BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22602_g1_i1 len=1510 path=[1386:0-352 2792:353-454 1739:455-495
@1780@!:496-1081 2366:1082-1509]

Length=1510
                                                                      Score     E

ref|XP_007139454.1|  hypothetical protein PHAVU_008G031000g             525   0.0      
ref|XP_003551764.1|  PREDICTED: PI-PLC X domain-containing protei...    524   0.0      
gb|KHN13530.1|  PI-PLC X domain-containing protein                      523   3e-180   
ref|XP_004232139.1|  PREDICTED: PI-PLC X domain-containing protei...    522   6e-180   
ref|XP_002277997.1|  PREDICTED: PI-PLC X domain-containing protei...    521   1e-179   Vitis vinifera
ref|XP_009792587.1|  PREDICTED: PI-PLC X domain-containing protei...    519   1e-178   
ref|XP_007215575.1|  hypothetical protein PRUPE_ppa007503mg             518   2e-178   
ref|XP_009596990.1|  PREDICTED: PI-PLC X domain-containing protei...    518   3e-178   
ref|XP_006338342.1|  PREDICTED: PI-PLC X domain-containing protei...    516   2e-177   
gb|KDP24289.1|  hypothetical protein JCGZ_25585                         515   3e-177   
ref|XP_003554924.1|  PREDICTED: PI-PLC X domain-containing protei...    514   6e-177   
ref|XP_003554923.1|  PREDICTED: PI-PLC X domain-containing protei...    513   1e-176   
ref|XP_008230282.1|  PREDICTED: PI-PLC X domain-containing protei...    513   1e-176   
ref|XP_002531003.1|  phospholipase C, putative                          512   4e-176   Ricinus communis
gb|KHN04383.1|  PI-PLC X domain-containing protein                      512   6e-176   
ref|XP_010257976.1|  PREDICTED: PI-PLC X domain-containing protei...    511   6e-176   
ref|XP_010032554.1|  PREDICTED: PI-PLC X domain-containing protei...    510   2e-175   
ref|XP_002317025.2|  hypothetical protein POPTR_0011s14800g             510   3e-175   Populus trichocarpa [western balsam poplar]
gb|KHN04384.1|  PI-PLC X domain-containing protein                      509   4e-175   
ref|XP_011030718.1|  PREDICTED: PI-PLC X domain-containing protei...    509   6e-175   
ref|XP_007151353.1|  hypothetical protein PHAVU_004G039300g             509   6e-175   
gb|KEH21727.1|  PLC-like phosphodiesterase superfamily protein          509   8e-175   
ref|XP_010032556.1|  PREDICTED: PI-PLC X domain-containing protei...    507   3e-174   
ref|XP_010032555.1|  PREDICTED: PI-PLC X domain-containing protei...    506   3e-174   
ref|XP_008775858.1|  PREDICTED: PI-PLC X domain-containing protei...    507   4e-174   
ref|XP_007032848.1|  PLC-like phosphodiesterases superfamily protein    506   6e-174   
ref|XP_010936443.1|  PREDICTED: PI-PLC X domain-containing protei...    504   1e-172   
gb|KCW51952.1|  hypothetical protein EUGRSUZ_J01396                     502   2e-172   
ref|XP_006430940.1|  hypothetical protein CICLE_v10013394mg             502   2e-172   
ref|XP_009380136.1|  PREDICTED: PI-PLC X domain-containing protei...    501   5e-172   
ref|XP_006373389.1|  hypothetical protein POPTR_0017s13330g             501   1e-171   
ref|XP_010936444.1|  PREDICTED: PI-PLC X domain-containing protei...    501   1e-171   
ref|XP_006482425.1|  PREDICTED: PI-PLC X domain-containing protei...    502   1e-171   
ref|XP_006482420.1|  PREDICTED: PI-PLC X domain-containing protei...    500   1e-171   
ref|XP_008341801.1|  PREDICTED: PI-PLC X domain-containing protei...    500   2e-171   
ref|XP_009373787.1|  PREDICTED: PI-PLC X domain-containing protei...    500   2e-171   
ref|XP_011099035.1|  PREDICTED: PI-PLC X domain-containing protei...    499   3e-171   
emb|CDP19975.1|  unnamed protein product                                499   3e-171   
ref|XP_010936441.1|  PREDICTED: PI-PLC X domain-containing protei...    500   4e-171   
ref|XP_006430942.1|  hypothetical protein CICLE_v10012018mg             498   2e-170   
gb|KDO72281.1|  hypothetical protein CISIN_1g045922mg                   497   2e-170   
ref|XP_011021066.1|  PREDICTED: PI-PLC X domain-containing protei...    497   3e-170   
ref|XP_002531004.1|  phospholipase C, putative                          492   2e-168   Ricinus communis
gb|EYU44228.1|  hypothetical protein MIMGU_mgv1a008818mg                491   4e-168   
ref|XP_004304210.1|  PREDICTED: PI-PLC X domain-containing protei...    491   6e-168   
ref|XP_011008607.1|  PREDICTED: PI-PLC X domain-containing protei...    492   7e-168   
ref|XP_002305392.1|  hypothetical protein POPTR_0004s11650g             491   7e-168   Populus trichocarpa [western balsam poplar]
ref|XP_011008606.1|  PREDICTED: PI-PLC X domain-containing protei...    491   2e-167   
ref|XP_010694075.1|  PREDICTED: PI-PLC X domain-containing protei...    486   7e-166   
ref|XP_004491886.1|  PREDICTED: PI-PLC X domain-containing protei...    484   3e-165   
gb|KDP24290.1|  hypothetical protein JCGZ_25586                         484   5e-165   
ref|XP_008379446.1|  PREDICTED: PI-PLC X domain-containing protei...    479   6e-163   
ref|XP_002512058.1|  phospholipase C, putative                          477   3e-162   Ricinus communis
ref|XP_010680657.1|  PREDICTED: PI-PLC X domain-containing protei...    472   2e-160   
ref|XP_008810954.1|  PREDICTED: PI-PLC X domain-containing protei...    472   2e-160   
ref|XP_010660569.1|  PREDICTED: PI-PLC X domain-containing protei...    469   1e-159   
ref|XP_007045812.1|  PLC-like phosphodiesterases superfamily protein    467   2e-158   
ref|XP_011099167.1|  PREDICTED: PI-PLC X domain-containing protei...    466   4e-158   
emb|CBI16942.3|  unnamed protein product                                466   5e-158   
ref|XP_003551765.1|  PREDICTED: PI-PLC X domain-containing protei...    464   5e-158   
gb|KHN37914.1|  PI-PLC X domain-containing protein                      462   7e-158   
ref|XP_007151350.1|  hypothetical protein PHAVU_004G039000g             464   2e-157   
gb|KDP41327.1|  hypothetical protein JCGZ_15734                         464   5e-157   
ref|XP_002465130.1|  hypothetical protein SORBIDRAFT_01g032510          461   4e-156   Sorghum bicolor [broomcorn]
ref|XP_008459396.1|  PREDICTED: PI-PLC X domain-containing protei...    460   9e-156   
gb|EYU44227.1|  hypothetical protein MIMGU_mgv1a025852mg                458   6e-155   
ref|XP_004984024.1|  PREDICTED: PI-PLC X domain-containing protei...    457   7e-155   
ref|XP_004141591.1|  PREDICTED: PI-PLC X domain-containing protei...    457   2e-154   
ref|NP_001050364.1|  Os03g0415200                                       456   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660055.1|  PREDICTED: PI-PLC X domain-containing protei...    455   1e-153   
ref|XP_003577935.1|  PREDICTED: PI-PLC X domain-containing protei...    454   1e-153   
ref|XP_006856404.1|  hypothetical protein AMTR_s00047p00211930          456   2e-153   
ref|XP_006650196.1|  PREDICTED: PI-PLC X domain-containing protei...    453   3e-153   
gb|ABF96605.1|  MAP3K-like protein kinase, putative, expressed          454   5e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810953.1|  PREDICTED: PI-PLC X domain-containing protei...    454   7e-153   
ref|XP_006482423.1|  PREDICTED: PI-PLC X domain-containing protei...    446   1e-150   
ref|XP_006482422.1|  PREDICTED: PI-PLC X domain-containing protei...    446   1e-150   
gb|KDO72284.1|  hypothetical protein CISIN_1g0438801mg                  442   8e-150   
ref|XP_004490218.1|  PREDICTED: PI-PLC X domain-containing protei...    441   3e-148   
gb|AFW88098.1|  hypothetical protein ZEAMMB73_151451                    439   2e-147   
gb|KHG07279.1|  hypothetical protein F383_15644                         436   2e-147   
dbj|BAJ88647.1|  predicted protein                                      438   4e-147   
ref|XP_003559985.1|  PREDICTED: PI-PLC X domain-containing protei...    434   4e-145   
ref|XP_010238022.1|  PREDICTED: PI-PLC X domain-containing protei...    432   2e-144   
ref|XP_010528969.1|  PREDICTED: PI-PLC X domain-containing protei...    430   3e-142   
ref|XP_009123955.1|  PREDICTED: PI-PLC X domain-containing protei...    422   4e-141   
emb|CDY36400.1|  BnaC05g10010D                                          421   1e-140   
ref|XP_006417100.1|  hypothetical protein EUTSA_v10009757mg             421   1e-140   
ref|XP_002890016.1|  hypothetical protein ARALYDRAFT_334664             418   1e-139   
ref|NP_172824.3|  phospholipase C/ phosphoric diester hydrolase         416   8e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476388.1|  PREDICTED: PI-PLC X domain-containing protei...    414   5e-138   
gb|EMT32828.1|  PI-PLC X domain-containing protein                      416   3e-137   
gb|EMT32829.1|  PI-PLC X domain-containing protein                      409   1e-136   
ref|XP_010099315.1|  hypothetical protein L484_018177                   409   2e-136   
ref|XP_008341802.1|  PREDICTED: PI-PLC X domain-containing protei...    407   1e-135   
ref|XP_011008608.1|  PREDICTED: PI-PLC X domain-containing protei...    408   1e-135   
ref|XP_010458823.1|  PREDICTED: PI-PLC X domain-containing protei...    405   2e-134   
ref|XP_006306173.1|  hypothetical protein CARUB_v10011738mg             405   2e-134   
gb|KCW55192.1|  hypothetical protein EUGRSUZ_I01136                     404   8e-134   
ref|XP_010028455.1|  PREDICTED: PI-PLC X domain-containing protei...    404   9e-134   
ref|XP_010028454.1|  PREDICTED: PI-PLC X domain-containing protei...    405   1e-133   
gb|KCW55193.1|  hypothetical protein EUGRSUZ_I01136                     403   1e-133   
ref|XP_010495516.1|  PREDICTED: PI-PLC X domain-containing protei...    402   2e-133   
ref|XP_010912463.1|  PREDICTED: PI-PLC X domain-containing protei...    404   3e-133   
ref|XP_010912461.1|  PREDICTED: PI-PLC X domain-containing protei...    404   5e-133   
ref|XP_006856490.1|  hypothetical protein AMTR_s00046p00078310          404   8e-133   
ref|XP_004505236.1|  PREDICTED: PI-PLC X domain-containing protei...    403   1e-132   
gb|AES90140.2|  PLC-like phosphodiesterase superfamily protein          402   1e-132   
ref|XP_010912462.1|  PREDICTED: PI-PLC X domain-containing protei...    401   6e-132   
ref|XP_010912460.1|  PREDICTED: PI-PLC X domain-containing protei...    400   9e-132   
ref|XP_009407010.1|  PREDICTED: PI-PLC X domain-containing protei...    400   1e-131   
emb|CDP02510.1|  unnamed protein product                                400   3e-131   
ref|XP_004296060.1|  PREDICTED: PI-PLC X domain-containing protei...    398   5e-131   
gb|AFK44546.1|  unknown                                                 397   1e-130   
ref|XP_009414849.1|  PREDICTED: PI-PLC X domain-containing protei...    396   2e-130   
ref|XP_010476389.1|  PREDICTED: PI-PLC X domain-containing protei...    393   9e-130   
ref|XP_010912029.1|  PREDICTED: PI-PLC X domain-containing protei...    395   1e-129   
ref|XP_010070359.1|  PREDICTED: PI-PLC X domain-containing protei...    396   1e-129   
ref|XP_009406116.1|  PREDICTED: PI-PLC X domain-containing protei...    395   2e-129   
ref|XP_010263485.1|  PREDICTED: PI-PLC X domain-containing protei...    395   2e-129   
gb|KDP32266.1|  hypothetical protein JCGZ_14787                         394   3e-129   
ref|XP_006574889.1|  PREDICTED: PI-PLC X domain-containing protei...    393   6e-129   
ref|XP_002866716.1|  phospholipase C                                    394   8e-129   
ref|XP_008236472.1|  PREDICTED: PI-PLC X domain-containing protei...    392   1e-128   
ref|XP_006393911.1|  hypothetical protein EUTSA_v10004292mg             393   1e-128   
ref|XP_011099119.1|  PREDICTED: PI-PLC X domain-containing protei...    394   1e-128   
ref|XP_007201061.1|  hypothetical protein PRUPE_ppa006614mg             392   2e-128   
ref|XP_010667411.1|  PREDICTED: PI-PLC X domain-containing protei...    392   2e-128   
ref|XP_007153589.1|  hypothetical protein PHAVU_003G048300g             391   3e-128   
ref|XP_010263507.1|  PREDICTED: PI-PLC X domain-containing protei...    391   4e-128   
ref|NP_569045.1|  PI-PLC X domain-containing protein                    391   5e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157386.1|  PREDICTED: PI-PLC X domain-containing protei...    390   1e-127   
gb|KGN57525.1|  hypothetical protein Csa_3G205280                       390   1e-127   
ref|XP_010558678.1|  PREDICTED: PI-PLC X domain-containing protei...    391   1e-127   
ref|XP_010107923.1|  PI-PLC X domain-containing protein                 389   1e-127   
ref|XP_010263486.1|  PREDICTED: PI-PLC X domain-containing protei...    389   2e-127   
ref|XP_004140805.1|  PREDICTED: PI-PLC X domain-containing protei...    389   2e-127   
gb|EPS66598.1|  hypothetical protein M569_08178                         389   2e-127   
ref|XP_011005991.1|  PREDICTED: PI-PLC X domain-containing protei...    389   2e-127   
gb|AAM65394.1|  unknown                                                 390   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008456136.1|  PREDICTED: PI-PLC X domain-containing protei...    389   3e-127   
gb|KHG16534.1|  hypothetical protein F383_21107                         385   3e-127   
ref|XP_006280502.1|  hypothetical protein CARUB_v10026440mg             389   4e-127   
ref|XP_010111794.1|  PI-PLC X domain-containing protein                 389   4e-127   
ref|XP_007047287.1|  PLC-like phosphodiesterases superfamily prot...    389   4e-127   
ref|XP_008785863.1|  PREDICTED: PI-PLC X domain-containing protei...    388   5e-127   
ref|XP_010647736.1|  PREDICTED: PI-PLC X domain-containing protei...    388   5e-127   
ref|XP_010458824.1|  PREDICTED: PI-PLC X domain-containing protei...    386   6e-127   
emb|CDO97188.1|  unnamed protein product                                390   6e-127   
gb|KHG16691.1|  hypothetical protein F383_20820                         388   1e-126   
ref|XP_006384401.1|  hypothetical protein POPTR_0004s14730g             386   2e-126   
ref|XP_002282885.1|  PREDICTED: PI-PLC X domain-containing protei...    387   3e-126   Vitis vinifera
ref|XP_003607943.1|  PI-PLC X domain-containing protein                 387   3e-126   
ref|XP_009346269.1|  PREDICTED: PI-PLC X domain-containing protei...    385   5e-126   
ref|XP_006425926.1|  hypothetical protein CICLE_v10025639mg             387   5e-126   
ref|XP_003539359.1|  PREDICTED: PI-PLC X domain-containing protei...    386   6e-126   
emb|CDY01436.1|  BnaA07g12090D                                          386   7e-126   
gb|KHN42089.1|  PI-PLC X domain-containing protein                      386   7e-126   
gb|ADE76605.1|  unknown                                                 385   7e-126   
ref|XP_008373129.1|  PREDICTED: PI-PLC X domain-containing protei...    385   7e-126   
ref|XP_006590655.1|  PREDICTED: PI-PLC X domain-containing protei...    386   7e-126   
ref|XP_009103450.1|  PREDICTED: PI-PLC X domain-containing protei...    385   8e-126   
ref|XP_007042450.1|  PLC-like phosphodiesterases superfamily protein    385   9e-126   
ref|XP_006573638.1|  PREDICTED: PI-PLC X domain-containing protei...    385   1e-125   
ref|XP_003517306.1|  PREDICTED: PI-PLC X domain-containing protei...    385   1e-125   
emb|CDY12809.1|  BnaC07g16240D                                          385   2e-125   
ref|XP_007047314.1|  PLC-like phosphodiesterases superfamily prot...    384   3e-125   
gb|KCW55190.1|  hypothetical protein EUGRSUZ_I01136                     381   3e-125   
ref|XP_010526723.1|  PREDICTED: PI-PLC X domain-containing protei...    384   4e-125   
gb|KDP31957.1|  hypothetical protein JCGZ_12418                         384   5e-125   
ref|XP_008795890.1|  PREDICTED: PI-PLC X domain-containing protei...    387   5e-125   
ref|XP_010526722.1|  PREDICTED: PI-PLC X domain-containing protei...    384   6e-125   
ref|XP_010270304.1|  PREDICTED: PI-PLC X domain-containing protei...    383   8e-125   
ref|XP_010526724.1|  PREDICTED: PI-PLC X domain-containing protei...    384   8e-125   
ref|XP_006494448.1|  PREDICTED: PI-PLC X domain-containing protei...    383   1e-124   
ref|XP_008784187.1|  PREDICTED: PI-PLC X domain-containing protei...    381   2e-124   
ref|XP_010906564.1|  PREDICTED: PI-PLC X domain-containing protei...    382   2e-124   
emb|CDY16515.1|  BnaA08g02520D                                          380   2e-124   
ref|XP_008340289.1|  PREDICTED: PI-PLC X domain-containing protei...    382   2e-124   
ref|XP_011008518.1|  PREDICTED: PI-PLC X domain-containing protei...    382   2e-124   
dbj|BAJ88671.1|  predicted protein                                      381   3e-124   
ref|XP_004956306.1|  PREDICTED: PI-PLC X domain-containing protei...    382   3e-124   
ref|XP_007156783.1|  hypothetical protein PHAVU_002G017300g             382   3e-124   
gb|KCW51951.1|  hypothetical protein EUGRSUZ_J01395                     375   3e-124   
ref|XP_002984037.1|  hypothetical protein SELMODRAFT_119480             379   4e-124   
ref|XP_010667419.1|  PREDICTED: PI-PLC X domain-containing protei...    381   4e-124   
ref|XP_003581234.1|  PREDICTED: PI-PLC X domain-containing protei...    380   5e-124   
gb|KCW51949.1|  hypothetical protein EUGRSUZ_J01395                     375   5e-124   
ref|XP_009772482.1|  PREDICTED: PI-PLC X domain-containing protei...    381   5e-124   
gb|KEH31448.1|  pi-PLC X domain plant-like protein                      381   5e-124   
gb|KDP31946.1|  hypothetical protein JCGZ_12407                         381   6e-124   
ref|XP_004975627.1|  PREDICTED: PI-PLC X domain-containing protei...    380   8e-124   
ref|XP_006487053.1|  PREDICTED: PI-PLC X domain-containing protei...    379   1e-123   
ref|XP_009621227.1|  PREDICTED: PI-PLC X domain-containing protei...    379   1e-123   
ref|XP_009406115.1|  PREDICTED: PI-PLC X domain-containing protei...    380   2e-123   
ref|XP_008241483.1|  PREDICTED: PI-PLC X domain-containing protei...    380   2e-123   
ref|XP_010550360.1|  PREDICTED: PI-PLC X domain-containing protei...    380   2e-123   
ref|XP_009621228.1|  PREDICTED: PI-PLC X domain-containing protei...    379   2e-123   
ref|XP_002980707.1|  hypothetical protein SELMODRAFT_420210             376   2e-123   
ref|XP_009387239.1|  PREDICTED: PI-PLC X domain-containing protei...    379   2e-123   
ref|XP_002307272.2|  hypothetical protein POPTR_0005s18330g             380   2e-123   Populus trichocarpa [western balsam poplar]
ref|XP_006422992.1|  hypothetical protein CICLE_v10028578mg             379   3e-123   
ref|XP_004509132.1|  PREDICTED: PI-PLC X domain-containing protei...    379   3e-123   
ref|XP_010500524.1|  PREDICTED: PI-PLC X domain-containing protei...    377   3e-123   
ref|NP_564553.1|  PI-PLC X domain-containing protein                    377   3e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KHF99292.1|  hypothetical protein F383_18663                         379   3e-123   
ref|XP_004509131.1|  PREDICTED: PI-PLC X domain-containing protei...    379   3e-123   
ref|NP_001132240.1|  uncharacterized protein LOC100193675 precursor     379   3e-123   Zea mays [maize]
emb|CDP02505.1|  unnamed protein product                                380   4e-123   
ref|XP_009387240.1|  PREDICTED: PI-PLC X domain-containing protei...    378   4e-123   
ref|XP_002446665.1|  hypothetical protein SORBIDRAFT_06g020050          379   4e-123   Sorghum bicolor [broomcorn]
ref|XP_006661031.1|  PREDICTED: PI-PLC X domain-containing protei...    378   5e-123   
ref|XP_002976966.1|  hypothetical protein SELMODRAFT_443348             375   5e-123   
ref|XP_009795144.1|  PREDICTED: PI-PLC X domain-containing protei...    378   5e-123   
gb|KFK35981.1|  hypothetical protein AALP_AA4G062800                    376   6e-123   
gb|KHN36237.1|  PI-PLC X domain-containing protein                      377   6e-123   
dbj|BAJ96824.1|  predicted protein                                      376   6e-123   
gb|EMT29159.1|  PI-PLC X domain-containing protein                      378   7e-123   
ref|XP_010690604.1|  PREDICTED: PI-PLC X domain-containing protei...    378   8e-123   
ref|XP_009367285.1|  PREDICTED: PI-PLC X domain-containing protei...    378   8e-123   
ref|XP_008338332.1|  PREDICTED: PI-PLC X domain-containing protei...    378   8e-123   
ref|XP_011016278.1|  PREDICTED: PI-PLC X domain-containing protei...    371   9e-123   
ref|XP_008788843.1|  PREDICTED: PI-PLC X domain-containing protei...    377   9e-123   
ref|XP_006393219.1|  hypothetical protein EUTSA_v10011609mg             375   1e-122   
ref|XP_009343282.1|  PREDICTED: PI-PLC X domain-containing protei...    377   2e-122   
ref|XP_003576905.1|  PREDICTED: PI-PLC X domain-containing protei...    376   3e-122   
ref|XP_009343292.1|  PREDICTED: PI-PLC X domain-containing protei...    376   3e-122   
ref|XP_002310130.2|  hypothetical protein POPTR_0007s10840g             377   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_002306474.2|  hypothetical protein POPTR_0005s18250g             375   3e-122   Populus trichocarpa [western balsam poplar]
ref|XP_008367979.1|  PREDICTED: PI-PLC X domain-containing protei...    376   3e-122   
ref|XP_011043520.1|  PREDICTED: PI-PLC X domain-containing protei...    377   4e-122   
ref|XP_004511913.1|  PREDICTED: PI-PLC X domain-containing protei...    377   4e-122   
ref|XP_002277922.2|  PREDICTED: PI-PLC X domain-containing protei...    376   4e-122   Vitis vinifera
ref|XP_009345958.1|  PREDICTED: PI-PLC X domain-containing protei...    376   4e-122   
ref|XP_009343170.1|  PREDICTED: PI-PLC X domain-containing protei...    376   4e-122   
ref|XP_008661429.1|  PREDICTED: uncharacterized protein LOC100193...    376   5e-122   
ref|XP_003524647.1|  PREDICTED: PI-PLC X domain-containing protei...    376   5e-122   
ref|XP_009107283.1|  PREDICTED: PI-PLC X domain-containing protei...    374   5e-122   
ref|XP_008457757.1|  PREDICTED: PI-PLC X domain-containing protei...    376   5e-122   
ref|XP_009107282.1|  PREDICTED: PI-PLC X domain-containing protei...    374   5e-122   
ref|XP_009138476.1|  PREDICTED: PI-PLC X domain-containing protei...    375   5e-122   
ref|XP_002891530.1|  phospholipase C                                    374   5e-122   
ref|XP_006339877.1|  PREDICTED: PI-PLC X domain-containing protei...    376   6e-122   
ref|XP_009367216.1|  PREDICTED: PI-PLC X domain-containing protei...    375   6e-122   
ref|XP_007047288.1|  PLC-like phosphodiesterases superfamily prot...    373   6e-122   
emb|CDY51044.1|  BnaA06g03070D                                          373   7e-122   
ref|XP_003538811.2|  PREDICTED: PI-PLC X domain-containing protei...    375   8e-122   
ref|XP_004230771.1|  PREDICTED: PI-PLC X domain-containing protei...    375   8e-122   
ref|XP_006305174.1|  hypothetical protein CARUB_v10009541mg             373   9e-122   
ref|XP_004231851.1|  PREDICTED: PI-PLC X domain-containing protei...    375   1e-121   
ref|XP_002960100.1|  hypothetical protein SELMODRAFT_74684              371   1e-121   
gb|KDO70310.1|  hypothetical protein CISIN_1g041719mg                   370   1e-121   
ref|XP_006437882.1|  hypothetical protein CICLE_v10033860mg             370   1e-121   
ref|XP_003516603.2|  PREDICTED: PI-PLC X domain-containing protei...    375   1e-121   
ref|XP_010479446.1|  PREDICTED: PI-PLC X domain-containing protei...    372   1e-121   
ref|XP_004149694.1|  PREDICTED: PI-PLC X domain-containing protei...    375   2e-121   
ref|XP_009147889.1|  PREDICTED: PI-PLC X domain-containing protei...    372   2e-121   
ref|XP_009621003.1|  PREDICTED: PI-PLC X domain-containing protei...    376   2e-121   
ref|XP_009147890.1|  PREDICTED: PI-PLC X domain-containing protei...    372   2e-121   
ref|XP_006484354.1|  PREDICTED: PI-PLC X domain-containing protei...    370   2e-121   
gb|EYU44417.1|  hypothetical protein MIMGU_mgv1a006572mg                375   2e-121   
ref|XP_006411920.1|  hypothetical protein EUTSA_v10025378mg             374   2e-121   
ref|XP_011008529.1|  PREDICTED: PI-PLC X domain-containing protei...    374   3e-121   
ref|XP_010315965.1|  PREDICTED: PI-PLC X domain-containing protei...    374   3e-121   
ref|XP_003550053.1|  PREDICTED: PI-PLC X domain-containing protei...    374   4e-121   
emb|CDY29535.1|  BnaA03g53800D                                          374   5e-121   
ref|NP_001062585.1|  Os09g0115600                                       373   6e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004511919.1|  PREDICTED: PI-PLC X domain-containing protei...    373   6e-121   
emb|CDY00365.1|  BnaC07g14610D                                          371   6e-121   
ref|XP_006466593.1|  PREDICTED: PI-PLC X domain-containing protei...    373   7e-121   
ref|XP_006346400.1|  PREDICTED: PI-PLC X domain-containing protei...    372   8e-121   
ref|XP_004511918.1|  PREDICTED: PI-PLC X domain-containing protei...    373   8e-121   
ref|XP_010461822.1|  PREDICTED: PI-PLC X domain-containing protei...    370   1e-120   
ref|XP_004511912.1|  PREDICTED: PI-PLC X domain-containing protei...    372   1e-120   
ref|XP_008340204.1|  PREDICTED: PI-PLC X domain-containing protei...    372   1e-120   
ref|XP_011088243.1|  PREDICTED: PI-PLC X domain-containing protei...    371   1e-120   
ref|XP_010239916.1|  PREDICTED: PI-PLC X domain-containing protei...    369   2e-120   
ref|XP_010040950.1|  PREDICTED: PI-PLC X domain-containing protei...    369   2e-120   
gb|KDO79190.1|  hypothetical protein CISIN_1g040409mg                   371   3e-120   
ref|XP_006425913.1|  hypothetical protein CICLE_v10025701mg             371   3e-120   
gb|KFK28405.1|  hypothetical protein AALP_AA8G510600                    372   3e-120   
ref|XP_006339884.1|  PREDICTED: PI-PLC X domain-containing protei...    371   3e-120   
emb|CDY66509.1|  BnaC07g51190D                                          370   5e-120   
ref|XP_004975626.1|  PREDICTED: PI-PLC X domain-containing protei...    371   5e-120   
ref|XP_007155909.1|  hypothetical protein PHAVU_003G242300g             372   8e-120   
ref|XP_011097253.1|  PREDICTED: PI-PLC X domain-containing protei...    370   9e-120   
ref|XP_010464487.1|  PREDICTED: PI-PLC X domain-containing protei...    370   1e-119   
ref|XP_006601503.1|  PREDICTED: PI-PLC X domain-containing protei...    370   1e-119   
ref|XP_004972406.1|  PREDICTED: PI-PLC X domain-containing protei...    369   2e-119   
ref|XP_003611697.1|  PI-PLC X domain-containing protein                 369   2e-119   
gb|KHN36243.1|  PI-PLC X domain-containing protein                      368   2e-119   
ref|XP_007155917.1|  hypothetical protein PHAVU_003G243100g             369   2e-119   
ref|XP_009417037.1|  PREDICTED: PI-PLC X domain-containing protei...    366   3e-119   
ref|XP_006473918.1|  PREDICTED: PI-PLC X domain-containing protei...    368   3e-119   
gb|AES94655.2|  pi-PLC X domain plant-like protein                      369   3e-119   
ref|XP_004149693.1|  PREDICTED: PI-PLC X domain-containing protei...    370   4e-119   
ref|XP_010484546.1|  PREDICTED: PI-PLC X domain-containing protei...    369   5e-119   
ref|XP_004972407.1|  PREDICTED: PI-PLC X domain-containing protei...    366   5e-119   
ref|XP_010269434.1|  PREDICTED: PI-PLC X domain-containing protei...    366   5e-119   
ref|XP_010269429.1|  PREDICTED: PI-PLC X domain-containing protei...    368   5e-119   
ref|XP_011097252.1|  PREDICTED: PI-PLC X domain-containing protei...    370   6e-119   
ref|XP_007204898.1|  hypothetical protein PRUPE_ppa006957mg             367   6e-119   
ref|XP_010093621.1|  PI-PLC X domain-containing protein                 367   9e-119   
ref|XP_010444691.1|  PREDICTED: PI-PLC X domain-containing protei...    368   9e-119   
ref|XP_006435372.1|  hypothetical protein CICLE_v10003333mg             366   1e-118   
ref|XP_010938528.1|  PREDICTED: PI-PLC X domain-containing protei...    361   1e-118   
ref|XP_007132000.1|  hypothetical protein PHAVU_011G058300g             367   1e-118   
ref|XP_002310720.2|  hypothetical protein POPTR_0007s10890g             364   2e-118   
ref|XP_009419399.1|  PREDICTED: PI-PLC X domain-containing protei...    366   2e-118   
ref|XP_002447844.1|  hypothetical protein SORBIDRAFT_06g016810          365   3e-118   
tpg|DAA37775.1|  TPA: phospholipase                                     366   4e-118   
ref|XP_008241471.1|  PREDICTED: PI-PLC X domain-containing protei...    365   4e-118   
ref|XP_004288021.1|  PREDICTED: PI-PLC X domain-containing protei...    365   6e-118   
gb|EAZ05289.1|  hypothetical protein OsI_27492                          365   6e-118   
ref|NP_001060773.1|  Os08g0103500                                       365   6e-118   
ref|NP_001052817.1|  Os04g0430200                                       365   9e-118   
gb|KDO79174.1|  hypothetical protein CISIN_1g038077mg                   365   9e-118   
gb|KGN48534.1|  hypothetical protein Csa_6G490980                       365   9e-118   
ref|XP_001763598.1|  predicted protein                                  362   2e-117   
gb|EYU44410.1|  hypothetical protein MIMGU_mgv1a007541mg                363   2e-117   
ref|XP_007202162.1|  hypothetical protein PRUPE_ppa006381mg             363   2e-117   
ref|XP_009405338.1|  PREDICTED: PI-PLC X domain-containing protei...    363   3e-117   
ref|XP_008440292.1|  PREDICTED: PI-PLC X domain-containing protei...    363   3e-117   
ref|XP_002523622.1|  phospholipase C, putative                          363   3e-117   
ref|XP_006425912.1|  hypothetical protein CICLE_v10025701mg             360   4e-117   
ref|XP_006653405.1|  PREDICTED: PI-PLC X domain-containing protei...    363   4e-117   
emb|CAH66396.1|  B0222C05.4                                             362   8e-117   
gb|KDO85114.1|  hypothetical protein CISIN_1g036538mg                   358   1e-116   
ref|XP_006380696.1|  hypothetical protein POPTR_0007s10840g             362   1e-116   
ref|XP_006659736.1|  PREDICTED: PI-PLC X domain-containing protei...    360   4e-116   
gb|EPS71276.1|  hypothetical protein M569_03481                         359   4e-116   
ref|NP_001150982.1|  phospholipase C precursor                          360   5e-116   
ref|XP_010437253.1|  PREDICTED: PI-PLC X domain-containing protei...    360   6e-116   
ref|XP_011043528.1|  PREDICTED: PI-PLC X domain-containing protei...    360   7e-116   
gb|KFK30315.1|  hypothetical protein AALP_AA7G245900                    359   1e-115   
ref|XP_009607896.1|  PREDICTED: PI-PLC X domain-containing protei...    359   1e-115   
ref|XP_011043529.1|  PREDICTED: PI-PLC X domain-containing protei...    358   1e-115   
gb|EEC75469.1|  hypothetical protein OsI_12041                          355   2e-115   
ref|XP_003611719.1|  MAP-like protein kinase                            358   4e-115   
ref|XP_010446692.1|  PREDICTED: PI-PLC X domain-containing protei...    357   4e-115   
ref|XP_002444862.1|  hypothetical protein SORBIDRAFT_07g000450          357   2e-114   
ref|XP_010432083.1|  PREDICTED: PI-PLC X domain-containing protei...    356   2e-114   
ref|NP_001078503.4|  PLC-like phosphodiesterases superfamily protein    355   3e-114   
ref|XP_004288026.1|  PREDICTED: uncharacterized protein LOC101291755    366   3e-114   
emb|CAD41004.1|  OSJNBa0042L16.20                                       355   4e-114   
gb|EAZ30778.1|  hypothetical protein OsJ_14843                          355   4e-114   
ref|XP_006285729.1|  hypothetical protein CARUB_v10007202mg             355   4e-114   
ref|XP_007047316.1|  PLC-like phosphodiesterases superfamily prot...    351   3e-113   
ref|XP_004141910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    362   6e-113   
ref|XP_011099127.1|  PREDICTED: PI-PLC X domain-containing protei...    351   1e-112   
ref|XP_010519299.1|  PREDICTED: PI-PLC X domain-containing protei...    350   2e-112   
ref|XP_001766511.1|  predicted protein                                  350   5e-112   
ref|XP_001758463.1|  predicted protein                                  347   1e-111   
ref|XP_010555997.1|  PREDICTED: PI-PLC X domain-containing protei...    348   3e-111   
ref|XP_010487867.1|  PREDICTED: PI-PLC X domain-containing protei...    345   3e-110   
ref|XP_002869001.1|  hypothetical protein ARALYDRAFT_328051             356   7e-110   
ref|XP_010468285.1|  PREDICTED: PI-PLC X domain-containing protei...    344   7e-110   
ref|XP_002883171.1|  phospholipase C                                    344   1e-109   
ref|XP_010487868.1|  PREDICTED: PI-PLC X domain-containing protei...    343   2e-109   
gb|AAO22804.1|  unknown protein                                         343   2e-109   
ref|XP_002313123.2|  hypothetical protein POPTR_0009s10320g             341   2e-109   
emb|CAB16796.1|  MAP3K-like protein kinase                              355   3e-109   
ref|NP_188562.1|  PLC-like phosphodiesterase-like protein               343   3e-109   
ref|XP_010507636.1|  PREDICTED: PI-PLC X domain-containing protei...    342   4e-109   
ref|NP_001140383.1|  uncharacterized LOC100272437 precursor             341   1e-108   
ref|NP_001054344.1|  Os04g0689300                                       342   3e-108   
emb|CAJ86344.1|  H0814G11.11                                            342   3e-108   
ref|XP_006406514.1|  hypothetical protein EUTSA_v10020826mg             340   4e-108   
ref|XP_006653912.1|  PREDICTED: PI-PLC X domain-containing protei...    340   1e-107   
ref|XP_006297790.1|  hypothetical protein CARUB_v10013826mg             338   2e-107   
ref|XP_010236396.1|  PREDICTED: PI-PLC X domain-containing protei...    337   2e-107   
ref|XP_004963364.1|  PREDICTED: PI-PLC X domain-containing protei...    338   3e-107   
ref|XP_010240655.1|  PREDICTED: PI-PLC X domain-containing protei...    341   1e-106   
emb|CDX99237.1|  BnaC05g33520D                                          335   3e-106   
gb|EEE61956.1|  hypothetical protein OsJ_16720                          343   3e-106   
dbj|BAK04257.1|  predicted protein                                      341   4e-106   
ref|XP_009145803.1|  PREDICTED: PI-PLC X domain-containing protei...    333   1e-105   
gb|EEC78300.1|  hypothetical protein OsI_18022                          342   2e-105   
ref|XP_002448826.1|  hypothetical protein SORBIDRAFT_06g033880          332   4e-105   
gb|KHN42096.1|  PI-PLC X domain-containing protein                      328   8e-105   
gb|KCW44755.1|  hypothetical protein EUGRSUZ_L01682                     329   9e-105   
ref|NP_001142037.1|  uncharacterized protein LOC100274192               332   1e-104   
gb|AAR95995.1|  hypothetical protein kinase                             330   1e-104   
gb|EMT26645.1|  PI-PLC X domain-containing protein                      341   3e-104   
ref|XP_010912030.1|  PREDICTED: PI-PLC X domain-containing protei...    327   3e-104   
gb|KFK39281.1|  hypothetical protein AALP_AA3G224100                    329   5e-104   
ref|XP_003528515.1|  PREDICTED: uncharacterized protein LOC100808487    336   7e-104   
ref|XP_001783758.1|  predicted protein                                  326   1e-103   
ref|XP_010476391.1|  PREDICTED: PI-PLC X domain-containing protei...    323   4e-103   
ref|XP_009792110.1|  PREDICTED: PI-PLC X domain-containing protei...    320   4e-102   
ref|XP_009792108.1|  PREDICTED: PI-PLC X domain-containing protei...    320   7e-102   
ref|XP_008346393.1|  PREDICTED: PI-PLC X domain-containing protei...    316   3e-100   
gb|ACF84360.1|  unknown                                                 314   6e-99    
ref|XP_010458825.1|  PREDICTED: PI-PLC X domain-containing protei...    312   7e-99    
ref|XP_003520058.1|  PREDICTED: PI-PLC X domain-containing protei...    311   6e-98    
gb|KHN05834.1|  PI-PLC X domain-containing protein                      311   6e-98    
emb|CAB53483.1|  CAA303710.1 protein                                    312   2e-97    
ref|XP_004505401.1|  PREDICTED: PI-PLC X domain-containing protei...    310   3e-97    
ref|XP_007047289.1|  PLC-like phosphodiesterases superfamily prot...    311   4e-97    
dbj|BAD12493.1|  nodulin of unknown function                            308   5e-97    
ref|XP_011008609.1|  PREDICTED: PI-PLC X domain-containing protei...    306   2e-96    
emb|CAN73150.1|  hypothetical protein VITISV_007143                     305   3e-96    
ref|XP_010458826.1|  PREDICTED: PI-PLC X domain-containing protei...    303   2e-95    
ref|XP_010458827.1|  PREDICTED: PI-PLC X domain-containing protei...    302   4e-95    
gb|KHG18052.1|  hypothetical protein F383_06271                         305   4e-95    
ref|XP_004157206.1|  PREDICTED: PI-PLC X domain-containing protei...    303   6e-95    
emb|CDY32852.1|  BnaC08g02740D                                          302   1e-94    
gb|KEH30907.1|  PLC-like phosphodiesterase superfamily protein          302   1e-94    
ref|XP_003607948.1|  PI-PLC X domain-containing protein                 299   2e-93    
ref|XP_006847110.1|  hypothetical protein AMTR_s00017p00220770          294   5e-93    
gb|EYU37662.1|  hypothetical protein MIMGU_mgv1a011382mg                296   8e-93    
gb|KEH30909.1|  PLC-like phosphodiesterase superfamily protein          285   5e-89    
gb|AFW58589.1|  hypothetical protein ZEAMMB73_540582                    285   9e-89    
ref|XP_003614167.1|  PI-PLC X domain-containing protein                 286   1e-88    
ref|XP_008810955.1|  PREDICTED: PI-PLC X domain-containing protei...    285   4e-88    
gb|AFW58588.1|  hypothetical protein ZEAMMB73_540582                    290   4e-88    
gb|EAZ08137.1|  hypothetical protein OsI_30401                          282   6e-88    
ref|XP_010239915.1|  PREDICTED: PI-PLC X domain-containing protei...    287   9e-88    
gb|KEH30908.1|  PLC-like phosphodiesterase superfamily protein          282   1e-87    
gb|EMT26327.1|  PI-PLC X domain-containing protein                      274   2e-83    
dbj|BAD95429.1|  MAP3K-like protein kinase                              270   9e-83    
ref|XP_006437887.1|  hypothetical protein CICLE_v10033330mg             266   1e-81    
ref|XP_010458828.1|  PREDICTED: PI-PLC X domain-containing protei...    266   3e-81    
ref|XP_007153590.1|  hypothetical protein PHAVU_003G048400g             264   2e-80    
gb|AFW65068.1|  hypothetical protein ZEAMMB73_415915                    262   1e-79    
gb|KHN43060.1|  PI-PLC X domain-containing protein                      261   2e-79    
ref|XP_002518747.1|  phospholipase C, putative                          253   6e-77    
gb|ACR37796.1|  unknown                                                 253   4e-76    
gb|EMT20004.1|  PI-PLC X domain-containing protein                      257   5e-76    
dbj|BAB10947.1|  unnamed protein product                                253   2e-75    
emb|CDX92322.1|  BnaA05g20850D                                          240   2e-71    
gb|KHN41411.1|  PI-PLC X domain-containing protein                      237   2e-70    
emb|CDP17722.1|  unnamed protein product                                241   3e-70    
gb|AFW65070.1|  hypothetical protein ZEAMMB73_415915                    235   3e-70    
ref|XP_003543882.1|  PREDICTED: PI-PLC X domain-containing protei...    230   2e-69    
gb|ACU18350.1|  unknown                                                 224   7e-66    
gb|KFK43627.1|  hypothetical protein AALP_AA1G150600                    216   7e-64    
gb|KCW51955.1|  hypothetical protein EUGRSUZ_J01401                     214   6e-61    
gb|KHG26478.1|  hypothetical protein F383_33212                         208   9e-61    
ref|XP_007200103.1|  hypothetical protein PRUPE_ppa019221mg             204   4e-58    
gb|KHN14019.1|  PI-PLC X domain-containing protein                      196   1e-55    
gb|KHG16842.1|  hypothetical protein F383_07605                         188   4e-53    
tpg|DAA37776.1|  TPA: hypothetical protein ZEAMMB73_836324              187   9e-53    
ref|XP_010480464.1|  PREDICTED: PI-PLC X domain-containing protei...    181   1e-50    
ref|XP_010107921.1|  hypothetical protein L484_027510                   181   2e-50    
gb|ACN35634.1|  unknown                                                 179   3e-49    
ref|XP_010028238.1|  PREDICTED: PI-PLC X domain-containing protei...    175   1e-48    
gb|ACU21154.1|  unknown                                                 176   2e-48    
emb|CDP14973.1|  unnamed protein product                                159   3e-40    
gb|AFK43916.1|  unknown                                                 143   5e-37    
ref|XP_008236489.1|  PREDICTED: PI-PLC X domain-containing protei...    128   5e-31    
ref|XP_010937926.1|  PREDICTED: PI-PLC X domain-containing protei...    125   5e-31    
ref|XP_001628778.1|  predicted protein                                  131   6e-30    
ref|WP_003963198.1|  glycoside hydrolase                                130   1e-28    
ref|WP_035910174.1|  phospholipase                                      124   8e-28    
ref|WP_030428654.1|  hypothetical protein                               121   1e-27    
ref|WP_030476744.1|  phospholipase                                      123   2e-27    
ref|WP_037807480.1|  hypothetical protein                               120   3e-27    
ref|WP_037865028.1|  hypothetical protein                               119   1e-26    
ref|WP_007261977.1|  predicted protein                                  120   2e-26    
ref|WP_033225451.1|  hypothetical protein                               117   3e-26    
ref|WP_030768689.1|  MULTISPECIES: hypothetical protein                 117   3e-26    
ref|WP_037832935.1|  hypothetical protein                               116   7e-26    
ref|WP_030200297.1|  hypothetical protein                               116   1e-25    
ref|WP_037634359.1|  hypothetical protein                               115   2e-25    
ref|WP_030822158.1|  MULTISPECIES: hypothetical protein                 115   2e-25    
ref|WP_030652133.1|  MULTISPECIES: hypothetical protein                 114   3e-25    
gb|KHG28694.1|  hypothetical protein F383_34944                         110   7e-25    
ref|WP_030770873.1|  hypothetical protein                               113   8e-25    
ref|WP_030386700.1|  hypothetical protein                               113   1e-24    
ref|WP_037879398.1|  hypothetical protein                               112   2e-24    
ref|WP_037661149.1|  hypothetical protein                               111   4e-24    
ref|WP_020385899.1|  hypothetical protein                               111   2e-23    
ref|WP_003955197.1|  glycoside hydrolase                                114   2e-23    
ref|WP_030317675.1|  hypothetical protein                               108   8e-23    
ref|XP_002523607.1|  hypothetical protein RCOM_1409730                  107   1e-22    
ref|WP_040878859.1|  hypothetical protein                               107   3e-22    
ref|WP_015182332.1|  hypothetical protein                               108   4e-22    
ref|WP_007457259.1|  esterase                                           109   5e-22    
ref|XP_008338374.1|  PREDICTED: uncharacterized protein LOC103401442    105   7e-22    
dbj|BAK02150.1|  predicted protein                                      102   1e-21    
ref|WP_036015884.1|  hypothetical protein                               105   2e-21    
gb|ADK54828.1|  hypothetical protein                                    106   8e-21    
gb|KFH70190.1|  hypothetical protein MVEG_04992                         103   8e-21    
ref|WP_003953132.1|  esterase                                           105   1e-20    
ref|WP_003963308.1|  esterase                                           105   1e-20    
ref|XP_010544485.1|  PREDICTED: PI-PLC X domain-containing protei...  99.0    1e-20    
gb|AFW58590.1|  hypothetical protein ZEAMMB73_953341                  99.0    2e-20    
ref|WP_037691035.1|  phospholipase                                      103   3e-20    
ref|WP_033211524.1|  hypothetical protein                               100   4e-20    
ref|WP_012412886.1|  glycoside hydrolase family protein                 103   6e-20    
ref|WP_010471429.1|  esterase                                           102   1e-19    
ref|WP_037749548.1|  phospholipase                                      100   1e-19    
ref|WP_025355599.1|  phospholipase                                      100   1e-19    
ref|WP_009313586.1|  hypothetical protein                               100   2e-19    
ref|WP_030937071.1|  phospholipase                                      100   2e-19    
ref|WP_006374807.1|  hypothetical protein                               100   3e-19    
ref|WP_037627882.1|  phospholipase                                    99.8    4e-19    
gb|EAZ08136.1|  hypothetical protein OsI_30400                        95.9    4e-19    
gb|EMF58173.1|  hypothetical protein SBD_0845                         99.8    5e-19    



>ref|XP_007139454.1| hypothetical protein PHAVU_008G031000g [Phaseolus vulgaris]
 gb|ESW11448.1| hypothetical protein PHAVU_008G031000g [Phaseolus vulgaris]
Length=364

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 293/379 (77%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             +T+ACS   C++LDE CS   DC AG++C SC LGFSG +CVRSTAT+QFKL NNSLPFN
Sbjct  18    MTTACSDGTCKLLDE-CSSDGDCEAGLYCFSCLLGFSGSRCVRSTATNQFKLTNNSLPFN  76

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TGVP +   NQED++TQQLNNGVRGLMLD YDF GDVWLCH
Sbjct  77    KYAFLTTHNAFAIDGEPSHTGVPRLTVDNQEDTITQQLNNGVRGLMLDTYDFEGDVWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD TAFEPA DTLKEIEAFLS NP+EIVTIILEDYV+AP GLT VFT AGLMKY
Sbjct  137   SFEGQCHDITAFEPAIDTLKEIEAFLSANPTEIVTIILEDYVHAPNGLTNVFTKAGLMKY  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFP+++MP+NG DWPLVSDMVAKNQRLLVFTSVKSKE+SEGIAYQWN+MVENQYGDGG K
Sbjct  197   WFPLASMPRNGQDWPLVSDMVAKNQRLLVFTSVKSKEQSEGIAYQWNFMVENQYGDGGRK  256

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR ES PL D +KSLVLVN+F + P++P+ C  NSG LI+M+ TCY AAGNRWAN
Sbjct  257   AGSCPNRAESSPLNDKSKSLVLVNYFRTAPIKPITCEDNSGELINMIHTCYGAAGNRWAN  316

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  317   FVAVDYYK----------------------------------RSEGGGSFQAVDTLNGKL  342

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG DDVH+CV GS  G C
Sbjct  343   LCGCDDVHTCVPGSTSGAC  361



>ref|XP_003551764.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Glycine max]
Length=364

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/384 (67%), Positives = 294/384 (77%), Gaps = 38/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V +ACS   C++LDE CS   DCG G++C SCP GF G +CVRST T+QFKL+NNSL
Sbjct  15    FYNVAAACSDGTCKLLDE-CSSDGDCGTGLYCFSCPFGFLGSRCVRSTVTNQFKLINNSL  73

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNA++I G  S TGVP V   NQEDSVTQQLNNGVRGLMLD YDF GDVW
Sbjct  74    PFNKYAFLTTHNAYAIDGEPSHTGVPRVTFTNQEDSVTQQLNNGVRGLMLDTYDFDGDVW  133

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSF G+CHDFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV+AP GLTKVFTDAGL
Sbjct  134   LCHSFEGQCHDFTAFEPALDTLKEIEAFLSANPTEIVTLILEDYVHAPNGLTKVFTDAGL  193

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFP+++MP+NG DWPLVSDMVAKNQRLLVFTS+ SKE+SEGIAYQWN+MVENQYGDG
Sbjct  194   MKYWFPLTSMPRNGQDWPLVSDMVAKNQRLLVFTSIASKEQSEGIAYQWNFMVENQYGDG  253

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             G K G CPNR ES PL D +KSLVLVN+F S P++P+ C  NSG LI+M+ TC+ AAGNR
Sbjct  254   GRKAGSCPNRAESSPLNDKSKSLVLVNYFRSTPIKPITCEDNSGELINMLQTCFGAAGNR  313

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG+F+AVD LN
Sbjct  314   WANFVAVDYYK----------------------------------RSEGGGSFQAVDTLN  339

Query  308   GGLLCGKDDVHSCVGGSK*GGCRR  237
             G LLCG DDVH+CV GS    C +
Sbjct  340   GKLLCGCDDVHTCVPGSTSEACSQ  363



>gb|KHN13530.1| PI-PLC X domain-containing protein [Glycine soja]
Length=364

 Score =   523 bits (1346),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 259/384 (67%), Positives = 293/384 (76%), Gaps = 38/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V +ACS   C++LDE CS   DCG G++C SCP GF G +CVRST T+QFKL+NNSL
Sbjct  15    FYNVAAACSDGTCKLLDE-CSSDGDCGTGLYCFSCPFGFLGSRCVRSTVTNQFKLINNSL  73

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNA++I G  S TGVP V   NQEDSVTQQLNNGVRGLMLD YDF GDVW
Sbjct  74    PFNKYAFLTTHNAYAIDGEPSHTGVPRVTFTNQEDSVTQQLNNGVRGLMLDTYDFDGDVW  133

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSF G+CHDFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV+AP GLTKVFTDAGL
Sbjct  134   LCHSFEGQCHDFTAFEPALDTLKEIEAFLSANPTEIVTLILEDYVHAPNGLTKVFTDAGL  193

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFP+ +MP+NG DWPLVSDMVAKNQRLLVFTS+ SKE+SEGIAYQWN+MVENQYGDG
Sbjct  194   MKYWFPLPSMPRNGQDWPLVSDMVAKNQRLLVFTSIASKEQSEGIAYQWNFMVENQYGDG  253

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             G K G CPNR ES PL D +KSLVLVN+F S P++P+ C  NSG LI+M+ TC+ AAGNR
Sbjct  254   GRKAGSCPNRAESSPLNDKSKSLVLVNYFRSTPIKPITCEDNSGELINMLQTCFGAAGNR  313

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG+F+AVD LN
Sbjct  314   WANFVAVDYYK----------------------------------RSEGGGSFQAVDTLN  339

Query  308   GGLLCGKDDVHSCVGGSK*GGCRR  237
             G LLCG DDVH+CV GS    C +
Sbjct  340   GKLLCGCDDVHTCVPGSTSEACSQ  363



>ref|XP_004232139.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Solanum 
lycopersicum]
Length=374

 Score =   522 bits (1345),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 258/401 (64%), Positives = 299/401 (75%), Gaps = 38/401 (9%)
 Frame = -3

Query  1430  MGFHEildlllivsvlSFNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPK  1260
             MG H+ +  L ++  + F V  + CS   C+ LD++CS   DCG G++CLSC L F G +
Sbjct  1     MGPHQNISSLFLIFSVLFVVAAADCSNGTCK-LDDKCSSDADCGPGLYCLSCALSFQGHR  59

Query  1259  CVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNN  1080
             CVRST TD FKL+N+SLPFNKYAFLTTHNAFSI G  S TG+P + P NQED++TQQLNN
Sbjct  60    CVRSTGTDPFKLVNSSLPFNKYAFLTTHNAFSIEGEPSHTGIPRITPTNQEDNITQQLNN  119

Query  1079  GVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILED  900
             GVRGLMLD YDF GD+WLCHSFGG+CHD+TAFEPA DTLKEIEAFLS+NPSEIVT+ILED
Sbjct  120   GVRGLMLDTYDFDGDIWLCHSFGGECHDYTAFEPAIDTLKEIEAFLSSNPSEIVTLILED  179

Query  899   YVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESE  720
             YV  P GLTKVFTDAGLMKYWFPV+ MPK G DWPLVSDMV  NQRL+VFTSVKSKE+SE
Sbjct  180   YVETPNGLTKVFTDAGLMKYWFPVAKMPKGGQDWPLVSDMVTNNQRLIVFTSVKSKEQSE  239

Query  719   GIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNS  540
             GIAYQWNYMVENQYGDGGM++G+CPNR ES P+ D +KSLVLVN+F ++PL+P+ACVQNS
Sbjct  240   GIAYQWNYMVENQYGDGGMEKGNCPNRAESSPMNDKSKSLVLVNYFRTLPLKPLACVQNS  299

Query  539   GPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVML  360
             G L+DM+ TC+  A NRWANF+AVDFYK                                
Sbjct  300   GNLLDMLMTCHDTAANRWANFIAVDFYK--------------------------------  327

Query  359   LQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCRR  237
               RS+GGG F A D LNG LLC   DVHSC  GS  G C R
Sbjct  328   --RSDGGGAFLATDTLNGQLLCNCGDVHSCAKGSTPGSCTR  366



>ref|XP_002277997.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Vitis 
vinifera]
 emb|CBI16943.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 252/379 (66%), Positives = 292/379 (77%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +AC+   C++LDE CS   DCGAG++C SCP GFSG +CVRS+ TDQFK+LNNSLPFN
Sbjct  18    VATACTNGKCRLLDE-CSTDEDCGAGLYCFSCPQGFSGSRCVRSSITDQFKVLNNSLPFN  76

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHN+++I G  S TGVP +   NQEDSVTQQLNNG RGLMLD YDF GDVWLCH
Sbjct  77    KYAFLTTHNSYAIDGEQSHTGVPRLTFTNQEDSVTQQLNNGARGLMLDTYDFEGDVWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGG+CHD+TAF PA DTL+E+EAFLS NP EIVT+ILEDYV AP GLTKVFTDAGLMKY
Sbjct  137   SFGGECHDYTAFGPAIDTLREVEAFLSANPVEIVTLILEDYVKAPNGLTKVFTDAGLMKY  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV++MP+NG DWPLVSDMVA+NQRL+VFTS+KSK+ESEGIAYQWNYMVENQYGDGGM 
Sbjct  197   WFPVTSMPQNGEDWPLVSDMVAQNQRLIVFTSIKSKQESEGIAYQWNYMVENQYGDGGMH  256

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
             RG+CP RGES PL D  KSLVLVN+F ++PL+   C QNSG LI+M+ TCY AAGNRWAN
Sbjct  257   RGNCPARGESSPLNDGAKSLVLVNYFKTIPLKQPTCQQNSGDLINMLQTCYGAAGNRWAN  316

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+A+D +N  L
Sbjct  317   FVAVDYYK----------------------------------RSEGGGSFQAIDTMNAKL  342

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG DD+H+CV  S  G C
Sbjct  343   LCGCDDIHACVALSTSGAC  361



>ref|XP_009792587.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nicotiana 
sylvestris]
Length=368

 Score =   519 bits (1336),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 256/377 (68%), Positives = 288/377 (76%), Gaps = 38/377 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F VV +ACS   C+ LD++CS   DC AG++C SC + FSG +CVRST T+ FKL+NNSL
Sbjct  17    FFVVATACSNGTCK-LDDKCSTDADCEAGLYCFSCTVSFSGNRCVRSTGTNPFKLVNNSL  75

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNAF+I G  S TG+P + P NQEDSVTQQLNNGVRGLMLD YDF GD+W
Sbjct  76    PFNKYAFLTTHNAFAIEGEPSHTGIPRITPTNQEDSVTQQLNNGVRGLMLDTYDFDGDIW  135

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSFGG CHD+TAF+PA DTLKEIEAFLS NPSEIVT+ILEDYV  PKGLTKVFTDAGL
Sbjct  136   LCHSFGGNCHDYTAFKPAIDTLKEIEAFLSANPSEIVTLILEDYVETPKGLTKVFTDAGL  195

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             +KYWFPVS MPK G +WPLVSDMVA NQRL+VFTS KSKEESEGIAYQWNYMVENQYGDG
Sbjct  196   IKYWFPVSKMPKGGQNWPLVSDMVANNQRLIVFTSKKSKEESEGIAYQWNYMVENQYGDG  255

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GM++G CPNR ES  + DT+KSLVLVN+F SVPL+P+ACVQNSG L+DM+ TC+ AA NR
Sbjct  256   GMEKGSCPNRAESSKMDDTSKSLVLVNYFRSVPLKPLACVQNSGELLDMLTTCHNAAANR  315

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F A D LN
Sbjct  316   WANFIAVDYYK----------------------------------RSEGGGAFLATDTLN  341

Query  308   GGLLCGKDDVHSCVGGS  258
             G LLC   DVHSC  GS
Sbjct  342   GQLLCHCGDVHSCSTGS  358



>ref|XP_007215575.1| hypothetical protein PRUPE_ppa007503mg [Prunus persica]
 gb|EMJ16774.1| hypothetical protein PRUPE_ppa007503mg [Prunus persica]
Length=365

 Score =   518 bits (1334),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 289/380 (76%), Gaps = 38/380 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS   C++L E+CS   DC AG+ C SCP  FSG +C+RST TDQFKLLNNSLPFN
Sbjct  20    VATACSNGQCKLL-EQCSTDGDCEAGLFCFSCPEAFSGSRCIRSTTTDQFKLLNNSLPFN  78

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TG+P V   NQED++TQQLNNGVR LMLD YDF+GDVWLCH
Sbjct  79    KYAFLTTHNAFAIEGEPSHTGIPRVTFTNQEDTITQQLNNGVRALMLDTYDFKGDVWLCH  138

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF GKCHD TAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLT VF  +GLM Y
Sbjct  139   SFNGKCHDITAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVEAPNGLTNVFKASGLMNY  198

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV++MPKNG DWPLVSDMVAKNQRLLVFTS  +KE+SEGIAYQWNYMVENQYGDGGMK
Sbjct  199   WFPVTSMPKNGQDWPLVSDMVAKNQRLLVFTSKSAKEQSEGIAYQWNYMVENQYGDGGMK  258

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G+CPNRGES PL D TKSLVLVN+F S+P++ ++C  NSG LI M+ TCY AAGNRWAN
Sbjct  259   PGNCPNRGESAPLNDKTKSLVLVNYFSSIPIKQVSCAINSGDLIKMLYTCYGAAGNRWAN  318

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RSEGGG+F+A+D LNG L
Sbjct  319   FVAVDFYK----------------------------------RSEGGGSFQALDNLNGEL  344

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG +DVH+CV GS  G C+
Sbjct  345   LCGCNDVHACVPGSPPGSCQ  364



>ref|XP_009596990.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nicotiana 
tomentosiformis]
Length=368

 Score =   518 bits (1333),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 256/377 (68%), Positives = 287/377 (76%), Gaps = 38/377 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F VV +ACS   C+ LD++C+   DC AG++C SC L FSG +CVRST T+ FKL+NNSL
Sbjct  17    FFVVATACSNGTCK-LDDKCATDADCEAGLYCFSCTLSFSGNRCVRSTGTNPFKLVNNSL  75

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNK+AFLTTHNAF+I G  S TG+P + P NQEDSVTQQLNNGVRGLMLD YDF GDVW
Sbjct  76    PFNKFAFLTTHNAFAIEGEPSHTGIPRITPTNQEDSVTQQLNNGVRGLMLDTYDFDGDVW  135

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSFGG CHD+TAFEPA DTLKEIEAFLS NPSEIVT+ILEDYV  PKGLTKVFTDAGL
Sbjct  136   LCHSFGGNCHDYTAFEPAIDTLKEIEAFLSVNPSEIVTLILEDYVETPKGLTKVFTDAGL  195

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFP+S MPK G DWPLVSDMVA NQRL+VFTS  SKEESEGIAYQWNYMVENQYGDG
Sbjct  196   MKYWFPLSKMPKGGQDWPLVSDMVANNQRLIVFTSKMSKEESEGIAYQWNYMVENQYGDG  255

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GM++G CPNR ES  + DT+KSLVLVN+F SVPL+P++CVQNSG L+DM+ TC+ AA NR
Sbjct  256   GMEKGSCPNRAESSKMDDTSKSLVLVNYFRSVPLKPLSCVQNSGELLDMLMTCHNAAANR  315

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F A D LN
Sbjct  316   WANFIAVDYYK----------------------------------RSEGGGAFLATDTLN  341

Query  308   GGLLCGKDDVHSCVGGS  258
             G LLC   DVHSC  GS
Sbjct  342   GQLLCHCGDVHSCSSGS  358



>ref|XP_006338342.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Solanum tuberosum]
Length=367

 Score =   516 bits (1328),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 253/384 (66%), Positives = 287/384 (75%), Gaps = 38/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F V  + CS   C+ LD++CS   DCG G++CLSC L F G +CVRST TD FKL+N+SL
Sbjct  18    FVVAAADCSNGTCK-LDDKCSSDADCGPGLYCLSCTLSFQGHRCVRSTGTDPFKLVNSSL  76

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNAF+I G  S TG+P V P NQED++TQQLNNGVRGLMLD YDF G +W
Sbjct  77    PFNKYAFLTTHNAFAIEGEPSHTGIPRVTPTNQEDNITQQLNNGVRGLMLDTYDFDGAIW  136

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSFGG+CHD+TAFEPA DTLKEIE FLS NPSEIVT+ILEDYV  P GLTKVFTDAGL
Sbjct  137   LCHSFGGQCHDYTAFEPAIDTLKEIEGFLSANPSEIVTLILEDYVETPNGLTKVFTDAGL  196

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFPV+ MPK G DWPLVSDMV  NQRL+VFTSVKSKE+SEGIAYQWNYMVENQYGDG
Sbjct  197   MKYWFPVAKMPKGGQDWPLVSDMVTNNQRLIVFTSVKSKEQSEGIAYQWNYMVENQYGDG  256

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GM++G+CPNR ES  + D +KSLVLVN+F ++PL+P+ACVQNSG L+DM+ TC+ AA NR
Sbjct  257   GMEKGNCPNRAESSAMNDKSKSLVLVNYFRTLPLKPLACVQNSGHLLDMLMTCHDAAANR  316

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVDFYK                                  RSEGGG F A D LN
Sbjct  317   WANFIAVDFYK----------------------------------RSEGGGAFLATDTLN  342

Query  308   GGLLCGKDDVHSCVGGSK*GGCRR  237
             G LLC   DVHSC  GS  G C R
Sbjct  343   GQLLCNCGDVHSCAKGSTPGSCTR  366



>gb|KDP24289.1| hypothetical protein JCGZ_25585 [Jatropha curcas]
Length=363

 Score =   515 bits (1326),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 253/379 (67%), Positives = 284/379 (75%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V   CS  +C++LDE CS   DC  G++C SCP GFSG +CVRST TDQFKLLNNSLPFN
Sbjct  18    VAVTCSNGDCRLLDE-CSSDQDCEGGLYCFSCPQGFSGSRCVRSTITDQFKLLNNSLPFN  76

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNA++I G+ S TGVP     NQEDSV QQLNNG R LMLD YDFRGDVWLCH
Sbjct  77    KYAFLTTHNAYAIDGYPSHTGVPRFTFTNQEDSVAQQLNNGARALMLDTYDFRGDVWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD+TAF PA DTLKEIEAFLS NPSEIVTIILEDYV AP GLTKVFTDAGLMKY
Sbjct  137   SFKGQCHDYTAFGPAIDTLKEIEAFLSANPSEIVTIILEDYVQAPNGLTKVFTDAGLMKY  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MPKNG DWPL+SDMV  NQRLLVF S+KSKEE+EGIAYQWNYMVEN YG+ GMK
Sbjct  197   WFPVTKMPKNGQDWPLISDMVKNNQRLLVFGSIKSKEETEGIAYQWNYMVENHYGEDGMK  256

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGES PL D +KSLVLVN+FGS+PL+ ++C  NSG LI+M+ TCY A+ NRWAN
Sbjct  257   AGSCSNRGESSPLDDRSKSLVLVNYFGSIPLKDLSCADNSGDLINMLHTCYGASANRWAN  316

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  317   FVAVDYYK----------------------------------RSEGGGSFQAVDTLNGKL  342

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG DD+H+CV GS    C
Sbjct  343   LCGCDDIHACVPGSTSRAC  361



>ref|XP_003554924.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Glycine max]
Length=364

 Score =   514 bits (1324),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 287/379 (76%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS  NC+V ++ECS   DCGAG++C SCPLG+ G +CVRS+ TDQFKL NNSLPFN
Sbjct  19    VDAACSNGNCKV-NDECSSNGDCGAGLYCFSCPLGYLGSRCVRSSITDQFKLTNNSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TGVP     NQ DSVT+QL NGVR LMLD YDFRGDVWLCH
Sbjct  78    KYAFLTTHNAFAIDGEPSHTGVPRATITNQADSVTEQLKNGVRALMLDTYDFRGDVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV  PKGLTKVF  AGLMK+
Sbjct  138   SFQGQCYDFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVKTPKGLTKVFAKAGLMKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MPK GGDWPLVSDM+AKNQRLLVFTSV+SKE+SEGIAYQWNYMVENQYGDGG K
Sbjct  198   WFPVTRMPKRGGDWPLVSDMIAKNQRLLVFTSVRSKEQSEGIAYQWNYMVENQYGDGGRK  257

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CP+R ES PL D +KSLVLVN+F S P +P+AC  NSG LIDM+ TC+ AA NRWAN
Sbjct  258   AGSCPHRAESSPLDDKSKSLVLVNYFRSTPFKPIACEDNSGGLIDMLQTCHGAAANRWAN  317

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             +LAVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  318   YLAVDYYK----------------------------------RSEGGGSFQAVDTLNGKL  343

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG +DVH+CV GS    C
Sbjct  344   LCGCNDVHACVPGSTSQAC  362



>ref|XP_003554923.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Glycine max]
Length=367

 Score =   513 bits (1322),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 291/382 (76%), Gaps = 41/382 (11%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             + +ACS   C+ LD+ECS   DCGAG++C SCP GFSG +CVRS+ TDQFKL+N+SLPFN
Sbjct  19    IDAACSNGKCK-LDDECSSNGDCGAGLYCFSCPHGFSGSRCVRSSITDQFKLINDSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TGV      NQEDSVTQQL NGVRGLMLD YDF GDVWLCH
Sbjct  78    KYAFLTTHNAFAINGEPSHTGVRRATLSNQEDSVTQQLKNGVRGLMLDTYDFDGDVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G CHDFTAFEPA DTLKEI AFLS+NP EIVT+ILEDYV APKGLTKVFTDAGL+K+
Sbjct  138   SFRGHCHDFTAFEPAIDTLKEIAAFLSSNPKEIVTLILEDYVEAPKGLTKVFTDAGLVKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGG--  666
             WFPV+ MPKNGGDWPLVSDMVAKNQRLL+FTSV SKE+SEGIAYQWNYMVENQ+GD G  
Sbjct  198   WFPVTRMPKNGGDWPLVSDMVAKNQRLLLFTSVSSKEKSEGIAYQWNYMVENQFGDKGRK  257

Query  665   -MKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
              +K G CPNR ES PL D +KSLVLVN+F ++PL+P++C  NSG LI+M+ TC+ AAGNR
Sbjct  258   ALKEGSCPNRKESSPLDDKSKSLVLVNYFRTIPLKPISCEDNSGGLIEMLQTCHRAAGNR  317

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG+F+AVD LN
Sbjct  318   WANFVAVDYYK----------------------------------RSEGGGSFQAVDTLN  343

Query  308   GGLLCGKDDVHSCVGGSK*GGC  243
             G LLCG +DVH+CV GS    C
Sbjct  344   GKLLCGCNDVHACVHGSTAKAC  365



>ref|XP_008230282.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Prunus 
mume]
Length=365

 Score =   513 bits (1321),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 253/378 (67%), Positives = 287/378 (76%), Gaps = 38/378 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             +ACS   C++L E+CS   DC AG+ C SCP  FSG +C+RST TDQFKLLNNSLPFNKY
Sbjct  22    TACSNGQCKLL-EQCSSDGDCEAGLFCFSCPEAFSGSRCIRSTITDQFKLLNNSLPFNKY  80

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             AFLTTHNAF+I G  S TG+P V   NQED++TQQLNNGVR LMLD YDF+GDVWLCHSF
Sbjct  81    AFLTTHNAFAIEGEPSHTGIPRVTFTNQEDTITQQLNNGVRALMLDTYDFKGDVWLCHSF  140

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              GKCHD TAFEPA DTL EIEAFLS NP+EIVT+ILEDYV AP GLT VF  +GLMKYWF
Sbjct  141   NGKCHDITAFEPAIDTLMEIEAFLSANPAEIVTLILEDYVEAPNGLTNVFKASGLMKYWF  200

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PV++MPKNG DWPLVSDMVAKNQRLLVFTS  +KE+SEGIAYQWNYMVENQYGDGGMK G
Sbjct  201   PVTSMPKNGQDWPLVSDMVAKNQRLLVFTSKSAKEQSEGIAYQWNYMVENQYGDGGMKPG  260

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
             +CPNR ES PL D TKSLVLVN+F S+P++ ++C  NSG LI M+ TCY AAGNRWANF+
Sbjct  261   NCPNRRESAPLNDETKSLVLVNYFTSIPIKQVSCAINSGDLIKMLYTCYGAAGNRWANFV  320

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AVDFYK                                  RSEGGG+F+A+D LNG LLC
Sbjct  321   AVDFYK----------------------------------RSEGGGSFQALDTLNGELLC  346

Query  293   GKDDVHSCVGGSK*GGCR  240
             G +DVH+CV GS  G C+
Sbjct  347   GCNDVHACVPGSTPGSCQ  364



>ref|XP_002531003.1| phospholipase C, putative [Ricinus communis]
 gb|EEF31391.1| phospholipase C, putative [Ricinus communis]
Length=363

 Score =   512 bits (1318),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 249/379 (66%), Positives = 284/379 (75%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V  ACS  +C++LDE CS   DC AG++C SCP GFSG +CVRST +DQFKLLNNSLP N
Sbjct  18    VAEACSNGDCRLLDE-CSSDQDCEAGLYCFSCPQGFSGSRCVRSTVSDQFKLLNNSLPLN  76

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNA++I G+ S TG P     NQEDSV QQLNNG R LMLD YDFRGDVWLCH
Sbjct  77    KYAFLTTHNAYAIDGYPSHTGAPRFTFTNQEDSVAQQLNNGARALMLDTYDFRGDVWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD+TAF PA DTLKEIEAFLS NPSEIVTIILEDYV AP GLTK+FTDAGLMKY
Sbjct  137   SFKGQCHDYTAFGPAIDTLKEIEAFLSANPSEIVTIILEDYVQAPNGLTKLFTDAGLMKY  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WF V+NMP+NG DWPLVSDMV  NQRLLVFTS++SKE++EGIAYQWNYMVEN YG+ GMK
Sbjct  197   WFSVTNMPQNGQDWPLVSDMVKNNQRLLVFTSIQSKEQTEGIAYQWNYMVENHYGEDGMK  256

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGES  L D TKSLVLVN+FG++PL+ ++C  NSG LIDM+ TCY A+ NRWAN
Sbjct  257   AGSCSNRGESSSLDDKTKSLVLVNYFGTIPLKDLSCHDNSGDLIDMLHTCYGASDNRWAN  316

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  317   FVAVDYYK----------------------------------RSEGGGSFQAVDTLNGKL  342

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG DD+H+C+ GS    C
Sbjct  343   LCGCDDIHACMAGSTSRAC  361



>gb|KHN04383.1| PI-PLC X domain-containing protein [Glycine soja]
Length=368

 Score =   512 bits (1318),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 251/371 (68%), Positives = 284/371 (77%), Gaps = 38/371 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS  NC+V ++ECS   DCGAG++C SCPLG+ G +CVRS+ TDQFKL NNSLPFN
Sbjct  19    VDAACSNGNCKV-NDECSSNGDCGAGLYCFSCPLGYLGSRCVRSSITDQFKLTNNSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TGVP     NQ DSVT+QL NGVR LMLD YDFRGDVWLCH
Sbjct  78    KYAFLTTHNAFAIDGEPSHTGVPRATITNQADSVTEQLKNGVRALMLDTYDFRGDVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV  PKGLTKVF  AGLMK+
Sbjct  138   SFQGQCYDFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVKTPKGLTKVFAKAGLMKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MPK GGDWPLVSDM+AKNQRLLVFTSV+SKE+SEGIAYQWNYMVENQYGDGG K
Sbjct  198   WFPVTRMPKRGGDWPLVSDMIAKNQRLLVFTSVRSKEQSEGIAYQWNYMVENQYGDGGRK  257

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CP+R ES PL D +KSLVLVN+F S P +P+AC  NSG LIDM+ TC+ AA NRWAN
Sbjct  258   AGSCPHRAESSPLDDKSKSLVLVNYFRSTPFKPIACEDNSGGLIDMLQTCHGAAANRWAN  317

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             +LAVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  318   YLAVDYYK----------------------------------RSEGGGSFQAVDTLNGKL  343

Query  299   LCGKDDVHSCV  267
             LCG +DVH+CV
Sbjct  344   LCGCNDVHACV  354



>ref|XP_010257976.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nelumbo 
nucifera]
Length=367

 Score =   511 bits (1317),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 247/372 (66%), Positives = 285/372 (77%), Gaps = 38/372 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             SACS   C++LD+ CS   DC +G++C SCP GFSG +CVRST TDQFKLLNNSLPFNKY
Sbjct  21    SACSNGECRLLDD-CSSDRDCMSGLYCFSCPRGFSGSRCVRSTITDQFKLLNNSLPFNKY  79

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             AFLTTHNA++I G  S TG+P +   NQEDS+TQQLNNGVR LMLD YDF GDVWLCHSF
Sbjct  80    AFLTTHNAYAIDGEPSHTGLPRLTFTNQEDSITQQLNNGVRALMLDTYDFEGDVWLCHSF  139

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
             GG+C++ TAF PA DTL+EIEAFL+ NPSEI+T+ILEDYV AP GLTKVFTDAGLMKYWF
Sbjct  140   GGRCYNLTAFGPALDTLREIEAFLAANPSEIITLILEDYVEAPNGLTKVFTDAGLMKYWF  199

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             P+S MP+NG DWPLV DMVA NQRL+VFTS+KSK+E+EGIAYQWNYMVENQYG GGM  G
Sbjct  200   PLSKMPQNGRDWPLVRDMVANNQRLIVFTSMKSKQETEGIAYQWNYMVENQYGKGGMHSG  259

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNRGES PL D T+SLVLVN+F SVP++  AC  NSG LI+M+ TCY AAGNRWANF+
Sbjct  260   SCPNRGESSPLGDKTRSLVLVNYFESVPIKQTACKHNSGDLINMLRTCYSAAGNRWANFV  319

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AVD+YK                                  RS+GGG F+A+D LNG LLC
Sbjct  320   AVDYYK----------------------------------RSDGGGAFQAIDTLNGELLC  345

Query  293   GKDDVHSCVGGS  258
             G+DD+H CV GS
Sbjct  346   GRDDIHECVPGS  357



>ref|XP_010032554.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW51948.1| hypothetical protein EUGRSUZ_J01395 [Eucalyptus grandis]
Length=364

 Score =   510 bits (1314),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 256/376 (68%), Positives = 287/376 (76%), Gaps = 36/376 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ++CS   C++LDE    SDC AG++C SCP GFSG +CVRST TDQFKL NNSLPFNKYA
Sbjct  21    ASCSNGECRLLDECSSDSDCVAGLYCFSCPQGFSGSRCVRSTITDQFKLWNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNA++I G    T VP V   NQED+VTQQLNNGVRGLMLD YDF GDVWLCHSF 
Sbjct  81    FLTTHNAYAIDGEPPHTPVPRVTVTNQEDTVTQQLNNGVRGLMLDTYDFEGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C+DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFTDAGLMKYWFP
Sbjct  141   GQCYDFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VSNMPKNG DWPLVSDMVA NQRLLVFTS+ SKE+SEGIAYQWNYMVENQYGDGGMK G 
Sbjct  201   VSNMPKNGQDWPLVSDMVANNQRLLVFTSILSKEQSEGIAYQWNYMVENQYGDGGMKAGS  260

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES  L D +KSLVLVN+F S P++ ++C  +SG LI+M+ TCY AAGNRWANF+A
Sbjct  261   CPNRAESASLDDRSKSLVLVNYFRSPPIKLLSCGDHSGNLINMLHTCYGAAGNRWANFVA  320

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VD+YK                                  RS+GGG+F+AVD LNG LLCG
Sbjct  321   VDYYK----------------------------------RSDGGGSFQAVDTLNGKLLCG  346

Query  290   KDDVHSCVGGSK*GGC  243
              DDVH+CV GS  G C
Sbjct  347   CDDVHACVPGSTSGVC  362



>ref|XP_002317025.2| hypothetical protein POPTR_0011s14800g [Populus trichocarpa]
 gb|EEE97637.2| hypothetical protein POPTR_0011s14800g [Populus trichocarpa]
Length=365

 Score =   510 bits (1313),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 298/399 (75%), Gaps = 39/399 (10%)
 Frame = -3

Query  1430  MGFHEildlllivsvlSFNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPK  1260
             MGF + L L++  SV+  +V T ACS   C++LDE CS   DCGAG++C SCP GFSG +
Sbjct  1     MGFSQNLFLIITASVILVDVAT-ACSNGQCKILDE-CSSNQDCGAGLYCFSCPAGFSGSR  58

Query  1259  CVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNN  1080
             CVRST T+QFKLLNNSLPFNKYAFLTTHNAF+I G+ S TG+P +   NQEDS+T+QLNN
Sbjct  59    CVRSTITNQFKLLNNSLPFNKYAFLTTHNAFAIDGYPSHTGIPRITVTNQEDSITEQLNN  118

Query  1079  GVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILED  900
             G R LMLD YDFRGDVWLCHSF G+C+DFTAF PA DTLKEIEAFLS NP+EIVT+ILED
Sbjct  119   GARALMLDTYDFRGDVWLCHSFKGQCYDFTAFGPAIDTLKEIEAFLSANPTEIVTLILED  178

Query  899   YVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESE  720
             YV AP GLTKVF DAGL KYWFPVS MPKNG DWPLVSDMV  NQRLLVFTS++SKE SE
Sbjct  179   YVQAPNGLTKVFADAGLKKYWFPVSKMPKNGQDWPLVSDMVQNNQRLLVFTSIQSKEASE  238

Query  719   GIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNS  540
             GIAYQWNYMVENQYGD GMK G CPNR ESPPL D ++SLVLVN+F S+ ++ ++C  NS
Sbjct  239   GIAYQWNYMVENQYGDDGMKAGSCPNRKESPPLDDKSRSLVLVNYFRSISMKKLSCEDNS  298

Query  539   GPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVML  360
               L++M+ TC  AA +RWANF+AV++YK                                
Sbjct  299   ENLMNMLRTCDGAAASRWANFVAVNYYK--------------------------------  326

Query  359   LQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
               RSEGGG+F+AVD LNG LLCG DD+H+CV GS  G C
Sbjct  327   --RSEGGGSFQAVDLLNGKLLCGCDDIHACVPGSTSGAC  363



>gb|KHN04384.1| PI-PLC X domain-containing protein [Glycine soja]
Length=373

 Score =   509 bits (1312),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 252/374 (67%), Positives = 288/374 (77%), Gaps = 41/374 (11%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             + +ACS   C+ LD+ECS   DCGAG++C SCP GFSG +CVRS+ TDQFKL+N+SLPFN
Sbjct  19    IDAACSNGKCK-LDDECSSNGDCGAGLYCFSCPHGFSGSRCVRSSITDQFKLINDSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TGV      NQEDSVTQQL NGVRGLMLD YDF GDVWLCH
Sbjct  78    KYAFLTTHNAFAINGEPSHTGVRRATLSNQEDSVTQQLKNGVRGLMLDTYDFDGDVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G CHDFTAFEPA DTLKEI AFLS+NP EIVT+ILEDYV APKGLTKVFTDAGL+K+
Sbjct  138   SFRGHCHDFTAFEPAIDTLKEIAAFLSSNPKEIVTLILEDYVEAPKGLTKVFTDAGLVKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGG--  666
             WFPV+ MPKNGGDWPLVSDMVAKNQRLL+FTSV SKE+SEGIAYQWNYMVENQ+GD G  
Sbjct  198   WFPVTRMPKNGGDWPLVSDMVAKNQRLLLFTSVSSKEKSEGIAYQWNYMVENQFGDKGRK  257

Query  665   -MKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
              +K G CPNR ES PL D +KSLVLVN+F ++PL+P++C  NSG LI+M+ TC+ AAGNR
Sbjct  258   ALKEGSCPNRKESSPLDDKSKSLVLVNYFRTIPLKPISCEDNSGGLIEMLQTCHRAAGNR  317

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG+F+AVD LN
Sbjct  318   WANFVAVDYYK----------------------------------RSEGGGSFQAVDTLN  343

Query  308   GGLLCGKDDVHSCV  267
             G LLCG +DVH+CV
Sbjct  344   GKLLCGCNDVHACV  357



>ref|XP_011030718.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Populus euphratica]
Length=365

 Score =   509 bits (1311),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 257/399 (64%), Positives = 297/399 (74%), Gaps = 39/399 (10%)
 Frame = -3

Query  1430  MGFHEildlllivsvlSFNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPK  1260
             MGF + L L++  SV+  +V T ACS   C++LD+ CS   DC AG++C SCP GFSG +
Sbjct  1     MGFSQNLFLIITSSVVLVDVAT-ACSNGECKILDK-CSSNQDCEAGLYCFSCPAGFSGSR  58

Query  1259  CVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNN  1080
             CVRST T+QFKLLNNSLP NKYAFLTTHNAF+I G+ S TG+P +   NQEDS+T+QLNN
Sbjct  59    CVRSTITNQFKLLNNSLPLNKYAFLTTHNAFAIDGYPSHTGIPRITVTNQEDSITEQLNN  118

Query  1079  GVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILED  900
             G R LMLD YDFRGDVWLCHSF GKC+DFTAF PA DTLKEIEAFLS NP+EIVT+ILED
Sbjct  119   GARALMLDTYDFRGDVWLCHSFKGKCYDFTAFGPAIDTLKEIEAFLSANPTEIVTLILED  178

Query  899   YVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESE  720
             YV AP GLTKVF DAGLMKYWFP+S MPKNG DWPLVSDMV  NQRLLVFTS++SKE SE
Sbjct  179   YVQAPNGLTKVFADAGLMKYWFPMSKMPKNGQDWPLVSDMVQNNQRLLVFTSIQSKEASE  238

Query  719   GIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNS  540
             GIAYQWNYMVENQYGD GMK G CPNR ESPPL D ++SLVLVN+F S  ++ ++C  NS
Sbjct  239   GIAYQWNYMVENQYGDDGMKAGSCPNRKESPPLDDKSRSLVLVNYFRSTSMKELSCEDNS  298

Query  539   GPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVML  360
               LI+M+ TC  AAGNRWANF+AV++YK                                
Sbjct  299   ENLINMLRTCDGAAGNRWANFVAVNYYK--------------------------------  326

Query  359   LQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
               RSEGGG+F+AVD LNG LLCG DD+H+CV GS  G C
Sbjct  327   --RSEGGGSFQAVDFLNGKLLCGCDDIHACVPGSTSGAC  363



>ref|XP_007151353.1| hypothetical protein PHAVU_004G039300g [Phaseolus vulgaris]
 gb|ESW23347.1| hypothetical protein PHAVU_004G039300g [Phaseolus vulgaris]
Length=367

 Score =   509 bits (1311),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 251/379 (66%), Positives = 286/379 (75%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS  NC+ LD+EC    DCGAG++C SCP G+ G +CVRS+ TDQFKL+NNSLPFN
Sbjct  19    VDAACSNGNCK-LDDECKSNGDCGAGLYCFSCPFGYLGSRCVRSSITDQFKLINNSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY+FLTTHNAF+I G  S TG P     NQEDSVT+QL NGVR LMLD YDF G VWLCH
Sbjct  78    KYSFLTTHNAFAIDGEPSHTGKPRTTITNQEDSVTEQLKNGVRALMLDTYDFDGKVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+DFTAFEPA DTLKEI AFLS NP+EIVT+ILEDYV  PKGLTKVFTDAGLMK+
Sbjct  138   SFQGQCYDFTAFEPAIDTLKEIAAFLSANPTEIVTLILEDYVKTPKGLTKVFTDAGLMKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MPK GGDWPLVSDMVAKNQRLLVFTSV+SKE+SEGIAYQWNYMVENQYGDGG K
Sbjct  198   WFPVTRMPKKGGDWPLVSDMVAKNQRLLVFTSVRSKEQSEGIAYQWNYMVENQYGDGGRK  257

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CP+R ES PL D +KSLVLVN+F S PL+P+ C  NSG LIDM+ TC+ AAG+RWAN
Sbjct  258   SGSCPSRAESSPLNDKSKSLVLVNYFRSAPLKPITCEDNSGGLIDMLQTCHGAAGDRWAN  317

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             ++AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  318   YVAVDYYK----------------------------------RSEGGGSFKAVDTLNGKL  343

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG +DVH+CV GS    C
Sbjct  344   LCGCNDVHACVPGSTSQAC  362



>gb|KEH21727.1| PLC-like phosphodiesterase superfamily protein [Medicago truncatula]
Length=364

 Score =   509 bits (1310),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 283/380 (74%), Gaps = 36/380 (9%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECSD--CGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             V + CS   C++ DE  SD  CG G++C  C L F G +CVRS+ TDQFKL+NNSLPFNK
Sbjct  18    VAADCSNGACKLGDECNSDEDCGTGLYCFDCSLEFDGKRCVRSSVTDQFKLINNSLPFNK  77

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             YAFLTTHNAF+I G  S TGVP +   NQED++TQQLNNGVR LMLD YDF  DVWLCHS
Sbjct  78    YAFLTTHNAFAIEGEPSHTGVPRITITNQEDTITQQLNNGVRALMLDTYDFDDDVWLCHS  137

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G CHDFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLT VF  AGL KYW
Sbjct  138   FQGHCHDFTAFEPAIDTLKEIEAFLSANPNEIVTLILEDYVEAPNGLTNVFNKAGLKKYW  197

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FP+++MPKNGG+WPLVSDMVAKNQRLLVFTS K+KE+SEGIAYQWNYMVENQYGDGG K 
Sbjct  198   FPLASMPKNGGNWPLVSDMVAKNQRLLVFTSKKAKEQSEGIAYQWNYMVENQYGDGGRKE  257

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CPNRGESPPL D +KSLVLVN+F + PL+P+ C  NSG LIDM+ TCY AAGNRWANF
Sbjct  258   GSCPNRGESPPLNDKSKSLVLVNYFRTAPLKPITCEDNSGGLIDMLQTCYGAAGNRWANF  317

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             +AVDFYK                                  RSEGGG+F+AVD LNG LL
Sbjct  318   VAVDFYK----------------------------------RSEGGGSFQAVDTLNGELL  343

Query  296   CGKDDVHSCVGGSK*GGCRR  237
             CG DDVH+CV GS    C +
Sbjct  344   CGCDDVHTCVPGSTSHACSQ  363



>ref|XP_010032556.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Eucalyptus grandis]
Length=364

 Score =   507 bits (1306),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 283/376 (75%), Gaps = 36/376 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ++CS   C++LDE    SDC AG++C SC    S  +CVRST TDQFKLLNNSLPFNKYA
Sbjct  21    ASCSNGECRLLDECSSNSDCEAGLYCFSCLGDVSDSRCVRSTVTDQFKLLNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNA +I G   RT VP V   NQED+VTQQLNNGVR LMLD YDF GDVWLCHSF 
Sbjct  81    FLTTHNAHAIDGEPPRTPVPRVTITNQEDTVTQQLNNGVRALMLDTYDFEGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
              +C+DFTAFEPA DTLKEIEAFLS N +EIVT+ILEDYV AP GLTKVFTDAGLMKYWFP
Sbjct  141   DQCYDFTAFEPAIDTLKEIEAFLSANQAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VSNMPKNG DWPLVSDMVA NQRLLVFTS++SKE+SEGIAYQWNYMVENQYGD GMK G 
Sbjct  201   VSNMPKNGQDWPLVSDMVANNQRLLVFTSIRSKEQSEGIAYQWNYMVENQYGDDGMKAGS  260

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL D +KSLVLVN+F SVP+  ++C +NSG LIDM+ TCY AAGNRWANF+A
Sbjct  261   CPNRAESVPLDDRSKSLVLVNYFRSVPVTLLSCKENSGDLIDMLHTCYGAAGNRWANFVA  320

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RSEGGG+F+AVD LNG LLCG
Sbjct  321   VDFYK----------------------------------RSEGGGSFQAVDTLNGKLLCG  346

Query  290   KDDVHSCVGGSK*GGC  243
              +DVH+CV GS  G C
Sbjct  347   CNDVHACVPGSTSGAC  362



>ref|XP_010032555.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Eucalyptus grandis]
Length=341

 Score =   506 bits (1304),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/372 (69%), Positives = 283/372 (76%), Gaps = 37/372 (10%)
 Frame = -3

Query  1349  ENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTT  1179
             EN   L +ECS   DC AG++C SCP GFSG +CVRST TDQFKL NNSLPFNKYAFLTT
Sbjct  2     ENAGFLLDECSSDSDCVAGLYCFSCPQGFSGSRCVRSTITDQFKLWNNSLPFNKYAFLTT  61

Query  1178  HNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCH  999
             HNA++I G    T VP V   NQED+VTQQLNNGVRGLMLD YDF GDVWLCHSF G+C+
Sbjct  62    HNAYAIDGEPPHTPVPRVTVTNQEDTVTQQLNNGVRGLMLDTYDFEGDVWLCHSFKGQCY  121

Query  998   DFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNM  819
             DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFTDAGLMKYWFPVSNM
Sbjct  122   DFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFPVSNM  181

Query  818   PKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNR  639
             PKNG DWPLVSDMVA NQRLLVFTS+ SKE+SEGIAYQWNYMVENQYGDGGMK G CPNR
Sbjct  182   PKNGQDWPLVSDMVANNQRLLVFTSILSKEQSEGIAYQWNYMVENQYGDGGMKAGSCPNR  241

Query  638   GESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
              ES  L D +KSLVLVN+F S P++ ++C  +SG LI+M+ TCY AAGNRWANF+AVD+Y
Sbjct  242   AESASLDDRSKSLVLVNYFRSPPIKLLSCGDHSGNLINMLHTCYGAAGNRWANFVAVDYY  301

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
             K                                  RS+GGG+F+AVD LNG LLCG DDV
Sbjct  302   K----------------------------------RSDGGGSFQAVDTLNGKLLCGCDDV  327

Query  278   HSCVGGSK*GGC  243
             H+CV GS  G C
Sbjct  328   HACVPGSTSGVC  339



>ref|XP_008775858.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Phoenix dactylifera]
Length=364

 Score =   507 bits (1305),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 287/382 (75%), Gaps = 38/382 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V++ACS  +C++LDE CS   DC +G++C SCPLGF G +CVRST T+QFKL+NNSL
Sbjct  15    FLSVSTACSNGSCRLLDE-CSSDGDCESGLYCFSCPLGFLGSRCVRSTITNQFKLVNNSL  73

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYA+LTTHN+++I G  S TGVP V   NQEDSVTQQLNNGVR LMLD YDF  DVW
Sbjct  74    PFNKYAYLTTHNSYAIEGEPSHTGVPRVTFNNQEDSVTQQLNNGVRALMLDTYDFDDDVW  133

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHS GGKCHDFTAFEPA DT+KEIEAFLS NPSEIVT+ILEDYV AP GLTKVF D+GL
Sbjct  134   LCHSNGGKCHDFTAFEPAIDTMKEIEAFLSANPSEIVTVILEDYVKAPNGLTKVFNDSGL  193

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             +KYWFPVS MP+NG DWPLVSDMVA NQRL+VFTSVKSK+E EGIAYQWN+MVENQYGD 
Sbjct  194   LKYWFPVSRMPQNGQDWPLVSDMVASNQRLIVFTSVKSKQELEGIAYQWNFMVENQYGDD  253

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GMK G C NR ES PL +T+KSLVLVN+F S+P++  ACVQNS  LI M+ TCY AA NR
Sbjct  254   GMKAGSCFNRAESSPLNETSKSLVLVNYFRSIPVKLTACVQNSAGLIGMLNTCYHAAANR  313

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F+A D LN
Sbjct  314   WANFVAVDYYK----------------------------------RSEGGGAFQATDMLN  339

Query  308   GGLLCGKDDVHSCVGGSK*GGC  243
             G LLCG DDVH+CV GS    C
Sbjct  340   GRLLCGCDDVHTCVPGSTSRAC  361



>ref|XP_007032848.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
 gb|EOY03774.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
Length=363

 Score =   506 bits (1304),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 285/382 (75%), Gaps = 39/382 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V SACS   C++LDE CS   DC AG++C +C  GFSG +CVRST TDQFKLLNNSL
Sbjct  16    FLSVASACSDGQCRLLDE-CSSDGDCEAGLYCFACSQGFSGSRCVRSTITDQFKLLNNSL  74

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNA++I G+   T VP V   NQEDS+T QLNNG RGLMLD YDF GDVW
Sbjct  75    PFNKYAFLTTHNAYAIDGYPLHTPVPRVTFTNQEDSITNQLNNGARGLMLDTYDFDGDVW  134

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             +CHSFGG CHD+TAF PA D LKEIEAFLS NP EIVT+ILEDYV  P GLTKVFTDAGL
Sbjct  135   MCHSFGGNCHDYTAFGPAIDYLKEIEAFLSANPEEIVTLILEDYV-GPNGLTKVFTDAGL  193

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFPVS+MPKNG DWPLVSDMVA NQRLLVFTS++SKE SEGIAYQWNYMVENQYG+G
Sbjct  194   MKYWFPVSSMPKNGEDWPLVSDMVANNQRLLVFTSIQSKEASEGIAYQWNYMVENQYGNG  253

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GM+ G CPNRGES  L DT+KSLVLVN+F S+P +   C  NSG LI+M+ TCY AAGNR
Sbjct  254   GMQAGSCPNRGESSALDDTSKSLVLVNYFHSIPSDSATCKDNSGDLINMLHTCYGAAGNR  313

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG+F+AVD LN
Sbjct  314   WANFVAVDYYK----------------------------------RSEGGGSFQAVDTLN  339

Query  308   GGLLCGKDDVHSCVGGSK*GGC  243
             G LLCG DD+H+CV GS  G C
Sbjct  340   GKLLCGCDDIHACVPGSTSGAC  361



>ref|XP_010936443.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X2 [Elaeis guineensis]
Length=397

 Score =   504 bits (1298),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 252/382 (66%), Positives = 288/382 (75%), Gaps = 38/382 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V++ACS  NC++LDE CS   DC +G++C SCPLGF G +CVRST +DQFKL+NNSL
Sbjct  48    FLSVSTACSNGNCRLLDE-CSSDGDCESGLYCFSCPLGFLGSRCVRSTISDQFKLVNNSL  106

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYA+LTTHN+++I G  S TGVP V   NQEDSVTQQLNNGVR LMLD YDF  DVW
Sbjct  107   PFNKYAYLTTHNSYAIEGEPSHTGVPRVTFDNQEDSVTQQLNNGVRALMLDTYDFDDDVW  166

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHS GGKC+DFTAFEPA DT+KEIEAFLS NPSEIVT+ILEDYV AP GLTKVF D+GL
Sbjct  167   LCHSNGGKCNDFTAFEPAIDTMKEIEAFLSANPSEIVTLILEDYVKAPNGLTKVFNDSGL  226

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             +KYWFPVS MP+ G DWPLVS+MVA NQRL+VFTSV+SK+ESEGIAYQWN+MVENQYGDG
Sbjct  227   LKYWFPVSRMPQIGQDWPLVSNMVASNQRLIVFTSVESKQESEGIAYQWNFMVENQYGDG  286

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GMK G+C NR ES PL D +KSLVLVN+F S+P++  ACVQNS  LI M+ TCY AA NR
Sbjct  287   GMKAGNCFNRAESAPLNDMSKSLVLVNYFPSIPVKLTACVQNSADLIGMLNTCYNAAANR  346

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F+A D LN
Sbjct  347   WANFVAVDYYK----------------------------------RSEGGGAFQATDMLN  372

Query  308   GGLLCGKDDVHSCVGGSK*GGC  243
             G LLCG DDVH+C  GS  G C
Sbjct  373   GRLLCGCDDVHACAPGSTSGAC  394



>gb|KCW51952.1| hypothetical protein EUGRSUZ_J01396, partial [Eucalyptus grandis]
Length=354

 Score =   502 bits (1293),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 279/368 (76%), Gaps = 36/368 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ++CS   C++LDE    SDC AG++C SC    S  +CVRST TDQFKLLNNSLPFNKYA
Sbjct  21    ASCSNGECRLLDECSSNSDCEAGLYCFSCLGDVSDSRCVRSTVTDQFKLLNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNA +I G   RT VP V   NQED+VTQQLNNGVR LMLD YDF GDVWLCHSF 
Sbjct  81    FLTTHNAHAIDGEPPRTPVPRVTITNQEDTVTQQLNNGVRALMLDTYDFEGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
              +C+DFTAFEPA DTLKEIEAFLS N +EIVT+ILEDYV AP GLTKVFTDAGLMKYWFP
Sbjct  141   DQCYDFTAFEPAIDTLKEIEAFLSANQAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VSNMPKNG DWPLVSDMVA NQRLLVFTS++SKE+SEGIAYQWNYMVENQYGD GMK G 
Sbjct  201   VSNMPKNGQDWPLVSDMVANNQRLLVFTSIRSKEQSEGIAYQWNYMVENQYGDDGMKAGS  260

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL D +KSLVLVN+F SVP+  ++C +NSG LIDM+ TCY AAGNRWANF+A
Sbjct  261   CPNRAESVPLDDRSKSLVLVNYFRSVPVTLLSCKENSGDLIDMLHTCYGAAGNRWANFVA  320

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RSEGGG+F+AVD LNG LLCG
Sbjct  321   VDFYK----------------------------------RSEGGGSFQAVDTLNGKLLCG  346

Query  290   KDDVHSCV  267
              +DVH+CV
Sbjct  347   CNDVHACV  354



>ref|XP_006430940.1| hypothetical protein CICLE_v10013394mg [Citrus clementina]
 gb|ESR44180.1| hypothetical protein CICLE_v10013394mg [Citrus clementina]
Length=364

 Score =   502 bits (1293),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 281/380 (74%), Gaps = 38/380 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
              V +ACS   C+ L E CS   DC AG++C SCP GFSG +C RST T+QFKLLNNSLP 
Sbjct  18    TVNAACSNGQCR-LREPCSSDGDCEAGLYCFSCPQGFSGSRCARSTVTNQFKLLNNSLPL  76

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFL THNAF+     S TGVP VA  NQED+V QQL+NGVRG MLD YDF+GDVWLC
Sbjct  77    NKYAFLATHNAFANENEPSHTGVPRVAATNQEDTVAQQLSNGVRGFMLDTYDFKGDVWLC  136

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKC+D TAFEPA DTLK+IEAF+S NP+EIVT+ILEDYV AP GLTKVF DAGLMK
Sbjct  137   HSFGGKCYDVTAFEPAIDTLKDIEAFMSANPAEIVTLILEDYVQAPNGLTKVFNDAGLMK  196

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YW+PVS MPKNG DWPLVSDMVA NQRLLVFTS KSKE SEGIAYQW+YMVENQYG+GGM
Sbjct  197   YWYPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKETSEGIAYQWSYMVENQYGNGGM  256

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ESPPL D +KSLVLVN+F S P++   CV NSG LI+M+ TC+ AAG+RWA
Sbjct  257   HAGSCPNRAESPPLNDKSKSLVLVNYFESFPIKQTTCVHNSGDLINMLDTCHGAAGSRWA  316

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RSEGGG+F+AVD LNG 
Sbjct  317   NFVAVDYYK----------------------------------RSEGGGSFQAVDTLNGK  342

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             LLCG DD+H+C  GS  G C
Sbjct  343   LLCGCDDLHACAPGSTAGAC  362



>ref|XP_009380136.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Musa 
acuminata subsp. malaccensis]
Length=365

 Score =   501 bits (1291),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 282/376 (75%), Gaps = 38/376 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ACSG  C++L EECS   DC AG++C SCP GFSG +CVRST TDQFK +NNSLPFNKYA
Sbjct  22    ACSGGECKLL-EECSTDSDCQAGLYCFSCPSGFSGSRCVRSTVTDQFKTVNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +LTTHNAF+I G  S TGVP +   NQED+VTQQLNNGVR LMLD YDF  D+WLCHS G
Sbjct  81    YLTTHNAFAIDGEPSHTGVPRITITNQEDTVTQQLNNGVRALMLDTYDFEDDIWLCHSTG  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             GKC+DFTAFEPA DT++EIEAFLS NPSEIVT+ILEDYV  P GL K+F D+GL KYWFP
Sbjct  141   GKCYDFTAFEPAIDTMREIEAFLSANPSEIVTLILEDYVETPNGLPKLFNDSGLTKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS+MP+NG DWPLVSDMVA NQRL+VFTS+KSK+++EGIAYQWNYMVENQYGD GM+ G 
Sbjct  201   VSSMPQNGQDWPLVSDMVASNQRLIVFTSIKSKQDAEGIAYQWNYMVENQYGDDGMEEGK  260

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             C NR ES  L+DTTKSLVLVN+F S+P++   C  NSG LI+M+ TCY AA NRWANF+A
Sbjct  261   CFNRAESASLSDTTKSLVLVNYFSSIPVKQTTCEDNSGRLINMLNTCYGAANNRWANFVA  320

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RS+GGG+F+A D LNG LLCG
Sbjct  321   VDFYK----------------------------------RSDGGGSFQATDMLNGRLLCG  346

Query  290   KDDVHSCVGGSK*GGC  243
              DDVH+CV GS  G C
Sbjct  347   CDDVHACVAGSTPGAC  362



>ref|XP_006373389.1| hypothetical protein POPTR_0017s13330g [Populus trichocarpa]
 gb|ERP51186.1| hypothetical protein POPTR_0017s13330g [Populus trichocarpa]
Length=361

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 242/371 (65%), Positives = 285/371 (77%), Gaps = 38/371 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS   C++LDE CS   DC AG++C SC +GFSG +CVRST T+QFKLLNNSLPFN
Sbjct  20    VATACSNGQCRILDE-CSSNQDCQAGLYCSSCLVGFSGSRCVRSTITNQFKLLNNSLPFN  78

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNA++I G+ S TGVP +   NQED++T+QLNNG R LMLD YDF+GDVWLCH
Sbjct  79    KYAFLTTHNAYAIDGYPSHTGVPRITFTNQEDNITEQLNNGARALMLDTYDFQGDVWLCH  138

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+D+TAF PA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFTDAGLMKY
Sbjct  139   SFKGQCYDYTAFGPAIDTLKEIEAFLSANPTEIVTLILEDYVQAPNGLTKVFTDAGLMKY  198

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MP+NG DWPLVSDMV  NQRLLVFTS++SKE SEGIAYQWNYMVENQYGD GMK
Sbjct  199   WFPVAKMPQNGQDWPLVSDMVQNNQRLLVFTSIQSKEASEGIAYQWNYMVENQYGDDGMK  258

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGESPPL D ++SLVLVN+F S+P++ ++C  NSG LI+++ TC  AA +RWAN
Sbjct  259   AGSCANRGESPPLDDKSRSLVLVNYFRSIPMKELSCEDNSGNLINILHTCDGAAASRWAN  318

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  319   FVAVDYYK----------------------------------RSEGGGSFQAVDLLNGKL  344

Query  299   LCGKDDVHSCV  267
             LCG DD+H+CV
Sbjct  345   LCGCDDIHACV  355



>ref|XP_010936444.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X3 [Elaeis guineensis]
Length=373

 Score =   501 bits (1289),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/383 (66%), Positives = 288/383 (75%), Gaps = 39/383 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V++ACS  NC++LDE CS   DC +G++C SCPLGF G +CVRST +DQFKL+NNSL
Sbjct  23    FLSVSTACSNGNCRLLDE-CSSDGDCESGLYCFSCPLGFLGSRCVRSTISDQFKLVNNSL  81

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYA+LTTHN+++I G  S TGVP V   NQEDSVTQQLNNGVR LMLD YDF  DVW
Sbjct  82    PFNKYAYLTTHNSYAIEGEPSHTGVPRVTFDNQEDSVTQQLNNGVRALMLDTYDFDDDVW  141

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHS GGKC+DFTAFEPA DT+KEIEAFLS NPSEIVT+ILEDYV AP GLTKVF D+GL
Sbjct  142   LCHSNGGKCNDFTAFEPAIDTMKEIEAFLSANPSEIVTLILEDYVKAPNGLTKVFNDSGL  201

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             +KYWFPVS MP+ G DWPLVS+MVA NQRL+VFTSV+SK+ESEGIAYQWN+MVENQYGDG
Sbjct  202   LKYWFPVSRMPQIGQDWPLVSNMVASNQRLIVFTSVESKQESEGIAYQWNFMVENQYGDG  261

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GMK G+C NR ES PL D +KSLVLVN+F S+P++  ACVQNS  LI M+ TCY AA NR
Sbjct  262   GMKAGNCFNRAESAPLNDMSKSLVLVNYFPSIPVKLTACVQNSADLIGMLNTCYNAAANR  321

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F+A D LN
Sbjct  322   WANFVAVDYYK----------------------------------RSEGGGAFQATDMLN  347

Query  308   GGLLCGKDDVHSCVG-GSK*GGC  243
             G LLCG DDVH+C   GS  G C
Sbjct  348   GRLLCGCDDVHACAQPGSTSGAC  370



>ref|XP_006482425.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Citrus sinensis]
Length=398

 Score =   502 bits (1292),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 281/375 (75%), Gaps = 38/375 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             ++ SACS    ++L E+CS   DC AG++C SCP  FSG +CVRST TDQFKLLNNSLP 
Sbjct  53    MLASACSNGQRKLL-EQCSSDGDCEAGLYCFSCPERFSGSRCVRSTITDQFKLLNNSLPL  111

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFLTTHNAF+I    S TGVP +   NQED+VTQQL NGVRGLMLD YDF+GDVWLC
Sbjct  112   NKYAFLTTHNAFAIDHTPSHTGVPRLTFTNQEDNVTQQLKNGVRGLMLDTYDFKGDVWLC  171

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKCHD+TAFEPA DTLKEIEAF+S+ P+EIVT+ILEDYV AP GLTKVF +AGLMK
Sbjct  172   HSFGGKCHDYTAFEPAIDTLKEIEAFMSSKPAEIVTLILEDYVQAPNGLTKVFAEAGLMK  231

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MP+NG DWPLVSDMVA NQRLLVFTS KSK+ESEGIAYQW+YMVEN+YG+ GM
Sbjct  232   YWFPVSKMPRNGEDWPLVSDMVANNQRLLVFTSNKSKQESEGIAYQWSYMVENKYGNRGM  291

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G C NR ES PL D  KSLVLVN+F S+P++  ACV NSG LIDM+ TCY AAGNRWA
Sbjct  292   HAGSCSNRAESSPLNDERKSLVLVNYFKSLPIKRTACVHNSGHLIDMLHTCYAAAGNRWA  351

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RSEG G+F+AVD LNG 
Sbjct  352   NFVAVDYYK----------------------------------RSEGRGSFQAVDTLNGR  377

Query  302   LLCGKDDVHSCVGGS  258
             LLCG DDVH+C   S
Sbjct  378   LLCGCDDVHACAVSS  392



>ref|XP_006482420.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482421.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Citrus sinensis]
Length=364

 Score =   500 bits (1288),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 281/380 (74%), Gaps = 38/380 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
              V +ACS   C++L E CS   DC AG++C SCP GFSG +C RST T+QFKLLNNSLP 
Sbjct  18    TVNAACSNGQCRLL-EPCSSDGDCEAGLYCFSCPQGFSGSRCARSTVTNQFKLLNNSLPL  76

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFL THNAF+     S TGVP VA  NQED+V QQL+NGVRG MLD YDF+GDVWLC
Sbjct  77    NKYAFLATHNAFANENEPSHTGVPRVAATNQEDTVAQQLSNGVRGFMLDTYDFKGDVWLC  136

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HS GGKC+D TAFEPA DTLK+IEAF+S NP+EIVT+ILEDYV AP GLTKVF DAGLMK
Sbjct  137   HSSGGKCYDVTAFEPAIDTLKDIEAFMSANPAEIVTLILEDYVQAPNGLTKVFNDAGLMK  196

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YW+PVS MPKNG DWPLVSDMVA NQRLLVFTS KSKE SEGIAYQW+YMVENQYG+GGM
Sbjct  197   YWYPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKETSEGIAYQWSYMVENQYGNGGM  256

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ESPPL D +KSLVLVN+F S P++   CV NSG LI+M+ TC+ AAG+RWA
Sbjct  257   HAGSCPNRAESPPLNDKSKSLVLVNYFESFPIKQTTCVHNSGDLINMLDTCHGAAGSRWA  316

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RSEGGG+F+AVD LNG 
Sbjct  317   NFVAVDYYK----------------------------------RSEGGGSFQAVDTLNGK  342

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             LLCG DD+H+C  GS  G C
Sbjct  343   LLCGCDDLHACAPGSTAGAC  362



>ref|XP_008341801.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Malus domestica]
 ref|XP_008362219.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Malus domestica]
Length=365

 Score =   500 bits (1287),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 280/380 (74%), Gaps = 38/380 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V  ACS   C++LDE CS   DC AG++C  CP GFSG +C+RS  TDQFKLLNNSLPFN
Sbjct  20    VAKACSNGQCKLLDE-CSMDADCEAGLYCGCCPQGFSGSRCIRSAITDQFKLLNNSLPFN  78

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TG+P V   NQED+VTQQLNNGVR LMLD YDF+ DVWLCH
Sbjct  79    KYAFLTTHNAFAIEGEPSHTGIPRVTFNNQEDTVTQQLNNGVRALMLDTYDFKDDVWLCH  138

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHDFTAFEPA DTLKE+EAFLS NPSEIVT+ILEDYV AP GLT VF  +GL  Y
Sbjct  139   SFNGQCHDFTAFEPAIDTLKEVEAFLSANPSEIVTLILEDYVEAPNGLTNVFNASGLKNY  198

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV++MPKNG DWPLVSDMVA NQRLLVFTS   KE+SEGIAYQWNYMVENQYGD GMK
Sbjct  199   WFPVTSMPKNGQDWPLVSDMVANNQRLLVFTSKSEKEQSEGIAYQWNYMVENQYGDDGMK  258

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGES PL D TKSLVLVN+F S+P +  +C  NSG LI+M+ TC+ AA NRWAN
Sbjct  259   EGSCSNRGESSPLDDKTKSLVLVNYFASIPFKLESCENNSGNLINMLYTCHGAAANRWAN  318

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RSEGGG+F+A+D LNG L
Sbjct  319   FVAVDFYK----------------------------------RSEGGGSFQALDNLNGEL  344

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG +DVH+CV GS  G C+
Sbjct  345   LCGCNDVHACVPGSPPGSCQ  364



>ref|XP_009373787.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Pyrus 
x bretschneideri]
Length=372

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 282/380 (74%), Gaps = 38/380 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V  ACS   C++LDE CS   DC AG++C  CP GFSG +C+RS  TDQFKLLNNSLPFN
Sbjct  27    VAKACSNGQCKLLDE-CSMDADCEAGLYCGCCPQGFSGSRCIRSAITDQFKLLNNSLPFN  85

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I G  S TG+P V   NQED+VTQQLNNGVR LMLD YDF+ DVWLCH
Sbjct  86    KYAFLTTHNAFAIEGEQSHTGIPRVTFNNQEDTVTQQLNNGVRALMLDTYDFKDDVWLCH  145

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+DFTAFEPA DTLKE+EAFLS NPSEIVT+ILEDYV AP GLT VF  +GL  Y
Sbjct  146   SFNGQCYDFTAFEPAIDTLKEVEAFLSANPSEIVTLILEDYVEAPNGLTNVFNASGLKNY  205

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV++MPKNG DWPLVSDMVA NQRLLVFTS  +KE+SEGIAYQWNYMVENQYGD GMK
Sbjct  206   WFPVTSMPKNGQDWPLVSDMVANNQRLLVFTSKSAKEQSEGIAYQWNYMVENQYGDDGMK  265

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGES PL D TKSLVLVN+F S+PL+  +C  NSG LI+M+ TC+ AA NRWAN
Sbjct  266   EGSCSNRGESSPLDDKTKSLVLVNYFASIPLKLESCENNSGDLINMLYTCHGAAANRWAN  325

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RSEGGG+F+A+D LNG L
Sbjct  326   FVAVDFYK----------------------------------RSEGGGSFQALDNLNGEL  351

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG +DVH+CV GS  G C+
Sbjct  352   LCGCNDVHACVPGSPQGSCQ  371



>ref|XP_011099035.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Sesamum indicum]
Length=361

 Score =   499 bits (1286),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/374 (67%), Positives = 279/374 (75%), Gaps = 43/374 (11%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS   C+V D  CS   DCGAG+ C SC   F G +CVRSTAT+QF ++NNSLPFN
Sbjct  23    VGAACSSGGCKVGDG-CSSGGDCGAGLFCSSCDAAFEGSRCVRSTATNQFNIVNNSLPFN  81

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNAF+I       GVP +   NQED+VTQQLNNGVR LMLD YDF GD+WLCH
Sbjct  82    KYAFLTTHNAFAID-----DGVPRLTFTNQEDNVTQQLNNGVRALMLDTYDFEGDIWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGGKCHD+T FEPA DTL+EIEAFLS NPSEIVT+ILEDYV+   GLTKVFT+AGLMKY
Sbjct  137   SFGGKCHDYTKFEPAIDTLREIEAFLSGNPSEIVTVILEDYVHTQNGLTKVFTEAGLMKY  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFP+S MPKNG DWPLVS+MVA NQRLLVFTS+KSKE SEGIAYQWNYMVENQYGD GMK
Sbjct  197   WFPLSKMPKNGQDWPLVSEMVANNQRLLVFTSIKSKESSEGIAYQWNYMVENQYGDDGMK  256

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G+C NRGES  L D +KSLVLVN+F SVP++ +ACVQNSG L+DM+ TCY AAGNRWAN
Sbjct  257   AGECSNRGESSALNDKSKSLVLVNYFRSVPVKALACVQNSGDLLDMLQTCYGAAGNRWAN  316

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RSEGGGTFEA D LNG L
Sbjct  317   FVAVDFYK----------------------------------RSEGGGTFEATDMLNGEL  342

Query  299   LCGKDDVHSCVGGS  258
             LCG  DVHSC  GS
Sbjct  343   LCGCKDVHSCAAGS  356



>emb|CDP19975.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   499 bits (1284),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 249/373 (67%), Positives = 279/373 (75%), Gaps = 47/373 (13%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             V  +ACS   C++LDE CS   DCGAG++C SC    +  +CVRSTATDQFKL+NNSLPF
Sbjct  20    VANAACSNGTCKILDE-CSSDADCGAGLYCFSC---LAKSRCVRSTATDQFKLVNNSLPF  75

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY FLTTHN+F+I G  S TGVP +   NQED      NNGVR LMLD YDF GDVWLC
Sbjct  76    NKYVFLTTHNSFAIEGEPSHTGVPRITFNNQED------NNGVRALMLDTYDFEGDVWLC  129

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+CHD+TAFEPA DTL+EIEAFLS NPSEIVT+ILEDYV AP GLTKVFTDAGLMK
Sbjct  130   HSFKGQCHDYTAFEPATDTLREIEAFLSANPSEIVTVILEDYVQAPSGLTKVFTDAGLMK  189

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YW PVS MP+NG DWPLVSDMVA NQRLLVFTSV+SKE+SEGIAYQWNYMVENQYGD GM
Sbjct  190   YWLPVSKMPQNGADWPLVSDMVANNQRLLVFTSVRSKEQSEGIAYQWNYMVENQYGDDGM  249

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K GDC NR ES PL DTTKSLVLVN+F SVP++P+ACVQNSG LIDM+ TC+ A+ NRWA
Sbjct  250   KAGDCFNRAESSPLNDTTKSLVLVNYFRSVPVKPLACVQNSGNLIDMLQTCHAASANRWA  309

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RS GGGTF+AVD  NG 
Sbjct  310   NFVAVDYYK----------------------------------RSMGGGTFQAVDTCNGE  335

Query  302   LLCGKDDVHSCVG  264
             LLCG ++VHSCV 
Sbjct  336   LLCGCNNVHSCVA  348



>ref|XP_010936441.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X1 [Elaeis guineensis]
Length=398

 Score =   500 bits (1288),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 252/383 (66%), Positives = 288/383 (75%), Gaps = 39/383 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F  V++ACS  NC++LDE CS   DC +G++C SCPLGF G +CVRST +DQFKL+NNSL
Sbjct  48    FLSVSTACSNGNCRLLDE-CSSDGDCESGLYCFSCPLGFLGSRCVRSTISDQFKLVNNSL  106

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYA+LTTHN+++I G  S TGVP V   NQEDSVTQQLNNGVR LMLD YDF  DVW
Sbjct  107   PFNKYAYLTTHNSYAIEGEPSHTGVPRVTFDNQEDSVTQQLNNGVRALMLDTYDFDDDVW  166

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHS GGKC+DFTAFEPA DT+KEIEAFLS NPSEIVT+ILEDYV AP GLTKVF D+GL
Sbjct  167   LCHSNGGKCNDFTAFEPAIDTMKEIEAFLSANPSEIVTLILEDYVKAPNGLTKVFNDSGL  226

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             +KYWFPVS MP+ G DWPLVS+MVA NQRL+VFTSV+SK+ESEGIAYQWN+MVENQYGDG
Sbjct  227   LKYWFPVSRMPQIGQDWPLVSNMVASNQRLIVFTSVESKQESEGIAYQWNFMVENQYGDG  286

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GMK G+C NR ES PL D +KSLVLVN+F S+P++  ACVQNS  LI M+ TCY AA NR
Sbjct  287   GMKAGNCFNRAESAPLNDMSKSLVLVNYFPSIPVKLTACVQNSADLIGMLNTCYNAAANR  346

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RSEGGG F+A D LN
Sbjct  347   WANFVAVDYYK----------------------------------RSEGGGAFQATDMLN  372

Query  308   GGLLCGKDDVHSCVG-GSK*GGC  243
             G LLCG DDVH+C   GS  G C
Sbjct  373   GRLLCGCDDVHACAQPGSTSGAC  395



>ref|XP_006430942.1| hypothetical protein CICLE_v10012018mg [Citrus clementina]
 gb|ESR44182.1| hypothetical protein CICLE_v10012018mg [Citrus clementina]
Length=366

 Score =   498 bits (1281),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 247/375 (66%), Positives = 279/375 (74%), Gaps = 38/375 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             ++ SACS    ++L E+CS   DC AG++C SCP  FSG +CVRST TDQFKLLNNSLP 
Sbjct  19    MLASACSNGQRKLL-EQCSSDGDCEAGLYCFSCPERFSGSRCVRSTITDQFKLLNNSLPL  77

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFLTTHNAF+I    S TGVP +   NQED+VTQQL NGVRG MLD YDF+GDVWLC
Sbjct  78    NKYAFLTTHNAFAIDHTPSHTGVPRLTFTNQEDNVTQQLKNGVRGFMLDTYDFKGDVWLC  137

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKCHD+TAFEPA DTLKEIEAF+S  P+EIVT+ILEDYV AP GLTKVF +AGLMK
Sbjct  138   HSFGGKCHDYTAFEPAIDTLKEIEAFMSAKPAEIVTLILEDYVQAPNGLTKVFAEAGLMK  197

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MPKNG DWPLVSDMVA NQRLLVFTS KSK+ESEGIAYQW+YMVEN+YG+ GM
Sbjct  198   YWFPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKQESEGIAYQWSYMVENKYGNRGM  257

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G C NR ES PL D  KSLVLVN+F S+P++  ACV NSG LI+M+ TCY AAGNRWA
Sbjct  258   HAGSCSNRAESSPLNDERKSLVLVNYFKSLPIKRTACVHNSGHLINMLHTCYAAAGNRWA  317

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RSEG G+F+AVD LNG 
Sbjct  318   NFVAVDYYK----------------------------------RSEGRGSFQAVDTLNGR  343

Query  302   LLCGKDDVHSCVGGS  258
             LLCG DDVH+C   S
Sbjct  344   LLCGCDDVHACAVSS  358



>gb|KDO72281.1| hypothetical protein CISIN_1g045922mg, partial [Citrus sinensis]
Length=354

 Score =   497 bits (1279),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/372 (66%), Positives = 278/372 (75%), Gaps = 38/372 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
              V +ACS   C++L E CS   DC AG++C SCP GFSG +C RST T+QFKLLNNSLP 
Sbjct  18    TVNAACSNGQCRLL-EPCSSDGDCEAGLYCFSCPQGFSGSRCARSTVTNQFKLLNNSLPL  76

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFL THNAF+     S TGVP VA  NQED+V QQL+NGVRG MLD YDF+GDVWLC
Sbjct  77    NKYAFLATHNAFANENEPSHTGVPRVAATNQEDTVAQQLSNGVRGFMLDTYDFKGDVWLC  136

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKC+D TAFEPA DTLK+IEAF+S NP+EIVT+ILEDYV AP GLTKVF DAGLMK
Sbjct  137   HSFGGKCYDVTAFEPAIDTLKDIEAFMSANPAEIVTLILEDYVQAPNGLTKVFNDAGLMK  196

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YW+PVS MPKNG DWPLVSDMVA NQRLLVFTS KSKE SEGIAYQW+YMVENQYG+GGM
Sbjct  197   YWYPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKETSEGIAYQWSYMVENQYGNGGM  256

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ESPPL D +KSLVLVN+F S P++   CV NSG LI+M+ TC+ AAG+RWA
Sbjct  257   HAGSCPNRAESPPLNDKSKSLVLVNYFESFPIKQTTCVHNSGDLINMLDTCHGAAGSRWA  316

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVD+YK                                  RSEGGG+F+AVD LNG 
Sbjct  317   NFVAVDYYK----------------------------------RSEGGGSFQAVDTLNGK  342

Query  302   LLCGKDDVHSCV  267
             LLCG DD+H+C 
Sbjct  343   LLCGCDDLHACA  354



>ref|XP_011021066.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Populus euphratica]
Length=365

 Score =   497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 242/379 (64%), Positives = 284/379 (75%), Gaps = 38/379 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS   C++LDE CS   DC AG++C SC +GFSG +CVRST T+QFKLLNNSL FN
Sbjct  20    VATACSNGQCRILDE-CSSDQDCEAGLYCSSCLVGFSGSRCVRSTITNQFKLLNNSLSFN  78

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHNA++I G+ S TGVP +   NQEDS+T+QLNNG R LMLD YDF+GDVWLCH
Sbjct  79    KYAFLTTHNAYAIDGYPSHTGVPRITFTNQEDSITEQLNNGARALMLDTYDFQGDVWLCH  138

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C+D+TAF PA DTLKEIEAFLS NP+EIV +ILED+V A  GLTKVFTDAGLMKY
Sbjct  139   SFKGQCYDYTAFGPAIDTLKEIEAFLSANPTEIVMLILEDHVQALNGLTKVFTDAGLMKY  198

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MPKNG DWPLVSDMV  NQRLLVF+S++SKE  EGIAYQWNYMVENQYGD GMK
Sbjct  199   WFPVAKMPKNGQDWPLVSDMVQNNQRLLVFSSIQSKEAGEGIAYQWNYMVENQYGDDGMK  258

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NR ESPPL D ++SLVLVN+F S+P++ ++C  NSG LI+M+ TCY  A +RWAN
Sbjct  259   AGSCANREESPPLDDKSRSLVLVNYFRSIPMKELSCEDNSGNLINMLHTCYGVAASRWAN  318

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  319   FIAVDYYK----------------------------------RSEGGGSFQAVDLLNGKL  344

Query  299   LCGKDDVHSCVGGSK*GGC  243
             LCG DD+H+CV GS  G C
Sbjct  345   LCGCDDIHACVPGSTSGAC  363



>ref|XP_002531004.1| phospholipase C, putative [Ricinus communis]
 gb|EEF31392.1| phospholipase C, putative [Ricinus communis]
Length=368

 Score =   492 bits (1267),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 279/377 (74%), Gaps = 38/377 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             SACS   C +LD+ CS   DC  G+ C  C  GFS  KCVRSTATDQF++LNNSLPFNKY
Sbjct  20    SACSDGPCGLLDK-CSSDQDCEDGLFCFYCIEGFSASKCVRSTATDQFRILNNSLPFNKY  78

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             AFLTTHNAF+I G+ SRTG+P +   NQED+VTQQLNNGVR LMLD YDFRGDVWLCHSF
Sbjct  79    AFLTTHNAFAIAGYPSRTGIPRLTVTNQEDNVTQQLNNGVRALMLDTYDFRGDVWLCHSF  138

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+CHD+TAF PA DTLKEIE FLS NPSEIVT+ILEDYV APKGLT+VF D+GLMKYW 
Sbjct  139   KGQCHDYTAFGPAIDTLKEIEEFLSANPSEIVTLILEDYVQAPKGLTRVFYDSGLMKYWV  198

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PV+ M K+G DWPLVSDMV  N RLLVFTS+KSKE+SEGIAYQWNYMVENQYGDGGM  G
Sbjct  199   PVTMMAKHGQDWPLVSDMVKNNHRLLVFTSIKSKEKSEGIAYQWNYMVENQYGDGGMHPG  258

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              C NR ES  L+D +KSLVLVN+F S+P++ + C+ NS  ++DM+ TCY AAGNRWANF+
Sbjct  259   SCSNRPESSALSDKSKSLVLVNYFRSIPMKELTCIDNSAKVLDMLQTCYAAAGNRWANFV  318

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV++YK                                  RSEGGG+F+AVD LNG LLC
Sbjct  319   AVNYYK----------------------------------RSEGGGSFQAVDSLNGKLLC  344

Query  293   GKDDVHSCVGGSK*GGC  243
             G DD+ +C+ GS    C
Sbjct  345   GCDDIRACLPGSSSAAC  361



>gb|EYU44228.1| hypothetical protein MIMGU_mgv1a008818mg [Erythranthe guttata]
Length=361

 Score =   491 bits (1265),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 277/377 (73%), Gaps = 46/377 (12%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAF  1188
             CS   C  + ++CS   DCG+GM+C +C   F G KCVRSTAT+QF ++NNSLPFNKYAF
Sbjct  24    CSNGACNQVGDDCSSDADCGSGMYCFTCRPEFDGSKCVRSTATNQFTIVNNSLPFNKYAF  83

Query  1187  LTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGG  1008
             LTTHNAF+I       GVP +   NQEDS+TQQLNNGVR LMLD YDF  D+WLCHSFGG
Sbjct  84    LTTHNAFAI-----EDGVPRLTFTNQEDSITQQLNNGVRALMLDTYDFEQDIWLCHSFGG  138

Query  1007  KCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPV  828
             +CHD+T FEPA + LKEIEAFLS NPSEIVT+ILEDYV    GLT VFT AGLMKYWFP+
Sbjct  139   QCHDYTKFEPAINALKEIEAFLSKNPSEIVTLILEDYVKTTNGLTNVFTKAGLMKYWFPL  198

Query  827   SNMPK-NGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             S MPK NG DWPLVSDMVA NQRLLVFTSVKSKE SEGIAYQWNYMVENQYGD GMK GD
Sbjct  199   SKMPKTNGQDWPLVSDMVANNQRLLVFTSVKSKESSEGIAYQWNYMVENQYGDDGMKAGD  258

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             C NRGES  L DTTKSLVLVN+FG++P++P+ACVQNSG L DM+ TCY AAGNRWANF+A
Sbjct  259   CINRGESSVLNDTTKSLVLVNYFGTIPIKPIACVQNSGGLSDMLRTCYGAAGNRWANFVA  318

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RSEGGGTFEA D LNG LLCG
Sbjct  319   VDFYK----------------------------------RSEGGGTFEATDMLNGELLCG  344

Query  290   KDDVHSCVGGSK*GGCR  240
              +DVHSC  GS    CR
Sbjct  345   CNDVHSCTPGSN---CR  358



>ref|XP_004304210.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Fragaria vesca subsp. vesca]
Length=368

 Score =   491 bits (1264),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 244/377 (65%), Positives = 278/377 (74%), Gaps = 38/377 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F+ +  ACS   C++LD  CS   DC AG++C  C L +SG KCVRST T+QF+LLNNSL
Sbjct  21    FSCIVMACSDGQCKLLDP-CSVDGDCEAGLYCFGCALEYSGSKCVRSTTTNQFQLLNNSL  79

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNA++I G  S TG+P V   NQED+VTQQLNNGVR LMLD YDF   VW
Sbjct  80    PFNKYAFLTTHNAYAIDGEPSHTGIPRVTFTNQEDTVTQQLNNGVRALMLDTYDFDDGVW  139

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSF GKCHD+TAFEPA DTL EI+AFLS NP EIVT+ILEDYV AP GLT VF  AGL
Sbjct  140   LCHSFKGKCHDYTAFEPALDTLNEIQAFLSANPGEIVTLILEDYVEAPNGLTNVFKAAGL  199

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFPVSNMPK+G DWPLVSDMVAKNQRLLVFTS + KE+SEGIAYQWNYMVENQYG+ 
Sbjct  200   MKYWFPVSNMPKSGQDWPLVSDMVAKNQRLLVFTSKQEKEQSEGIAYQWNYMVENQYGND  259

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GMK G C NRGES PL D TKSLVLVN+FG+VP++ ++C  NS  L+ M+ TCY AAGNR
Sbjct  260   GMKAGSCSNRGESSPLNDKTKSLVLVNYFGTVPIKQLSCKFNSEDLVSMLNTCYTAAGNR  319

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVDFYK                                  RS GGG+F+A D LN
Sbjct  320   WANFVAVDFYK----------------------------------RSAGGGSFQATDTLN  345

Query  308   GGLLCGKDDVHSCVGGS  258
             G L+CG +DVH+CV GS
Sbjct  346   GELICGCNDVHACVPGS  362



>ref|XP_011008607.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Populus euphratica]
Length=393

 Score =   492 bits (1267),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 239/371 (64%), Positives = 277/371 (75%), Gaps = 38/371 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V ++CS   C+ L +ECS   DC AG++CL+CPLGF G +CVRST TDQFKLLNNSLPFN
Sbjct  29    VAASCSKGECR-LHDECSSNQDCEAGLYCLACPLGFQGTRCVRSTITDQFKLLNNSLPFN  87

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFL THNA++I G+ S T VP +   NQED+V  QLNNG R LMLD YDFRGDVWLCH
Sbjct  88    KYAFLATHNAYAIDGYPSHTRVPRITFTNQEDNVMDQLNNGARALMLDTYDFRGDVWLCH  147

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD+TAF PA DTL+EIEAFLST+PSEIVTIILEDYV AP GLTKVFTDAGLMKY
Sbjct  148   SFKGQCHDYTAFGPAIDTLREIEAFLSTHPSEIVTIILEDYVQAPNGLTKVFTDAGLMKY  207

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+NMPKNG DWPLV+DMV  NQRLLVFTS++SKE SEGIAYQWN+MVENQYG+ GMK
Sbjct  208   WFPVTNMPKNGQDWPLVNDMVQNNQRLLVFTSIQSKEASEGIAYQWNFMVENQYGNVGMK  267

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NR ES  L D ++SLVLVN+F  +P++ ++C  NS  LI M+ TC  AA NRWAN
Sbjct  268   AGSCTNRKESSSLNDKSRSLVLVNYFRCIPMKKLSCEDNSRNLIKMLHTCSGAAANRWAN  327

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  328   FVAVDYYK----------------------------------RSEGGGSFQAVDLLNGKL  353

Query  299   LCGKDDVHSCV  267
             LCG DD+H+CV
Sbjct  354   LCGCDDIHACV  364



>ref|XP_002305392.1| hypothetical protein POPTR_0004s11650g [Populus trichocarpa]
 gb|EEE85903.1| hypothetical protein POPTR_0004s11650g [Populus trichocarpa]
Length=362

 Score =   491 bits (1264),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 240/367 (65%), Positives = 276/367 (75%), Gaps = 38/367 (10%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAF  1188
             CS   C+ L +ECS   DC AG++CL+CPLGF G +CVRST TDQFKLLNNSLPFNKYAF
Sbjct  25    CSNGECR-LHDECSSNQDCEAGLYCLACPLGFPGTRCVRSTITDQFKLLNNSLPFNKYAF  83

Query  1187  LTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGG  1008
             L THNA++I G+ S T VP +   NQEDSV  QLNNG R LMLD YDFRGDVWLCHSF G
Sbjct  84    LATHNAYAIDGYPSHTRVPRITFTNQEDSVMDQLNNGARALMLDTYDFRGDVWLCHSFKG  143

Query  1007  KCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPV  828
             +CHD+TAF PA DTL+EIEAFLS +P+EIVTIILEDYV AP GLTKVFTDAGLMKYWFPV
Sbjct  144   QCHDYTAFGPAIDTLREIEAFLSAHPAEIVTIILEDYVRAPNGLTKVFTDAGLMKYWFPV  203

Query  827   SNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDC  648
             +NMPKNG DWPLV+DMV  NQRLLVFTS++SKE SEGIAYQWNYMVENQYG+ GMK G C
Sbjct  204   TNMPKNGQDWPLVNDMVQNNQRLLVFTSIQSKEASEGIAYQWNYMVENQYGNIGMKAGSC  263

Query  647   PNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAV  468
              NR ESPPL D ++SLVLVN+F  +P++ ++C  NS  LI+M+ TC  AA NRWANF+AV
Sbjct  264   TNRKESPPLNDKSRSLVLVNYFRCIPMKKLSCEDNSRNLINMLHTCNGAAANRWANFVAV  323

Query  467   DFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGK  288
             D+YK                                  RSEGGG+F+AVD LNG LLCG 
Sbjct  324   DYYK----------------------------------RSEGGGSFQAVDLLNGKLLCGC  349

Query  287   DDVHSCV  267
             DD+H+CV
Sbjct  350   DDIHACV  356



>ref|XP_011008606.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Populus euphratica]
Length=398

 Score =   491 bits (1264),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 239/371 (64%), Positives = 277/371 (75%), Gaps = 38/371 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V ++CS   C+ L +ECS   DC AG++CL+CPLGF G +CVRST TDQFKLLNNSLPFN
Sbjct  29    VAASCSKGECR-LHDECSSNQDCEAGLYCLACPLGFQGTRCVRSTITDQFKLLNNSLPFN  87

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFL THNA++I G+ S T VP +   NQED+V  QLNNG R LMLD YDFRGDVWLCH
Sbjct  88    KYAFLATHNAYAIDGYPSHTRVPRITFTNQEDNVMDQLNNGARALMLDTYDFRGDVWLCH  147

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD+TAF PA DTL+EIEAFLST+PSEIVTIILEDYV AP GLTKVFTDAGLMKY
Sbjct  148   SFKGQCHDYTAFGPAIDTLREIEAFLSTHPSEIVTIILEDYVQAPNGLTKVFTDAGLMKY  207

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+NMPKNG DWPLV+DMV  NQRLLVFTS++SKE SEGIAYQWN+MVENQYG+ GMK
Sbjct  208   WFPVTNMPKNGQDWPLVNDMVQNNQRLLVFTSIQSKEASEGIAYQWNFMVENQYGNVGMK  267

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NR ES  L D ++SLVLVN+F  +P++ ++C  NS  LI M+ TC  AA NRWAN
Sbjct  268   AGSCTNRKESSSLNDKSRSLVLVNYFRCIPMKKLSCEDNSRNLIKMLHTCSGAAANRWAN  327

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  328   FVAVDYYK----------------------------------RSEGGGSFQAVDLLNGKL  353

Query  299   LCGKDDVHSCV  267
             LCG DD+H+CV
Sbjct  354   LCGCDDIHACV  364



>ref|XP_010694075.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Beta vulgaris subsp. vulgaris]
Length=359

 Score =   486 bits (1250),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 273/368 (74%), Gaps = 34/368 (9%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             +++ ACS   C+   + C  C  G +C  C  GF GPKCVRSTATDQFKL+NNSLPFNKY
Sbjct  20    LLSHACSNGVCKEEIDLCGKCEEGFYCFGCLAGFIGPKCVRSTATDQFKLVNNSLPFNKY  79

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             +FLTTHNAF+I G  S T VP V   NQE+++TQQL +GVR LMLD YDF GDVWLCHSF
Sbjct  80    SFLTTHNAFAIEGEHSHTKVPRVTFSNQENNITQQLQDGVRALMLDTYDFNGDVWLCHSF  139

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
             GGKC+D+TAFEPA +TL+EIEAFLS+ P+EIVT+ILEDYV A KGLTKVFT AGLMKYWF
Sbjct  140   GGKCNDYTAFEPAINTLREIEAFLSSKPTEIVTLILEDYVKAYKGLTKVFTKAGLMKYWF  199

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             P+S MP+ G DWP VSDM+AKNQRLLVFTS++SK+ SEGIAYQWNYMVENQYGD GMK G
Sbjct  200   PISKMPRQGQDWPSVSDMIAKNQRLLVFTSMRSKQNSEGIAYQWNYMVENQYGDEGMKAG  259

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              C NRGES  L D TKSLVLVN+F SVPL+ ++CV NS  L+ M+ TC  AAG+RWANF+
Sbjct  260   SCTNRGESSSLNDETKSLVLVNYFRSVPLKELSCVDNSANLMKMLRTCNDAAGHRWANFV  319

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AVD+YK                                  RSEGGG FEAVD LNG LLC
Sbjct  320   AVDYYK----------------------------------RSEGGGAFEAVDMLNGELLC  345

Query  293   GKDDVHSC  270
             G+DDVH+C
Sbjct  346   GRDDVHAC  353



>ref|XP_004491886.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cicer arietinum]
Length=347

 Score =   484 bits (1245),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/364 (66%), Positives = 273/364 (75%), Gaps = 38/364 (10%)
 Frame = -3

Query  1340  QVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNA  1170
             Q+LDE C+   DCGAG++C SC  GFSG +CVRS+ TDQFKLLNNSLPFNKYAFLTTHN+
Sbjct  11    QLLDE-CNADEDCGAGLYCSSCAFGFSGSRCVRSSITDQFKLLNNSLPFNKYAFLTTHNS  69

Query  1169  FSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFT  990
             FSI G  S TGVP +   +Q+D++TQQLNNGVR LMLD YDF GDVWLCHSF G C+ FT
Sbjct  70    FSIEGEPSHTGVPRITQIDQQDNITQQLNNGVRALMLDTYDFDGDVWLCHSFKGNCYAFT  129

Query  989   AFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKN  810
             AFEPA DTLKE+EAFL+ NP+EIVTI LEDYV  PK LT VFT A LMKYWFP+++MPKN
Sbjct  130   AFEPAVDTLKEVEAFLTANPTEIVTIFLEDYVKTPKALTNVFTKADLMKYWFPLASMPKN  189

Query  809   GGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGES  630
             G DWPLVSDMVAKN RLLVFTS ++KE+SEGIAYQWNYMVENQYGD GMK G+C NR ES
Sbjct  190   GEDWPLVSDMVAKNHRLLVFTSKRAKEQSEGIAYQWNYMVENQYGDDGMKEGNCSNRAES  249

Query  629   PPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVV  450
               L D TKSLVLVN+F S P + ++C  N+G LI+M+ TCY AAGNRWANF+AVDFYK  
Sbjct  250   DTLNDKTKSLVLVNYFRSNPFKQLSCKDNAGGLINMLHTCYGAAGNRWANFVAVDFYK--  307

Query  449   KSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                             +S+GGG F+AVD LNG LLCG DDVHSC
Sbjct  308   --------------------------------KSQGGGAFQAVDTLNGKLLCGCDDVHSC  335

Query  269   VGGS  258
             V GS
Sbjct  336   VPGS  339



>gb|KDP24290.1| hypothetical protein JCGZ_25586 [Jatropha curcas]
Length=370

 Score =   484 bits (1246),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 279/371 (75%), Gaps = 38/371 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             AC  E C++LD+ CS   DC  G++C  C   FS  KCVRS+AT QFKLLNNSLPFNKYA
Sbjct  22    ACPSEPCKLLDK-CSSDQDCKDGLYCFFCIEDFSSSKCVRSSATSQFKLLNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNAF+I G+   TG+P +   NQED+VTQQLNNGVR LMLD YDFRGDVWLCHSF 
Sbjct  81    FLTTHNAFAIDGYPIHTGLPRLTVTNQEDTVTQQLNNGVRALMLDTYDFRGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G C+D+TAF PA DTLKEIEAFLS NPSEIVTIILEDYV A  GLTKVFTDAGLMKYWFP
Sbjct  141   GHCYDYTAFGPAIDTLKEIEAFLSANPSEIVTIILEDYVQASNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             V+ MPKNG DWPLVSDMV  NQRLLVFTS+KSKEESEGIAYQWNYMVENQYGDGGM  G 
Sbjct  201   VTKMPKNGKDWPLVSDMVKNNQRLLVFTSIKSKEESEGIAYQWNYMVENQYGDGGMHVGS  260

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES  L+D +KSLVLVN+F ++P++ + C+ NSG LI+M+ TCY  AGNRWANF+A
Sbjct  261   CPNRAESSSLSDKSKSLVLVNYFRTIPMKELTCIDNSGGLINMLHTCYGPAGNRWANFVA  320

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V++YK                                  RSEGGG+F+AVD LNG LLCG
Sbjct  321   VNYYK----------------------------------RSEGGGSFQAVDTLNGKLLCG  346

Query  290   KDDVHSCVGGS  258
              DD+H+CV GS
Sbjct  347   CDDIHACVLGS  357



>ref|XP_008379446.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Malus domestica]
Length=378

 Score =   479 bits (1233),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 245/381 (64%), Positives = 279/381 (73%), Gaps = 39/381 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             V  +  S   C++LDE CS   DC AG+ C SCP GFSG +C+RS  TDQFKLLNNSLP 
Sbjct  33    VFAAVLSIGQCKLLDE-CSTDADCEAGLLCGSCPQGFSGTRCIRSAITDQFKLLNNSLPX  91

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYAFLTTHNAF+I G  S TG+P V   NQE++VTQQL+ GVR LMLD YDF+ DVWLC
Sbjct  92    NKYAFLTTHNAFAIDGEPSHTGIPRVTFNNQEETVTQQLSGGVRALMLDTYDFKDDVWLC  151

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+CHDFTAF PA DTLKE+EAFLS NPSEIVT+ILEDYV AP GLTKVF  +GL K
Sbjct  152   HSFKGECHDFTAFGPAIDTLKEVEAFLSANPSEIVTLILEDYVEAPNGLTKVFDASGLKK  211

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPV++MPK G DWPLVSDMVAKNQRLLVFT  K+KE+SEGIAYQWNYMVENQYGD GM
Sbjct  212   YWFPVTSMPKTGQDWPLVSDMVAKNQRLLVFTXKKAKEQSEGIAYQWNYMVENQYGDDGM  271

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G C NRGES  L D TKSLVLVN+F SVP++  +CV NSG LI+M+ TC+ AAGNRWA
Sbjct  272   KDG-CSNRGESSXLDDKTKSLVLVNYFASVPIKKGSCVDNSGNLINMLYTCHGAAGNRWA  330

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG+F A+D LNG 
Sbjct  331   NFVAVDFYK----------------------------------RSDGGGSFRALDNLNGE  356

Query  302   LLCGKDDVHSCVGGSK*GGCR  240
             L CG +DVH+CV GS  G C+
Sbjct  357   LXCGCNDVHACVPGSPPGSCK  377



>ref|XP_002512058.1| phospholipase C, putative [Ricinus communis]
 gb|EEF50727.1| phospholipase C, putative [Ricinus communis]
Length=365

 Score =   477 bits (1227),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 277/379 (73%), Gaps = 41/379 (11%)
 Frame = -3

Query  1379  FNVVTSA--CSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNN  1215
              N++ +A  CS   C+ L EECS   DC AG+ CLSC L F G +CVRS  TDQF+LLNN
Sbjct  17    LNLIATAFTCSSGQCK-LQEECSSDADCEAGLFCLSCSLQFDGSRCVRSAITDQFRLLNN  75

Query  1214  SLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGD  1035
             SLPFNKYAFLTTHN+F+I G   RT +P +   NQEDSVT+QLN+GVR LMLD YDF GD
Sbjct  76    SLPFNKYAFLTTHNSFAIEGERRRTPIPRLTFTNQEDSVTEQLNHGVRALMLDTYDFDGD  135

Query  1034  VWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDA  855
             VWLCHSF  KC DFTAFEPA DTLKE+EAFLS NPSEIVT+ILEDYV AP  LT VFT++
Sbjct  136   VWLCHSFKRKCQDFTAFEPALDTLKEVEAFLSANPSEIVTLILEDYVEAPNELTTVFTNS  195

Query  854   GLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYG  675
             GLMKYWFPVS MP+NG DWP V DM+A NQRL+VFTS +SK+E+EGIAYQWN+MVENQYG
Sbjct  196   GLMKYWFPVSKMPQNGQDWPPVKDMIANNQRLIVFTSKRSKQETEGIAYQWNFMVENQYG  255

Query  674   DGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAG  495
             + G+K  DC NRGES PL D TKSLVLVN FGSVPL+ +AC +NSG LI+ + TCY AAG
Sbjct  256   NDGLK-NDCTNRGESAPLNDKTKSLVLVNHFGSVPLKEIACYENSGSLINSLRTCYGAAG  314

Query  494   NRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDR  315
             NRWANF+AVD+YK                                  RS+GGG F+AVD 
Sbjct  315   NRWANFVAVDYYK----------------------------------RSDGGGAFQAVDT  340

Query  314   LNGGLLCGKDDVHSCVGGS  258
             LNG L CG  DVH+C+ GS
Sbjct  341   LNGELSCGCTDVHACMVGS  359



>ref|XP_010680657.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Beta 
vulgaris subsp. vulgaris]
Length=363

 Score =   472 bits (1214),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/376 (60%), Positives = 273/376 (73%), Gaps = 41/376 (11%)
 Frame = -3

Query  1376  NVVTSACSGENCQVLDEECS---DCGAGMHCLSCPL---GFSGPKCVRSTATDQFKLLNN  1215
             +VV+++CS   C++L E CS   DC AG++C  C      FSG KCVRST T+QFKL+NN
Sbjct  21    SVVSASCSNRQCKLL-ESCSRNSDCAAGLYCSKCQYPRPRFSGSKCVRSTVTNQFKLVNN  79

Query  1214  SLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGD  1035
             SLPFNKYAFLTTHN+F+I G +  T  P V  +NQEDS+T+QL+NGVR LMLD YD+RGD
Sbjct  80    SLPFNKYAFLTTHNSFAIEGEAHNTKAPRVTFRNQEDSITEQLHNGVRALMLDTYDYRGD  139

Query  1034  VWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDA  855
             VWLCHSF GKCH +TAFE A DT KEIEAF+++NPSEI+T+ILEDYV  PKGLT +F  +
Sbjct  140   VWLCHSFKGKCHSYTAFERAIDTFKEIEAFMASNPSEIITLILEDYVKTPKGLTNLFKAS  199

Query  854   GLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYG  675
             GLMKYWFPVS+MPKNG +WPLV  M+AKNQRL+VFTS ++K++SEGIAYQW YMVENQYG
Sbjct  200   GLMKYWFPVSSMPKNGENWPLVKHMIAKNQRLVVFTSDRTKQQSEGIAYQWKYMVENQYG  259

Query  674   DGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAG  495
               GM+ G CP R ES P+ D TKSLVLVN F +VP++  AC  NS  LI+M+ TCY AAG
Sbjct  260   SKGMEPGSCPKRNESSPMNDRTKSLVLVNHFKTVPVKLTACEHNSRELIEMLKTCYAAAG  319

Query  494   NRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDR  315
             NRWANF+AVDFYK                                  RS GGG FEAVD 
Sbjct  320   NRWANFVAVDFYK----------------------------------RSAGGGAFEAVDT  345

Query  314   LNGGLLCGKDDVHSCV  267
             LNG LLCG +D+H+C+
Sbjct  346   LNGELLCGSNDIHACM  361



>ref|XP_008810954.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Phoenix dactylifera]
Length=360

 Score =   472 bits (1214),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/367 (63%), Positives = 270/367 (74%), Gaps = 37/367 (10%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L +ECS   DC AG++C SC  GFSG +CVRS  TDQFKLLNNSLPFNKYA+LTTHN+++
Sbjct  25    LLDECSSDSDCEAGLYCFSCSQGFSGSRCVRSAITDQFKLLNNSLPFNKYAYLTTHNSYA  84

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G  S TGVP  A  NQED++TQQLNNGVR LMLD YDF+ DVWLCHS GGKC + TAF
Sbjct  85    IDGEPSHTGVPRNAFTNQEDTLTQQLNNGVRALMLDTYDFKDDVWLCHSSGGKCFNITAF  144

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
             EPA DT+KEIEAFLSTNPSEIVT+ILEDYV A  GLTKVF ++GL++YWFPVSNMP+NG 
Sbjct  145   EPAIDTMKEIEAFLSTNPSEIVTLILEDYVQAANGLTKVFNESGLLEYWFPVSNMPQNGE  204

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMV+ N RL+VFTS++SK+++EGIAYQWNYMVENQYGD GMK G C NR ES  
Sbjct  205   DWPLVHDMVSNNHRLIVFTSIESKQDTEGIAYQWNYMVENQYGDDGMKAGTCFNRAESST  264

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             L+D +K LVLVN+F ++P +   CV NS  LI+M+ TCY AAGNRWANF+AV++YK    
Sbjct  265   LSDASKYLVLVNYFRTIPEKSRTCVDNSADLINMLHTCYGAAGNRWANFVAVNYYK----  320

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVG  264
                                           RSEGGG F+A D LNG LLCG DDVH+C  
Sbjct  321   ------------------------------RSEGGGAFQATDMLNGRLLCGCDDVHACTP  350

Query  263   GSK*GGC  243
             GS  G C
Sbjct  351   GSTSGAC  357



>ref|XP_010660569.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Vitis vinifera]
Length=359

 Score =   469 bits (1208),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 237/372 (64%), Positives = 269/372 (72%), Gaps = 38/372 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             V T+ CS   CQ L ++CS   DC AG+ C SC   FS   CVRST T+QF LLNNSLPF
Sbjct  19    VATADCSNGGCQ-LHDKCSSHGDCAAGLFCFSCSELFSDNTCVRSTVTNQFSLLNNSLPF  77

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY+FLTTHN+F+I+G  S TG P +    QEDSVT QL +GVRGLMLD YDF+GDVWLC
Sbjct  78    NKYSFLTTHNSFAISGEPSHTGFPRLTTTCQEDSVTDQLRSGVRGLMLDAYDFKGDVWLC  137

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF GKC DFTAF PA DT KEIEAFLS NP+EIVT+ILEDYV  P  LTKVFTDAGLMK
Sbjct  138   HSFDGKCFDFTAFGPAIDTFKEIEAFLSANPTEIVTLILEDYVRTPNALTKVFTDAGLMK  197

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPV +MP+NG DWPLVSDM+AKNQRL+VFTS K KE SEGIAYQWNYMVENQYGDGG+
Sbjct  198   YWFPVKSMPQNGQDWPLVSDMIAKNQRLVVFTSAKYKENSEGIAYQWNYMVENQYGDGGL  257

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             + G+C  RGESPPL D TKSLVLVN+F SVPL+   C  NS  L+ M+ TC+ AAGNRWA
Sbjct  258   QSGNCTARGESPPLNDMTKSLVLVNYFLSVPLKLPTCELNSKTLLSMLDTCHGAAGNRWA  317

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGGTF+AVD +NG 
Sbjct  318   NFVAVDFYK----------------------------------RSDGGGTFQAVDTMNGE  343

Query  302   LLCGKDDVHSCV  267
             LLCG  DV +C+
Sbjct  344   LLCGSRDVRACL  355



>ref|XP_007045812.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
 gb|EOY01644.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
Length=368

 Score =   467 bits (1202),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/381 (61%), Positives = 272/381 (71%), Gaps = 39/381 (10%)
 Frame = -3

Query  1376  NVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLP  1206
             N +TSACS   C++LDE CS   DC  G+ C SC   F G +C+RS  T+QFKL+N+SLP
Sbjct  22    NTITSACSNGQCKLLDE-CSSDGDCQPGLSCFSCSEAFDGSRCIRSATTNQFKLVNDSLP  80

Query  1205  FNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWL  1026
             FNKYAFLTTHN+F+       TG+  +   NQED+VTQQLNNGVR LMLD YDF+ D+WL
Sbjct  81    FNKYAFLTTHNSFANKAEPLHTGI-RITFTNQEDTVTQQLNNGVRALMLDTYDFKEDIWL  139

Query  1025  CHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLM  846
             CHSF GKCHD+TAF  A DT KE+EAFLS NPSEIVT+ILEDYV  P GL+KVF D+GLM
Sbjct  140   CHSFEGKCHDYTAFGLAIDTFKEVEAFLSANPSEIVTLILEDYVETPNGLSKVFKDSGLM  199

Query  845   KYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGG  666
             KYWFPVS+MP+NG DWPLV DMVA NQRL+VFTS KSK+ESEGIAYQWNYMVENQYGD G
Sbjct  200   KYWFPVSSMPQNGQDWPLVKDMVANNQRLVVFTSKKSKQESEGIAYQWNYMVENQYGDDG  259

Query  665   MKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRW  486
                G+C NRGES PL D TKSLVLVN F S+P++ M C  NS  ++ M+ +CY AAG+RW
Sbjct  260   EHTGECGNRGESAPLNDKTKSLVLVNHFHSIPIKGMTCEDNSAVVVSMLDSCYGAAGSRW  319

Query  485   ANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNG  306
             ANF+AV++YK                                  RS+GGG F+AVD+LNG
Sbjct  320   ANFVAVNYYK----------------------------------RSDGGGVFQAVDKLNG  345

Query  305   GLLCGKDDVHSCVGGSK*GGC  243
              LLCG DDVHSCV GS    C
Sbjct  346   KLLCGCDDVHSCVPGSSSATC  366



>ref|XP_011099167.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Sesamum indicum]
Length=362

 Score =   466 bits (1199),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/366 (62%), Positives = 265/366 (72%), Gaps = 36/366 (10%)
 Frame = -3

Query  1358  CSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFL  1185
             CS   C+V D      DCGAG++C SC +GF G +CVRS AT+ F++LNNS+P NKYAFL
Sbjct  26    CSHGTCKVKDSCWRGGDCGAGLYCYSCEVGFPGSRCVRSKATNPFRILNNSMPLNKYAFL  85

Query  1184  TTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGK  1005
             TTHNAF+I G    TGVP +   NQED+VTQQLNNGVR LMLD YDF GD+WLCHSFGG+
Sbjct  86    TTHNAFAIEGEPYHTGVPRITVTNQEDTVTQQLNNGVRALMLDTYDFEGDIWLCHSFGGR  145

Query  1004  CHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVS  825
             CHDFTAF+PA DT+KEIE+FL TNPSEI+T+IL+DYV  PKG++KV  +AGL KY FP+S
Sbjct  146   CHDFTAFKPAVDTMKEIESFLRTNPSEILTLILQDYVQTPKGISKVLREAGLSKYRFPLS  205

Query  824   NMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCP  645
              MP+NG DW  VSDMVA+NQRLLVFTSV+SKE+SEGIAYQWNYMVENQYGD GM  G C 
Sbjct  206   RMPRNGEDWAAVSDMVARNQRLLVFTSVQSKEKSEGIAYQWNYMVENQYGDDGMIVGSCI  265

Query  644   NRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVD  465
             NR ES  L D  KSLVL+N+FGS+P +  ACV NS  L+ M+ TC+ + G RW NF+AVD
Sbjct  266   NRMESSALNDKRKSLVLMNYFGSIPSKKFACVHNSANLLAMIQTCHQSTGGRWPNFVAVD  325

Query  464   FYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKD  285
             FYK                                  RSEGGGTFEAVD LNG LLCG++
Sbjct  326   FYK----------------------------------RSEGGGTFEAVDTLNGELLCGRN  351

Query  284   DVHSCV  267
             DVH CV
Sbjct  352   DVHECV  357



>emb|CBI16942.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   466 bits (1200),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 264/363 (73%), Gaps = 37/363 (10%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             N  +L ++CS   DC AG+ C SC   FS   CVRST T+QF LLNNSLPFNKY+FLTTH
Sbjct  35    NFYLLHDKCSSHGDCAAGLFCFSCSELFSDNTCVRSTVTNQFSLLNNSLPFNKYSFLTTH  94

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+F+I+G  S TG P +    QEDSVT QL +GVRGLMLD YDF+GDVWLCHSF GKC D
Sbjct  95    NSFAISGEPSHTGFPRLTTTCQEDSVTDQLRSGVRGLMLDAYDFKGDVWLCHSFDGKCFD  154

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF PA DT KEIEAFLS NP+EIVT+ILEDYV  P  LTKVFTDAGLMKYWFPV +MP
Sbjct  155   FTAFGPAIDTFKEIEAFLSANPTEIVTLILEDYVRTPNALTKVFTDAGLMKYWFPVKSMP  214

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             +NG DWPLVSDM+AKNQRL+VFTS K KE SEGIAYQWNYMVENQYGDGG++ G+C  RG
Sbjct  215   QNGQDWPLVSDMIAKNQRLVVFTSAKYKENSEGIAYQWNYMVENQYGDGGLQSGNCTARG  274

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ESPPL D TKSLVLVN+F SVPL+   C  NS  L+ M+ TC+ AAGNRWANF+AVDFYK
Sbjct  275   ESPPLNDMTKSLVLVNYFLSVPLKLPTCELNSKTLLSMLDTCHGAAGNRWANFVAVDFYK  334

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGGTF+AVD +NG LLCG  DV 
Sbjct  335   ----------------------------------RSDGGGTFQAVDTMNGELLCGSRDVR  360

Query  275   SCV  267
             +C+
Sbjct  361   ACL  363



>ref|XP_003551765.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Glycine max]
Length=321

 Score =   464 bits (1194),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 229/344 (67%), Positives = 260/344 (76%), Gaps = 35/344 (10%)
 Frame = -3

Query  1268  GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQ  1089
              P+ +     D+ ++ NNSLPFNKYAFLTTHNA++I G  S TGVP V   NQEDSVTQQ
Sbjct  12    APRGIPPYGVDETQM-NNSLPFNKYAFLTTHNAYAIDGEPSHTGVPRVTFTNQEDSVTQQ  70

Query  1088  LNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTII  909
             LNNGVRGLMLD YDF GDVWLCHSF G+CHDFTAFEPA DTLKEIEAFLS NP+EIVT+I
Sbjct  71    LNNGVRGLMLDTYDFDGDVWLCHSFEGQCHDFTAFEPALDTLKEIEAFLSANPTEIVTLI  130

Query  908   LEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKE  729
             LEDYV+AP GLTKVFTDAGLMKYWFP+ +MP+NG DWPLVSDMVAKNQRLLVFTS+ SKE
Sbjct  131   LEDYVDAPNGLTKVFTDAGLMKYWFPLPSMPRNGQDWPLVSDMVAKNQRLLVFTSIASKE  190

Query  728   ESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACV  549
             +SEGIAYQWN+MVENQYGDGG K G CPNR ES PL D +KSLVLVN+F S P++P+ C 
Sbjct  191   QSEGIAYQWNFMVENQYGDGGRKAGSCPNRAESSPLNDKSKSLVLVNYFRSTPIKPITCE  250

Query  548   QNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**Q  369
              NSG LI+M+ TC+ AAGNRWANF+AVD+YK                             
Sbjct  251   DNSGELINMLQTCFGAAGNRWANFVAVDYYK-----------------------------  281

Query  368   VMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCRR  237
                  RSEGGG+F+AVD LNG LLCG DDVH+CV GS    C +
Sbjct  282   -----RSEGGGSFQAVDTLNGKLLCGCDDVHTCVPGSTSEACSQ  320



>gb|KHN37914.1| PI-PLC X domain-containing protein, partial [Glycine soja]
Length=295

 Score =   462 bits (1190),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/328 (69%), Positives = 253/328 (77%), Gaps = 34/328 (10%)
 Frame = -3

Query  1220  NNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFR  1041
             NNSLPFNKYAFLTTHNA++I G  S TGVP V   NQEDSVTQQLNNGVRGLMLD YDF 
Sbjct  1     NNSLPFNKYAFLTTHNAYAIDGEPSHTGVPRVTFTNQEDSVTQQLNNGVRGLMLDTYDFD  60

Query  1040  GDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFT  861
             GDVWLCHSF G+CHDFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV+AP GLTKVFT
Sbjct  61    GDVWLCHSFEGQCHDFTAFEPALDTLKEIEAFLSANPTEIVTLILEDYVHAPNGLTKVFT  120

Query  860   DAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ  681
             DAGLMKYWFP+ +MP+NG DWPLVSDMVAKNQRLLVFTS+ SKE+SEGIAYQWN+MVENQ
Sbjct  121   DAGLMKYWFPLPSMPRNGQDWPLVSDMVAKNQRLLVFTSIASKEQSEGIAYQWNFMVENQ  180

Query  680   YGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLA  501
             YGDGG K G CPNR ES PL D +KSLVLVN+F S P++P+ C  NSG LI+M+ TC+ A
Sbjct  181   YGDGGRKAGSCPNRAESSPLNDKSKSLVLVNYFRSTPIKPITCEDNSGELINMLQTCFGA  240

Query  500   AGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAV  321
             AGNRWANF+AVD+YK                                  RSEGGG+F+AV
Sbjct  241   AGNRWANFVAVDYYK----------------------------------RSEGGGSFQAV  266

Query  320   DRLNGGLLCGKDDVHSCVGGSK*GGCRR  237
             D LNG LLCG DDVH+CV GS    C +
Sbjct  267   DTLNGKLLCGCDDVHTCVPGSTSEACSQ  294



>ref|XP_007151350.1| hypothetical protein PHAVU_004G039000g [Phaseolus vulgaris]
 gb|ESW23344.1| hypothetical protein PHAVU_004G039000g [Phaseolus vulgaris]
Length=353

 Score =   464 bits (1194),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/309 (72%), Positives = 253/309 (82%), Gaps = 4/309 (1%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V +ACS   C+ L++ECS   DCG G++C SCPLGFSG +CVRS+ TD FKL+NNSLPFN
Sbjct  19    VDAACSNGKCK-LNDECSSNGDCGPGLYCFSCPLGFSGSRCVRSSVTDPFKLINNSLPFN  77

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHN+F+I G  S TGVP V   NQEDSVTQQL NGVRGLMLD YDF GDVWLCH
Sbjct  78    KYAFLTTHNSFAIHGEPSNTGVPRVTITNQEDSVTQQLKNGVRGLMLDTYDFDGDVWLCH  137

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G CHDFTAFEPA DTLKEI AFLS NP EIVT+IL+DYV  PK L KVFT+AGLMK+
Sbjct  138   SFRGHCHDFTAFEPAIDTLKEIAAFLSANPKEIVTLILDDYVETPKALKKVFTEAGLMKF  197

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV  M K GGDWPLVSDMVAKNQRLLVFTS+ SK++SEGIAYQWNYMVENQYGDGG K
Sbjct  198   WFPVMRMTKKGGDWPLVSDMVAKNQRLLVFTSISSKQQSEGIAYQWNYMVENQYGDGGRK  257

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C +R ES  L D ++SLVL+N+F + PL+P+ C  NSG LIDM+ TC+ AAGNRWAN
Sbjct  258   AGRCLHRKESSALDDKSRSLVLINYFRTFPLKPITCEDNSGGLIDMLQTCHDAAGNRWAN  317

Query  479   FLAVDFYKV  453
             ++AVD+YKV
Sbjct  318   YVAVDYYKV  326



>gb|KDP41327.1| hypothetical protein JCGZ_15734 [Jatropha curcas]
Length=390

 Score =   464 bits (1195),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/374 (62%), Positives = 267/374 (71%), Gaps = 39/374 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F +   ACS   C+ L ++CS   DC AG++CLSC   F G +CVRST TDQFKLLNNSL
Sbjct  20    FIITAFACSSGQCK-LQDQCSSDADCEAGLYCLSCSREFEGSRCVRSTITDQFKLLNNSL  78

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLT+HN+F+I G  SRTGVP +   NQED+VTQQLN+GVR LMLD YDF GDVW
Sbjct  79    PFNKYAFLTSHNSFAIKGEPSRTGVPRLTFTNQEDTVTQQLNHGVRALMLDTYDFDGDVW  138

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSF GKC DFTAFEPA +TLKEI AFL+ NPSEIVT+ILEDYV  P GL KVF D+GL
Sbjct  139   LCHSFKGKCRDFTAFEPAIETLKEIGAFLAANPSEIVTLILEDYVKTPNGLRKVFKDSGL  198

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFP+S MP+NG DWPLV +MVA NQRL+VFTSVKSK+++EGIAYQWN+MVENQYG+ 
Sbjct  199   MKYWFPLSKMPENGQDWPLVKEMVANNQRLIVFTSVKSKQQTEGIAYQWNFMVENQYGNK  258

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             G+   +C NR ES  L D TKSLVLVN FGS+P   +AC  NS  LI+ +  CY A+GNR
Sbjct  259   GLHE-NCKNREESSTLDDKTKSLVLVNHFGSIPARTLACGLNSESLINSLHKCYTASGNR  317

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVD+YK                                  RS GGG FEAVD LN
Sbjct  318   WANFIAVDYYK----------------------------------RSNGGGAFEAVDTLN  343

Query  308   GGLLCGKDDVHSCV  267
             G LLCG  DV +C 
Sbjct  344   GELLCGCSDVRACA  357



>ref|XP_002465130.1| hypothetical protein SORBIDRAFT_01g032510 [Sorghum bicolor]
 gb|EER92128.1| hypothetical protein SORBIDRAFT_01g032510 [Sorghum bicolor]
Length=367

 Score =   461 bits (1187),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 226/354 (64%), Positives = 258/354 (73%), Gaps = 34/354 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +DCGAG  C  C   FSG  CVRS AT+ F+L+NNSLPFNKYA+LTTHN+++I G  S T
Sbjct  45    ADCGAGQWCFDCEPKFSGSHCVRSAATNPFQLINNSLPFNKYAYLTTHNSYAIVGEPSHT  104

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G+P V   NQED+VT QLNNGVR LMLD YDF+ DVWLCHS GGKC+DFTAFEPA DT K
Sbjct  105   GIPRVTFDNQEDTVTDQLNNGVRALMLDTYDFKNDVWLCHSSGGKCNDFTAFEPALDTFK  164

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EIEAFLS NPSEIVTIILEDYV+AP GLT VF  +GL+KYWFPVS MP+NG DWPLVSDM
Sbjct  165   EIEAFLSANPSEIVTIILEDYVHAPNGLTNVFNASGLLKYWFPVSKMPQNGQDWPLVSDM  224

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VA NQRLLVFTS+ SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL D TKSL
Sbjct  225   VASNQRLLVFTSISSKQSTEGIAYQWNFMVENNYGDDGMDAGKCSNRAESAPLNDNTKSL  284

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F SVP++  AC+Q+S  LIDMV TCY AAGNRWANF+AVD+YK            
Sbjct  285   VLMNYFPSVPVKFTACLQHSQNLIDMVNTCYGAAGNRWANFVAVDYYK------------  332

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                   RS+GGG F+A D LNG LLCG  D+ +C  GS
Sbjct  333   ----------------------RSDGGGAFQATDLLNGKLLCGCQDIRACSQGS  364



>ref|XP_008459396.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Cucumis 
melo]
Length=367

 Score =   460 bits (1184),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 269/369 (73%), Gaps = 39/369 (11%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             CS   C+V DE CS   DCG G++C SC P  F G KCVRST T+QFKLLNNSLPFNKYA
Sbjct  34    CSNGPCKVGDE-CSSSEDCGDGLYCFSCIPTFFGGSKCVRSTYTNQFKLLNNSLPFNKYA  92

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L+THN+F+I G  S+TGVP V   NQED+++QQLNNGVR  MLD YDF GDVWLCHSFG
Sbjct  93    YLSTHNSFAIEGEPSQTGVPRVTLNNQEDTISQQLNNGVRAFMLDTYDFLGDVWLCHSFG  152

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             GKC+++TAFEPA +TLKEIEAFL  N  EIVT+ILEDYV +P GLTKVFT+AGL K+WFP
Sbjct  153   GKCYNYTAFEPALNTLKEIEAFLEANTEEIVTLILEDYVQSPNGLTKVFTNAGLKKFWFP  212

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             ++NMPKNG DWP VSDMVA NQRLLVFTS  +KE +EGIAYQWNYMVENQYG+ GMK G 
Sbjct  213   ITNMPKNGEDWPRVSDMVANNQRLLVFTSNNTKEAAEGIAYQWNYMVENQYGNDGMKEGS  272

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             C NRGES  L D  KSL+L+N+F +VPL+  ACV NS  L+ M+ TC+ AAGNRW NF+A
Sbjct  273   CSNRGESSRLDDKGKSLILMNYFPTVPLKIEACVDNSKNLLGMLQTCHGAAGNRWPNFVA  332

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RS+GGG F+A+D LNG LLC 
Sbjct  333   VDFYK----------------------------------RSDGGGAFQALDTLNGKLLCA  358

Query  290   KDDVHSCVG  264
               D+HSCVG
Sbjct  359   SQDIHSCVG  367



>gb|EYU44227.1| hypothetical protein MIMGU_mgv1a025852mg, partial [Erythranthe 
guttata]
Length=358

 Score =   458 bits (1178),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 264/371 (71%), Gaps = 37/371 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             + +ACS   C  + +ECS   DCG+G++C SC  GF G +CVR  AT+QFK+LNNSLPFN
Sbjct  22    LAAACSNGTCGRVMDECSSDEDCGSGLYCFSCEAGFPGSRCVRMKATNQFKILNNSLPFN  81

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFL THN+F+I G  S TGVP + P NQED++TQQLNNGVRGLMLD+YD+ GD+WLCH
Sbjct  82    KYAFLATHNSFAIEGEPSHTGVPRITPTNQEDTITQQLNNGVRGLMLDIYDYEGDIWLCH  141

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGG+C DFTAF PA DTLKEIEAF+  NP+EIVT+IL+DYV  P GLTKV   AGLM Y
Sbjct  142   SFGGRCRDFTAFGPAIDTLKEIEAFMRKNPTEIVTLILQDYVQTPNGLTKVLKKAGLMNY  201

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
              FP+S MP+NG +WPLV +MVAKNQRLL+FTSV+SK++SEGIAYQWNY+VE  YGD GM 
Sbjct  202   QFPLSKMPRNGENWPLVKEMVAKNQRLLIFTSVESKQKSEGIAYQWNYIVETLYGDNGMT  261

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
                C NR ES  L DT+KSLVLVN+FGS+P + M+C+ NS  L  ++ TC+ AAG RW N
Sbjct  262   STYCVNREESSRLNDTSKSLVLVNYFGSLPSKKMSCIHNSEDLRKVIETCHRAAGERWPN  321

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAVDFYK                                  RSEGGG F+AVD LNG L
Sbjct  322   FLAVDFYK----------------------------------RSEGGGPFQAVDALNGEL  347

Query  299   LCGKDDVHSCV  267
              CG+ DV  C 
Sbjct  348   ACGRKDVFQCA  358



>ref|XP_004984024.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Setaria italica]
Length=357

 Score =   457 bits (1177),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 259/354 (73%), Gaps = 34/354 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +DCGAG  C  C    SG  CVRS AT+ F+L+NNSLPFNKYA+LTTHN+++I G  S T
Sbjct  32    ADCGAGQWCFDCEPKLSGSHCVRSAATNPFQLINNSLPFNKYAYLTTHNSYAIVGEPSHT  91

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G+P +   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT +
Sbjct  92    GIPRITFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEPALDTFQ  151

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EIEAFLS NPSEIVTIILEDYV+AP GLT VF  +GL+KYWFPVS MP+NG DWPLVSDM
Sbjct  152   EIEAFLSANPSEIVTIILEDYVHAPNGLTNVFNTSGLLKYWFPVSKMPQNGQDWPLVSDM  211

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VA NQRLLVFTS+ SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL+D TKSL
Sbjct  212   VASNQRLLVFTSISSKQSTEGIAYQWNFMVENNYGDDGMDAGKCSNRAESAPLSDKTKSL  271

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F SVP++  AC+Q+S  L DMV TCY AAGNRWANF+AVD+YK            
Sbjct  272   VLMNYFPSVPIKFTACLQHSQSLTDMVNTCYGAAGNRWANFIAVDYYK------------  319

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                   RS+GGG F++ D LNG LLCG  D+ +C+ GS
Sbjct  320   ----------------------RSDGGGVFQSTDLLNGRLLCGCQDIRACLPGS  351



>ref|XP_004141591.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cucumis sativus]
 ref|XP_004173044.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cucumis sativus]
 gb|KGN52525.1| hypothetical protein Csa_5G640590 [Cucumis sativus]
Length=366

 Score =   457 bits (1175),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/369 (62%), Positives = 268/369 (73%), Gaps = 39/369 (11%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             CS   C+V D+ CS   DCG G++C SC P  F G KCVRST T+QFKLLNNSLPFNKYA
Sbjct  33    CSNGPCKVGDQ-CSSSEDCGDGLYCFSCIPTFFGGSKCVRSTYTNQFKLLNNSLPFNKYA  91

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THN+F+I G  S+TGVP V   NQED+V+QQLNNGVR  MLD YDF GDVWLCHSFG
Sbjct  92    YLATHNSFAIEGEPSQTGVPRVTLNNQEDTVSQQLNNGVRAFMLDTYDFLGDVWLCHSFG  151

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             GKC+++TAFEPA +TLKEIE FL  N  EIVT+ILEDYV +P GLTKVFT+AGL K+WFP
Sbjct  152   GKCYNYTAFEPALNTLKEIEGFLEANTEEIVTLILEDYVQSPNGLTKVFTNAGLKKFWFP  211

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             ++NMPKNG DWP VSDMVA NQRLLVFTS  +KE +EGIAYQWNYMVENQYG+ GMK+G 
Sbjct  212   ITNMPKNGEDWPRVSDMVANNQRLLVFTSNNTKEAAEGIAYQWNYMVENQYGNDGMKKGS  271

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             C NRG+S  L D  KSL+L+N+F +VPL+  ACV NS  L+ M+ TC+ AAGNRW NF+A
Sbjct  272   CSNRGQSSRLDDKGKSLILMNYFPTVPLKIEACVDNSKNLLGMLQTCHGAAGNRWPNFVA  331

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             VDFYK                                  RS+GGG F+A+D LNG LLC 
Sbjct  332   VDFYK----------------------------------RSDGGGAFQALDTLNGELLCA  357

Query  290   KDDVHSCVG  264
               D+HSCVG
Sbjct  358   SQDIHSCVG  366



>ref|NP_001050364.1| Os03g0415200 [Oryza sativa Japonica Group]
 gb|AAS07086.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF96604.1| MAP3K-like protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12278.1| Os03g0415200 [Oryza sativa Japonica Group]
 dbj|BAG89177.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59256.1| hypothetical protein OsJ_11265 [Oryza sativa Japonica Group]
Length=360

 Score =   456 bits (1174),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 253/353 (72%), Gaps = 34/353 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             DCG G  C  C   F+G  CVRS AT+ F+L NNSLPFNKYA+LTTHN+F+I G  S TG
Sbjct  36    DCGGGQWCFDCQPEFAGSSCVRSAATNPFQLTNNSLPFNKYAYLTTHNSFAIVGEPSHTG  95

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
             VP +   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT KE
Sbjct  96    VPRITFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSNGGKCNDFTAFEPALDTFKE  155

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             IEAFL  NPSEIVT+ILEDYV+AP GLT VF  +GLMKYWFPVS MP+ G DWPLVSDMV
Sbjct  156   IEAFLGANPSEIVTLILEDYVHAPNGLTNVFKASGLMKYWFPVSKMPQKGKDWPLVSDMV  215

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
             A NQRLLVFTS++SK+ +EGIAYQWNYMVEN YGD GM  G C NR ES PL D TKSLV
Sbjct  216   ASNQRLLVFTSIRSKQATEGIAYQWNYMVENNYGDDGMDAGKCSNRAESAPLNDKTKSLV  275

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F SVP++  AC+Q+S  L DMV TCY AAGNRWAN LAVD+YK             
Sbjct  276   LVNYFPSVPVKVTACLQHSKSLTDMVNTCYGAAGNRWANLLAVDYYK-------------  322

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                  RS+GGG F+A D LNG LLCG  DV +C  GS
Sbjct  323   ---------------------RSDGGGAFQATDLLNGRLLCGCQDVRACSRGS  354



>ref|XP_008660055.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Zea 
mays]
 gb|AFW88097.1| hypothetical protein ZEAMMB73_151451 [Zea mays]
Length=371

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 257/354 (73%), Gaps = 34/354 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +DCGAG  C  C    SG  CVRS AT+ F+L+NNSLPFNKYA+LTTHNA++I G  S T
Sbjct  46    ADCGAGQWCFDCEPQLSGSHCVRSAATNPFQLINNSLPFNKYAYLTTHNAYAIVGEPSHT  105

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G+P V   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT K
Sbjct  106   GIPRVTFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEPALDTFK  165

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EIEAFL+ NPSEIVT+ILEDYV+AP GLT VF  +GL+KYWFPVS MP +G DWPLVSDM
Sbjct  166   EIEAFLAANPSEIVTLILEDYVHAPNGLTNVFNASGLLKYWFPVSRMPPSGQDWPLVSDM  225

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VA NQRLLVFTSV SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL D TKSL
Sbjct  226   VATNQRLLVFTSVSSKQSAEGIAYQWNFMVENNYGDDGMDAGKCSNRAESAPLNDNTKSL  285

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F S+P++  AC+Q+S  L+DMV TCY AAGNRWANF+AVD+YK            
Sbjct  286   VLMNYFPSLPVKFTACLQHSQSLVDMVSTCYGAAGNRWANFVAVDYYK------------  333

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                   RS+GGG F+A D LNG LLCG  D+ +C  GS
Sbjct  334   ----------------------RSDGGGAFQATDLLNGRLLCGCQDIRACSQGS  365



>ref|XP_003577935.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Brachypodium distachyon]
Length=359

 Score =   454 bits (1169),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 256/360 (71%), Gaps = 37/360 (10%)
 Frame = -3

Query  1328  EECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSIT  1158
             ++CS   DCGAG  C  C    SG  CVRS  T+ F+L+NNSLPFNKYA+LTTHNAF+I 
Sbjct  28    DDCSTSADCGAGQWCFDCEPELSGSHCVRSVGTNPFQLVNNSLPFNKYAYLTTHNAFAIV  87

Query  1157  GWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEP  978
             G  S TG+P +   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEP
Sbjct  88    GEPSHTGIPRITFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEP  147

Query  977   AGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDW  798
             A DT  EI+AFLS NPSEIVT+ILEDYV+AP GLT VF  +GL KYWFPVS MP N  DW
Sbjct  148   ALDTFNEIQAFLSANPSEIVTLILEDYVSAPNGLTNVFKSSGLQKYWFPVSKMPSNSQDW  207

Query  797   PLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLT  618
             PLVSDMVA NQRLLVFTSV+SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL 
Sbjct  208   PLVSDMVASNQRLLVFTSVRSKQATEGIAYQWNFMVENNYGDAGMDAGQCSNRAESAPLA  267

Query  617   DTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLV  438
             D TKSLVL+N+F SVPL+  AC+Q+S  L DMV TCY A+GNRWANFLAVD+YK      
Sbjct  268   DKTKSLVLMNYFPSVPLKLTACLQHSKGLTDMVNTCYSASGNRWANFLAVDYYK------  321

Query  437   RIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                         RSEGGG F+ +D LNG LLCG  DV +C  GS
Sbjct  322   ----------------------------RSEGGGVFQDMDLLNGKLLCGCQDVQACPKGS  353



>ref|XP_006856404.1| hypothetical protein AMTR_s00047p00211930 [Amborella trichopoda]
 gb|ERN17871.1| hypothetical protein AMTR_s00047p00211930 [Amborella trichopoda]
Length=410

 Score =   456 bits (1172),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/421 (56%), Positives = 275/421 (65%), Gaps = 81/421 (19%)
 Frame = -3

Query  1364  SACSGENCQVLD--EECSDCGAGMHCLSCPLGFSGPKCVRSTA-----------------  1242
             SACS   C++LD     SDC AG++C SC +GF G +C+R T                  
Sbjct  22    SACSDGTCKLLDNCSTDSDCEAGLYCGSCVVGFKGSRCIRLTTSNPFSLVVLHEENYVQH  81

Query  1241  ----------------------------TDQFKLLNNSLPFNKYAFLTTHNAFSITGWSS  1146
                                         T+Q  LLNNSLP+NKY FLTTHN+++I G  S
Sbjct  82    VLIDTSRRRTGSILLKRRTEEAEPIQDDTNQAILLNNSLPYNKYGFLTTHNSYAIDGEPS  141

Query  1145  RTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDT  966
              TGVP +   NQED++TQQLNNG R LMLD YDF GDVWLCHS GG+C D TAF PA DT
Sbjct  142   HTGVPRITFTNQEDTITQQLNNGARALMLDTYDFEGDVWLCHSRGGQCFDVTAFGPANDT  201

Query  965   LKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVS  786
             ++EIEAFL+ NPSEIVT+ILEDYVNAP GLTKVF ++GL KYWFP+S MPKNG DWPLVS
Sbjct  202   MQEIEAFLAANPSEIVTLILEDYVNAPNGLTKVFNESGLSKYWFPLSKMPKNGEDWPLVS  261

Query  785   DMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTK  606
             DMVA N+RLLVFTS  SKE++EGIAYQWNYMVENQYGDGGMK+G C NRGES PL D TK
Sbjct  262   DMVAANERLLVFTSKASKEQTEGIAYQWNYMVENQYGDGGMKQGQCTNRGESAPLNDRTK  321

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SLVLVN+FGS+P + ++C  NS  L++M+ TCY AA +RWANF AVD+YK          
Sbjct  322   SLVLVNYFGSIPNKWLSCQYNSDDLLNMLRTCYTAADSRWANFAAVDYYK----------  371

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GG  246
                                     RSEGGG F+AVD LNG LLCG DD+H+C+ GS  G 
Sbjct  372   ------------------------RSEGGGAFQAVDTLNGKLLCGCDDIHACMPGSTSGA  407

Query  245   C  243
             C
Sbjct  408   C  408



>ref|XP_006650196.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Oryza brachyantha]
Length=357

 Score =   453 bits (1166),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 255/354 (72%), Gaps = 34/354 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +DCGAG  C  C   F+G  CVRS A + F+L NNSLPFNKYA+LTTHN+F+I G  S T
Sbjct  32    ADCGAGQWCFDCEPEFAGSSCVRSAAANPFQLANNSLPFNKYAYLTTHNSFAIVGEPSHT  91

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             GVP +   NQED+VT QL NGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT K
Sbjct  92    GVPRITFDNQEDTVTDQLKNGVRALMLDTYDFKGDVWLCHSNGGKCNDFTAFEPALDTFK  151

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EIEAFL  NPSEIVT+ILEDYV+AP GLT VF  +GLMKYWFPVS MP+NG DWPLVS+M
Sbjct  152   EIEAFLGANPSEIVTLILEDYVHAPNGLTNVFKASGLMKYWFPVSKMPQNGKDWPLVSEM  211

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VA N+RLLVFTS++SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL D TKSL
Sbjct  212   VAGNERLLVFTSIRSKQATEGIAYQWNFMVENNYGDDGMDAGKCSNRAESAPLNDKTKSL  271

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VLVN+F SVP++  AC+Q+S  L DMV TCY  +GNRWANFLAVD+YK            
Sbjct  272   VLVNYFPSVPVKITACLQHSKSLTDMVNTCYGTSGNRWANFLAVDYYK------------  319

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                   RS+GGG F+A D LNG LLCG  D+ +C GGS
Sbjct  320   ----------------------RSDGGGAFQATDLLNGRLLCGCQDIKACSGGS  351



>gb|ABF96605.1| MAP3K-like protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
Length=377

 Score =   454 bits (1167),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 251/349 (72%), Gaps = 34/349 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             DCG G  C  C   F+G  CVRS AT+ F+L NNSLPFNKYA+LTTHN+F+I G  S TG
Sbjct  36    DCGGGQWCFDCQPEFAGSSCVRSAATNPFQLTNNSLPFNKYAYLTTHNSFAIVGEPSHTG  95

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
             VP +   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT KE
Sbjct  96    VPRITFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSNGGKCNDFTAFEPALDTFKE  155

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             IEAFL  NPSEIVT+ILEDYV+AP GLT VF  +GLMKYWFPVS MP+ G DWPLVSDMV
Sbjct  156   IEAFLGANPSEIVTLILEDYVHAPNGLTNVFKASGLMKYWFPVSKMPQKGKDWPLVSDMV  215

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
             A NQRLLVFTS++SK+ +EGIAYQWNYMVEN YGD GM  G C NR ES PL D TKSLV
Sbjct  216   ASNQRLLVFTSIRSKQATEGIAYQWNYMVENNYGDDGMDAGKCSNRAESAPLNDKTKSLV  275

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F SVP++  AC+Q+S  L DMV TCY AAGNRWAN LAVD+YK             
Sbjct  276   LVNYFPSVPVKVTACLQHSKSLTDMVNTCYGAAGNRWANLLAVDYYK-------------  322

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                  RS+GGG F+A D LNG LLCG  DV +C
Sbjct  323   ---------------------RSDGGGAFQATDLLNGRLLCGCQDVRAC  350



>ref|XP_008810953.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Phoenix dactylifera]
Length=398

 Score =   454 bits (1168),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 270/405 (67%), Gaps = 75/405 (19%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L +ECS   DC AG++C SC  GFSG +CVRS  TDQFKLLNNSLPFNKYA+LTTHN+++
Sbjct  25    LLDECSSDSDCEAGLYCFSCSQGFSGSRCVRSAITDQFKLLNNSLPFNKYAYLTTHNSYA  84

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G  S TGVP  A  NQED++TQQLNNGVR LMLD YDF+ DVWLCHS GGKC + TAF
Sbjct  85    IDGEPSHTGVPRNAFTNQEDTLTQQLNNGVRALMLDTYDFKDDVWLCHSSGGKCFNITAF  144

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
             EPA DT+KEIEAFLSTNPSEIVT+ILEDYV A  GLTKVF ++GL++YWFPVSNMP+NG 
Sbjct  145   EPAIDTMKEIEAFLSTNPSEIVTLILEDYVQAANGLTKVFNESGLLEYWFPVSNMPQNGE  204

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ-------------------  681
             DWPLV DMV+ N RL+VFTS++SK+++EGIAYQWNYMVENQ                   
Sbjct  205   DWPLVHDMVSNNHRLIVFTSIESKQDTEGIAYQWNYMVENQWRSATRIYHIIMVQMPQLS  264

Query  680   -------------------YGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPM  558
                                YGD GMK G C NR ES  L+D +K LVLVN+F ++P +  
Sbjct  265   VGRNPKAVIGVSNELQAMAYGDDGMKAGTCFNRAESSTLSDASKYLVLVNYFRTIPEKSR  324

Query  557   ACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS  378
              CV NS  LI+M+ TCY AAGNRWANF+AV++YK                          
Sbjct  325   TCVDNSADLINMLHTCYGAAGNRWANFVAVNYYK--------------------------  358

Query  377   **QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                     RSEGGG F+A D LNG LLCG DDVH+C  GS  G C
Sbjct  359   --------RSEGGGAFQATDMLNGRLLCGCDDVHACTPGSTSGAC  395



>ref|XP_006482423.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X4 [Citrus sinensis]
Length=341

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 244/327 (75%), Gaps = 34/327 (10%)
 Frame = -3

Query  1223  LNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDF  1044
             LNNSLP NKYAFL THNAF+     S TGVP VA  NQED+V QQL+NGVRG MLD YDF
Sbjct  47    LNNSLPLNKYAFLATHNAFANENEPSHTGVPRVAATNQEDTVAQQLSNGVRGFMLDTYDF  106

Query  1043  RGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVF  864
             +GDVWLCHS GGKC+D TAFEPA DTLK+IEAF+S NP+EIVT+ILEDYV AP GLTKVF
Sbjct  107   KGDVWLCHSSGGKCYDVTAFEPAIDTLKDIEAFMSANPAEIVTLILEDYVQAPNGLTKVF  166

Query  863   TDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVEN  684
              DAGLMKYW+PVS MPKNG DWPLVSDMVA NQRLLVFTS KSKE SEGIAYQW+YMVEN
Sbjct  167   NDAGLMKYWYPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKETSEGIAYQWSYMVEN  226

Query  683   QYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYL  504
             QYG+GGM  G CPNR ESPPL D +KSLVLVN+F S P++   CV NSG LI+M+ TC+ 
Sbjct  227   QYGNGGMHAGSCPNRAESPPLNDKSKSLVLVNYFESFPIKQTTCVHNSGDLINMLDTCHG  286

Query  503   AAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEA  324
             AAG+RWANF+AVD+YK                                  RSEGGG+F+A
Sbjct  287   AAGSRWANFVAVDYYK----------------------------------RSEGGGSFQA  312

Query  323   VDRLNGGLLCGKDDVHSCVGGSK*GGC  243
             VD LNG LLCG DD+H+C  GS  G C
Sbjct  313   VDTLNGKLLCGCDDLHACAPGSTAGAC  339



>ref|XP_006482422.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X3 [Citrus sinensis]
Length=341

 Score =   446 bits (1147),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 244/327 (75%), Gaps = 34/327 (10%)
 Frame = -3

Query  1223  LNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDF  1044
             LNNSLP NKYAFL THNAF+     S TGVP VA  NQED+V QQL+NGVRG MLD YDF
Sbjct  47    LNNSLPLNKYAFLATHNAFANENEPSHTGVPRVAATNQEDTVAQQLSNGVRGFMLDTYDF  106

Query  1043  RGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVF  864
             +GDVWLCHS GGKC+D TAFEPA DTLK+IEAF+S NP+EIVT+ILEDYV AP GLTKVF
Sbjct  107   KGDVWLCHSSGGKCYDVTAFEPAIDTLKDIEAFMSANPAEIVTLILEDYVQAPNGLTKVF  166

Query  863   TDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVEN  684
              DAGLMKYW+PVS MPKNG DWPLVSDMVA NQRLLVFTS KSKE SEGIAYQW+YMVEN
Sbjct  167   NDAGLMKYWYPVSKMPKNGEDWPLVSDMVANNQRLLVFTSNKSKETSEGIAYQWSYMVEN  226

Query  683   QYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYL  504
             QYG+GGM  G CPNR ESPPL D +KSLVLVN+F S P++   CV NSG LI+M+ TC+ 
Sbjct  227   QYGNGGMHAGSCPNRAESPPLNDKSKSLVLVNYFESFPIKQTTCVHNSGDLINMLDTCHG  286

Query  503   AAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEA  324
             AAG+RWANF+AVD+YK                                  RSEGGG+F+A
Sbjct  287   AAGSRWANFVAVDYYK----------------------------------RSEGGGSFQA  312

Query  323   VDRLNGGLLCGKDDVHSCVGGSK*GGC  243
             VD LNG LLCG DD+H+C  GS  G C
Sbjct  313   VDTLNGKLLCGCDDLHACAPGSTAGAC  339



>gb|KDO72284.1| hypothetical protein CISIN_1g0438801mg, partial [Citrus sinensis]
Length=284

 Score =   442 bits (1136),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 215/318 (68%), Positives = 241/318 (76%), Gaps = 34/318 (11%)
 Frame = -3

Query  1220  NNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFR  1041
             NNSLP NKYAFLTTHNAF+I    S TGVP +   NQED+VTQQL NGVRGLMLD YDF+
Sbjct  1     NNSLPLNKYAFLTTHNAFAIDHTPSHTGVPRLTFTNQEDNVTQQLKNGVRGLMLDTYDFK  60

Query  1040  GDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFT  861
             GDVWLCHSFGGKCHD+TAFEPA DTLKEIEAF+S+ P+EIVT+ILEDYV AP GLTKVF 
Sbjct  61    GDVWLCHSFGGKCHDYTAFEPAIDTLKEIEAFMSSKPAEIVTLILEDYVQAPNGLTKVFA  120

Query  860   DAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ  681
             +AGLMKYWFPVS MP+NG DWPLVSDMVA NQRLLVFTS KSK+ESEGIAYQW+YMVEN+
Sbjct  121   EAGLMKYWFPVSKMPRNGEDWPLVSDMVANNQRLLVFTSNKSKQESEGIAYQWSYMVENK  180

Query  680   YGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLA  501
             YG+ GM  G C NR ES PL D  KSLVLVN+F S+P++  ACV NSG LI+M+ TCY A
Sbjct  181   YGNRGMHAGSCSNRAESSPLNDERKSLVLVNYFKSLPIKRTACVHNSGHLINMLHTCYAA  240

Query  500   AGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAV  321
             AGNRWANF+AVD+YK                                  RSEG G+F+AV
Sbjct  241   AGNRWANFVAVDYYK----------------------------------RSEGRGSFQAV  266

Query  320   DRLNGGLLCGKDDVHSCV  267
             D LNG LLCG DDVH+C 
Sbjct  267   DTLNGRLLCGCDDVHACA  284



>ref|XP_004490218.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cicer arietinum]
Length=362

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 255/361 (71%), Gaps = 37/361 (10%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L E+C+   DC  G+ C SC + F G +CVRS  T+ FKLLN SLPFNKYA+LTTHN+F+
Sbjct  28    LSEKCTFNEDCATGLFCSSCSVEFKGSRCVRSLTTNPFKLLNTSLPFNKYAYLTTHNSFA  87

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I         P V   NQED+++QQL+NGVR LMLD YDF+GDVWLCHSFGGKCHDFTAF
Sbjct  88    IKRRPIPDPTPVVTFTNQEDTISQQLSNGVRALMLDTYDFKGDVWLCHSFGGKCHDFTAF  147

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
             EPA + LKE+E FLS+NPSEIVT+ILEDYV  P GLT VF  +GL+KYWFP+SNMPK+G 
Sbjct  148   EPAINALKEVENFLSSNPSEIVTLILEDYVEVPNGLTNVFIASGLIKYWFPISNMPKDGK  207

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DM+AKN RL+VF S K KEESEGIAYQWNYMVENQYG  GM  G CP R +S  
Sbjct  208   DWPLVKDMIAKNYRLIVFGSQKHKEESEGIAYQWNYMVENQYGKDGMVEGKCPKRKDSSE  267

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             L D +KSLVL+N F ++P++ + C  NS  LI+M+ TC++ AGNRWANF+AVD+YK    
Sbjct  268   LNDRSKSLVLINHFRTIPIQKVTCKVNSEDLINMLSTCHVVAGNRWANFVAVDYYK----  323

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVG  264
                                           RS+GGG+F+AVD LNG LLCG DDVH+C  
Sbjct  324   ------------------------------RSDGGGSFQAVDMLNGKLLCGCDDVHACAL  353

Query  263   G  261
             G
Sbjct  354   G  354



>gb|AFW88098.1| hypothetical protein ZEAMMB73_151451 [Zea mays]
Length=365

 Score =   439 bits (1129),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/354 (62%), Positives = 252/354 (71%), Gaps = 40/354 (11%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +DCGAG  C  C    SG  CVRS AT+ F+L+NNSLPFNKYA+LTTHNA++I G  S T
Sbjct  46    ADCGAGQWCFDCEPQLSGSHCVRSAATNPFQLINNSLPFNKYAYLTTHNAYAIVGEPSHT  105

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G+P V   NQED+      NGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT K
Sbjct  106   GIPRVTFDNQEDT------NGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEPALDTFK  159

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EIEAFL+ NPSEIVT+ILEDYV+AP GLT VF  +GL+KYWFPVS MP +G DWPLVSDM
Sbjct  160   EIEAFLAANPSEIVTLILEDYVHAPNGLTNVFNASGLLKYWFPVSRMPPSGQDWPLVSDM  219

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VA NQRLLVFTSV SK+ +EGIAYQWN+MVEN YGD GM  G C NR ES PL D TKSL
Sbjct  220   VATNQRLLVFTSVSSKQSAEGIAYQWNFMVENNYGDDGMDAGKCSNRAESAPLNDNTKSL  279

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F S+P++  AC+Q+S  L+DMV TCY AAGNRWANF+AVD+YK            
Sbjct  280   VLMNYFPSLPVKFTACLQHSQSLVDMVSTCYGAAGNRWANFVAVDYYK------------  327

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
                                   RS+GGG F+A D LNG LLCG  D+ +C  GS
Sbjct  328   ----------------------RSDGGGAFQATDLLNGRLLCGCQDIRACSQGS  359



>gb|KHG07279.1| hypothetical protein F383_15644 [Gossypium arboreum]
 gb|KHG08967.1| hypothetical protein F383_11224 [Gossypium arboreum]
Length=296

 Score =   436 bits (1122),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/327 (67%), Positives = 240/327 (73%), Gaps = 35/327 (11%)
 Frame = -3

Query  1223  LNNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDF  1044
             +NNSLPFNKYAFLTTHNA++I G+   T VP V   NQED +T QLNNG R LMLD YDF
Sbjct  3     MNNSLPFNKYAFLTTHNAYAIDGYPLHTPVPRVTFTNQEDMITDQLNNGARALMLDTYDF  62

Query  1043  RGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVF  864
              GDVW+CHSFGG+CHD TAF PA D LKEIEAFLS N  EIVT+ILEDYV  P GLTKVF
Sbjct  63    DGDVWMCHSFGGQCHDITAFGPAIDYLKEIEAFLSANTEEIVTLILEDYV-GPNGLTKVF  121

Query  863   TDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVEN  684
             TDAGLMKYWFPVSNMPKNG DWPLVSDMVA NQRLLVFTS++SKE SEGIAYQWNYMVEN
Sbjct  122   TDAGLMKYWFPVSNMPKNGEDWPLVSDMVANNQRLLVFTSIQSKEASEGIAYQWNYMVEN  181

Query  683   QYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYL  504
             QYGDGGM+ G CPNR ES  L D TKSLVLVN+F S+  +   C  NSG LI+M+ TCY 
Sbjct  182   QYGDGGMQAGSCPNRAESSGLDDKTKSLVLVNYFHSMSSKEKTCEDNSGDLINMLRTCYA  241

Query  503   AAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEA  324
             AAGNRWANF+AVD+YK                                  RSEGGG+F+A
Sbjct  242   AAGNRWANFVAVDYYK----------------------------------RSEGGGSFQA  267

Query  323   VDRLNGGLLCGKDDVHSCVGGSK*GGC  243
             VD LNG LLCG DD+H+CV GS  G C
Sbjct  268   VDTLNGKLLCGCDDIHACVVGSTSGAC  294



>dbj|BAJ88647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   438 bits (1126),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 264/373 (71%), Gaps = 38/373 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNK  1197
              +ACSG  C+ L + CS   DCG+ ++C +C + F+G +CVR+T  D FK+++ SLPFNK
Sbjct  10    AAACSGGRCE-LGDRCSSEADCGSELYCYNCWIEFAGKRCVRTTVADPFKIVDTSLPFNK  68

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             YAFLTTHN+FSI G  S TGVP +   NQ+DSVT QLNNGVR LMLDVYDFR ++WLCHS
Sbjct  69    YAFLTTHNSFSIRGEPSHTGVPRITLYNQDDSVTDQLNNGVRALMLDVYDFRDNIWLCHS  128

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
              GGKC DFTAFEPA  T+ E+EAFLS NPSEIVT+ILEDYV +  GL+K+F  AGL KYW
Sbjct  129   KGGKCFDFTAFEPAIGTMMEVEAFLSANPSEIVTLILEDYVGSDHGLSKLFDSAGLTKYW  188

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPVS+MP++GGDWP V DM+ +N RLLVFTS +SK+ +EGIAYQWN+MVE+QYGDGGM  
Sbjct  189   FPVSSMPRDGGDWPRVRDMIRRNHRLLVFTSDESKQRAEGIAYQWNFMVESQYGDGGMSS  248

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
               C  R ES  L + T+SLVLVN+F +VPL   ACV++S  L D++  C+ AAGNRWANF
Sbjct  249   RACHRRAESLDLDNRTRSLVLVNYFHTVPLRVTACVEHSLGLADVLRVCHAAAGNRWANF  308

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAVD+YK                                  RS+GGG FEA D LNG L+
Sbjct  309   LAVDYYK----------------------------------RSDGGGVFEATDMLNGMLI  334

Query  296   CGKDDVHSCVGGS  258
             CG+DDV +C  GS
Sbjct  335   CGRDDVRACTVGS  347



>ref|XP_003559985.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Brachypodium 
distachyon]
Length=382

 Score =   434 bits (1115),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 214/372 (58%), Positives = 263/372 (71%), Gaps = 40/372 (11%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
               +ACS   C+V D  CS   DCG+ ++C +C + F+G KCVRST  D FK+++ SLPFN
Sbjct  18    AATACSDGQCEVGDR-CSSEADCGSELYCYNCWIEFAGKKCVRSTVADPFKIVDTSLPFN  76

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KYAFLTTHN+FSI G  SRTGVP +   NQ+DS+T QLNNGVR LMLDVYDFR +VWLCH
Sbjct  77    KYAFLTTHNSFSIRGEPSRTGVPRITFYNQDDSITDQLNNGVRALMLDVYDFRDEVWLCH  136

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             S GGKC DFTAFEPA D ++E+EAFL+ NPSE+VT+ILEDYV++ +GL+K+F   GL ++
Sbjct  137   SKGGKCFDFTAFEPAIDAMREVEAFLAANPSEVVTLILEDYVSSDQGLSKLFNATGLTRH  196

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MP+ G DWP V DMVA++ RLLVFTS +SKE  EGIAYQWN+MVENQYGDGGM 
Sbjct  197   WFPVSRMPRRGEDWPRVRDMVARDHRLLVFTSDESKEAGEGIAYQWNFMVENQYGDGGMM  256

Query  659   -RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGP-LIDMVGTCYLAAGNRW  486
                 C +R ES  + DT +SLVLVN+F +VPL   ACV++S P L+D +  C+ AAGNRW
Sbjct  257   GLHGCRSRSESREMGDTARSLVLVNYFHTVPLRATACVEHSRPGLVDALRACHAAAGNRW  316

Query  485   ANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNG  306
             ANFLAVD+YK                                  RS+GGG FEA D LNG
Sbjct  317   ANFLAVDYYK----------------------------------RSDGGGVFEATDMLNG  342

Query  305   GLLCGKDDVHSC  270
              L+CG+DDV +C
Sbjct  343   MLICGRDDVRAC  354



>ref|XP_010238022.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brachypodium distachyon]
 ref|XP_010238023.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brachypodium distachyon]
 ref|XP_010238024.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brachypodium distachyon]
 ref|XP_010238025.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brachypodium distachyon]
 ref|XP_010238026.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brachypodium distachyon]
Length=393

 Score =   432 bits (1112),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 255/394 (65%), Gaps = 71/394 (18%)
 Frame = -3

Query  1328  EECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSIT  1158
             ++CS   DCGAG  C  C    SG  CVRS  T+ F+L+NNSLPFNKYA+LTTHNAF+I 
Sbjct  28    DDCSTSADCGAGQWCFDCEPELSGSHCVRSVGTNPFQLVNNSLPFNKYAYLTTHNAFAIV  87

Query  1157  GWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEP  978
             G  S TG+P +   NQED+VT QLNNGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEP
Sbjct  88    GEPSHTGIPRITFDNQEDTVTDQLNNGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEP  147

Query  977   AGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDW  798
             A DT  EI+AFLS NPSEIVT+ILEDYV+AP GLT VF  +GL KYWFPVS MP N  DW
Sbjct  148   ALDTFNEIQAFLSANPSEIVTLILEDYVSAPNGLTNVFKSSGLQKYWFPVSKMPSNSQDW  207

Query  797   PLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQY--------------------  678
             PLVSDMVA NQRLLVFTSV+SK+ +EGIAYQWN+MVEN                      
Sbjct  208   PLVSDMVASNQRLLVFTSVRSKQATEGIAYQWNFMVENNCEAPPFLQTKTLFTSSSSSVS  267

Query  677   --------------GDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNS  540
                           GD GM  G C NR ES PL D TKSLVL+N+F SVPL+  AC+Q+S
Sbjct  268   SVCIWKLHVSFVADGDAGMDAGQCSNRAESAPLADKTKSLVLMNYFPSVPLKLTACLQHS  327

Query  539   GPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVML  360
               L DMV TCY A+GNRWANFLAVD+YK                                
Sbjct  328   KGLTDMVNTCYSASGNRWANFLAVDYYK--------------------------------  355

Query  359   LQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGS  258
               RSEGGG F+ +D LNG LLCG  DV +C  GS
Sbjct  356   --RSEGGGVFQDMDLLNGKLLCGCQDVQACPKGS  387



>ref|XP_010528969.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Tarenaya 
hassleriana]
Length=481

 Score =   430 bits (1106),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 213/361 (59%), Positives = 250/361 (69%), Gaps = 46/361 (13%)
 Frame = -3

Query  1340  QVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNA  1170
             + L E CS   +C AG+ C+ C  G   PKCVRS  TDQF ++NNSLPFNKYAFLTTHN+
Sbjct  164   ERLGEICSSDEECDAGLSCVPC--GLQAPKCVRSNFTDQFAIVNNSLPFNKYAFLTTHNS  221

Query  1169  FSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFT  990
             F+I G             NQEDS+TQQLNNGVR LM+D YDF+G+VWLCHSFGG C+D T
Sbjct  222   FAIEGKPFHMA-------NQEDSITQQLNNGVRALMMDTYDFKGEVWLCHSFGGNCYDLT  274

Query  989   AFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKN  810
             AF PA DT KEI AFL+ NPSEI+T+ LEDYV  P  L KVFTD+GL K+WFPV NMP+ 
Sbjct  275   AFNPAIDTFKEISAFLAANPSEIITVFLEDYVKTPNALIKVFTDSGLKKFWFPVQNMPRP  334

Query  809   GGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGES  630
             G DWP V DMV+ NQRL+VFTS KSKE+SEGIAYQWNY+VENQYGD G KR +C NRGES
Sbjct  335   GQDWPTVKDMVSNNQRLIVFTSSKSKEQSEGIAYQWNYVVENQYGDDGEKRNECRNRGES  394

Query  629   PPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVV  450
              PLTD TKSLVLVN F S P++ ++C  NS  L+D++ TCY AAGNRWANF+AVDFYKV 
Sbjct  395   APLTDKTKSLVLVNHFKSFPVKALSCGDNSEGLLDVIQTCYNAAGNRWANFVAVDFYKV-  453

Query  449   KSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                              S+G G F A+D+LNG +LCG +DVH C
Sbjct  454   ---------------------------------SDGAGVFRALDKLNGEILCGGEDVHLC  480

Query  269   V  267
              
Sbjct  481   T  481



>ref|XP_009123955.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Brassica 
rapa]
 emb|CDX98120.1| BnaA06g08710D [Brassica napus]
Length=348

 Score =   422 bits (1085),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 248/354 (70%), Gaps = 46/354 (13%)
 Frame = -3

Query  1331  DEECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGW  1152
             DEECS    G+ C  C  G    +CVRS  TDQF L+NNS+PFNKYAFLTTHN+++I G 
Sbjct  39    DEECS---VGLGCFKC--GIDAARCVRSNITDQFSLVNNSMPFNKYAFLTTHNSYAIEG-  92

Query  1151  SSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAG  972
                     +    QEDS+T+QLN+GVR LMLD YD+ GDVWLCHSF  +C +FT F  A 
Sbjct  93    ------KPLHVATQEDSITEQLNSGVRALMLDTYDYEGDVWLCHSFNEQCFEFTKFNRAI  146

Query  971   DTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPL  792
             DTL E+ AFL+ NPSEIVTI LEDYV +P  LTKVFTD+GL K+WFPV +MPK G DWPL
Sbjct  147   DTLAEVFAFLTANPSEIVTIFLEDYVKSPNALTKVFTDSGLKKFWFPVEDMPKGGQDWPL  206

Query  791   VSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDT  612
             V DMVA N RL+VFTS KSK+E+EGIAYQWNY++ENQYGD G+K  +C NRGES  LTD 
Sbjct  207   VKDMVANNHRLVVFTSDKSKQETEGIAYQWNYVLENQYGDDGVKPSECSNRGESAQLTDK  266

Query  611   TKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRI  432
             TK+LVLVN F +VP++ ++C +NS  LID + TCY+AAG+RWANF+AVDFYK        
Sbjct  267   TKALVLVNHFSTVPVKLLSCEENSQHLIDTIKTCYVAAGDRWANFVAVDFYK--------  318

Query  431   YTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                       RS GGGTF+AVD+LNGGLLCG+DDVH C
Sbjct  319   --------------------------RSNGGGTFQAVDKLNGGLLCGRDDVHDC  346



>emb|CDY36400.1| BnaC05g10010D [Brassica napus]
Length=348

 Score =   421 bits (1082),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/361 (57%), Positives = 251/361 (70%), Gaps = 47/361 (13%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHN  1173
             G+ C   DEECS    G+ C  C  G    +CVRS  TDQF L+NNS+PFNKYAFLTTHN
Sbjct  33    GDQCSS-DEECS---VGLGCFKC--GIDAARCVRSNITDQFSLVNNSMPFNKYAFLTTHN  86

Query  1172  AFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDF  993
             +++I G         +    QEDS+T+QLN+GVR LMLD YD+ GDVWLCHSF  +C +F
Sbjct  87    SYAIEG-------KPLHVATQEDSITEQLNSGVRALMLDTYDYEGDVWLCHSFHEQCFEF  139

Query  992   TAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPK  813
             T F  A DT +E+ AFL+ NPSEIVTI LEDYV +P  LTKVFTD+GL K+WFPV +MPK
Sbjct  140   TKFNRAIDTFEEVFAFLTANPSEIVTIFLEDYVKSPNALTKVFTDSGLKKFWFPVEDMPK  199

Query  812   NGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGE  633
              G DWPLV DMVA N RL+VFTS KSK+E+EGIAYQWNY++ENQYGD G+K  +C NRGE
Sbjct  200   GGQDWPLVKDMVANNHRLVVFTSDKSKQETEGIAYQWNYVLENQYGDDGVKPSECSNRGE  259

Query  632   SPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKV  453
             S  LTD TK+LVL+N F ++P++ M+C +NS  LID + TCY+AAG+RWANF+AVDFYK 
Sbjct  260   SAQLTDKTKALVLINHFSTIPVKLMSCEENSQHLIDTIKTCYVAAGDRWANFVAVDFYK-  318

Query  452   VKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHS  273
                                              RS+GGGTF+AVD+LNG LLCG+DDVH 
Sbjct  319   ---------------------------------RSDGGGTFQAVDKLNGELLCGRDDVHD  345

Query  272   C  270
             C
Sbjct  346   C  346



>ref|XP_006417100.1| hypothetical protein EUTSA_v10009757mg [Eutrema salsugineum]
 gb|ESQ35453.1| hypothetical protein EUTSA_v10009757mg [Eutrema salsugineum]
Length=346

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 252/358 (70%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   +C  G+ C  C  G    +CVRS  TDQF ++NNS+PFNKYAFLTTHN+++
Sbjct  32    LGDQCSSDEECNVGLGCFKC--GIDVARCVRSNVTDQFSVVNNSMPFNKYAFLTTHNSYA  89

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G         +    QED++TQQLN+GVR LMLD YD+ GDVWLCHSF  KC +FT F
Sbjct  90    IEG-------KPLHVATQEDTITQQLNSGVRALMLDTYDYEGDVWLCHSFNEKCFEFTKF  142

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A  T +EI AFL+ NPSEIVT+ILEDYV +P GLTKVFT++GL K+WFPV NMPK G 
Sbjct  143   NRAIYTFEEIFAFLTANPSEIVTLILEDYVKSPNGLTKVFTESGLKKFWFPVQNMPKAGQ  202

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DM+A N RL+VFTS KSK+E+EGIAYQWNY+VENQYGD G+K  +C NR ES P
Sbjct  203   DWPLVKDMIANNHRLIVFTSAKSKQETEGIAYQWNYVVENQYGDNGVKPWECSNRAESAP  262

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTD TK+LVLVN F +VP++ + C +NS  L+DM+ TCY+AAG+RWANF+AV+FYK    
Sbjct  263   LTDKTKALVLVNHFRTVPVKILTCEENSKHLLDMIKTCYVAAGDRWANFVAVNFYK----  318

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS+GGGTF+AVD+LNG LLCG+DDVH+C
Sbjct  319   ------------------------------RSDGGGTFQAVDKLNGELLCGRDDVHAC  346



>ref|XP_002890016.1| hypothetical protein ARALYDRAFT_334664 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66275.1| hypothetical protein ARALYDRAFT_334664 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 249/358 (70%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G    +CVRS  TDQF ++NNS+PFNKYAFLTTHN+++
Sbjct  32    LGDQCSSDEDCNVGLGCFKC--GVDVARCVRSNITDQFSVVNNSMPFNKYAFLTTHNSYA  89

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G              QED++ QQLN+GVR LMLD YD+ GDVWLCHSF  +C +FT F
Sbjct  90    IEGKPFHVAT-------QEDTIVQQLNSGVRALMLDTYDYEGDVWLCHSFDEQCFEFTKF  142

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI AFL+ NPSEIVT++LEDYV +  GLTKVFTD+GL K+WFPV NMP  G 
Sbjct  143   NRAIDTFKEIFAFLTANPSEIVTLLLEDYVKSQNGLTKVFTDSGLKKFWFPVQNMPLGGQ  202

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA N RL+VFTS KSK+E+EGIAYQWNY+VENQYGD G+K  +C NR +S  
Sbjct  203   DWPLVKDMVANNHRLIVFTSAKSKQETEGIAYQWNYVVENQYGDNGVKPDECSNRADSAL  262

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTDTTKSLVLVN F +VP++ + C +NS  L+DM+ TCY+AAGNRWANF+AV+FYK    
Sbjct  263   LTDTTKSLVLVNHFKTVPVKILTCEENSEQLLDMIKTCYVAAGNRWANFVAVNFYK----  318

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS+GGGTF+AVD+LNG LLCG+DDVH+C
Sbjct  319   ------------------------------RSDGGGTFQAVDKLNGELLCGRDDVHAC  346



>ref|NP_172824.3| phospholipase C/ phosphoric diester hydrolase [Arabidopsis thaliana]
 gb|AAF81295.1|AC027656_12 Contains similarity to MAP3K-like protein kinase from Arabidopsis 
thaliana gb|Z99707 [Arabidopsis thaliana]
 gb|AEE29057.1| phospholipase C/ phosphoric diester hydrolase [Arabidopsis thaliana]
Length=346

 Score =   416 bits (1069),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 202/358 (56%), Positives = 246/358 (69%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G    +CVRS  TDQF ++NNS+PFNKYAFLTTHN+++
Sbjct  32    LGDQCSSDEDCNVGLGCFKC--GIDVARCVRSNITDQFSIVNNSMPFNKYAFLTTHNSYA  89

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G +            QED++ QQLN+GVR LMLD YD+ GDVW CHSF  +C +FT F
Sbjct  90    IEGKALHVAT-------QEDTIVQQLNSGVRALMLDTYDYEGDVWFCHSFDEQCFEFTKF  142

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI AFL+ NPSEIVT+ILEDYV +  GLTKVFTD+GL K+WFPV NMP  G 
Sbjct  143   NRAIDTFKEIFAFLTANPSEIVTLILEDYVKSQNGLTKVFTDSGLKKFWFPVQNMPIGGQ  202

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA N RL+VFTS KSK+E+EGIAYQWNYMVENQYGD G+K  +C NR +S  
Sbjct  203   DWPLVKDMVANNHRLIVFTSAKSKQETEGIAYQWNYMVENQYGDDGVKPDECSNRADSAL  262

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTD TK+LV VN F +VP++ + C +NS  L+DM+ TCY+AAGNRWANF+AV+FYK    
Sbjct  263   LTDKTKALVSVNHFKTVPVKILTCEENSEQLLDMIKTCYVAAGNRWANFVAVNFYK----  318

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS GGGTF+A+D+LNG LLCG+DDVH+C
Sbjct  319   ------------------------------RSNGGGTFQAIDKLNGELLCGRDDVHAC  346



>ref|XP_010476388.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Camelina sativa]
Length=344

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 245/358 (68%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G +  +CVRS  TD F ++NNS+PFNKYAFLTTHN+F+
Sbjct  30    LGDKCSSDEDCNVGLGCYKC--GINVARCVRSNITDPFSVVNNSMPFNKYAFLTTHNSFA  87

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G              QED++ QQLN+GVR LMLD YD++GDVWLCHSF  KC ++T F
Sbjct  88    IEGKPFHVAA-------QEDTIVQQLNSGVRALMLDTYDYQGDVWLCHSFDEKCFEYTKF  140

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI  FL+ NP EIVT+ LEDYV +P GLTKVFTD+GL K+WFPV NMP  G 
Sbjct  141   NRAIDTFKEIFTFLTANPLEIVTLFLEDYVKSPNGLTKVFTDSGLKKFWFPVENMPLGGR  200

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA NQRL+VFTS KSK+ +EGIAYQWNY+VENQYGD G+KR +C NRGES  
Sbjct  201   DWPLVKDMVANNQRLIVFTSAKSKQNTEGIAYQWNYVVENQYGDDGVKRDECSNRGESAL  260

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTD  K+LVLVN F +VP++ + C  NS  L+DM+ TCYLAAGNRWAN++AV+FYK    
Sbjct  261   LTDKNKALVLVNHFKTVPVKILTCEDNSEQLVDMIKTCYLAAGNRWANYVAVNFYK----  316

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS GGGTF AVD+LNG LLCG+DDVH+C
Sbjct  317   ------------------------------RSSGGGTFRAVDKLNGELLCGRDDVHAC  344



>gb|EMT32828.1| PI-PLC X domain-containing protein [Aegilops tauschii]
Length=436

 Score =   416 bits (1068),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 253/414 (61%), Gaps = 98/414 (24%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLL--------------NNSLPFNKYAFLT  1182
             +DCGAG  C  C    +G  CVRS AT+ F+L+              NNSLPFNKYA+LT
Sbjct  35    ADCGAGQWCFDCEPELAGSHCVRSAATNPFQLVLYIGITFSTCIEISNNSLPFNKYAYLT  94

Query  1181  THNAFSITGWSSRTGVPNVAPKNQEDSVTQQLN---------------------------  1083
             THN+F+I G  S TG+P +   NQED+VT QLN                           
Sbjct  95    THNSFAIVGEPSHTGIPRITFDNQEDTVTDQLNVASASSDKILLLFYISYLTSINSLHNP  154

Query  1082  ----NGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVT  915
                 NGVR LMLD YDF+GDVWLCHS GGKC+DFTAFEPA DT KEIEAFLS NPSEIVT
Sbjct  155   NVLQNGVRALMLDTYDFKGDVWLCHSSGGKCNDFTAFEPALDTFKEIEAFLSANPSEIVT  214

Query  914   IILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKS  735
             +ILEDYVNAP GLT VF  +GL KYWFPVS MP+NG DWPLVSDMV  NQRLLVFTS +S
Sbjct  215   LILEDYVNAPNGLTNVFNASGLQKYWFPVSKMPQNGQDWPLVSDMVTSNQRLLVFTSARS  274

Query  734   KEESEGIAYQWNYMVENQY-------------------GDGGMKRGDCPNRGESPPLTDT  612
             K+ +EGIAYQWN+MVEN +                   GD GM  G+C NR ES PL D 
Sbjct  275   KQVTEGIAYQWNFMVENNFPHYLKYRCSEIDRFHCVEDGDDGMDAGECSNRAESAPLNDK  334

Query  611   TKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRI  432
             TKSLVL+N+F SVP++  AC+Q++  L DM  TCY AAGNRWANF+AVD+YK        
Sbjct  335   TKSLVLMNYFPSVPVKLTACLQHNKGLTDMASTCYSAAGNRWANFIAVDYYK--------  386

Query  431   YTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                       RSEGGG F+A D LNG LLCG  DV +C
Sbjct  387   --------------------------RSEGGGAFQATDLLNGMLLCGCQDVKAC  414



>gb|EMT32829.1| PI-PLC X domain-containing protein [Aegilops tauschii]
Length=320

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 230/317 (73%), Gaps = 34/317 (11%)
 Frame = -3

Query  1220  NNSLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFR  1041
             NNSLPFNKYA+LTTHN+F+I G  S TG+P +   NQED+VT QL NGVR LMLD YDF+
Sbjct  23    NNSLPFNKYAYLTTHNSFAIVGEPSHTGIPRITFDNQEDTVTDQLKNGVRALMLDTYDFK  82

Query  1040  GDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFT  861
             G VWLCHS GGKC+DFTAFEPA DT KEIEAFLS NPSEIVT+ILEDYV+AP GLT VF 
Sbjct  83    GSVWLCHSSGGKCNDFTAFEPALDTFKEIEAFLSANPSEIVTLILEDYVHAPNGLTNVFK  142

Query  860   DAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ  681
              +GL KYWFPVSNMPK+G +WPLVS+MV  NQRLLVFTS +SK+ +EGIAYQWN+MVEN 
Sbjct  143   ASGLQKYWFPVSNMPKDGQEWPLVSEMVTSNQRLLVFTSARSKQVTEGIAYQWNFMVENN  202

Query  680   YGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLA  501
             YGD GM  G C NR ES PL D TKSLVL+N+F SVP++P AC+Q+S  L  M  TCY +
Sbjct  203   YGDDGMDAGKCSNRAESAPLNDKTKSLVLMNYFPSVPMKPTACLQHSRGLTGMSNTCYGS  262

Query  500   AGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAV  321
             AGNRWANF+AVD+YK                                  RSEGGG F+A 
Sbjct  263   AGNRWANFIAVDYYK----------------------------------RSEGGGAFQAT  288

Query  320   DRLNGGLLCGKDDVHSC  270
             D LNG LLCG  DV +C
Sbjct  289   DLLNGMLLCGCQDVKAC  305



>ref|XP_010099315.1| hypothetical protein L484_018177 [Morus notabilis]
 gb|EXB77661.1| hypothetical protein L484_018177 [Morus notabilis]
Length=325

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 220/382 (58%), Positives = 251/382 (66%), Gaps = 77/382 (20%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSL  1209
             F+V TS CS   C++LDE CS   DC +G++C SCP GFSG +CVRSTAT+QFKL+NNSL
Sbjct  16    FSVATS-CSNGKCRLLDE-CSNDGDCESGLYCFSCPQGFSGTRCVRSTATNQFKLVNNSL  73

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKYAFLTTHNAF+I       G P +   NQEDSVTQQLN                  
Sbjct  74    PFNKYAFLTTHNAFAIDD-----GAPRLTVTNQEDSVTQQLN------------------  110

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
                              A +TLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFT AGL
Sbjct  111   ---------------RSAIETLKEIEAFLSANPTEIVTLILEDYVKAPNGLTKVFTQAGL  155

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
             MKYWFPV+NMPK+  DWPLVSDMVAKNQRL+VFTS+KSKEE+EGIAYQWNYMVEN YGD 
Sbjct  156   MKYWFPVTNMPKSDQDWPLVSDMVAKNQRLIVFTSIKSKEETEGIAYQWNYMVENNYGDK  215

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             GM+ G C NR ES PL D +KSLVLVN F S P++ + C  NS  LI M+ TCY +AGNR
Sbjct  216   GMEAGSCSNRVESSPLDDKSKSLVLVNHFNSAPIKQLICENNSADLIKMLQTCYGSAGNR  275

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
             WANF+AVDFYK                                  RSEGGG F+AVD LN
Sbjct  276   WANFVAVDFYK----------------------------------RSEGGGAFQAVDTLN  301

Query  308   GGLLCGKDDVHSCVGGSK*GGC  243
             G LLCG DD+H+C+  S  G C
Sbjct  302   GKLLCGCDDIHACMLESTSGVC  323



>ref|XP_008341802.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Malus domestica]
 ref|XP_008362220.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Malus domestica]
Length=319

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/380 (56%), Positives = 242/380 (64%), Gaps = 84/380 (22%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V  ACS   C++LDE CS   DC AG++C  CP GFSG +C+RS  TDQFKLLN      
Sbjct  20    VAKACSNGQCKLLDE-CSMDADCEAGLYCGCCPQGFSGSRCIRSAITDQFKLLN------  72

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
                                                     GVR LMLD YDF+ DVWLCH
Sbjct  73    ----------------------------------------GVRALMLDTYDFKDDVWLCH  92

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHDFTAFEPA DTLKE+EAFLS NPSEIVT+ILEDYV AP GLT VF  +GL  Y
Sbjct  93    SFNGQCHDFTAFEPAIDTLKEVEAFLSANPSEIVTLILEDYVEAPNGLTNVFNASGLKNY  152

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV++MPKNG DWPLVSDMVA NQRLLVFTS   KE+SEGIAYQWNYMVENQYGD GMK
Sbjct  153   WFPVTSMPKNGQDWPLVSDMVANNQRLLVFTSKSEKEQSEGIAYQWNYMVENQYGDDGMK  212

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NRGES PL D TKSLVLVN+F S+P +  +C  NSG LI+M+ TC+ AA NRWAN
Sbjct  213   EGSCSNRGESSPLDDKTKSLVLVNYFASIPFKLESCENNSGNLINMLYTCHGAAANRWAN  272

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RSEGGG+F+A+D LNG L
Sbjct  273   FVAVDFYK----------------------------------RSEGGGSFQALDNLNGEL  298

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG +DVH+CV GS  G C+
Sbjct  299   LCGCNDVHACVPGSPPGSCQ  318



>ref|XP_011008608.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X3 [Populus euphratica]
Length=353

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 244/375 (65%), Gaps = 84/375 (22%)
 Frame = -3

Query  1370  VTSACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V ++CS   C+ L +ECS   DC AG++CL+CPLGF G +CVRST TDQFKLLN      
Sbjct  29    VAASCSKGECR-LHDECSSNQDCEAGLYCLACPLGFQGTRCVRSTITDQFKLLN------  81

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
                                                     G R LMLD YDFRGDVWLCH
Sbjct  82    ----------------------------------------GARALMLDTYDFRGDVWLCH  101

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+CHD+TAF PA DTL+EIEAFLST+PSEIVTIILEDYV AP GLTKVFTDAGLMKY
Sbjct  102   SFKGQCHDYTAFGPAIDTLREIEAFLSTHPSEIVTIILEDYVQAPNGLTKVFTDAGLMKY  161

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+NMPKNG DWPLV+DMV  NQRLLVFTS++SKE SEGIAYQWN+MVENQYG+ GMK
Sbjct  162   WFPVTNMPKNGQDWPLVNDMVQNNQRLLVFTSIQSKEASEGIAYQWNFMVENQYGNVGMK  221

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G C NR ES  L D ++SLVLVN+F  +P++ ++C  NS  LI M+ TC  AA NRWAN
Sbjct  222   AGSCTNRKESSSLNDKSRSLVLVNYFRCIPMKKLSCEDNSRNLIKMLHTCSGAAANRWAN  281

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVD+YK                                  RSEGGG+F+AVD LNG L
Sbjct  282   FVAVDYYK----------------------------------RSEGGGSFQAVDLLNGKL  307

Query  299   LCGKDDVHSCVGGSK  255
             LCG DD+H+CV  S+
Sbjct  308   LCGCDDIHACVEESQ  322



>ref|XP_010458823.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Camelina sativa]
Length=344

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 244/358 (68%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G    +CVR+  TD F ++NNS+PFNKYAFLTTHN+F+
Sbjct  30    LGDQCSSNEDCNVGLGCYKC--GIDVARCVRTNITDPFSVVNNSMPFNKYAFLTTHNSFA  87

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G              QED++ QQLN+GVR LMLD YD++GDVWLCHSF  KC + T F
Sbjct  88    IEGKPFHVAA-------QEDTIVQQLNSGVRALMLDTYDYQGDVWLCHSFDEKCFELTKF  140

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI AFL+ NP EIVT+ LEDYV +P GLTKVFT++GL K+WFPV NMP  G 
Sbjct  141   NRAIDTFKEIFAFLTANPLEIVTLFLEDYVKSPNGLTKVFTNSGLKKFWFPVQNMPLGGQ  200

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA NQRL+VFTS +SK+ +EGIAYQWNY+VENQYGD G+K  +C NRGES  
Sbjct  201   DWPLVKDMVANNQRLIVFTSAESKQNTEGIAYQWNYVVENQYGDDGVKPDECSNRGESAL  260

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LT+  K+LVLVN F +VP++ + C  NS  L+DM+ TCYLAAGNRWAN++AV+FYK    
Sbjct  261   LTNKNKALVLVNHFRTVPVKILTCEDNSEQLLDMIKTCYLAAGNRWANYVAVNFYK----  316

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS GGGTF+AVD+LNG LLCG+DDVH+C
Sbjct  317   ------------------------------RSNGGGTFQAVDKLNGELLCGRDDVHAC  344



>ref|XP_006306173.1| hypothetical protein CARUB_v10011738mg [Capsella rubella]
 gb|EOA39071.1| hypothetical protein CARUB_v10011738mg [Capsella rubella]
Length=348

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 244/358 (68%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G     CVRS  TD F ++NNS+PFNKYAFLTTHN+++
Sbjct  32    LGDQCSSDEDCKVGLGCFKC--GIDIATCVRSNITDPFSVVNNSMPFNKYAFLTTHNSYA  89

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G              QED++ QQLN+GVR LMLD YD++GDVW CHSF  KC + T F
Sbjct  90    IEGKPLHVAT-------QEDTIVQQLNSGVRALMLDTYDYQGDVWFCHSFDEKCFELTKF  142

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KE+ AFL+ NPSEIVT+ LEDYV +P GLTKVFTD+GL K+WFPV NM   G 
Sbjct  143   NRAIDTFKELFAFLTANPSEIVTLFLEDYVKSPNGLTKVFTDSGLKKFWFPVQNMALGGR  202

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA N RL+VFTS +SK+ +EGIAYQWNY+VENQYGD G+K  +C NRGES  
Sbjct  203   DWPLVKDMVANNHRLIVFTSAESKQVTEGIAYQWNYVVENQYGDDGVKPDECSNRGESKL  262

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTD TK+LVLVN F +VP++ + C +NS  L+DM+ TCY+AAGNRWAN++AV+FYK    
Sbjct  263   LTDKTKALVLVNHFKTVPVKLLTCEENSEQLLDMIKTCYVAAGNRWANYVAVNFYK----  318

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS+GGGTF+AVD+LNG LLCG+DDVH+C
Sbjct  319   ------------------------------RSDGGGTFQAVDKLNGELLCGRDDVHAC  346



>gb|KCW55192.1| hypothetical protein EUGRSUZ_I01136 [Eucalyptus grandis]
Length=355

 Score =   404 bits (1037),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 239/349 (68%), Gaps = 36/349 (10%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             C +G+HC +C   G + P+C R   +D     NN LPFN+Y++LTTHNA++     S TG
Sbjct  34    CDSGLHCETCVTDGNARPRCTRIRPSDPTSQANN-LPFNRYSWLTTHNAYARMQVKSATG  92

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
                V+P+NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHS+GG C+++TAF+PA + LKE
Sbjct  93    SVIVSPRNQQDSVTDQLNNGVRGLMLDMYDFENDIWLCHSYGGNCYNYTAFQPAINVLKE  152

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             ++ FL  NPSEIVTII+EDYV++P GLTKVF  AGL KYWFPVS MPKNGGDWP V+DMV
Sbjct  153   LQTFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAGLRKYWFPVSRMPKNGGDWPTVNDMV  212

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
              KNQRLLVFTS  SKE SEGIAYQW YMVENQYGDGGM  G CPNR ESP +  T++SLV
Sbjct  213   QKNQRLLVFTSKSSKEASEGIAYQWRYMVENQYGDGGMTAGLCPNRAESPSMNTTSRSLV  272

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F  +P    AC  NS PLI MV TCY AAG RW NF+AVDFYK             
Sbjct  273   LVNYFPDMPDFTKACKHNSAPLISMVNTCYGAAGKRWPNFIAVDFYK-------------  319

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                  RS+GGG   AVD  NG L+CG + + SC
Sbjct  320   ---------------------RSDGGGAPAAVDMANGHLVCGCNSITSC  347



>ref|XP_010028455.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Eucalyptus grandis]
Length=357

 Score =   404 bits (1037),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 239/349 (68%), Gaps = 36/349 (10%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             C +G+HC +C   G + P+C R   +D     NN LPFN+Y++LTTHNA++     S TG
Sbjct  36    CDSGLHCETCVTDGNARPRCTRIRPSDPTSQANN-LPFNRYSWLTTHNAYARMQVKSATG  94

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
                V+P+NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHS+GG C+++TAF+PA + LKE
Sbjct  95    SVIVSPRNQQDSVTDQLNNGVRGLMLDMYDFENDIWLCHSYGGNCYNYTAFQPAINVLKE  154

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             ++ FL  NPSEIVTII+EDYV++P GLTKVF  AGL KYWFPVS MPKNGGDWP V+DMV
Sbjct  155   LQTFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAGLRKYWFPVSRMPKNGGDWPTVNDMV  214

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
              KNQRLLVFTS  SKE SEGIAYQW YMVENQYGDGGM  G CPNR ESP +  T++SLV
Sbjct  215   QKNQRLLVFTSKSSKEASEGIAYQWRYMVENQYGDGGMTAGLCPNRAESPSMNTTSRSLV  274

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F  +P    AC  NS PLI MV TCY AAG RW NF+AVDFYK             
Sbjct  275   LVNYFPDMPDFTKACKHNSAPLISMVNTCYGAAGKRWPNFIAVDFYK-------------  321

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                  RS+GGG   AVD  NG L+CG + + SC
Sbjct  322   ---------------------RSDGGGAPAAVDMANGHLVCGCNSITSC  349



>ref|XP_010028454.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW55189.1| hypothetical protein EUGRSUZ_I01136 [Eucalyptus grandis]
Length=400

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 241/358 (67%), Gaps = 36/358 (10%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             C +G+HC +C   G + P+C R   +D     NN LPFN+Y++LTTHNA++     S TG
Sbjct  36    CDSGLHCETCVTDGNARPRCTRIRPSDPTSQANN-LPFNRYSWLTTHNAYARMQVKSATG  94

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
                V+P+NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHS+GG C+++TAF+PA + LKE
Sbjct  95    SVIVSPRNQQDSVTDQLNNGVRGLMLDMYDFENDIWLCHSYGGNCYNYTAFQPAINVLKE  154

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             ++ FL  NPSEIVTII+EDYV++P GLTKVF  AGL KYWFPVS MPKNGGDWP V+DMV
Sbjct  155   LQTFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAGLRKYWFPVSRMPKNGGDWPTVNDMV  214

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
              KNQRLLVFTS  SKE SEGIAYQW YMVENQYGDGGM  G CPNR ESP +  T++SLV
Sbjct  215   QKNQRLLVFTSKSSKEASEGIAYQWRYMVENQYGDGGMTAGLCPNRAESPSMNTTSRSLV  274

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F  +P    AC  NS PLI MV TCY AAG RW NF+AVDFYK             
Sbjct  275   LVNYFPDMPDFTKACKHNSAPLISMVNTCYGAAGKRWPNFIAVDFYK-------------  321

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                  RS+GGG   AVD  NG L+CG + + SC      G C
Sbjct  322   ---------------------RSDGGGAPAAVDMANGHLVCGCNSITSCKANMTFGSC  358



>gb|KCW55193.1| hypothetical protein EUGRSUZ_I01136 [Eucalyptus grandis]
Length=354

 Score =   403 bits (1036),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 239/349 (68%), Gaps = 36/349 (10%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             C +G+HC +C   G + P+C R   +D     NN LPFN+Y++LTTHNA++     S TG
Sbjct  34    CDSGLHCETCVTDGNARPRCTRIRPSDPTSQANN-LPFNRYSWLTTHNAYARMQVKSATG  92

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
                V+P+NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHS+GG C+++TAF+PA + LKE
Sbjct  93    SVIVSPRNQQDSVTDQLNNGVRGLMLDMYDFENDIWLCHSYGGNCYNYTAFQPAINVLKE  152

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             ++ FL  NPSEIVTII+EDYV++P GLTKVF  AGL KYWFPVS MPKNGGDWP V+DMV
Sbjct  153   LQTFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAGLRKYWFPVSRMPKNGGDWPTVNDMV  212

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
              KNQRLLVFTS  SKE SEGIAYQW YMVENQYGDGGM  G CPNR ESP +  T++SLV
Sbjct  213   QKNQRLLVFTSKSSKEASEGIAYQWRYMVENQYGDGGMTAGLCPNRAESPSMNTTSRSLV  272

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             LVN+F  +P    AC  NS PLI MV TCY AAG RW NF+AVDFYK             
Sbjct  273   LVNYFPDMPDFTKACKHNSAPLISMVNTCYGAAGKRWPNFIAVDFYK-------------  319

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                  RS+GGG   AVD  NG L+CG + + SC
Sbjct  320   ---------------------RSDGGGAPAAVDMANGHLVCGCNSITSC  347



>ref|XP_010495516.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Camelina sativa]
Length=344

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 244/358 (68%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G    +CVRS  TD F ++NNS+PFNKYAFLTTHN+F+
Sbjct  30    LGDQCSSNEDCNVGLGCYKC--GIDVARCVRSNITDPFSVVNNSMPFNKYAFLTTHNSFA  87

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G              QED++ QQLN+GVR LMLD YD++GDVWLCHSF  +C + T F
Sbjct  88    IEGKPFHVAA-------QEDTIVQQLNSGVRALMLDTYDYQGDVWLCHSFDERCFEITKF  140

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI AFL+ NP EIVT+ LEDYV +P GLTKVFT++GL K+WFPV NM   G 
Sbjct  141   NRAIDTFKEIFAFLTANPLEIVTLFLEDYVKSPNGLTKVFTNSGLKKFWFPVENMLLGGR  200

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA NQRL+VFTS +SK+ +EGIAYQWNY+VENQYGD G+K  +C NRGES  
Sbjct  201   DWPLVKDMVANNQRLIVFTSAESKQNTEGIAYQWNYVVENQYGDDGVKPDECSNRGESAL  260

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LT+ +K+LVLVN F +VP++ + C  NS  L+DM+ TCYLAAGNRWAN++AV+FYK    
Sbjct  261   LTNKSKALVLVNHFRTVPVKILTCEDNSEQLLDMIKTCYLAAGNRWANYVAVNFYK----  316

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS GGGTF+AVD+LNG LLCG+DDVH+C
Sbjct  317   ------------------------------RSNGGGTFQAVDKLNGELLCGRDDVHAC  344



>ref|XP_010912463.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X4 [Elaeis guineensis]
Length=404

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/372 (54%), Positives = 247/372 (66%), Gaps = 39/372 (10%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             G+ C ++D  C +   G+HC +C   G   P+C R   TD      + LPFN+YA++TTH
Sbjct  27    GKTC-LIDRNCDE---GLHCETCVADGDIRPRCTRIKPTDPKSKGGSDLPFNRYAWMTTH  82

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++  G  S TG P +AP NQ+DSV  QLNNGVRGLMLD+YDF  D+WLCHSFGG C++
Sbjct  83    NSYAKIGQKSYTGTPTLAPMNQQDSVADQLNNGVRGLMLDMYDFLNDIWLCHSFGGNCYN  142

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
              TAF+PA + LKEI+AFL  NPSE++TI +EDYV +PKGLTKVFT++GLMKYWFPVS MP
Sbjct  143   ITAFQPAINVLKEIQAFLEANPSEVITIFIEDYVTSPKGLTKVFTNSGLMKYWFPVSRMP  202

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNGGDWPL+SDM+ KNQRLLVFTS  SKE +EGIAYQW Y+VENQYGDGGMK G CPNR 
Sbjct  203   KNGGDWPLLSDMINKNQRLLVFTSKSSKEATEGIAYQWRYVVENQYGDGGMKDGSCPNRA  262

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ESP +   ++SLVL+N+F   P    AC +NS PL  M+ TC+ A+ NRW NF+AVDFYK
Sbjct  263   ESPSMNTKSRSLVLMNYFPDAPNLAAACKENSAPLETMLNTCHNASANRWPNFIAVDFYK  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS GGG  EA D  NG L+CG + V 
Sbjct  323   ----------------------------------RSNGGGAPEATDTANGQLICGCNSVA  348

Query  275   SCVGGSK*GGCR  240
              C   +  G C+
Sbjct  349   QCKINASWGQCQ  360



>ref|XP_010912461.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Elaeis guineensis]
Length=414

 Score =   404 bits (1037),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 200/372 (54%), Positives = 247/372 (66%), Gaps = 39/372 (10%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             G+ C ++D  C +   G+HC +C   G   P+C R   TD      + LPFN+YA++TTH
Sbjct  37    GKTC-LIDRNCDE---GLHCETCVADGDIRPRCTRIKPTDPKSKGGSDLPFNRYAWMTTH  92

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++  G  S TG P +AP NQ+DSV  QLNNGVRGLMLD+YDF  D+WLCHSFGG C++
Sbjct  93    NSYAKIGQKSYTGTPTLAPMNQQDSVADQLNNGVRGLMLDMYDFLNDIWLCHSFGGNCYN  152

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
              TAF+PA + LKEI+AFL  NPSE++TI +EDYV +PKGLTKVFT++GLMKYWFPVS MP
Sbjct  153   ITAFQPAINVLKEIQAFLEANPSEVITIFIEDYVTSPKGLTKVFTNSGLMKYWFPVSRMP  212

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNGGDWPL+SDM+ KNQRLLVFTS  SKE +EGIAYQW Y+VENQYGDGGMK G CPNR 
Sbjct  213   KNGGDWPLLSDMINKNQRLLVFTSKSSKEATEGIAYQWRYVVENQYGDGGMKDGSCPNRA  272

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ESP +   ++SLVL+N+F   P    AC +NS PL  M+ TC+ A+ NRW NF+AVDFYK
Sbjct  273   ESPSMNTKSRSLVLMNYFPDAPNLAAACKENSAPLETMLNTCHNASANRWPNFIAVDFYK  332

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS GGG  EA D  NG L+CG + V 
Sbjct  333   ----------------------------------RSNGGGAPEATDTANGQLICGCNSVA  358

Query  275   SCVGGSK*GGCR  240
              C   +  G C+
Sbjct  359   QCKINASWGQCQ  370



>ref|XP_006856490.1| hypothetical protein AMTR_s00046p00078310 [Amborella trichopoda]
 gb|ERN17957.1| hypothetical protein AMTR_s00046p00078310 [Amborella trichopoda]
Length=419

 Score =   404 bits (1037),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 254/379 (67%), Gaps = 38/379 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             ++ACS  +CQ+LD   E SDCG+G++C +CP +  + P C R  AT    ++N  L FNK
Sbjct  23    STACSNGDCQLLDSCSETSDCGSGLYCGNCPAMNKNQPVCTRGQATQVTNIIN-GLAFNK  81

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y +L THNAFSI G  S TG   V   NQEDSVT QL NGVRGLMLD+YD+  D+WLCHS
Sbjct  82    YTWLVTHNAFSIVGEPSLTGAQRVTFYNQEDSVTNQLLNGVRGLMLDMYDYNNDIWLCHS  141

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G+C +FTAFEPA +TL+E+EAFLS+NPSEIVTII+EDYV +PKGLT +FT+AGL+KYW
Sbjct  142   FQGQCFNFTAFEPAINTLREVEAFLSSNPSEIVTIIIEDYVRSPKGLTNLFTNAGLLKYW  201

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPVS+MPKNG DWP V+DMV  NQRLLVFTSV SKE  EGIAYQW YMVEN+ GDGG+  
Sbjct  202   FPVSSMPKNGEDWPTVTDMVKNNQRLLVFTSVASKEADEGIAYQWRYMVENESGDGGITP  261

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
               C NR ES  L   T++L + N+F ++P +  AC ++S  LIDMV  CY AAGNR  NF
Sbjct  262   ASCANRKESHNLNSRTETLFVQNYFPTIPNQSEACKEHSTSLIDMVNACYRAAGNRMPNF  321

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAV+FY                                   RS+GGG F+ +DR+NG  L
Sbjct  322   LAVNFY----------------------------------MRSDGGGVFDTIDRMNGRSL  347

Query  296   CGKDDVHSCVGGSK*GGCR  240
             CG   V +C  G+  G C+
Sbjct  348   CGCTTVTACQAGAPQGTCK  366



>ref|XP_004505236.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cicer arietinum]
Length=408

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 244/362 (67%), Gaps = 38/362 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C  G+HC +C   G   P+C R    +    +   LPFN+Y++LTTHN+F++ G  S T
Sbjct  38    NCDLGLHCETCVANGNLRPRCTRIQPINPTSKVK-GLPFNRYSWLTTHNSFALLGQKSAT  96

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+D++T QLNNGVRGLMLD+YDF  DVWLCHSFGG+C+++TAF+PA + LK
Sbjct  97    GSVILAPTNQQDTITSQLNNGVRGLMLDMYDFENDVWLCHSFGGQCYNYTAFQPAINVLK  156

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSEIVTII+EDYV +PKGLTKVF  AGL KYWFPVS MPKNGG+WP V DM
Sbjct  157   EIQTFLEANPSEIVTIIIEDYVTSPKGLTKVFNAAGLRKYWFPVSRMPKNGGNWPTVDDM  216

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYG--DGGMKRGDCPNRGESPPLTDTTK  606
             V KNQRL+VFTS  SKE SEGIAY+W Y+VENQYG  +GGMK G CPNR ESPP+  T++
Sbjct  217   VQKNQRLVVFTSKASKEASEGIAYEWRYLVENQYGNSNGGMKAGSCPNRAESPPMNTTSR  276

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SLVLVN+F  +P E  +C  NS PL+DMV TCY AAG RW NF+AVDFYK          
Sbjct  277   SLVLVNYFRDLPDETKSCKDNSAPLLDMVNTCYQAAGKRWPNFIAVDFYK----------  326

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GG  246
                                     RS+GGG  EA+D  NG L+CG  ++ SC      G 
Sbjct  327   ------------------------RSDGGGAPEAIDVANGHLVCGCGNIASCKANMTFGA  362

Query  245   CR  240
             C 
Sbjct  363   CE  364



>gb|AES90140.2| PLC-like phosphodiesterase superfamily protein [Medicago truncatula]
Length=405

 Score =   402 bits (1034),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 242/352 (69%), Gaps = 38/352 (11%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C   G   P+C R   T+    +   LPFN+Y++LTTHN+F++ G  S T
Sbjct  35    NCNSGLHCETCVANGNVRPRCTRIQPTNPTSKVK-GLPFNRYSWLTTHNSFALLGQKSAT  93

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+D++T QLNNGVRGLMLD+YDF  DVWLCHSFGG+C+++TAF+PA + LK
Sbjct  94    GSVILAPTNQQDTITAQLNNGVRGLMLDLYDFENDVWLCHSFGGQCYNYTAFQPAINVLK  153

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSEIVTII+EDYV +PKGLTKVF  AGL KYWFPVS MPKNGGDWP V DM
Sbjct  154   EIQVFLEANPSEIVTIIIEDYVTSPKGLTKVFNAAGLRKYWFPVSRMPKNGGDWPTVDDM  213

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYG--DGGMKRGDCPNRGESPPLTDTTK  606
             V KNQRL+VFTS  +KE SEGIAY+W Y+VENQYG  +GGMK G CPNR ESP +  T++
Sbjct  214   VQKNQRLVVFTSKAAKEASEGIAYEWRYLVENQYGNSNGGMKAGSCPNRAESPSMNTTSR  273

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SLVLVNFF  +P    +C  NS PL+DMV TCY AAG RW NF+AVDFYK          
Sbjct  274   SLVLVNFFKDLPDVTQSCKDNSAPLLDMVNTCYQAAGKRWPNFIAVDFYK----------  323

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                     RS+GGG  EAVD  NG L+CG  ++ SC
Sbjct  324   ------------------------RSDGGGAPEAVDVANGHLVCGCGNIASC  351



>ref|XP_010912462.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X3 [Elaeis guineensis]
Length=406

 Score =   401 bits (1030),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 200/374 (53%), Positives = 248/374 (66%), Gaps = 41/374 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLN--NSLPFNKYAFLT  1182
             G+ C ++D  C +   G+HC +C   G   P+C R   TD    +   + LPFN+YA++T
Sbjct  27    GKTC-LIDRNCDE---GLHCETCVADGDIRPRCTRIKPTDPKSKVEGGSDLPFNRYAWMT  82

Query  1181  THNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKC  1002
             THN+++  G  S TG P +AP NQ+DSV  QLNNGVRGLMLD+YDF  D+WLCHSFGG C
Sbjct  83    THNSYAKIGQKSYTGTPTLAPMNQQDSVADQLNNGVRGLMLDMYDFLNDIWLCHSFGGNC  142

Query  1001  HDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSN  822
             ++ TAF+PA + LKEI+AFL  NPSE++TI +EDYV +PKGLTKVFT++GLMKYWFPVS 
Sbjct  143   YNITAFQPAINVLKEIQAFLEANPSEVITIFIEDYVTSPKGLTKVFTNSGLMKYWFPVSR  202

Query  821   MPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPN  642
             MPKNGGDWPL+SDM+ KNQRLLVFTS  SKE +EGIAYQW Y+VENQYGDGGMK G CPN
Sbjct  203   MPKNGGDWPLLSDMINKNQRLLVFTSKSSKEATEGIAYQWRYVVENQYGDGGMKDGSCPN  262

Query  641   RGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDF  462
             R ESP +   ++SLVL+N+F   P    AC +NS PL  M+ TC+ A+ NRW NF+AVDF
Sbjct  263   RAESPSMNTKSRSLVLMNYFPDAPNLAAACKENSAPLETMLNTCHNASANRWPNFIAVDF  322

Query  461   YKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDD  282
             YK                                  RS GGG  EA D  NG L+CG + 
Sbjct  323   YK----------------------------------RSNGGGAPEATDTANGQLICGCNS  348

Query  281   VHSCVGGSK*GGCR  240
             V  C   +  G C+
Sbjct  349   VAQCKINASWGQCQ  362



>ref|XP_010912460.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Elaeis guineensis]
Length=416

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 200/374 (53%), Positives = 248/374 (66%), Gaps = 41/374 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLN--NSLPFNKYAFLT  1182
             G+ C ++D  C +   G+HC +C   G   P+C R   TD    +   + LPFN+YA++T
Sbjct  37    GKTC-LIDRNCDE---GLHCETCVADGDIRPRCTRIKPTDPKSKVEGGSDLPFNRYAWMT  92

Query  1181  THNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKC  1002
             THN+++  G  S TG P +AP NQ+DSV  QLNNGVRGLMLD+YDF  D+WLCHSFGG C
Sbjct  93    THNSYAKIGQKSYTGTPTLAPMNQQDSVADQLNNGVRGLMLDMYDFLNDIWLCHSFGGNC  152

Query  1001  HDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSN  822
             ++ TAF+PA + LKEI+AFL  NPSE++TI +EDYV +PKGLTKVFT++GLMKYWFPVS 
Sbjct  153   YNITAFQPAINVLKEIQAFLEANPSEVITIFIEDYVTSPKGLTKVFTNSGLMKYWFPVSR  212

Query  821   MPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPN  642
             MPKNGGDWPL+SDM+ KNQRLLVFTS  SKE +EGIAYQW Y+VENQYGDGGMK G CPN
Sbjct  213   MPKNGGDWPLLSDMINKNQRLLVFTSKSSKEATEGIAYQWRYVVENQYGDGGMKDGSCPN  272

Query  641   RGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDF  462
             R ESP +   ++SLVL+N+F   P    AC +NS PL  M+ TC+ A+ NRW NF+AVDF
Sbjct  273   RAESPSMNTKSRSLVLMNYFPDAPNLAAACKENSAPLETMLNTCHNASANRWPNFIAVDF  332

Query  461   YKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDD  282
             YK                                  RS GGG  EA D  NG L+CG + 
Sbjct  333   YK----------------------------------RSNGGGAPEATDTANGQLICGCNS  358

Query  281   VHSCVGGSK*GGCR  240
             V  C   +  G C+
Sbjct  359   VAQCKINASWGQCQ  372



>ref|XP_009407010.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Musa acuminata subsp. malaccensis]
Length=416

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 243/360 (68%), Gaps = 36/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGP-KCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C     G  +C R   +D  K     LPFN+Y++LTTHN+F+     SRT
Sbjct  52    NCDAGLHCEACIASGDGLFRCTRIQPSDP-KSKETGLPFNRYSWLTTHNSFAKLCPESRT  110

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G+P +  +NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCHSFGGKCHD TAF+PA D LK
Sbjct  111   GIPVITLENQQDSITDQLNNGVRGLMLDMYDFLDDIWLCHSFGGKCHDITAFQPAIDVLK  170

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSE+VTII+EDYV +P GLTKVF  +GL KYWFPVS MPKNGGDWPL+SDM
Sbjct  171   EIQVFLEANPSEVVTIIIEDYVTSPMGLTKVFNASGLFKYWFPVSRMPKNGGDWPLLSDM  230

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             +++NQRLLVFTS  +KE SEGIAY+W Y+VENQYGDGGM+ G CPNRGES P+  T++SL
Sbjct  231   ISRNQRLLVFTSKSAKEASEGIAYEWKYIVENQYGDGGMEAGACPNRGESSPMNTTSRSL  290

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F ++P    AC  NS PL+ M+ TC+  + NRW NF+AVDFYK            
Sbjct  291   VLMNYFPTIPNPVTACKHNSAPLLSMLNTCHNLSANRWPNFIAVDFYK------------  338

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS GGG  EA D  NG L+CG D++  C   +  G C 
Sbjct  339   ----------------------RSNGGGAPEATDVANGHLVCGCDNIAYCKVNASFGVCE  376



>emb|CDP02510.1| unnamed protein product [Coffea canephora]
Length=441

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/381 (53%), Positives = 253/381 (66%), Gaps = 38/381 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPF  1203
             +  +ACS  NCQ+LD     +DCG G++C +CP +G + P C R  AT    ++N  LPF
Sbjct  45    IPATACSTGNCQLLDSCTSATDCGPGLYCGNCPAVGKTQPFCARGQATIPTSIIN-GLPF  103

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY +L THN+FSI    S TG   +   NQED+VT QL NGVRGLMLD+YDF  D+WLC
Sbjct  104   NKYTWLVTHNSFSIVDAPSLTGAQRITFYNQEDTVTNQLRNGVRGLMLDMYDFEDDIWLC  163

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+C++FTAFEPA DTLKE+EAFL+ NP+EIVTII+EDYV+APKGLTKVF++AGL K
Sbjct  164   HSFRGQCYNFTAFEPAIDTLKEVEAFLNENPTEIVTIIIEDYVHAPKGLTKVFSNAGLDK  223

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFP+S MPK G DWP V+DM+  N RLLVFTS  SKE +EGIAYQW +MVEN+ GD G+
Sbjct  224   YWFPLSKMPKKGEDWPTVTDMIKDNHRLLVFTSDSSKEATEGIAYQWKHMVENEAGDPGV  283

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ES PL   + SL L N+F ++P +  AC ++S  LIDM+ TCY AAGN   
Sbjct  284   VPGSCPNRKESKPLNSKSASLFLQNYFPTIPDQNQACKEHSVALIDMINTCYKAAGNVIP  343

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NFLAV+FY                                   RS+GGG F+AVDR+NG 
Sbjct  344   NFLAVNFY----------------------------------MRSDGGGVFDAVDRMNGQ  369

Query  302   LLCGKDDVHSCVGGSK*GGCR  240
              LCG   + +C  G+  G C+
Sbjct  370   ALCGCTVITACQAGASFGSCK  390



>ref|XP_004296060.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 240/360 (67%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDC AG+HC +C    +  PKC R   T     +  +LPFNKY++LTTHN+F+I G  S 
Sbjct  34    SDCDAGLHCETCVADNNFVPKCTRVKPTSPISEVK-TLPFNKYSWLTTHNSFAILGQKSA  92

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             T    +AP NQ+DS+T QLNNGVRGLMLD+YD+ GD+WLCHS+GG+C+++TAF+PA   L
Sbjct  93    TKSVILAPTNQQDSITDQLNNGVRGLMLDMYDYLGDIWLCHSYGGQCYNYTAFQPAIGEL  152

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI AFL  NPSEIVTII+EDYV +PKGLTKVF  AGL K+WFPVS MPK GGDWP V+D
Sbjct  153   KEITAFLEANPSEIVTIIIEDYVTSPKGLTKVFDAAGLRKFWFPVSRMPKRGGDWPTVAD  212

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             M+ KNQRLLVFTS + KE  EGIAYQW+YMVENQYG+GGMK G CPNR ES  +  TT+S
Sbjct  213   MIQKNQRLLVFTSKQRKEADEGIAYQWSYMVENQYGNGGMKAGSCPNRAESSAMNTTTRS  272

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN+F   P  P +C  NS  L++MV TCY  AG RW NF+AVDFYK           
Sbjct  273   LVLVNYFRDTPTLPQSCKDNSDSLLNMVNTCYNVAGKRWPNFIAVDFYK-----------  321

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG  +AVD +NG L+CG   +  C      G C
Sbjct  322   -----------------------RSDGGGAPKAVDVVNGHLVCGCASIADCKANVSYGTC  358



>gb|AFK44546.1| unknown [Lotus japonicus]
Length=405

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 243/360 (68%), Gaps = 36/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C   G   P+C R+   +    +   LPFN+Y++LTTHN+F++ G  S T
Sbjct  38    NCNSGLHCETCVTNGNVRPRCTRTQPINPTSKVK-GLPFNRYSWLTTHNSFALLGQKSMT  96

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   ++P NQ+D++T QLNNGVRGLMLD+YDF  DVWLCHSFGG+C+++TAF+PA + LK
Sbjct  97    GSVILSPTNQQDTITDQLNNGVRGLMLDLYDFENDVWLCHSFGGQCYNYTAFQPAINVLK  156

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSEIVTII+EDYV +PKGLTKVF  AGL KYWFPVS MPKNGGDWP V DM
Sbjct  157   EIQVFLEANPSEIVTIIIEDYVTSPKGLTKVFDAAGLRKYWFPVSRMPKNGGDWPKVDDM  216

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             V KNQRL+VFTS  SKE SEGIAY+W Y+VENQYG+GGMK G CPNR ESP +  T++SL
Sbjct  217   VQKNQRLVVFTSKASKEASEGIAYEWRYLVENQYGNGGMKAGSCPNRAESPSMNTTSRSL  276

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VLVNFF  +P    +C  +S PL+ MV TC  AAG RW NF+AVDFYK            
Sbjct  277   VLVNFFRDLPDVAQSCKDDSAPLLSMVSTCNQAAGKRWPNFIAVDFYK------------  324

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS+GGG  EAVD  NG L+CG  ++ +C      G C+
Sbjct  325   ----------------------RSDGGGAPEAVDVANGHLVCGCGNIATCKENMGFGACQ  362



>ref|XP_009414849.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Musa acuminata subsp. malaccensis]
Length=398

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 242/359 (67%), Gaps = 36/359 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C   G   P+C R   +D  K   N LPFN++A+LTTHN+F+  G  SRT
Sbjct  34    NCDAGLHCETCLANGNLRPRCTRIQPSDP-KSKGNGLPFNRFAWLTTHNSFARLGQQSRT  92

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G P +AP+NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHSFGG C +FTAF+PA D LK
Sbjct  93    GTPVIAPENQQDSVTGQLNNGVRGLMLDMYDFENDIWLCHSFGGNCFNFTAFQPAIDVLK  152

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSE++TI +EDYV +PKGLTKVF  +GLMKYWFPV  MPKNGGDWPL+ DM
Sbjct  153   EIQLFLEANPSEVITIFIEDYVTSPKGLTKVFNASGLMKYWFPVERMPKNGGDWPLLGDM  212

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             +++N+RLLVFTS  +KE SEGIAY+W Y+VENQYGDGGM+ G CPNR ES P+   ++SL
Sbjct  213   ISRNERLLVFTSKAAKEASEGIAYEWRYVVENQYGDGGMEAGSCPNRAESLPMNAMSRSL  272

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N F S P    AC  NS PL+ M+ TC+ ++ NRW NF+AVDFYK            
Sbjct  273   VLMNHFPSNPDMATACKHNSAPLVSMLSTCHGSSANRWPNFIAVDFYK------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   RS+GGG  +A D  NG L+CG + +  C   +  G C
Sbjct  321   ----------------------RSDGGGAPQATDIANGHLVCGCNSIAYCKVNASFGVC  357



>ref|XP_010476389.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Camelina sativa]
 ref|XP_010476390.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Camelina sativa]
Length=344

 Score =   393 bits (1009),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 243/358 (68%), Gaps = 46/358 (13%)
 Frame = -3

Query  1334  LDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFS  1164
             L ++CS   DC  G+ C  C  G    +CVRS  T+ F + NNS+PFNKYAFLTTHN+F+
Sbjct  30    LGDQCSSDEDCNVGLGCYKC--GIEDARCVRSNITNPFSVGNNSMPFNKYAFLTTHNSFA  87

Query  1163  ITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF  984
             I G      + +VA   QED++ QQLN+GVR LMLD YD++GDVWLCHSF  KC + T F
Sbjct  88    IEG-----KLLHVA--TQEDTIVQQLNSGVRALMLDTYDYQGDVWLCHSFDEKCFEITKF  140

Query  983   EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGG  804
               A DT KEI AFL+ NP EIVT+ LEDYV +P GLTKVFTD+GL K+WFPV  MP  G 
Sbjct  141   NRAIDTFKEIFAFLTANPLEIVTLFLEDYVKSPNGLTKVFTDSGLKKFWFPVKIMPLGGR  200

Query  803   DWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPP  624
             DWPLV DMVA NQRL+VFTS +SK+++EGIAYQWNY+VENQYG+ G    +C NRGES  
Sbjct  201   DWPLVKDMVANNQRLIVFTSAESKQKTEGIAYQWNYVVENQYGNDGAIPYECSNRGESAL  260

Query  623   LTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKS  444
             LTD TK+LVLVN F +VP++ + C  NS  L+DM+ TCYLAAG+RWAN++AV+FYK    
Sbjct  261   LTDKTKALVLVNHFKTVPIKILTCEDNSEQLVDMIKTCYLAAGDRWANYVAVNFYK----  316

Query  443   LVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                           RS GGGTF+AVD LN  LLCG+ DVH+C
Sbjct  317   ------------------------------RSIGGGTFQAVDILNAKLLCGRYDVHAC  344



>ref|XP_010912029.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Elaeis guineensis]
Length=402

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 248/372 (67%), Gaps = 40/372 (11%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             N   + E C    DCG G+HC SC  G S   C+R    D  +  +  LPFN+Y++LTTH
Sbjct  22    NAATVGETCGANGDCGTGLHCGSCGSGQS--ICMRVKPIDP-ESQDKGLPFNRYSWLTTH  78

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++I G  S TG   V+P NQ+DSVT QLNNGVRGLMLD+YDF   +WLCHSFGGKC++
Sbjct  79    NSYAIAGSQSATGSILVSPTNQQDSVTSQLNNGVRGLMLDMYDFENGIWLCHSFGGKCYN  138

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + LKEI+ FL  NPSE++TI +EDYV +P+GLTKVF  +GLMKYWFP+S+MP
Sbjct  139   FTAFQPAINVLKEIDTFLEANPSEVITIFIEDYVTSPQGLTKVFNASGLMKYWFPLSHMP  198

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
              NG DWPL+SDM+ +NQRLLVFTS KSKE SEGIAY+WNY+VENQYGD GMK G CPNR 
Sbjct  199   NNGSDWPLLSDMIRQNQRLLVFTSKKSKEASEGIAYEWNYVVENQYGDEGMKAGSCPNRA  258

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P+  T+KSLVL+N+F + P +  AC  NS PL+ M+ TC+  + NRW NF+AVDFY 
Sbjct  259   ESSPMNTTSKSLVLMNYFPTNPNQTEACSDNSAPLVSMLKTCHKLSDNRWPNFIAVDFYM  318

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
             +                                  S+GGG  EA D  NG L+CG D++ 
Sbjct  319   L----------------------------------SDGGGAPEATDIANGHLVCGCDNIA  344

Query  275   SCVGGSK*GGCR  240
              C   +  G C+
Sbjct  345   YCKANATFGTCK  356



>ref|XP_010070359.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Eucalyptus 
grandis]
 gb|KCW59065.1| hypothetical protein EUGRSUZ_H01688 [Eucalyptus grandis]
 gb|KCW59066.1| hypothetical protein EUGRSUZ_H01688 [Eucalyptus grandis]
Length=433

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 202/385 (52%), Positives = 252/385 (65%), Gaps = 38/385 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             +SACS   CQVLD     SDCG G++C +CP LG + P C R  A     ++   LPFNK
Sbjct  31    SSACSNGGCQVLDACAAASDCGPGLYCGNCPSLGHNQPICTRGQAAVPTSVIG-GLPFNK  89

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y +L THN+FSI       GV  V   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS
Sbjct  90    YTWLVTHNSFSIVDAPPLPGVQRVTLYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHS  149

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G+C +FTAF+PA +TL+E+EAFLS NP+EIVTII+EDYV+ PKGLT +FT+AGL KYW
Sbjct  150   FRGQCFNFTAFQPAVNTLREVEAFLSENPTEIVTIIIEDYVHTPKGLTNLFTNAGLDKYW  209

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPVS MPK G DWP V++MV  N RLLVFTSV +KE  EG+AYQW YMVEN+ GD G+ +
Sbjct  210   FPVSKMPKKGEDWPTVAEMVQNNYRLLVFTSVAAKEAEEGVAYQWKYMVENESGDPGVAK  269

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CPNR ES PL+  + SL L N+F + P++  AC ++S PL +MV TCY AAGNR  NF
Sbjct  270   GSCPNRKESKPLSSKSVSLYLENYFPTYPVQVDACKEHSTPLAEMVTTCYKAAGNRMPNF  329

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAV+FY                                   R++GGG F+A+DR+NG  L
Sbjct  330   LAVNFY----------------------------------MRNDGGGVFDALDRMNGPTL  355

Query  296   CGKDDVHSCVGGSK*GGCRRWNTRT  222
             CG   + +C  G+  G C+  +T T
Sbjct  356   CGCSTIAACQAGAPYGSCKNISTPT  380



>ref|XP_009406116.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 243/360 (68%), Gaps = 36/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGP-KCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C    +G  +C R   +D  K     LPFN+Y++LTTHN+F+  G  SRT
Sbjct  40    NCDAGLHCETCVASGNGLFRCTRIQPSDP-KSKGTGLPFNRYSWLTTHNSFAKLGQKSRT  98

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G P +  +NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCHS GGKC++FTAF+PA D LK
Sbjct  99    GTPVITLENQQDSITDQLNNGVRGLMLDMYDFLDDIWLCHSTGGKCYNFTAFQPAIDVLK  158

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSE+VTII+EDYV +P GLTKVF  +GL+KYWFPVS MPKNG DWPL+SDM
Sbjct  159   EIQVFLEANPSEVVTIIIEDYVTSPMGLTKVFNASGLLKYWFPVSRMPKNGRDWPLLSDM  218

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             +++NQRLLVFTS  +KE SEGIAY+W Y+VENQYGDGGM+ G CPNR ES P+  T++SL
Sbjct  219   ISRNQRLLVFTSKSAKEASEGIAYEWTYIVENQYGDGGMEAGACPNRAESSPMNTTSRSL  278

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F ++P    AC  NS PL+ M+ TC+  + NRW NF+AVDFYK            
Sbjct  279   VLMNYFPTIPNLATACKHNSAPLLSMLNTCHNLSANRWPNFIAVDFYK------------  326

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS GGG  EA D  NG L+CG D++  C   +  G C 
Sbjct  327   ----------------------RSNGGGAPEATDVANGHLVCGCDNIAYCKVNASFGVCE  364



>ref|XP_010263485.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Nelumbo nucifera]
Length=426

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 253/385 (66%), Gaps = 40/385 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNS  1212
             F + +SACSG NCQ+LD  CS   DCG G++C +CP  G + P C R  A     ++   
Sbjct  28    FFLGSSACSGGNCQLLDS-CSLPTDCGPGLYCGNCPASGKTEPTCTRGQAIQPTSIIAG-  85

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY++L THN+FSI      TG+  +   NQEDSVT QL NGVRGLMLD+YDF  D+
Sbjct  86    LPFNKYSWLVTHNSFSIVDAPPLTGIQRMTSYNQEDSVTNQLRNGVRGLMLDMYDFNNDI  145

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHS  G+C+DFTAFEPA +TLKE+E FLS NP EIVTII+EDYV+ PKGLTK+FTDAG
Sbjct  146   WLCHSMRGQCYDFTAFEPAINTLKEVETFLSENPLEIVTIIIEDYVHTPKGLTKLFTDAG  205

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L+ YWFPVSNMP  G DWP V+DMVA+N RLLVFTS  SKE SEGIAYQW +M+EN+ GD
Sbjct  206   LLNYWFPVSNMPTKGEDWPTVTDMVAENHRLLVFTSDASKEASEGIAYQWRFMLENEPGD  265

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+ +G CPNR ES PL   + SL L N+F + P+E  +C +NS  L+ M+GTCY AAGN
Sbjct  266   PGIVQGSCPNRKESQPLNSRSASLFLQNYFPTFPVEYESCKENSAALVGMIGTCYKAAGN  325

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NFLAV+FY                                   R++G G F+A+DR+
Sbjct  326   VMPNFLAVNFY----------------------------------MRNDGEGVFDALDRM  351

Query  311   NGGLLCGKDDVHSCVGGSK*GGCRR  237
             NG  LCG   V +C  G+  G C+ 
Sbjct  352   NGFTLCGCTTVSACQVGAPMGSCKE  376



>gb|KDP32266.1| hypothetical protein JCGZ_14787 [Jatropha curcas]
Length=403

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 242/371 (65%), Gaps = 40/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPF  1203
             F   TS   G+ C        +C +G+HC +C   G + P+C R    +    +   LPF
Sbjct  19    FTFSTSLKEGQTCVA----NRNCDSGLHCETCLANGNARPRCTRIQPINPTSKVK-GLPF  73

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             N+Y +LTTHN+F+  G  S TG   + P NQ+DS+T+QLNNGVRGLMLD+YDF+ D+WLC
Sbjct  74    NRYTWLTTHNSFAKLGVRSATGSVLLTPMNQQDSITEQLNNGVRGLMLDMYDFQNDIWLC  133

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKC++FTAF+PA + LKEI+ FL  NPSEIVTII+EDYV++P GLTKVF  AGL K
Sbjct  134   HSFGGKCYNFTAFQPAINVLKEIQVFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAGLRK  193

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MPKNGG+WP V DMV KNQRL+VFTS  SKE SEGIAY+W Y+VENQYGDGGM
Sbjct  194   YWFPVSRMPKNGGNWPTVDDMVQKNQRLVVFTSKSSKEASEGIAYEWRYVVENQYGDGGM  253

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ESP +  T++SLVLVN F   P     C  NS PL+DMV TCY AAG RW 
Sbjct  254   VAGSCPNRAESPAMNTTSRSLVLVNHFPDRPDFTQTCKYNSAPLMDMVNTCYAAAGKRWP  313

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG  EA D  NG 
Sbjct  314   NFIAVDFYK----------------------------------RSDGGGAAEASDVANGH  339

Query  302   LLCGKDDVHSC  270
             L+CG + + SC
Sbjct  340   LVCGCESISSC  350



>ref|XP_006574889.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Glycine 
max]
 gb|KHN05833.1| PI-PLC X domain-containing protein [Glycine soja]
Length=405

 Score =   393 bits (1010),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 197/372 (53%), Positives = 248/372 (67%), Gaps = 40/372 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             G+ C V D+   +C +G+HC +C   G   P+C R    +    +   LPFN+Y++LTTH
Sbjct  28    GQTC-VADK---NCDSGLHCETCVANGNVRPRCTRVQPINPTSKIK-GLPFNRYSWLTTH  82

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+F+I G  S TG   ++P NQ+D++T QLNNGVRGLMLD+YDF+ D+WLCHSFGG+C++
Sbjct  83    NSFAILGKKSMTGSVILSPTNQQDTITSQLNNGVRGLMLDMYDFQNDIWLCHSFGGQCYN  142

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             +TAF+PA + LKEI+ FL  NPSEIVTI +EDYV +PKGLTKVF  AGL KYWFPVS MP
Sbjct  143   YTAFQPAINVLKEIQVFLDANPSEIVTIFIEDYVTSPKGLTKVFDAAGLRKYWFPVSRMP  202

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNGG+WP V DMV KNQRL+VFTS  SKE SEGIAY+W Y+VENQYG+GGMK G CPNR 
Sbjct  203   KNGGNWPTVDDMVKKNQRLVVFTSKSSKEASEGIAYEWRYLVENQYGNGGMKAGSCPNRA  262

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ESP +   ++SLVLVNFF  +P    +C  NS PL+ MV TCY AA  RW NF+AVDFYK
Sbjct  263   ESPSMNTKSRSLVLVNFFRDLPDVTKSCKDNSAPLLSMVNTCYEAADKRWPNFIAVDFYK  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG  +A+D  NG L+CG +++ 
Sbjct  323   ----------------------------------RSDGGGAPDAIDVANGHLVCGCENLA  348

Query  275   SCVGGSK*GGCR  240
             SC      G C+
Sbjct  349   SCKANMTFGVCQ  360



>ref|XP_002866716.1| phospholipase C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42975.1| phospholipase C [Arabidopsis lyrata subsp. lyrata]
Length=427

 Score =   394 bits (1011),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 253/389 (65%), Gaps = 38/389 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSL  1209
             F   +SACS  NCQ+LD     +DC  G++C  CP +G S P C R  AT    ++N  L
Sbjct  22    FFSFSSACSNGNCQLLDSCSSATDCVQGLYCGDCPAVGRSKPVCTRGQATIPTSIIN-GL  80

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKY +L THNAFS        GV  +   NQED++T QL NGVRGLMLD+YDF  D+W
Sbjct  81    PFNKYTWLMTHNAFSNANAPPLPGVERITFYNQEDTITNQLQNGVRGLMLDMYDFNNDIW  140

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHS  G+C +FTAF+PA +TL+E+EAFLS NP+EIVTII+EDYV+ PKGL+ +F +AGL
Sbjct  141   LCHSLRGQCFNFTAFQPAINTLREVEAFLSQNPTEIVTIIIEDYVHRPKGLSTLFANAGL  200

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
              KYWFPVS MP+ G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW YMVEN+ GD 
Sbjct  201   DKYWFPVSKMPRKGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYMVENESGDP  260

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             G+KRG CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  + GNR
Sbjct  261   GVKRGSCPNRKESQPLNSKSSSLFLMNYFPTYPVEKDACKEHSAPLAEMVGTCLKSGGNR  320

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
               NFLAV+FY                                   RS+GGG FE +DR+N
Sbjct  321   MPNFLAVNFY----------------------------------MRSDGGGVFEILDRMN  346

Query  308   GGLLCGKDDVHSCVGGSK*GGCRRWNTRT  222
             G +LCG + + +C  G+  G C+    +T
Sbjct  347   GPVLCGCETLAACQPGAAYGSCKNVTLQT  375



>ref|XP_008236472.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Prunus mume]
Length=405

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 240/360 (67%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDC +G+HC +C   G   PKC R+   +    +  +LPFN+Y++LTTHN+F+  G  S 
Sbjct  34    SDCDSGLHCETCLADGNVVPKCTRTQPINPISQVK-TLPFNRYSWLTTHNSFARLGEKSA  92

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T QLNNGVRGLMLD+YDF+ D+WLCHSFGG C++FT+F+PA + L
Sbjct  93    TGSLILAPTNQQDSITDQLNNGVRGLMLDMYDFQNDIWLCHSFGGNCYNFTSFQPAINVL  152

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI+AFL  NPSEIVTII+EDYV +PKGLTKVF  AGL K+WFPVS MPKNGG+WP V+D
Sbjct  153   KEIQAFLQANPSEIVTIIIEDYVTSPKGLTKVFDAAGLRKFWFPVSRMPKNGGNWPTVAD  212

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             M+  NQRL+VFTS ++KE SEGIAY+WNY+VENQYG GGM  G CPNR ES P+  TTKS
Sbjct  213   MIQNNQRLVVFTSKRAKEASEGIAYEWNYVVENQYGKGGMIAGSCPNRAESSPMNTTTKS  272

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN+F  VP    AC  NS  L+ MV TC  AAG RW NF+AVDFYK           
Sbjct  273   LVLVNYFRDVPDLAQACKDNSDSLLRMVNTCSDAAGKRWPNFIAVDFYK-----------  321

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG   A D  NG L+CG   + +C      G C
Sbjct  322   -----------------------RSDGGGAPRATDVANGHLVCGCGTIANCKANMSFGVC  358



>ref|XP_006393911.1| hypothetical protein EUTSA_v10004292mg [Eutrema salsugineum]
 gb|ESQ31197.1| hypothetical protein EUTSA_v10004292mg [Eutrema salsugineum]
Length=420

 Score =   393 bits (1009),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 199/386 (52%), Positives = 252/386 (65%), Gaps = 38/386 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             V+SACS  NCQ+LD     +DC +G++C +CP +G + P C R  AT    ++N  LPFN
Sbjct  23    VSSACSNGNCQMLDSCSSATDCVSGLYCGNCPAIGRTKPVCTRGQATIPTSIIN-GLPFN  81

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY +L THNAFS        GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCH
Sbjct  82    KYTWLMTHNAFSNANQPPLPGVERITFFNQEDTVTNQLRNGVRGLMLDMYDFNNDIWLCH  141

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             S  G+C +FTAF+PA DTL+E+E FLS NP+EIVTII+EDYV+ PKGL+ +F +AGL KY
Sbjct  142   SLRGQCFNFTAFQPAIDTLREVETFLSQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKY  201

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MPK G DWP V+DMV +N RLLVFTSV +KE  EG+AYQW YMVEN+ GD G+K
Sbjct  202   WFPVSKMPKKGEDWPTVTDMVQENHRLLVFTSVAAKENEEGVAYQWRYMVENESGDPGVK  261

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
             RG CPNR ES PL     SL L+N+F + P+E  AC ++S PL +MVGTC  +AGNR  N
Sbjct  262   RGSCPNRKESQPLNSKGSSLFLMNYFPTYPVEKDACKEHSAPLAEMVGTCLKSAGNRMPN  321

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAV+FY                                   RS+GGG FE +DR+NG +
Sbjct  322   FLAVNFY----------------------------------MRSDGGGVFEILDRMNGPV  347

Query  299   LCGKDDVHSCVGGSK*GGCRRWNTRT  222
             +CG + + +C   +  G C+    +T
Sbjct  348   ICGCETLAACQPEATYGTCKNITLQT  373



>ref|XP_011099119.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Sesamum 
indicum]
Length=444

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 251/373 (67%), Gaps = 40/373 (11%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTT  1179
             +CQ+L E CS   DCGAG++C +CP LG + P C+R  AT    +++  LPFNKY++L T
Sbjct  57    DCQLL-ESCSTATDCGAGLYCGNCPSLGKTQPFCIRGQATTPTSIISG-LPFNKYSWLMT  114

Query  1178  HNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCH  999
             HNAFSI    S TG   +   NQEDSVT QL NGVRG MLD+YDF  D+WLCHSF G+C+
Sbjct  115   HNAFSIVDAPSLTGAQRITFYNQEDSVTNQLRNGVRGFMLDMYDFENDIWLCHSFRGQCY  174

Query  998   DFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNM  819
             +FTAFEPA +TL+EIEAFL+ NPSEIVTII+EDYV+ PKGLTKVFTD+GL KYW+PV+ M
Sbjct  175   NFTAFEPAINTLREIEAFLTQNPSEIVTIIIEDYVHTPKGLTKVFTDSGLDKYWYPVAKM  234

Query  818   PKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNR  639
             PK G DWP V+ MV  N RLLVFTS  SKE +EGIAYQW YMVEN+ GD G+  G CPNR
Sbjct  235   PKKGEDWPTVNSMVQNNYRLLVFTSDSSKEGTEGIAYQWRYMVENEPGDPGVVPGSCPNR  294

Query  638   GESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
              ES PL   + SL L+N+F ++P++  AC ++S PL DM+ TCY +AGN+  NFLAV+FY
Sbjct  295   KESKPLNSRSASLFLMNYFPTIPVQNEACKEHSMPLADMIATCYKSAGNQIPNFLAVNFY  354

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS+GGG F+ +DR+NG  LCG   +
Sbjct  355   ----------------------------------MRSDGGGVFDYLDRMNGQTLCGCSTI  380

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G CR
Sbjct  381   SACQPGATFGSCR  393



>ref|XP_007201061.1| hypothetical protein PRUPE_ppa006614mg [Prunus persica]
 gb|EMJ02260.1| hypothetical protein PRUPE_ppa006614mg [Prunus persica]
Length=403

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 240/360 (67%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDC +G+HC +C   G   PKC R+   +    +  +LPFN+Y++LTTHN+F+  G  S 
Sbjct  34    SDCDSGLHCETCVADGNVVPKCTRTQPINPISQVK-TLPFNRYSWLTTHNSFARLGEKSA  92

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T QLNNGVRGLMLD+YDF+ D+WLCHSFGG C++ T+F+PA + L
Sbjct  93    TGSIILAPTNQQDSITDQLNNGVRGLMLDMYDFQNDIWLCHSFGGNCYNITSFQPAINVL  152

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI+AFL  NPSEIVTII+EDYV +PKGLTKVF  AGL K+WFPVS MPKNGG+WP V+D
Sbjct  153   KEIQAFLQANPSEIVTIIIEDYVTSPKGLTKVFDAAGLRKFWFPVSRMPKNGGNWPTVAD  212

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             M+ KNQRL+VFTS ++KE SEGIAY+WNY+VENQYG GGM  G CPNR ES P+  TTKS
Sbjct  213   MIQKNQRLVVFTSKRAKEASEGIAYEWNYVVENQYGKGGMIAGSCPNRAESSPMNTTTKS  272

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN+F  VP    AC  NS  L+ MV TC  AAG RW NF+AVDFYK           
Sbjct  273   LVLVNYFRDVPDVTQACKDNSDSLLRMVNTCSDAAGKRWPNFIAVDFYK-----------  321

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG   A D  NG L+CG   + +C      G C
Sbjct  322   -----------------------RSDGGGAPSATDVANGHLVCGCGTIANCKTNMSFGVC  358



>ref|XP_010667411.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Beta vulgaris subsp. vulgaris]
Length=420

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/375 (54%), Positives = 244/375 (65%), Gaps = 47/375 (13%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFNKYAFL  1185
             GE C     + SDC AG+ C +C   G + P+C R+     T + K     L FNKY++L
Sbjct  34    GETC----SKDSDCDAGLRCETCKANGNTRPRCSRTQPLIPTSKVK----GLAFNKYSWL  85

Query  1184  TTHNAFSITG-WSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGG  1008
             T+HN+F+++G   S TG   +AP NQEDSVT QL NGVRGLMLD+YDF+ ++WLCHSFGG
Sbjct  86    TSHNSFAMSGTIKSSTGSILLAPTNQEDSVTSQLRNGVRGLMLDMYDFQNNIWLCHSFGG  145

Query  1007  KCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPV  828
             KC +FTAF+PA + L+EI+ FL  NP+EIVTII+EDYV +  GLTKVF  AGL K+ FP+
Sbjct  146   KCFNFTAFQPAINVLREIQTFLQANPTEIVTIIIEDYVTSSMGLTKVFNAAGLSKFMFPL  205

Query  827   SNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDC  648
             S MPKNG DWP V DMV KNQRLLVFTS KSKE SEGIAYQWNYMVENQYGD GM  G C
Sbjct  206   SRMPKNGSDWPTVDDMVQKNQRLLVFTSAKSKEASEGIAYQWNYMVENQYGDEGMIDGSC  265

Query  647   PNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAV  468
             PNRGESPP+  TT SLVLVN+F + P    AC +NS PLI M+ TC+   G RW NF+AV
Sbjct  266   PNRGESPPMNTTTASLVLVNYFPTNPNSTQACAKNSAPLISMINTCFQQDGRRWPNFIAV  325

Query  467   DFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGK  288
             D+Y                                  QRS+GGG  EAVD  NG L CG 
Sbjct  326   DYY----------------------------------QRSDGGGASEAVDVANGHLTCGC  351

Query  287   DDVHSCVGGSK*GGC  243
             D++  C  G   G C
Sbjct  352   DNIAYCKAGGTFGSC  366



>ref|XP_007153589.1| hypothetical protein PHAVU_003G048300g [Phaseolus vulgaris]
 gb|ESW25583.1| hypothetical protein PHAVU_003G048300g [Phaseolus vulgaris]
Length=402

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 239/360 (66%), Gaps = 36/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C  G+HC +C   G   P+C R    +    +   LPFN+Y++LTTHN+F+I G     
Sbjct  34    NCDLGLHCETCVANGNVRPRCTRIQPINPSSKVK-GLPFNRYSWLTTHNSFAILGQKPMK  92

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QL+NGVRGLMLD+YDF  DVWLCHSFGG+C+++TAF+PA + LK
Sbjct  93    GSVLLAPTNQQDSITSQLHNGVRGLMLDMYDFENDVWLCHSFGGQCYNYTAFQPAINVLK  152

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSEIVTI +EDYV +PKGLTKVF  AGL KYWFPVS MPKNGG+WP + DM
Sbjct  153   EIQVFLDANPSEIVTIFIEDYVTSPKGLTKVFDAAGLRKYWFPVSRMPKNGGNWPTIDDM  212

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             V KNQRL+VFTS  SKE SEGIAY+W Y+VENQYG+GGMK G CPNR ESP +  T++SL
Sbjct  213   VKKNQRLVVFTSKASKESSEGIAYEWRYLVENQYGNGGMKVGSCPNRAESPSMNTTSRSL  272

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+NFF  +P    +C  NSGPL+DMV TCY AAG RW NF+ VDFYK            
Sbjct  273   VLLNFFRDLPDVTKSCKDNSGPLLDMVNTCYGAAGKRWPNFITVDFYK------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS+GGG  EA+D  NG L+CG +++  C      G C 
Sbjct  321   ----------------------RSDGGGASEALDVANGHLVCGCENMAICKANMTFGACE  358



>ref|XP_010263507.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Nelumbo nucifera]
Length=409

 Score =   391 bits (1004),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 238/360 (66%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             S+C AG+HC +C   G   P+C R    +    +   LPFN+Y++LTTHN+F++ G    
Sbjct  41    SNCDAGLHCETCVSNGNLRPRCTRVRPLNPTSKVK-GLPFNRYSWLTTHNSFALLGAKPG  99

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
              G   +AP+NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCHSFGG+C++FTAF+PA + L
Sbjct  100   IGSVLLAPENQQDSITSQLNNGVRGLMLDMYDFNSDIWLCHSFGGQCYNFTAFQPAINVL  159

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI+ FL  NP+EI+TI +EDYV +P+GLT VF  AGL KYWFPVS MPKNGGDWP V D
Sbjct  160   KEIQLFLEANPTEIITIFIEDYVTSPRGLTNVFNAAGLRKYWFPVSRMPKNGGDWPTVDD  219

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV +NQRL+VFTS  +KE SEGIAY+W Y+VENQYGDGGMK G CPNR ES P+  TT+S
Sbjct  220   MVRQNQRLVVFTSKSAKEASEGIAYEWRYLVENQYGDGGMKAGSCPNRAESSPMNTTTRS  279

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVL N+F + P    AC  NS PL+ M+GTCY AAG RW NF+ VDFYK           
Sbjct  280   LVLQNYFPNNPNIVEACKHNSAPLVSMMGTCYEAAGKRWPNFITVDFYK-----------  328

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG  EAVD  NG L CG  ++  C   +  G C
Sbjct  329   -----------------------RSDGGGASEAVDVANGHLACGCTNIAYCKANATFGTC  365



>ref|NP_569045.1| PI-PLC X domain-containing protein [Arabidopsis thaliana]
 sp|Q93XX5.1|Y5713_ARATH RecName: Full=PI-PLC X domain-containing protein At5g67130; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK96865.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10115.1| unknown protein [Arabidopsis thaliana]
 gb|AED98305.1| PI-PLC X domain-containing protein [Arabidopsis thaliana]
Length=426

 Score =   391 bits (1005),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 250/383 (65%), Gaps = 38/383 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ACS  NCQ+LD     +DC +G++C  CP +G S P C R  AT    ++N  LPFNKY 
Sbjct  28    ACSNGNCQLLDSCSSATDCVSGLYCGDCPAVGRSKPVCTRGQATSPTSIIN-GLPFNKYT  86

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THNAFS        GV  +   NQED++T QL NGVRGLMLD+YDF  D+WLCHS  
Sbjct  87    WLMTHNAFSNANAPLLPGVERITFYNQEDTITNQLQNGVRGLMLDMYDFNNDIWLCHSLR  146

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C +FTAF+PA + L+E+EAFLS NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWFP
Sbjct  147   GQCFNFTAFQPAINILREVEAFLSQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWFP  206

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS MP+ G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW YMVEN+ GD G+KRG 
Sbjct  207   VSKMPRKGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYMVENESGDPGVKRGS  266

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  + GNR  NFLA
Sbjct  267   CPNRKESQPLNSKSSSLFLMNYFPTYPVEKDACKEHSAPLAEMVGTCLKSGGNRMPNFLA  326

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V+FY                                   RS+GGG FE +DR+NG +LCG
Sbjct  327   VNFY----------------------------------MRSDGGGVFEILDRMNGPVLCG  352

Query  290   KDDVHSCVGGSK*GGCRRWNTRT  222
              + + +C  G+  G C+    +T
Sbjct  353   CETLSACQPGAAYGSCKNVTVQT  375



>ref|XP_004157386.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cucumis sativus]
Length=418

 Score =   390 bits (1002),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 238/359 (66%), Gaps = 36/359 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +CGAG+HC +C   G   P+C R         + + LPFN Y +LTTHN+F+  G  S T
Sbjct  34    NCGAGLHCETCFADGNVRPRCTRIQPISPISKVKD-LPFNHYTWLTTHNSFAKLGAKSAT  92

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QLNNGVRG MLD+YDF  D+WLCHS+GG+C+++TAF+PA + LK
Sbjct  93    GSLILAPTNQQDSITSQLNNGVRGFMLDMYDFENDIWLCHSYGGQCYNYTAFQPAINVLK  152

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E +AFL  NP EIVTII+EDYV +PKGLT VF  AGL K+WFPV  MPKNGG+WP VSDM
Sbjct  153   EFQAFLEANPFEIVTIIIEDYVTSPKGLTNVFGAAGLRKFWFPVWRMPKNGGNWPTVSDM  212

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + KNQRLLVFTS  +KE SEGIAY W Y+VENQYGDGGMK G CPNRGES P+  T++SL
Sbjct  213   IQKNQRLLVFTSKAAKEASEGIAYVWRYIVENQYGDGGMKAGSCPNRGESLPMNTTSRSL  272

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             V+VNFF      P AC  NS PL++MV TC+ AAGNRW NF+AVDFYK            
Sbjct  273   VIVNFFRDAANFPEACKDNSAPLLNMVNTCHNAAGNRWPNFIAVDFYK------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   RS+GGG  +AVD  NG  +CG  ++ SC    + G C
Sbjct  321   ----------------------RSDGGGAAKAVDVTNGHSVCGCPNISSCKENMRYGAC  357



>gb|KGN57525.1| hypothetical protein Csa_3G205280 [Cucumis sativus]
Length=419

 Score =   390 bits (1002),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 238/359 (66%), Gaps = 36/359 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +CGAG+HC +C   G   P+C R         + + LPFN Y +LTTHN+F+  G  S T
Sbjct  34    NCGAGLHCETCFADGNVRPRCTRIQPISPISKVKD-LPFNHYTWLTTHNSFAKLGAKSAT  92

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QLNNGVRG MLD+YDF  D+WLCHS+GG+C+++TAF+PA + LK
Sbjct  93    GSLILAPTNQQDSITSQLNNGVRGFMLDMYDFENDIWLCHSYGGQCYNYTAFQPAINVLK  152

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E +AFL  NP EIVTII+EDYV +PKGLT VF  AGL K+WFPV  MPKNGG+WP VSDM
Sbjct  153   EFQAFLEANPFEIVTIIIEDYVTSPKGLTNVFGAAGLRKFWFPVWRMPKNGGNWPTVSDM  212

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + KNQRLLVFTS  +KE SEGIAY W Y+VENQYGDGGMK G CPNRGES P+  T++SL
Sbjct  213   IQKNQRLLVFTSKAAKEASEGIAYVWRYIVENQYGDGGMKAGSCPNRGESLPMNTTSRSL  272

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             V+VNFF      P AC  NS PL++MV TC+ AAGNRW NF+AVDFYK            
Sbjct  273   VIVNFFRDAANFPEACKDNSAPLLNMVNTCHNAAGNRWPNFIAVDFYK------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   RS+GGG  +AVD  NG  +CG  ++ SC    + G C
Sbjct  321   ----------------------RSDGGGAAKAVDVTNGHSVCGCPNISSCKENMRYGAC  357



>ref|XP_010558678.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Tarenaya hassleriana]
Length=435

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 200/373 (54%), Positives = 245/373 (66%), Gaps = 39/373 (10%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             NCQ LD     +DC  G++C +CP  G + P C R  AT    ++N  LPFNKY +L TH
Sbjct  38    NCQALDSCSTATDCAPGLYCGNCPASGKTQPICTRGQATIPTSVING-LPFNKYTWLVTH  96

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI       G   +   NQEDSVT QL NGVRGLMLD+YDF  D+WLCHSF G+C +
Sbjct  97    NSFSIVDAPPLPGSQRLTFYNQEDSVTNQLRNGVRGLMLDMYDFNNDIWLCHSFRGQCFN  156

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA DTLKE+EAFLS NP+EIVTII+EDYV  PKGL+ +F +AGL KYWFPVS MP
Sbjct  157   FTAFQPAIDTLKEVEAFLSQNPTEIVTIIIEDYVRTPKGLSTLFANAGLDKYWFPVSKMP  216

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V++MV +N RLLVFTSV +KEE EG+AYQW YMVEN+ GD G+K G CPNR 
Sbjct  217   KKGEDWPTVTEMVQENHRLLVFTSVAAKEEEEGVAYQWRYMVENESGDPGVKHGSCPNRK  276

Query  635   ESPPLTD-TTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
             ES PLT  ++ SL L+N+F + P+E  AC ++S PL +MVGTC  AAGNR  NFLAV+FY
Sbjct  277   ESKPLTSKSSSSLFLMNYFPTYPVERDACKEHSAPLAEMVGTCLKAAGNRMPNFLAVNFY  336

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS+GGG FE +DR+NG +LCG   +
Sbjct  337   ----------------------------------MRSDGGGVFEVLDRMNGPVLCGCSTI  362

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G CR
Sbjct  363   SACQPGAAFGSCR  375



>ref|XP_010107923.1| PI-PLC X domain-containing protein [Morus notabilis]
 gb|EXC17323.1| PI-PLC X domain-containing protein [Morus notabilis]
Length=397

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 242/380 (64%), Gaps = 47/380 (12%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPF  1203
              N  ++   GE C        +C +G+HC +C   G   P+C R    +    +   LPF
Sbjct  22    LNSSSALKQGETCAT----NKNCDSGLHCQTCVANGNLRPRCTRIKPINPISQMK-GLPF  76

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             N+Y++LTTHNAF+  G S       VAP NQ+DS+T QLNNGVRG MLD+YDFR D+WLC
Sbjct  77    NRYSWLTTHNAFARLGKS-------VAPSNQQDSITDQLNNGVRGFMLDMYDFRNDIWLC  129

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFG KC++ TAF+PA + LKE++ FL +NPSEI+TII+EDYV +PKGL+KVF  AGL K
Sbjct  130   HSFGSKCYNITAFQPAINVLKEVQTFLESNPSEIITIIIEDYVTSPKGLSKVFDAAGLRK  189

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MPKNGG+WP V DM+ KNQRL+VFTS  SKE SEGIAYQW YMVENQYG+GGM
Sbjct  190   YWFPVSRMPKNGGNWPTVDDMIQKNQRLVVFTSKSSKEASEGIAYQWRYMVENQYGNGGM  249

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR ESP +   ++SLVL+NFF   P  P +C  NS PL++M  TCY AAG RW 
Sbjct  250   KNGSCPNRAESPAMNTKSRSLVLMNFFRDNPDLPQSCKDNSAPLLNMANTCYEAAGKRWP  309

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG   AVD +NG 
Sbjct  310   NFIAVDFYK----------------------------------RSDGGGAPAAVDVVNGH  335

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             L+CG  ++  C      G C
Sbjct  336   LVCGCGNIAYCKANGTYGVC  355



>ref|XP_010263486.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Nelumbo nucifera]
Length=386

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 248/374 (66%), Gaps = 40/374 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNS  1212
             F + +SACSG NCQ+LD  CS   DCG G++C +CP  G + P C R  A     ++   
Sbjct  28    FFLGSSACSGGNCQLLDS-CSLPTDCGPGLYCGNCPASGKTEPTCTRGQAIQPTSIIA-G  85

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY++L THN+FSI      TG+  +   NQEDSVT QL NGVRGLMLD+YDF  D+
Sbjct  86    LPFNKYSWLVTHNSFSIVDAPPLTGIQRMTSYNQEDSVTNQLRNGVRGLMLDMYDFNNDI  145

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHS  G+C+DFTAFEPA +TLKE+E FLS NP EIVTII+EDYV+ PKGLTK+FTDAG
Sbjct  146   WLCHSMRGQCYDFTAFEPAINTLKEVETFLSENPLEIVTIIIEDYVHTPKGLTKLFTDAG  205

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L+ YWFPVSNMP  G DWP V+DMVA+N RLLVFTS  SKE SEGIAYQW +M+EN+ GD
Sbjct  206   LLNYWFPVSNMPTKGEDWPTVTDMVAENHRLLVFTSDASKEASEGIAYQWRFMLENEPGD  265

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+ +G CPNR ES PL   + SL L N+F + P+E  +C +NS  L+ M+GTCY AAGN
Sbjct  266   PGIVQGSCPNRKESQPLNSRSASLFLQNYFPTFPVEYESCKENSAALVGMIGTCYKAAGN  325

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NFLAV+FY                                   R++G G F+A+DR+
Sbjct  326   VMPNFLAVNFY----------------------------------MRNDGEGVFDALDRM  351

Query  311   NGGLLCGKDDVHSC  270
             NG  LCG   V +C
Sbjct  352   NGFTLCGCTTVSAC  365



>ref|XP_004140805.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Cucumis sativus]
Length=415

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 238/359 (66%), Gaps = 36/359 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +CGAG+HC +C   G   P+C R         + + LPFN Y +LTTHN+F+  G  S T
Sbjct  34    NCGAGLHCETCFADGNVRPRCTRIQPISPISKVKD-LPFNHYTWLTTHNSFAKLGAKSAT  92

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QLNNGVRG MLD+YDF  D+WLCHS+GG+C+++TAF+PA + LK
Sbjct  93    GSLILAPTNQQDSITSQLNNGVRGFMLDMYDFENDIWLCHSYGGQCYNYTAFQPAINVLK  152

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E +AFL  NP EIVTII+EDYV +PKGLT VF  AGL K+WFPV  MPKNGG+WP VSDM
Sbjct  153   EFQAFLEANPFEIVTIIIEDYVTSPKGLTNVFGAAGLRKFWFPVWRMPKNGGNWPTVSDM  212

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + KNQRLLVFTS  +KE SEGIAY W Y+VENQYGDGGMK G CPNRGES P+  T++SL
Sbjct  213   IQKNQRLLVFTSKAAKEASEGIAYVWRYIVENQYGDGGMKAGSCPNRGESLPMNTTSRSL  272

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             V+VNFF      P AC  NS PL++MV TC+ AAGNRW NF+AVDFYK            
Sbjct  273   VIVNFFRDAANFPEACKDNSAPLLNMVNTCHNAAGNRWPNFIAVDFYK------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   RS+GGG  +AVD  NG  +CG  ++ SC    + G C
Sbjct  321   ----------------------RSDGGGAAKAVDVTNGHSVCGCPNISSCKENMRYGAC  357



>gb|EPS66598.1| hypothetical protein M569_08178 [Genlisea aurea]
Length=396

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 240/361 (66%), Gaps = 36/361 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +CP  G   P+C R    D        LPFN+Y++LTTHNAF+  G  S T
Sbjct  32    NCDSGLHCETCPANGNIRPRCTRIQPVDPLSK-TRGLPFNRYSWLTTHNAFARFGEKSST  90

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP+NQ+DS+T QLNNGVRGLMLD+YDF GD+WLCHS+GG C+++TAF+PA + LK
Sbjct  91    GSVILAPQNQQDSITDQLNNGVRGLMLDMYDFLGDIWLCHSYGGNCYNYTAFQPAINVLK  150

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NP+EIVTII+EDYV +P GLTKVF  +GLMK+WFPVS MPKNG DWP+V +M
Sbjct  151   EIQVFLEANPTEIVTIIIEDYVTSPNGLTKVFNSSGLMKFWFPVSAMPKNGEDWPIVDEM  210

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             +  N+RLLVFTS  SKE SEGIAY+W Y+VENQYGDGGMK G CP+R ESP + +T++SL
Sbjct  211   IRDNRRLLVFTSKASKESSEGIAYEWRYIVENQYGDGGMKPGSCPSRAESPAMNETSRSL  270

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F S P    AC  NS PL+ M  TCY A+G RW NF+AVDFYK            
Sbjct  271   VLMNYFPSAPDLVTACRDNSSPLLAMANTCYEASGRRWPNFIAVDFYK------------  318

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS+GGG   AVD  NG L+CG   +  C   +  G C 
Sbjct  319   ----------------------RSDGGGAPLAVDTSNGQLVCGCSSISFCGEDTPFGVCE  356

Query  239   R  237
             +
Sbjct  357   K  357



>ref|XP_011005991.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Populus euphratica]
Length=406

 Score =   389 bits (999),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 246/379 (65%), Gaps = 46/379 (12%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFN  1200
             T+   G+ C V+D   S+C +G+HC +C   G   P+C R      T + K     LPFN
Sbjct  23    TAVKEGQTC-VVD---SNCNSGLHCETCVANGNVRPRCTRIQPLIPTSKEK----GLPFN  74

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             +Y +LTTHN+F+  G  S TG   +AP NQ+D+VT QLNNG+RG MLD+YDF+ D+WLCH
Sbjct  75    QYTWLTTHNSFAKLGDRSATGSIILAPTNQQDTVTSQLNNGIRGFMLDMYDFQNDIWLCH  134

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGG C++FTAF+PA + LKEI+AFL  NPSEI+TI +EDYV +P+GLTKVF  AGL KY
Sbjct  135   SFGGNCYNFTAFQPAINVLKEIQAFLEANPSEIITIFIEDYVTSPRGLTKVFDAAGLRKY  194

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             W+PVS MPKNGG WP V DMV KNQRL+VFTS  +KE SEGIAY+W Y+VENQYGDGGM 
Sbjct  195   WYPVSRMPKNGGKWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYEWRYIVENQYGDGGMI  254

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR ESP L  T++SLVLVN F   P    AC  NS PL+DMV TCY AAGNRW N
Sbjct  255   AGSCPNRAESPALNTTSRSLVLVNHFPDGPDITQACKHNSAPLMDMVNTCYQAAGNRWPN  314

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RS+GGG   AVD  NG L
Sbjct  315   FIAVDFYK----------------------------------RSDGGGAPAAVDVSNGHL  340

Query  299   LCGKDDVHSCVGGSK*GGC  243
             +CG  ++ +C      G C
Sbjct  341   VCGCGNIATCKPNMTFGAC  359



>gb|AAM65394.1| unknown [Arabidopsis thaliana]
Length=426

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/383 (51%), Positives = 249/383 (65%), Gaps = 38/383 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ACS  NCQ+LD     +DC +G++C  CP +G S P C R  AT    ++N  LPFNKY 
Sbjct  28    ACSNGNCQLLDSCSSATDCVSGLYCGDCPAVGRSKPVCTRGQATSPTSIIN-GLPFNKYT  86

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THNAFS        GV  +   NQED++T QL NGVRGLMLD+YDF  D+WLCHS  
Sbjct  87    WLMTHNAFSNANAPLLPGVERITFYNQEDTITNQLQNGVRGLMLDMYDFNNDIWLCHSLR  146

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C +FT F+PA + L+E+EAFLS NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWFP
Sbjct  147   GQCFNFTXFQPAINILREVEAFLSQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWFP  206

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS MP+ G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW YMVEN+ GD G+KRG 
Sbjct  207   VSKMPRKGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYMVENESGDPGVKRGS  266

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  + GNR  NFLA
Sbjct  267   CPNRKESQPLNSKSSSLFLMNYFPTYPVEKDACKEHSAPLAEMVGTCLKSGGNRMPNFLA  326

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V+FY                                   RS+GGG FE +DR+NG +LCG
Sbjct  327   VNFY----------------------------------MRSDGGGVFEILDRMNGPVLCG  352

Query  290   KDDVHSCVGGSK*GGCRRWNTRT  222
              + + +C  G+  G C+    +T
Sbjct  353   CETLSACQPGAAYGSCKNVTVQT  375



>ref|XP_008456136.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Cucumis 
melo]
Length=417

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 238/359 (66%), Gaps = 36/359 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C   G   P+C R         + + LPFN Y +LTTHN+F+  G  S T
Sbjct  40    NCDAGLHCETCFADGNVRPRCTRIQPISPISKVKD-LPFNHYTWLTTHNSFAKLGAKSAT  98

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QLNNGVRG MLD+YDF  D+WLCHS+GG+C+++TAF+PA + LK
Sbjct  99    GSLILAPTNQQDSITSQLNNGVRGFMLDMYDFENDIWLCHSYGGQCYNYTAFQPAINVLK  158

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E +AFL  NP EIVTII+EDYV +PKGLT VF  AGL K+WFPV  MPKNGG+WP VSDM
Sbjct  159   EFQAFLDANPFEIVTIIIEDYVTSPKGLTNVFGAAGLRKFWFPVWRMPKNGGNWPTVSDM  218

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + KNQRLLVFTS  +KE SEGIAY W YMVENQYGDGGMK G CPNRGES P+  T++SL
Sbjct  219   IQKNQRLLVFTSKAAKEASEGIAYVWRYMVENQYGDGGMKAGSCPNRGESLPMNTTSRSL  278

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             V+VNFF +    P AC  NS PL++MV TC+ AAGNRW NF+AVDFYK            
Sbjct  279   VIVNFFRNAANFPEACKDNSAPLLNMVNTCHNAAGNRWPNFIAVDFYK------------  326

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   RS+GGG  +AVD  NG  +CG  ++ SC    + G C
Sbjct  327   ----------------------RSDGGGAAKAVDITNGHSVCGCPNISSCKENMRYGAC  363



>gb|KHG16534.1| hypothetical protein F383_21107 [Gossypium arboreum]
Length=323

 Score =   385 bits (990),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 236/384 (61%), Gaps = 86/384 (22%)
 Frame = -3

Query  1379  FNVVTS--ACSGENCQVLDEECS---DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNN  1215
             F V+T+  ACS   C+ L +ECS   DC  G+ C SC   F G +C+RST T+QF+ +N 
Sbjct  15    FAVITATFACSNGQCK-LGDECSSDADCQTGLSCFSCSEAFDGLRCIRSTTTNQFEFMN-  72

Query  1214  SLPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGD  1035
                                                          GVR LMLD YDF+GD
Sbjct  73    ---------------------------------------------GVRALMLDTYDFKGD  87

Query  1034  VWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDA  855
             +WLCHSFGG+CHD+TAF  A DTLKE+EAFLS NPSEIVT+ LEDYV  P GL+KVF DA
Sbjct  88    IWLCHSFGGRCHDYTAFWLAIDTLKEVEAFLSGNPSEIVTLFLEDYVETPNGLSKVFKDA  147

Query  854   GLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYG  675
             GLMKYWFPVS+MP+NG DWPLV DMVA NQR +VFTS KSK+ESEGIAYQWNY+VEN YG
Sbjct  148   GLMKYWFPVSSMPQNGQDWPLVKDMVASNQRFVVFTSAKSKQESEGIAYQWNYVVENHYG  207

Query  674   DGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAG  495
             D G   G+C NRGES PL D TKSLVL+N F S+  + MAC  NS  LI M+ TCY  +G
Sbjct  208   DVGEHPGECSNRGESAPLNDKTKSLVLINHFHSIAFKVMACEDNSASLISMLDTCYGRSG  267

Query  494   NRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDR  315
             NRWANF+AVD+YK                                  RS+GGG F+AVD+
Sbjct  268   NRWANFVAVDYYK----------------------------------RSDGGGVFQAVDK  293

Query  314   LNGGLLCGKDDVHSCVGGSK*GGC  243
             LNG LLCG DDVHSCV GS    C
Sbjct  294   LNGQLLCGCDDVHSCVPGSSSATC  317



>ref|XP_006280502.1| hypothetical protein CARUB_v10026440mg [Capsella rubella]
 gb|EOA13400.1| hypothetical protein CARUB_v10026440mg [Capsella rubella]
Length=431

 Score =   389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/383 (51%), Positives = 249/383 (65%), Gaps = 38/383 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ACS  NCQ+LD     +DC  G++C  CP +G S P C R  AT    ++N  LPFNKY 
Sbjct  32    ACSNGNCQMLDSCSSATDCVPGLYCGDCPAVGRSKPVCTRGQATSPTSIIN-GLPFNKYT  90

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THNAFS        GV  +   NQED++T QL NGVRGLMLD+YDF  D+WLCHS  
Sbjct  91    WLMTHNAFSNANAPPLPGVERITFYNQEDTITNQLQNGVRGLMLDMYDFNNDIWLCHSLR  150

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C +FTAF+PA +TL+E+E FLS NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWFP
Sbjct  151   GQCFNFTAFQPAINTLREVETFLSQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWFP  210

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS MPK G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW Y+VEN+ GD G+KRG 
Sbjct  211   VSKMPKKGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYIVENESGDPGVKRGS  270

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CP+R ES PL   + SL L+N+F ++P+E  AC ++S PL +MVGTC  + GNR  NFLA
Sbjct  271   CPHRKESQPLNSKSSSLFLMNYFPTIPIEKDACKEHSAPLAEMVGTCLKSGGNRMPNFLA  330

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V+FY                                   RS+GGG FE +DR+NG +LCG
Sbjct  331   VNFY----------------------------------MRSDGGGVFEILDRMNGPVLCG  356

Query  290   KDDVHSCVGGSK*GGCRRWNTRT  222
                + +C  G+  G C+    +T
Sbjct  357   CQTLAACQPGAAYGSCKNVTLQT  379



>ref|XP_010111794.1| PI-PLC X domain-containing protein [Morus notabilis]
 gb|EXC31740.1| PI-PLC X domain-containing protein [Morus notabilis]
Length=424

 Score =   389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 246/380 (65%), Gaps = 40/380 (11%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFN  1200
             +SACS  NCQVL E CS   DCG G++C +CP  G + P C R        ++N  LPFN
Sbjct  31    SSACSNGNCQVL-EACSAATDCGPGLYCGNCPASGSNQPICTRGQQILPTSIIN-GLPFN  88

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY +L THN+FSI       GV  +   NQED+VT QLNNGVRGLMLD+YDF  D+WLCH
Sbjct  89    KYTWLVTHNSFSIVDAPPLNGVQRLTFYNQEDTVTNQLNNGVRGLMLDMYDFENDIWLCH  148

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C++FTAF+PA +TLKE+EAFLSTNP+EIVTII+EDYV+  KGLT +FT+AGL KY
Sbjct  149   SFKGQCYNFTAFQPAINTLKEVEAFLSTNPNEIVTIIIEDYVHTTKGLTNLFTNAGLDKY  208

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MPK G DWP V++MV  N RLLVFTS  SKE  EGIAYQW YMVEN+ GD G+ 
Sbjct  209   WFPVSKMPKKGDDWPTVTEMVQANYRLLVFTSDSSKEAKEGIAYQWKYMVENEAGDPGVV  268

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR +S PL   + SL   N+F + P++  AC +NS PL  MVGTCY AAGN   N
Sbjct  269   PGSCPNRKQSKPLNSKSVSLFFQNYFPTYPVQAEACKENSAPLAAMVGTCYKAAGNVMPN  328

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAV+FY                                   RS GGG F+AVDR+NG  
Sbjct  329   FLAVNFY----------------------------------MRSGGGGVFDAVDRMNGQT  354

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG   V +C  G+  G C+
Sbjct  355   LCGCSTVAACQPGAPFGSCK  374



>ref|XP_007047287.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX91444.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
Length=423

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 249/383 (65%), Gaps = 42/383 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNS  1212
             F++ +S   GE C       S C +G+ C +C + G + P+C R    + T + K     
Sbjct  25    FSMSSSLKIGETCSSSSSSNSACDSGLSCQTCSVNGNTRPRCTRIQPLSPTSKVK----G  80

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY++LTTHN+F++ G     G   +AP NQEDS+T QL NGVRGLMLD+YDF GD+
Sbjct  81    LPFNKYSWLTTHNSFALKGAIPAIGPAIIAPANQEDSITNQLKNGVRGLMLDMYDFNGDI  140

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSFGG+C++ TAF+PA + LKEI+AFL  NPSEI+TI +EDYV +P+GLTKVF  AG
Sbjct  141   WLCHSFGGQCYNVTAFQPAINVLKEIQAFLEANPSEIITIFIEDYVASPQGLTKVFNAAG  200

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPV+ MPKNG DWP V DMV +N+RL+VFTS  +KE SEGIAY+W Y+VEN+YG+
Sbjct  201   LKKYWFPVAKMPKNGEDWPTVDDMVKQNERLVVFTSKSAKEASEGIAYEWRYVVENEYGN  260

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CPNR ES P+   T+SLVL N+F + P +  AC +NS PL+ M+ TC+ AAGN
Sbjct  261   DGMKAGSCPNRAESSPMNTKTRSLVLENYFPTNPNQTTACSENSAPLVSMLNTCHKAAGN  320

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RW NF+AVDFY                                  QRS+GGG  EAVD  
Sbjct  321   RWPNFIAVDFY----------------------------------QRSDGGGAPEAVDIA  346

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L CG D++  C   +  G C
Sbjct  347   NGHLTCGCDNLAYCKVNATFGSC  369



>ref|XP_008785863.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Phoenix dactylifera]
Length=402

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 243/358 (68%), Gaps = 37/358 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTG  1137
             DC  G HC SC  G S   C+R    D  +  +  LPFN+Y++LTTHN++++ G +S TG
Sbjct  35    DCNTGQHCGSCGGGQS--ICMRVEPIDP-ETQDKRLPFNRYSWLTTHNSYAMVGANSATG  91

Query  1136  VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKE  957
              P ++P NQ+DSVT QL NG+RGLMLD+YDF   +WLCHSFGG C+++TAF+PA + LKE
Sbjct  92    SPLLSPTNQQDSVTSQLKNGIRGLMLDMYDFENGIWLCHSFGGNCYNYTAFQPAINVLKE  151

Query  956   IEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMV  777
             I  FL  NPSE++TI +EDYV +P+GL+KVF  +GLMKYWFP+S MPKNG +WPL+SDM+
Sbjct  152   IHTFLEANPSEVITIFIEDYVTSPQGLSKVFNASGLMKYWFPLSLMPKNGSNWPLLSDMI  211

Query  776   AKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLV  597
             ++NQRLLVFTS KSKE SEGIAY+WNY+VENQYGDGGMK G CPNR ES P+  T+KSLV
Sbjct  212   SQNQRLLVFTSKKSKEASEGIAYEWNYVVENQYGDGGMKAGSCPNRAESSPMNTTSKSLV  271

Query  596   LVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             L+N+F + P +  AC  NS PL+ M+ TC+  +GNRW NF+AVDFY +            
Sbjct  272   LMNYFPTNPNQSEACSDNSAPLVSMLKTCHNLSGNRWPNFIAVDFYML------------  319

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                   S+GGG  EA D  NG L+CG D++  C   +  G C
Sbjct  320   ----------------------SDGGGAPEATDTANGHLVCGCDNIAYCKANATFGTC  355



>ref|XP_010647736.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Vitis vinifera]
 ref|XP_010647737.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Vitis vinifera]
 emb|CBI32391.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   388 bits (996),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 241/361 (67%), Gaps = 37/361 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C   G   P+C R+   +    +   LPFN+Y++LTTHNAF+  G  S +
Sbjct  31    NCDSGLHCETCLANGNVRPRCTRTRPVNPTSKVK-GLPFNRYSWLTTHNAFAKLGAKSAS  89

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G P + P NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCHS+GG+C+++TAF+PA + LK
Sbjct  90    GWPILTPTNQQDSITSQLNNGVRGLMLDMYDFDNDIWLCHSYGGQCYNYTAFQPAINVLK  149

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E++ FL  NPSEIVTII+EDYV +PKGLT VF  AGL K+WFPVS MP+NGGDWP V DM
Sbjct  150   EVQVFLEANPSEIVTIIIEDYVTSPKGLTNVFNAAGLRKFWFPVSRMPRNGGDWPTVEDM  209

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDT-TKS  603
             V KNQRL+VFTS  +K+ SEGIAY+W Y+VENQYG+GGMK G CPNRGES P+ +T TKS
Sbjct  210   VEKNQRLVVFTSKAAKQASEGIAYEWRYLVENQYGNGGMKAGSCPNRGESSPMNNTKTKS  269

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVL+N+F   P    AC  NS PLI M+ TC+ AAG RW NF+AVDFYK           
Sbjct  270   LVLMNYFPDGPDVTQACKHNSAPLISMLNTCHEAAGKRWPNFIAVDFYK-----------  318

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG  EAVD  NG L+CG  ++  C      G C
Sbjct  319   -----------------------RSDGGGAPEAVDLANGQLVCGCGNIAYCQANMTFGKC  355

Query  242   R  240
              
Sbjct  356   E  356



>ref|XP_010458824.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Camelina sativa]
Length=344

 Score =   386 bits (991),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 236/361 (65%), Gaps = 47/361 (13%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHN  1173
             G+ C  LDE   DC  G+ C  C  G    +CVRS  T  F ++NNS+PFNKYAFLTTHN
Sbjct  31    GDQCS-LDE---DCNVGLGCYKC--GIEVARCVRSNITYPFSVVNNSMPFNKYAFLTTHN  84

Query  1172  AFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDF  993
             +F+I G              QED++ QQLN+GVR LMLD YD++GDVWLCHSF  KC + 
Sbjct  85    SFAIEGKPFHVA-------TQEDTIVQQLNSGVRALMLDTYDYQGDVWLCHSFDEKCFEL  137

Query  992   TAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPK  813
             T F  A DT  EI AFL+ NP EIVT+ L DYV +P GLTKVFTD+GL K+WFPV NMP 
Sbjct  138   TKFNRAIDTFTEIFAFLTVNPLEIVTLFLVDYVKSPNGLTKVFTDSGLKKFWFPVKNMPL  197

Query  812   NGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGE  633
              G DWPLV DMVA NQRL+VFTS +SK+ +EGIAYQ  Y+VENQYGD G+K G+C NRGE
Sbjct  198   GGQDWPLVKDMVANNQRLIVFTSAESKQNTEGIAYQLKYVVENQYGDDGVKPGECSNRGE  257

Query  632   SPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKV  453
             S  LT+  K+LVLVN F +VP++ + C  N   L+DM+ TCYLAAGNRW N++AV+FYK 
Sbjct  258   SALLTNKNKALVLVNHFKTVPVKILTCEDNFEQLVDMIKTCYLAAGNRWTNYVAVNFYK-  316

Query  452   VKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHS  273
                                              RS  GGTF+AVD LNG LLC +DDVH+
Sbjct  317   ---------------------------------RSIEGGTFQAVDILNGKLLCRRDDVHA  343

Query  272   C  270
             C
Sbjct  344   C  344



>emb|CDO97188.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   390 bits (1001),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 246/379 (65%), Gaps = 39/379 (10%)
 Frame = -3

Query  1376  NVVTSACSGENCQVLDEECSDCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             N  T+   GE C +L + C D  AG+HC +C   G   P+C R    + F  +   LPFN
Sbjct  65    NSCTALKVGETC-LLSKNCDD--AGLHCETCLAEGQGRPRCTRIQPINPFSKVK-GLPFN  120

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             +Y++LTTHNAF+  G  S TG   ++P NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCH
Sbjct  121   RYSWLTTHNAFARLGEKSSTGAVILSPTNQQDSITSQLNNGVRGLMLDMYDFENDIWLCH  180

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGGKC++FTAF+PA + LKEI+ FL  NPSEIVTII+EDYV +P GLTKVF  AGL KY
Sbjct  181   SFGGKCYNFTAFQPAINVLKEIQVFLEANPSEIVTIIIEDYVTSPNGLTKVFDAAGLRKY  240

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MPK GG+WP V DM+  NQRL+VFTS  SKE SEGIAY+W Y+VENQYG+GGMK
Sbjct  241   WFPVSQMPKTGGEWPTVDDMIQHNQRLVVFTSKSSKESSEGIAYEWRYLVENQYGNGGMK  300

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR ESP +  TT+SLVL+N+F   P    AC  NS PLI M+ TCY AAG RW N
Sbjct  301   PGLCPNRAESPAMNTTTRSLVLMNYFPDTPDLTQACKHNSAPLISMMNTCYAAAGKRWPN  360

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RS+GGG  +AVD  N  L
Sbjct  361   FIAVDFYK----------------------------------RSDGGGAPQAVDTANSQL  386

Query  299   LCGKDDVHSCVGGSK*GGC  243
             +CG  D+ SC      G C
Sbjct  387   MCGCPDISSCKENVTFGSC  405



>gb|KHG16691.1| hypothetical protein F383_20820 [Gossypium arboreum]
Length=422

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 240/380 (63%), Gaps = 40/380 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPF  1203
             F   +S   G+ C + D  C    +G+HC +C   G   P+C R    +    L   LPF
Sbjct  37    FGFCSSLREGQTC-IADRYCD---SGLHCETCLANGNVRPRCTRIQPLNPISKLK-GLPF  91

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             N+Y++LTTHN+F+  G  S TG   +AP NQ+DS+T QLNNGVRGLMLD+YDF  DVWLC
Sbjct  92    NRYSWLTTHNSFARLGERSATGSLILAPTNQQDSITSQLNNGVRGLMLDMYDFLNDVWLC  151

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGG+C ++TAF+PA D LKE+  FL  NP EIVTII+EDYV +P+GL+KVF  AGL K
Sbjct  152   HSFGGQCFNYTAFQPAIDVLKEVRVFLEANPLEIVTIIIEDYVTSPRGLSKVFDAAGLRK  211

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             +WFPVS MPKNG +WP V DMV KNQRL+VFTS  +KE SEGIAYQW YMVENQYGDGGM
Sbjct  212   FWFPVSRMPKNGENWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYQWRYMVENQYGDGGM  271

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G CPNR ESP +   ++SLVLVN+F   P    AC  NS PLI M  TCY AAGNRW 
Sbjct  272   VAGSCPNRAESPVMNTKSRSLVLVNYFPDRPDITQACKHNSAPLISMAKTCYTAAGNRWP  331

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NFLAVDFYK                                  RS+ GG  EAVD +NG 
Sbjct  332   NFLAVDFYK----------------------------------RSDSGGAPEAVDVVNGN  357

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             L+CG  ++  C      G C
Sbjct  358   LVCGCGNIAKCKANMTFGVC  377



>ref|XP_006384401.1| hypothetical protein POPTR_0004s14730g [Populus trichocarpa]
 gb|ERP62198.1| hypothetical protein POPTR_0004s14730g [Populus trichocarpa]
Length=406

 Score =   386 bits (992),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/379 (53%), Positives = 245/379 (65%), Gaps = 46/379 (12%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFN  1200
             T+   G+ C V+D   S+C +G+HC +C   G   P+C R      T + K     LPFN
Sbjct  23    TALKEGQTC-VVD---SNCNSGLHCETCVANGNVRPRCTRIQPLIPTSKEK----GLPFN  74

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             +Y +LTTHN+F+  G  S TG   +AP NQ+D+VT QLNNG+RG MLD+YDF+ D+WLCH
Sbjct  75    QYTWLTTHNSFAKLGDRSATGSIILAPTNQQDTVTSQLNNGIRGFMLDMYDFQNDIWLCH  134

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SFGG C++FTAF+PA + LKEI+AFL  NPSEI+TI +EDYV +P+GLTKVF  AGL KY
Sbjct  135   SFGGNCYNFTAFQPAINVLKEIQAFLEANPSEIITIFIEDYVTSPRGLTKVFDAAGLRKY  194

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             W+PVS MPKNGG WP V DMV KNQRL+VFTS  +KE SEGIAY+W Y+VENQYGDGGM 
Sbjct  195   WYPVSRMPKNGGKWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYEWRYIVENQYGDGGMI  254

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR ESP L  T++SLVLVN F   P    AC  NS PL+ MV TCY AAGNRW N
Sbjct  255   AGSCPNRAESPALDTTSRSLVLVNHFPDRPDITQACKHNSAPLMAMVNTCYQAAGNRWPN  314

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AVDFYK                                  RS+GGG   AVD  NG L
Sbjct  315   FIAVDFYK----------------------------------RSDGGGAPAAVDVSNGHL  340

Query  299   LCGKDDVHSCVGGSK*GGC  243
             +CG  ++ +C      G C
Sbjct  341   VCGCGNIATCKPNMTFGAC  359



>ref|XP_002282885.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Vitis 
vinifera]
 emb|CBI21399.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 250/380 (66%), Gaps = 40/380 (11%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             ++ACS  NCQVL E CS   DCG G++C +CP +G + P C R  AT    ++N  LPFN
Sbjct  35    SAACSNRNCQVL-EPCSLPTDCGPGLYCGNCPAMGKNQPICTRGQATIPTTIIN-GLPFN  92

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY++L THNAFSI       GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCH
Sbjct  93    KYSWLMTHNAFSIVDAPPLPGVQRITFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCH  152

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C++FTAF+PA +TLKE+E FLS NPSEIVTI++EDYV+  KGLT +FT+AGL KY
Sbjct  153   SFRGQCYNFTAFQPAINTLKEVETFLSENPSEIVTIVIEDYVHTTKGLTNLFTNAGLDKY  212

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MP+ G DWP V+DMV +N RLLVFTS+ SKE  EGIAYQW YMVEN+ GDGG+ 
Sbjct  213   WFPVSKMPRKGEDWPTVTDMVQENHRLLVFTSIASKEADEGIAYQWRYMVENEPGDGGVV  272

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
             +G CPNR ES PL   + SL L N F S P+E  +C ++S  + ++VGTCY AAGN   N
Sbjct  273   QGSCPNRKESRPLNSKSASLFLQNSFPSFPVESDSCKEHSATVGELVGTCYKAAGNVMPN  332

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAV+FY                                   RS+GGG F+ +D +NG  
Sbjct  333   FLAVNFY----------------------------------MRSDGGGVFDVLDGMNGQT  358

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG   V +C  G+  G C+
Sbjct  359   LCGCSSVAACQAGAPFGTCK  378



>ref|XP_003607943.1| PI-PLC X domain-containing protein [Medicago truncatula]
Length=430

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 240/377 (64%), Gaps = 63/377 (17%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C   G   P+C R   T+    +   LPFN+Y++LTTHN+F++ G  S T
Sbjct  35    NCNSGLHCETCVANGNVRPRCTRIQPTNPTSKVK-GLPFNRYSWLTTHNSFALLGQKSAT  93

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+D++T QLNNGVRGLMLD+YDF  DVWLCHSFGG+C+++TAF+PA + LK
Sbjct  94    GSVILAPTNQQDTITAQLNNGVRGLMLDLYDFENDVWLCHSFGGQCYNYTAFQPAINVLK  153

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL  NPSEIVTII+EDYV +PKGLTKVF  AGL KYWFPVS MPKNGGDWP V DM
Sbjct  154   EIQVFLEANPSEIVTIIIEDYVTSPKGLTKVFNAAGLRKYWFPVSRMPKNGGDWPTVDDM  213

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ---------------------------  681
             V KNQRL+VFTS  +KE SEGIAY+W Y+VENQ                           
Sbjct  214   VQKNQRLVVFTSKAAKEASEGIAYEWRYLVENQCKYKFQKFKLTLVLVTYAALIPRIEDG  273

Query  680   YGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLA  501
               +GGMK G CPNR ESP +  T++SLVLVNFF  +P    +C  NS PL+DMV TCY A
Sbjct  274   NSNGGMKAGSCPNRAESPSMNTTSRSLVLVNFFKDLPDVTQSCKDNSAPLLDMVNTCYQA  333

Query  500   AGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAV  321
             AG RW NF+AVDFYK                                  RS+GGG  EAV
Sbjct  334   AGKRWPNFIAVDFYK----------------------------------RSDGGGAPEAV  359

Query  320   DRLNGGLLCGKDDVHSC  270
             D  NG L+CG  ++ SC
Sbjct  360   DVANGHLVCGCGNIASC  376



>ref|XP_009346269.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=403

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 238/360 (66%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDC +G+HC +C   G   PKC R         +  +LPFNKY++LTTHN+F+  G  S 
Sbjct  34    SDCDSGLHCETCVADGNVVPKCTRIKPISPISQVQ-TLPFNKYSWLTTHNSFARLGDRSA  92

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T+QLNNGVRGLMLD+YDF+  +WLCHSFGG C+++T+F+PA + L
Sbjct  93    TGSLIIAPTNQQDSITEQLNNGVRGLMLDMYDFQNGIWLCHSFGGNCYNYTSFQPAINVL  152

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI+AFL  NPS+IVTII+EDYV +PKGLTKVF  AGL K+WFPVS MPK GGDWP V+D
Sbjct  153   KEIQAFLQANPSDIVTIIIEDYVTSPKGLTKVFDAAGLRKFWFPVSRMPKKGGDWPTVAD  212

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             M+ KNQRL+VFTS ++KE SEGIAY+WNY+VENQYG GGM  G CPNR ES P+  T+KS
Sbjct  213   MIQKNQRLVVFTSKRAKEASEGIAYEWNYVVENQYGKGGMVAGSCPNRAESSPMNTTSKS  272

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN+F   P    AC  NS  L+ MV TCY A+  RW NF+AVDFYK           
Sbjct  273   LVLVNYFRDAPDITQACKDNSDALLRMVNTCYDASSKRWPNFIAVDFYK-----------  321

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG  +A D  NG L+CG   + +C      G C
Sbjct  322   -----------------------RSDGGGAPKATDVANGHLVCGCGTIANCKANVSFGVC  358



>ref|XP_006425926.1| hypothetical protein CICLE_v10025639mg [Citrus clementina]
 gb|ESR39166.1| hypothetical protein CICLE_v10025639mg [Citrus clementina]
Length=435

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 250/381 (66%), Gaps = 38/381 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPF  1203
             V ++ACS  NCQVLD     +DCG G++C +CP LG + P C R  AT    ++ + LPF
Sbjct  30    VNSTACSNGNCQVLDSCAAATDCGPGLYCGNCPALGKNRPICTRGQATIPTTIIGD-LPF  88

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY++L THN+FSI    +  GV  +   NQED VT QL NGVRGLMLD+YDF GD+WLC
Sbjct  89    NKYSWLVTHNSFSIVDTPALPGVQRLTFYNQEDMVTNQLRNGVRGLMLDMYDFNGDIWLC  148

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+C +FTAF+PA +TL+E+EAFLS  P+EIVTII+EDYV  PKGLT +F  AGL K
Sbjct  149   HSFRGQCFNFTAFQPAINTLREVEAFLSQYPTEIVTIIIEDYVQTPKGLTSLFVRAGLDK  208

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             Y+FPVS MPK G DWP V++MV KN RLLVF+SV SKE  EGIAYQW Y++EN+ GD G+
Sbjct  209   YFFPVSKMPKKGEDWPTVTEMVQKNYRLLVFSSVASKEAEEGIAYQWRYILENESGDPGV  268

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CP+R ES PL     SL L N+F + P+E  AC ++S PL +MVGTCY AAGN   
Sbjct  269   KAGSCPHRKESQPLNSRKASLFLQNYFPTYPVEEDACKEHSTPLAEMVGTCYKAAGNLLP  328

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NFLAV+FY                                   RS+GGG F+ +D++NG 
Sbjct  329   NFLAVNFY----------------------------------MRSDGGGVFDVLDKMNGQ  354

Query  302   LLCGKDDVHSCVGGSK*GGCR  240
              LCG   V +C GG+  G C+
Sbjct  355   TLCGCSTVLACQGGAPFGSCK  375



>ref|XP_003539359.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Glycine max]
Length=419

 Score =   386 bits (991),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 246/383 (64%), Gaps = 46/383 (12%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNS  1212
             F   +++  GENC   ++    C AG+ C +CP  G + P+C R+   + T + K     
Sbjct  23    FTSSSASKIGENCGSDNK----CDAGLSCQTCPANGNTRPRCSRTQPLSPTSKVK----G  74

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             L FN+Y++LTTHN++++ G  S TG   VAP NQED V +QL NGVRG MLD+YDF+ D+
Sbjct  75    LAFNRYSWLTTHNSYALAGARSATGSVIVAPMNQEDKVDEQLKNGVRGFMLDMYDFQNDI  134

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF  KC +FTAF+PA + LK++  FL  NPSEI+TI +EDYV AP+GLTKV  D+G
Sbjct  135   WLCHSFQSKCFNFTAFQPAINVLKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVLRDSG  194

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KY FPVS MPKNG DWP V DMV KNQRL+VFTS  +KE SEGIAYQW Y+VENQYGD
Sbjct  195   LSKYMFPVSRMPKNGEDWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYQWTYVVENQYGD  254

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CP+R ESP +   ++SLVLVN+F S P    AC  NS PL+DM+ TC+ AAGN
Sbjct  255   DGMKAGSCPSRAESPAMNTKSRSLVLVNYFHSAPNRSQACADNSAPLLDMMKTCHEAAGN  314

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RWANF+AVD+Y                                  QRS+GGG   AVD  
Sbjct  315   RWANFIAVDYY----------------------------------QRSDGGGAPLAVDEA  340

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L CG D++  C   +K G C
Sbjct  341   NGHLTCGCDNIAYCKENAKSGTC  363



>emb|CDY01436.1| BnaA07g12090D [Brassica napus]
Length=424

 Score =   386 bits (991),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 252/384 (66%), Gaps = 40/384 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ACS  NCQ+L E CS   DC  G++C +CP +G + P C R  AT    ++N  LPFNKY
Sbjct  30    ACSNGNCQML-ESCSSATDCVPGLYCGNCPAIGRTKPICTRGQATIPTSIIN-GLPFNKY  87

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
              +L THNAFS        GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS 
Sbjct  88    TWLMTHNAFSNANQPPLPGVQRLTFFNQEDTVTNQLRNGVRGLMLDMYDFNDDIWLCHSL  147

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWF
Sbjct  148   RGQCFNFTAFQPAVNTLREVEAFLTQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWF  207

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MPK G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW Y+VEN+ GD G+KRG
Sbjct  208   PVSKMPKRGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYIVENESGDPGVKRG  267

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  +AGNR  NFL
Sbjct  268   SCPNRKESQPLNSKSSSLFLMNYFPTFPVEKDACKEHSAPLAEMVGTCLKSAGNRMPNFL  327

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV+FY                                   RS+GGG FE +DR+NG ++C
Sbjct  328   AVNFY----------------------------------MRSDGGGVFEVLDRMNGPVIC  353

Query  293   GKDDVHSCVGGSK*GGCRRWNTRT  222
             G + + +C   +  G C+    +T
Sbjct  354   GCETLAACQPEAAFGSCKNVTLQT  377



>gb|KHN42089.1| PI-PLC X domain-containing protein [Glycine soja]
Length=419

 Score =   386 bits (991),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 246/383 (64%), Gaps = 46/383 (12%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNS  1212
             F   +++  GENC   ++    C AG+ C +CP  G + P+C R+   + T + K     
Sbjct  23    FTSSSASKIGENCGSDNK----CDAGLSCQTCPANGNTRPRCSRTQPLSPTSKVK----G  74

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             L FN+Y++LTTHN++++ G  S TG   VAP NQED V +QL NGVRG MLD+YDF+ D+
Sbjct  75    LAFNRYSWLTTHNSYALAGARSATGSVIVAPMNQEDKVDEQLKNGVRGFMLDMYDFQNDI  134

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF  KC +FTAF+PA + LK++  FL  NPSEI+TI +EDYV AP+GLTKV  D+G
Sbjct  135   WLCHSFQSKCFNFTAFQPAINVLKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVLRDSG  194

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KY FPVS MPKNG DWP V DMV KNQRL+VFTS  +KE SEGIAYQW Y+VENQYGD
Sbjct  195   LSKYMFPVSRMPKNGEDWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYQWTYVVENQYGD  254

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CP+R ESP +   ++SLVLVN+F S P    AC  NS PL+DM+ TC+ AAGN
Sbjct  255   DGMKAGSCPSRAESPAMNTESRSLVLVNYFHSAPNRSQACADNSAPLLDMMKTCHEAAGN  314

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RWANF+AVD+Y                                  QRS+GGG   AVD  
Sbjct  315   RWANFIAVDYY----------------------------------QRSDGGGAPLAVDEA  340

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L CG D++  C   +K G C
Sbjct  341   NGHLTCGCDNIAYCKENAKSGTC  363



>gb|ADE76605.1| unknown [Picea sitchensis]
Length=389

 Score =   385 bits (988),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 246/371 (66%), Gaps = 39/371 (11%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECS--DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPF  1203
             +   ACS   CQ+LD   +  DCG+G++C +C  +G + P CVR  AT    ++N  LPF
Sbjct  13    ITARACSNGGCQLLDSCYTEGDCGSGLYCSTCQAVGQNQPVCVRGQATIVTSIVN-GLPF  71

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY +LTTHNAFSI G  S TG   V   NQEDSVT QLNNGVRGLMLD+YDF GDVWLC
Sbjct  72    NKYTWLTTHNAFSIIGEQSYTGTARVTFYNQEDSVTNQLNNGVRGLMLDMYDFMGDVWLC  131

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HS  G+C++FTAFEPA +TL+E+EAFLS NP+EIVTI +EDYV+A KGLTKVFTDAGL K
Sbjct  132   HSLQGQCYNFTAFEPAINTLREVEAFLSLNPTEIVTIFIEDYVHAIKGLTKVFTDAGLSK  191

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MP NG DWP V++MVA NQRL+VFTS+ SKE +EGIAYQW Y+ EN+ GDGG+
Sbjct  192   YWFPVSKMPMNGEDWPTVTEMVANNQRLVVFTSMPSKEATEGIAYQWRYITENEPGDGGI  251

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G C NR ES PL      L L+N+F ++P +   C  +S  LI M+  CY  AG +  
Sbjct  252   KPGSCSNRKESVPLNSKAAILFLMNYFPTIPDQSGTCKDHSTSLIQMLNVCYHGAG-KAP  310

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AV+FY                                   RS+GGG F+AVDR+NG 
Sbjct  311   NFIAVNFY----------------------------------MRSDGGGVFDAVDRVNGR  336

Query  302   LLCGKDDVHSC  270
              LCG + V +C
Sbjct  337   SLCGCNTVAAC  347



>ref|XP_008373129.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Malus domestica]
Length=403

 Score =   385 bits (989),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 237/360 (66%), Gaps = 36/360 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDC +G+HC +C   G   PKC R         +  +LPFNKY++LTTHN+F+  G  S 
Sbjct  34    SDCDSGLHCETCVADGNVVPKCTRIKPISPISQVQ-TLPFNKYSWLTTHNSFARLGDRSA  92

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T+QLNNGVRGLMLD+YDF+  +WLCHSFGG C+++T+F+PA + L
Sbjct  93    TGSLIIAPTNQQDSITEQLNNGVRGLMLDMYDFQNGIWLCHSFGGNCYNYTSFQPAINVL  152

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KEI+AFL  NPSEIVTII+EDYV +PKGLTKVF  AGL K+WFPVS MPK GGDWP V+D
Sbjct  153   KEIQAFLQANPSEIVTIIIEDYVTSPKGLTKVFDAAGLRKFWFPVSRMPKKGGDWPTVAD  212

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             M+ KNQRL+VFTS ++KE SEGIAY+WNY+VENQYG GGM  G CPNR ES  +  T+KS
Sbjct  213   MIQKNQRLVVFTSKRAKEASEGIAYEWNYVVENQYGKGGMVAGSCPNRAESSSMNTTSKS  272

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN+F   P    AC  NS  L+ MV TCY A+  RW NF+AVDFYK           
Sbjct  273   LVLVNYFRDAPDITQACKDNSDALLRMVNTCYDASSKRWPNFIAVDFYK-----------  321

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG  +A D  NG L+CG   + SC      G C
Sbjct  322   -----------------------RSDGGGAPKATDVANGHLVCGCGTIASCKTNVSFGVC  358



>ref|XP_006590655.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Glycine max]
Length=421

 Score =   386 bits (991),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 246/383 (64%), Gaps = 46/383 (12%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNS  1212
             F   +++  GENC   ++    C AG+ C +CP  G + P+C R+   + T + K     
Sbjct  25    FTSSSASKIGENCGSDNK----CDAGLSCQTCPANGNTRPRCSRTQPLSPTSKVK----G  76

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             L FN+Y++LTTHN++++ G  S TG   VAP NQED V +QL NGVRG MLD+YDF+ D+
Sbjct  77    LAFNRYSWLTTHNSYALAGARSATGSVIVAPMNQEDKVDEQLKNGVRGFMLDMYDFQNDI  136

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF  KC +FTAF+PA + LK++  FL  NPSEI+TI +EDYV AP+GLTKV  D+G
Sbjct  137   WLCHSFQSKCFNFTAFQPAINVLKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVLRDSG  196

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KY FPVS MPKNG DWP V DMV KNQRL+VFTS  +KE SEGIAYQW Y+VENQYGD
Sbjct  197   LSKYMFPVSRMPKNGEDWPTVDDMVQKNQRLVVFTSKSAKEASEGIAYQWTYVVENQYGD  256

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CP+R ESP +   ++SLVLVN+F S P    AC  NS PL+DM+ TC+ AAGN
Sbjct  257   DGMKAGSCPSRAESPAMNTKSRSLVLVNYFHSAPNRSQACADNSAPLLDMMKTCHEAAGN  316

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RWANF+AVD+Y                                  QRS+GGG   AVD  
Sbjct  317   RWANFIAVDYY----------------------------------QRSDGGGAPLAVDEA  342

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L CG D++  C   +K G C
Sbjct  343   NGHLTCGCDNIAYCKENAKSGTC  365



>ref|XP_009103450.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Brassica 
rapa]
Length=424

 Score =   385 bits (990),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 252/384 (66%), Gaps = 40/384 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ACS  NCQ+L E CS   DC  G++C +CP +G + P C R  AT    ++N  LPFNKY
Sbjct  30    ACSNGNCQML-ESCSSATDCVPGLYCGNCPAIGRTKPICTRGQATMPTSIIN-GLPFNKY  87

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
              +L THNAFS        GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS 
Sbjct  88    TWLMTHNAFSNANQPPLPGVQRLTFFNQEDTVTNQLRNGVRGLMLDMYDFNDDIWLCHSL  147

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWF
Sbjct  148   RGQCFNFTAFQPAINTLREVEAFLTQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWF  207

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MPK G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW Y+VEN+ GD G+KRG
Sbjct  208   PVSKMPKRGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYIVENESGDPGVKRG  267

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  +AGNR  NFL
Sbjct  268   SCPNRKESQPLNSKSSSLFLMNYFPTFPVEKDACKEHSAPLAEMVGTCLKSAGNRMPNFL  327

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV+FY                                   RS+GGG FE +DR+NG ++C
Sbjct  328   AVNFY----------------------------------MRSDGGGVFEVLDRMNGPVIC  353

Query  293   GKDDVHSCVGGSK*GGCRRWNTRT  222
             G + + +C   +  G C+    +T
Sbjct  354   GCETLAACQPEAAFGSCKNVTLQT  377



>ref|XP_007042450.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
 gb|EOX98281.1| PLC-like phosphodiesterases superfamily protein [Theobroma cacao]
Length=399

 Score =   385 bits (988),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 234/353 (66%), Gaps = 42/353 (12%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFNKYAFLTTHNAFSITGWS  1149
             +C  G+HC +C   G   P+C R      T Q K     LPFN+Y++LTTHN+++  G  
Sbjct  31    NCDPGLHCETCLANGNVRPRCTRIQPLNPTSQVK----GLPFNRYSWLTTHNSYARFGER  86

Query  1148  SRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGD  969
             S TG   +AP NQ+DSVT QLNNGVRGLMLD+YDF+ D+WLCHSFGG+C ++TAF+PA +
Sbjct  87    SATGSLILAPTNQQDSVTSQLNNGVRGLMLDMYDFQNDIWLCHSFGGQCFNYTAFQPAIN  146

Query  968   TLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLV  789
              LKE++AFL   PSEIVTII+EDYV +P+GLTKVF  AGL K+WFPVS MPKNGG WP V
Sbjct  147   VLKEVQAFLQAKPSEIVTIIIEDYVTSPRGLTKVFDAAGLRKFWFPVSRMPKNGGKWPTV  206

Query  788   SDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTT  609
              DMV KNQRL+VFTS   KE SEGIAYQW YMVENQYG+GGM  G CPNR ESP +  T+
Sbjct  207   DDMVQKNQRLVVFTSKSDKEASEGIAYQWRYMVENQYGNGGMVAGSCPNRAESPAMNATS  266

Query  608   KSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIY  429
             +SLVLVN+F   P    AC  NS PL  MV TCY+AAGNRW NF+AVDFYK         
Sbjct  267   RSLVLVNYFPDTPDVTQACKHNSAPLFRMVNTCYVAAGNRWPNFIAVDFYK---------  317

Query  428   TIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                      RS+ GG  EA+D  NG L+CG  ++  C
Sbjct  318   -------------------------RSDSGGAPEALDVANGHLVCGCGNIVYC  345



>ref|XP_006573638.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Glycine max]
Length=423

 Score =   385 bits (989),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 236/361 (65%), Gaps = 42/361 (12%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSS  1146
             C AG+ C +CP  G +  +C R    + T + K     LPFN+Y++LTTHN++++ G  S
Sbjct  45    CDAGLSCQACPANGNTRTRCSRIQPLSPTSRVK----GLPFNRYSWLTTHNSYALAGARS  100

Query  1145  RTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDT  966
              TG   VAP NQED+V +QL NGVRG MLD+YDF+ D+WLCHSF  KC +FTAF+PA + 
Sbjct  101   ATGSVLVAPMNQEDTVAEQLKNGVRGFMLDMYDFQKDIWLCHSFQSKCFNFTAFQPAINV  160

Query  965   LKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVS  786
             LK++  FL  NPSEI+TI +EDYV AP+GLTKVF D+GL KY FPVS MPKNGGDWP V 
Sbjct  161   LKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVFKDSGLSKYIFPVSRMPKNGGDWPTVD  220

Query  785   DMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTK  606
             DMV KNQRL+VFTS  +KE SE IAYQW Y+VENQYGD GMK G CP+R ESP +   ++
Sbjct  221   DMVQKNQRLVVFTSKSAKEASENIAYQWTYVVENQYGDDGMKAGSCPSRAESPAMNTESR  280

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SLVLVN+F S P    AC  NS PL+DM  TC+ AAGNRWANF+AVD+Y           
Sbjct  281   SLVLVNYFHSAPNRSQACADNSAPLLDMTKTCHEAAGNRWANFIAVDYY-----------  329

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GG  246
                                    QRS+GGG   AVD  NG L CG D++  C   +K G 
Sbjct  330   -----------------------QRSDGGGAPLAVDEANGHLTCGCDNIAYCKENAKFGT  366

Query  245   C  243
             C
Sbjct  367   C  367



>ref|XP_003517306.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Glycine max]
Length=416

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 236/361 (65%), Gaps = 42/361 (12%)
 Frame = -3

Query  1313  CGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSS  1146
             C AG+ C +CP  G +  +C R    + T + K     LPFN+Y++LTTHN++++ G  S
Sbjct  38    CDAGLSCQACPANGNTRTRCSRIQPLSPTSRVK----GLPFNRYSWLTTHNSYALAGARS  93

Query  1145  RTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDT  966
              TG   VAP NQED+V +QL NGVRG MLD+YDF+ D+WLCHSF  KC +FTAF+PA + 
Sbjct  94    ATGSVLVAPMNQEDTVAEQLKNGVRGFMLDMYDFQKDIWLCHSFQSKCFNFTAFQPAINV  153

Query  965   LKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVS  786
             LK++  FL  NPSEI+TI +EDYV AP+GLTKVF D+GL KY FPVS MPKNGGDWP V 
Sbjct  154   LKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVFKDSGLSKYIFPVSRMPKNGGDWPTVD  213

Query  785   DMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTK  606
             DMV KNQRL+VFTS  +KE SE IAYQW Y+VENQYGD GMK G CP+R ESP +   ++
Sbjct  214   DMVQKNQRLVVFTSKSAKEASENIAYQWTYVVENQYGDDGMKAGSCPSRAESPAMNTESR  273

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SLVLVN+F S P    AC  NS PL+DM  TC+ AAGNRWANF+AVD+Y           
Sbjct  274   SLVLVNYFHSAPNRSQACADNSAPLLDMTKTCHEAAGNRWANFIAVDYY-----------  322

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GG  246
                                    QRS+GGG   AVD  NG L CG D++  C   +K G 
Sbjct  323   -----------------------QRSDGGGAPLAVDEANGHLTCGCDNIAYCKENAKFGT  359

Query  245   C  243
             C
Sbjct  360   C  360



>emb|CDY12809.1| BnaC07g16240D [Brassica napus]
Length=423

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 251/384 (65%), Gaps = 40/384 (10%)
 Frame = -3

Query  1361  ACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ACS  NCQ L E CS   DC  G++C +CP +G + P C R  AT    ++N  LPFNKY
Sbjct  29    ACSNGNCQTL-ESCSSATDCVPGLYCGNCPAIGRTKPICTRGQATIPTSIIN-GLPFNKY  86

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
              +L THNAFS        GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS 
Sbjct  87    TWLMTHNAFSNANQPPLPGVQRLTFFNQEDTVTNQLRNGVRGLMLDMYDFNDDIWLCHSL  146

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTII+EDYV+ PKGL+ +F +AGL KYWF
Sbjct  147   RGQCFNFTAFQPAINTLREVEAFLTQNPTEIVTIIIEDYVHRPKGLSTLFANAGLDKYWF  206

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MPK G DWP V+DMV +N RLLVFTSV +KE+ EG+AYQW Y+VEN+ GD G+KRG
Sbjct  207   PVSKMPKRGEDWPTVTDMVQENHRLLVFTSVAAKEDEEGVAYQWRYIVENESGDPGVKRG  266

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNR ES PL   + SL L+N+F + P+E  AC ++S PL +MVGTC  +AGNR  NF+
Sbjct  267   SCPNRKESQPLNSKSSSLFLMNYFPTFPVEKDACKEHSAPLAEMVGTCLKSAGNRMPNFV  326

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV+FY                                   RS+GGG FE +DR+NG ++C
Sbjct  327   AVNFY----------------------------------MRSDGGGVFEVLDRMNGPVIC  352

Query  293   GKDDVHSCVGGSK*GGCRRWNTRT  222
             G + + +C   +  G C+    +T
Sbjct  353   GCETLAACQPEAAFGSCKNVTLQT  376



>ref|XP_007047314.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047315.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX91471.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX91472.1| PLC-like phosphodiesterases superfamily protein isoform 1 [Theobroma 
cacao]
Length=425

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 198/384 (52%), Positives = 251/384 (65%), Gaps = 38/384 (10%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ++CS  NCQVLD   + +DCG G++C +CP LG + P C R  AT    ++   LPFNKY
Sbjct  33    TSCSNGNCQVLDSCSQATDCGPGLYCGNCPALGKTQPFCTRGQATIPTSVIGG-LPFNKY  91

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             ++L THN+FSI    S  GV  +   NQED+VT QL NGVRGLMLD+YDF GD+WLCHSF
Sbjct  92    SWLVTHNSFSIVDAPSLPGVQRLTFYNQEDTVTNQLMNGVRGLMLDMYDFDGDIWLCHSF  151

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTII+EDYV+ PKGLT +FT+AGL KYWF
Sbjct  152   RGQCFNFTAFQPAINTLREVEAFLTQNPTEIVTIIIEDYVHTPKGLTTLFTNAGLDKYWF  211

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PV+ MPK G DWP V++MV  N RLLVFTSV SKE  EGIAYQW Y++EN+ GD G+K G
Sbjct  212   PVAKMPKKGEDWPTVNEMVQANHRLLVFTSVASKEAEEGIAYQWKYILENEAGDPGVKPG  271

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNR ES PL   + SL L+N+F + P+E  AC ++S  L DM+GTCY AAG    NFL
Sbjct  272   SCPNRKESRPLNSKSASLFLMNYFPTFPVEDEACKEHSALLADMIGTCYKAAGIMMPNFL  331

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV+FY                                   RS+GGG F  +D +NG  LC
Sbjct  332   AVNFY----------------------------------MRSDGGGVFYDLDIMNGQRLC  357

Query  293   GKDDVHSCVGGSK*GGCRRWNTRT  222
             G   + +C  G+  G C+  +  T
Sbjct  358   GCSTIAACQAGAPFGSCKNISIPT  381



>gb|KCW55190.1| hypothetical protein EUGRSUZ_I01136 [Eucalyptus grandis]
 gb|KCW55191.1| hypothetical protein EUGRSUZ_I01136 [Eucalyptus grandis]
Length=345

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 222/323 (69%), Gaps = 34/323 (11%)
 Frame = -3

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             +P ++Y++LTTHNA++     S TG   V+P+NQ+DSVT QLNNGVRGLMLD+YDF  D+
Sbjct  15    IPLHRYSWLTTHNAYARMQVKSATGSVIVSPRNQQDSVTDQLNNGVRGLMLDMYDFENDI  74

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHS+GG C+++TAF+PA + LKE++ FL  NPSEIVTII+EDYV++P GLTKVF  AG
Sbjct  75    WLCHSYGGNCYNYTAFQPAINVLKELQTFLEANPSEIVTIIIEDYVSSPNGLTKVFDAAG  134

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS MPKNGGDWP V+DMV KNQRLLVFTS  SKE SEGIAYQW YMVENQYGD
Sbjct  135   LRKYWFPVSRMPKNGGDWPTVNDMVQKNQRLLVFTSKSSKEASEGIAYQWRYMVENQYGD  194

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
             GGM  G CPNR ESP +  T++SLVLVN+F  +P    AC  NS PLI MV TCY AAG 
Sbjct  195   GGMTAGLCPNRAESPSMNTTSRSLVLVNYFPDMPDFTKACKHNSAPLISMVNTCYGAAGK  254

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RW NF+AVDFYK                                  RS+GGG   AVD  
Sbjct  255   RWPNFIAVDFYK----------------------------------RSDGGGAPAAVDMA  280

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L+CG + + SC      G C
Sbjct  281   NGHLVCGCNSITSCKANMTFGSC  303



>ref|XP_010526723.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X2 [Tarenaya hassleriana]
Length=417

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 236/372 (63%), Gaps = 40/372 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             GE C    +    C  G+ C SCP  G +  +C R    +    +   LPFNKY+FLTTH
Sbjct  32    GETC----DSSRPCDVGLSCRSCPANGDTRSRCTRIRPVNPTSKVKG-LPFNKYSFLTTH  86

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++++G  S TG   ++P NQEDSV+ QL NGV GLMLD+YDF  D+WLCHS GG+C +
Sbjct  87    NSYALSGAKSATGSILISPTNQEDSVSDQLQNGVGGLMLDMYDFNNDIWLCHSTGGRCFN  146

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + LKEI  FL +NPSEIVTII+EDYV +P+GLTKVF  +GL KYWFP+S MP
Sbjct  147   FTAFQPAVNVLKEIHDFLESNPSEIVTIIIEDYVTSPQGLTKVFNTSGLSKYWFPISRMP  206

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG +WP V DMV +NQRL+VFTS K KE SEGIAYQWNYMVENQYGD GMK G CP RG
Sbjct  207   KNGENWPAVDDMVKQNQRLVVFTSRKDKESSEGIAYQWNYMVENQYGDDGMKDGSCPKRG  266

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   ++SLVL N+F + P    AC  NS PL  M+ TC+ AAG RW NF+AVDFY 
Sbjct  267   ESSPLDTKSRSLVLQNYFSTNPNSSQACADNSAPLTKMMRTCFEAAGKRWPNFIAVDFY-  325

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD  NG L CG D + 
Sbjct  326   ---------------------------------QRSDGGGAAEAVDEANGHLTCGCDSIA  352

Query  275   SCVGGSK*GGCR  240
              C   +  G C 
Sbjct  353   FCKENAAFGTCE  364



>gb|KDP31957.1| hypothetical protein JCGZ_12418 [Jatropha curcas]
Length=421

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 200/372 (54%), Positives = 243/372 (65%), Gaps = 38/372 (10%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             + QVLD     ++CGAG+ C +CP LG + P C R  A     +++  LPFNKY +L TH
Sbjct  34    HAQVLDSCTAATNCGAGLFCGNCPALGKNQPVCTRGQAIIPTSIIDG-LPFNKYTWLVTH  92

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI    S  GV  +   NQEDSVT QL NGVRGLMLD+YDF GD+WLCHSF G+C +
Sbjct  93    NSFSIVDAPSLPGVQRLTFYNQEDSVTNQLRNGVRGLMLDMYDFDGDIWLCHSFRGQCFN  152

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF PA +TL+E+EAFLS NP+EIVTII+EDYV+ PKGL  +FT AGL KYWFPVS MP
Sbjct  153   FTAFGPAINTLREVEAFLSENPTEIVTIIIEDYVHTPKGLINLFTSAGLDKYWFPVSKMP  212

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V+ MV +N RLLVFTSV SKE  EGIAYQW YM+EN+ GD G+K G CPNR 
Sbjct  213   KKGEDWPTVTQMVQENHRLLVFTSVASKEAEEGIAYQWKYMLENEPGDPGVKPGSCPNRK  272

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   + SL+L N+F + P+E  AC ++S PL  MVGTCY AAGN   NFLAV+FY 
Sbjct  273   ESKPLNSRSASLILENYFPTYPVESEACKEHSIPLAQMVGTCYKAAGNVMPNFLAVNFY-  331

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG F+A+DR+NG  LCG   V 
Sbjct  332   ---------------------------------MRSDGGGVFDALDRMNGQTLCGCSTVT  358

Query  275   SCVGGSK*GGCR  240
             +C  G+  G C+
Sbjct  359   ACQPGAPFGSCK  370



>ref|XP_008795890.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Phoenix dactylifera]
Length=505

 Score =   387 bits (993),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 202/379 (53%), Positives = 248/379 (65%), Gaps = 40/379 (11%)
 Frame = -3

Query  1364  SACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             ++CS  +CQ+LD  CS   DC  G++C +CP  G + P C+R  AT    ++N  LPFNK
Sbjct  113   ASCSPHSCQLLDP-CSTADDCAPGLYCGNCPASGKTQPSCIRGQATLPTSIVNG-LPFNK  170

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             YA+L THN+FSI    S TGV  V   NQED+VT QL NGVRGLMLD+YDFR D+WLCHS
Sbjct  171   YAWLVTHNSFSIVNEPSSTGVQRVTFYNQEDTVTNQLRNGVRGLMLDMYDFRDDIWLCHS  230

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
               G+C+DFTAFEPA +TL+E+EAFL+ NPSEIVTI +EDYV+APKGLTK+FT+AGL KYW
Sbjct  231   LQGQCYDFTAFEPAINTLREVEAFLTENPSEIVTIFIEDYVHAPKGLTKLFTNAGLAKYW  290

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             +PVS MP NG DWP V+DMVAKN+RLLVFTS  SKE  EGIAYQW Y++EN+ GD GM  
Sbjct  291   YPVSEMPTNGRDWPGVTDMVAKNRRLLVFTSDASKEADEGIAYQWRYILENESGDPGMVP  350

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CPNR ES  L     SL L NFF ++P E   C ++S  L +MV  CY AAGN   NF
Sbjct  351   GSCPNRRESQALNSRYASLFLQNFFPTIPFENETCKEHSVGLAEMVDACYKAAGNILPNF  410

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             +AV+FY                                   RS+GGG F+  DR+NG  L
Sbjct  411   IAVNFY----------------------------------MRSDGGGVFDIQDRMNGLNL  436

Query  296   CGKDDVHSCVGGSK*GGCR  240
             CG + V +C  G+    C+
Sbjct  437   CGCNTVTACQAGAPKAACK  455



>ref|XP_010526722.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X1 [Tarenaya hassleriana]
Length=443

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 233/362 (64%), Gaps = 40/362 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             GE C    +    C  G+ C SCP  G +  +C R    +    +   LPFNKY+FLTTH
Sbjct  32    GETC----DSSRPCDVGLSCRSCPANGDTRSRCTRIRPVNPTSKVKG-LPFNKYSFLTTH  86

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++++G  S TG   ++P NQEDSV+ QL NGV GLMLD+YDF  D+WLCHS GG+C +
Sbjct  87    NSYALSGAKSATGSILISPTNQEDSVSDQLQNGVGGLMLDMYDFNNDIWLCHSTGGRCFN  146

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + LKEI  FL +NPSEIVTII+EDYV +P+GLTKVF  +GL KYWFP+S MP
Sbjct  147   FTAFQPAVNVLKEIHDFLESNPSEIVTIIIEDYVTSPQGLTKVFNTSGLSKYWFPISRMP  206

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG +WP V DMV +NQRL+VFTS K KE SEGIAYQWNYMVENQYGD GMK G CP RG
Sbjct  207   KNGENWPAVDDMVKQNQRLVVFTSRKDKESSEGIAYQWNYMVENQYGDDGMKDGSCPKRG  266

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   ++SLVL N+F + P    AC  NS PL  M+ TC+ AAG RW NF+AVDFY 
Sbjct  267   ESSPLDTKSRSLVLQNYFSTNPNSSQACADNSAPLTKMMRTCFEAAGKRWPNFIAVDFY-  325

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD  NG L CG D + 
Sbjct  326   ---------------------------------QRSDGGGAAEAVDEANGHLTCGCDSIA  352

Query  275   SC  270
              C
Sbjct  353   FC  354



>ref|XP_010270304.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nelumbo 
nucifera]
Length=426

 Score =   383 bits (984),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 247/385 (64%), Gaps = 40/385 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNS  1212
             F +   ACS  NCQ LD  CS   DCG G++C +CP  G + P C R  A      +   
Sbjct  28    FVLSCRACSNGNCQFLDS-CSTPTDCGPGLYCGNCPASGKTEPTCTRGQAIQPTSFIPG-  85

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY++L THN+FSI       GV  +   NQEDSV+ QL NGVRGLMLD+YDF  DV
Sbjct  86    LPFNKYSWLVTHNSFSIVDAPPLPGVQRMTFYNQEDSVSNQLRNGVRGLMLDMYDFEDDV  145

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHS  G+C++FTAFEPA +TLKE+EAFLS NPSEIVTII+EDYV+ PK LT++FT+AG
Sbjct  146   WLCHSMRGQCYNFTAFEPAINTLKEVEAFLSENPSEIVTIIIEDYVHTPKALTRLFTNAG  205

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L++YWFPVS MPK G DWP ++DMVA+N RLLVFTS  SKE  EGIAYQW Y++EN+ GD
Sbjct  206   LLEYWFPVSKMPKKGEDWPTITDMVAENHRLLVFTSDASKEADEGIAYQWKYILENEPGD  265

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G  +G C NR ES PL   + SL L N+F + P+E  +C +NS  LI MVGTCY AAGN
Sbjct  266   PGFVQGSCSNRKESQPLNSRSASLFLQNYFPTFPVESESCKENSATLIGMVGTCYKAAGN  325

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NF+A++FY                                   RS+GGG F+A+DR+
Sbjct  326   VMPNFVAINFY----------------------------------MRSDGGGVFDALDRM  351

Query  311   NGGLLCGKDDVHSCVGGSK*GGCRR  237
             NG  LCG   V +C  G+  G C+ 
Sbjct  352   NGLTLCGCSTVTACQVGAPKGSCKE  376



>ref|XP_010526724.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X3 [Tarenaya hassleriana]
Length=442

 Score =   384 bits (985),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 233/362 (64%), Gaps = 40/362 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             GE C    +    C  G+ C SCP  G +  +C R    +    +   LPFNKY+FLTTH
Sbjct  31    GETC----DSSRPCDVGLSCRSCPANGDTRSRCTRIRPVNPTSKVKG-LPFNKYSFLTTH  85

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++++G  S TG   ++P NQEDSV+ QL NGV GLMLD+YDF  D+WLCHS GG+C +
Sbjct  86    NSYALSGAKSATGSILISPTNQEDSVSDQLQNGVGGLMLDMYDFNNDIWLCHSTGGRCFN  145

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + LKEI  FL +NPSEIVTII+EDYV +P+GLTKVF  +GL KYWFP+S MP
Sbjct  146   FTAFQPAVNVLKEIHDFLESNPSEIVTIIIEDYVTSPQGLTKVFNTSGLSKYWFPISRMP  205

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG +WP V DMV +NQRL+VFTS K KE SEGIAYQWNYMVENQYGD GMK G CP RG
Sbjct  206   KNGENWPAVDDMVKQNQRLVVFTSRKDKESSEGIAYQWNYMVENQYGDDGMKDGSCPKRG  265

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   ++SLVL N+F + P    AC  NS PL  M+ TC+ AAG RW NF+AVDFY 
Sbjct  266   ESSPLDTKSRSLVLQNYFSTNPNSSQACADNSAPLTKMMRTCFEAAGKRWPNFIAVDFY-  324

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD  NG L CG D + 
Sbjct  325   ---------------------------------QRSDGGGAAEAVDEANGHLTCGCDSIA  351

Query  275   SC  270
              C
Sbjct  352   FC  353



>ref|XP_006494448.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Citrus sinensis]
Length=435

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/381 (52%), Positives = 248/381 (65%), Gaps = 38/381 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPF  1203
             V ++ACS  NCQVLD     +DCG G++C +CP LG + P C R  AT    ++ + LPF
Sbjct  30    VNSTACSNGNCQVLDSCAAATDCGPGLYCGNCPALGKNRPICTRGQATIPTTIIGD-LPF  88

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY++L THN+FSI    +  GV  +   NQED VT QL NG RGLMLD+YDF GD+WLC
Sbjct  89    NKYSWLVTHNSFSIVDTPALPGVQRLTFYNQEDPVTNQLRNGARGLMLDMYDFNGDIWLC  148

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+C +FTAF+PA +TL+E+EAFLS  P+EIVTII+EDYV  PKGLT +F  AGL K
Sbjct  149   HSFRGQCFNFTAFQPAINTLREVEAFLSQYPTEIVTIIIEDYVQTPKGLTSLFVRAGLDK  208

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             Y+FPVS MPK G DWP V++MV KN RLLVF+SV SKE  EGIAYQW Y++EN+ GD G+
Sbjct  209   YFFPVSKMPKKGEDWPTVTEMVQKNYRLLVFSSVASKEAEEGIAYQWRYILENESGDPGV  268

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CP+R ES PL     SL L N+F + P+E  AC ++S PL +MVGTCY AAGN   
Sbjct  269   KAGSCPHRKESQPLNSRKASLFLQNYFPTYPVEEDACKEHSTPLAEMVGTCYKAAGNLLP  328

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NFLAV+FY                                   RS+GGG F+ +D++NG 
Sbjct  329   NFLAVNFY----------------------------------MRSDGGGVFDVLDKMNGQ  354

Query  302   LLCGKDDVHSCVGGSK*GGCR  240
              LCG   V +C  G+  G C+
Sbjct  355   TLCGCSTVLACQSGAPFGSCK  375



>ref|XP_008784187.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Phoenix dactylifera]
Length=396

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/360 (54%), Positives = 236/360 (66%), Gaps = 44/360 (12%)
 Frame = -3

Query  1316  DCGAGMHCLSC-PLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C   G   P+C R   TD      + LPFN+YA+LTTHN+F+        
Sbjct  35    NCDAGLHCETCIAEGEFRPRCTRIKPTDPKSKGGSDLPFNRYAWLTTHNSFAKIA-----  89

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
                 +AP NQ+DSVT QLNNGVRGLMLD+YDF  D+WLCHSFGG C++FTAF+PA D LK
Sbjct  90    --ATLAPTNQQDSVTDQLNNGVRGLMLDMYDFLNDIWLCHSFGGNCYNFTAFKPAIDVLK  147

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+AFL  NPSE++TI +EDYV +P GLTKVFT +GL KYWFPVS MP+ GGDWPL+SDM
Sbjct  148   EIQAFLQANPSEVITIFIEDYVTSPNGLTKVFTASGLKKYWFPVSRMPQKGGDWPLLSDM  207

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + KNQRL+VFTS  SKE +EGIAYQW Y+VENQYGDGGMK G CPNR ES P+   ++SL
Sbjct  208   INKNQRLVVFTSKSSKEAAEGIAYQWRYVVENQYGDGGMKDGSCPNRAESSPMNTMSRSL  267

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F   P  P AC +NS PL  M+ TC  A+ +RW NF+AVDFYK            
Sbjct  268   VLMNYFPDAPNYPAACKENSAPLESMLNTCRNASASRWPNFIAVDFYK------------  315

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC-VGGSK*GGC  243
                                   RS+ GG  EA D  NG L+CG   +  C V GS+ G C
Sbjct  316   ----------------------RSDRGGAPEATDIANGQLICGCGSIADCKVNGSR-GTC  352



>ref|XP_010906564.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Elaeis 
guineensis]
Length=414

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 250/378 (66%), Gaps = 39/378 (10%)
 Frame = -3

Query  1364  SACSGENCQVLD--EECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ++CS  +CQ+LD      DC +G++C +CP  G + P C R  AT    ++   LP+N+Y
Sbjct  23    ASCSPHSCQLLDPCSTADDCASGLYCGNCPASGKTQPSCTRGQATLPTSIVK-GLPYNRY  81

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             A+L THN+FSI    S TGV  V   NQED+VT QL NGVRGLMLD+YDF+ D+WLCHS 
Sbjct  82    AWLVTHNSFSIVNEPSSTGVQRVTFYNQEDTVTNQLRNGVRGLMLDMYDFQDDIWLCHSL  141

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
              G+C++FTAFEPA +TL+E+EAFL+ NPSEIVTI +EDYV+APKGLTK+FT+AGL KYW+
Sbjct  142   QGQCYNFTAFEPAINTLREVEAFLTENPSEIVTIFIEDYVHAPKGLTKLFTNAGLAKYWY  201

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MP NG DWP V+DMVAKN+RL+VFTSV SKE  EGIAYQW +++EN+ GD G+  G
Sbjct  202   PVSEMPTNGRDWPSVTDMVAKNRRLIVFTSVASKEADEGIAYQWRHILENEPGDPGIVPG  261

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              CPNR ES PL     SL L N+F ++P E  AC ++S  L +MV  CY AAGN   NF+
Sbjct  262   SCPNRKESQPLNSRYASLFLQNYFPTIPFENEACKEHSVGLAEMVDACYKAAGNIMPNFI  321

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLC  294
             AV+FY                                   RS+GGG F+  DR+N GLLC
Sbjct  322   AVNFY----------------------------------MRSDGGGVFDIQDRMN-GLLC  346

Query  293   GKDDVHSCVGGSK*GGCR  240
             G + V +C  G+  G C+
Sbjct  347   GCNTVTACQAGAPKGACK  364



>emb|CDY16515.1| BnaA08g02520D [Brassica napus]
Length=359

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/371 (51%), Positives = 241/371 (65%), Gaps = 39/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C + D    +C AG+HC +C    +  P+C R+   +    +   LPF
Sbjct  20    FEISSALQEGKTCILND----NCDAGLHCETCLANNNLRPRCSRTQPINPISKVKKGLPF  75

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYA+LTTHN+F+  G  S+TG   +AP NQ+DSVT QL NGVRG MLD+YDF  D+WLC
Sbjct  76    NKYAWLTTHNSFARLGQVSKTGSVILAPTNQQDSVTSQLANGVRGFMLDMYDFENDIWLC  135

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF   C +FTAF+PA + L+EI+ FL  N  E+VTII+EDYV +PKGLTKVF  AGL K
Sbjct  136   HSFDETCFNFTAFQPAVNVLREIQGFLENNKDEVVTIIIEDYVKSPKGLTKVFNAAGLQK  195

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             + FPV+ MPK GGDWP + DM+ +NQRLLVFTS +SKE +EGIAYQW YMVENQYG+GG+
Sbjct  196   FMFPVTRMPKIGGDWPTLDDMIQQNQRLLVFTSDRSKEATEGIAYQWKYMVENQYGNGGL  255

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR +S P++D +KSLVLVN F   P   +AC QNS PL++ +  CY AAG RW 
Sbjct  256   KVGACPNRAQSAPMSDKSKSLVLVNHFPDAPDLVVACRQNSAPLLESIKACYQAAGQRWP  315

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG  +AVD  NG 
Sbjct  316   NFIAVDFYK----------------------------------RSDGGGAPQAVDVSNGN  341

Query  302   LLCGKDDVHSC  270
             L+CG D+  +C
Sbjct  342   LICGCDNFAAC  352



>ref|XP_008340289.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Malus 
domestica]
Length=424

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 245/386 (63%), Gaps = 39/386 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFN  1200
             +++ACS  NCQVLD     +DCG G++C +CP  G + P C R  A     + N  LPFN
Sbjct  31    ISTACSNGNCQVLDACAAATDCGPGLYCGNCPASGKNQPVCTRGQAIVPTSIXNG-LPFN  89

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCH
Sbjct  90    KYTWLATHNSFSIVDAPPVAGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCH  149

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C +FTAF+PA +TL E+E FLS NP+EIVTII+EDYV  PKGLT +FT+AGL KY
Sbjct  150   SFKGQCFNFTAFQPAINTLTEVETFLSQNPTEIVTIIIEDYVKTPKGLTTLFTNAGLDKY  209

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPV+ MP+ G DWP V++MV +N RLLVFTS  SKE  EG+AYQW YMVEN+ GD G+K
Sbjct  210   WFPVAKMPRKGEDWPTVTEMVQENHRLLVFTSDASKEAQEGVAYQWKYMVENEAGDPGVK  269

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CP R ES PL   + SL   N+F + P+E  AC ++S PL  M+GTCY AAG    N
Sbjct  270   PGSCPKRKESKPLNSKSASLFFQNYFSTYPVEAEACEEHSSPLEQMIGTCYKAAG-VMPN  328

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAV+FY                                   RS+GGG F+AVDR+NG +
Sbjct  329   FLAVNFY----------------------------------MRSDGGGVFDAVDRMNGPV  354

Query  299   LCGKDDVHSCVGGSK*GGCRRWNTRT  222
             LCG   V +C  G+  G C+  +  T
Sbjct  355   LCGCSTVSACQAGAPSGSCKNISVPT  380



>ref|XP_011008518.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Populus euphratica]
Length=430

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 240/361 (66%), Gaps = 36/361 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             ++CG G++C +CP LG + P C+R  A     ++N  LPFNKY +L THN+FSI      
Sbjct  45    TNCGVGLYCGNCPALGKTQPICIRGQAIIPNSIIN-GLPFNKYTWLVTHNSFSIVDAPPL  103

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
              GV  +   NQED+VT QL NGVRGLMLD+YDF GD+WLCHSF G+C +FTAF+PA +TL
Sbjct  104   PGVQRLTFYNQEDTVTNQLRNGVRGLMLDLYDFEGDIWLCHSFRGQCFNFTAFQPAINTL  163

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             +E+E+FLS NP+EIVTII+EDYV+ PKGL  +FT+AGL KYWFPVS MPK G DWP V++
Sbjct  164   REVESFLSENPTEIVTIIIEDYVHTPKGLINLFTNAGLDKYWFPVSKMPKKGEDWPTVAE  223

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV +N RL+VFTSV SKE  EGIAYQW YM+EN+ GD G+K G CPNR ES PL     S
Sbjct  224   MVQENHRLVVFTSVASKEAEEGIAYQWKYMLENEAGDPGVKPGSCPNRKESKPLNSKRAS  283

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             L L+N+F + P+E  AC ++S PL  MVGTCY AA N   NFLAV+FY            
Sbjct  284   LFLMNYFPTYPVETEACKEHSTPLAQMVGTCYKAARNVMPNFLAVNFY------------  331

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG F+A+DR+NG  LCG + V +C  G+  G C
Sbjct  332   ----------------------MRSDGGGVFDALDRMNGQTLCGCNTVTACQSGAPFGSC  369

Query  242   R  240
             +
Sbjct  370   K  370



>dbj|BAJ88671.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   381 bits (979),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 242/372 (65%), Gaps = 38/372 (10%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             +CQV D      DCG G++C  C   G + P C+R  A     ++   LPFN+Y++L TH
Sbjct  27    SCQVGDSCLAARDCGVGLYCGDCAAAGRTRPSCIRDLAIQPTSIVKG-LPFNRYSWLVTH  85

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI G  SRTGV  V   NQED+VT QL NGVRGLMLD+YDF GDVWLCHS  G+C++
Sbjct  86    NSFSIVGEPSRTGVERVTFYNQEDTVTNQLRNGVRGLMLDMYDFSGDVWLCHSLQGQCYN  145

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAFEPA DTLKE+EAFLS NP+EIVTI +EDYV+AP  L+K+FT A LMKYW+P+S MP
Sbjct  146   FTAFEPAIDTLKEVEAFLSENPTEIVTIFIEDYVHAPMRLSKLFTAADLMKYWYPISEMP  205

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
              +G DWP V+DMVAKN RLLVFTS  SKE SEGIAYQW Y++EN+ GD G+    CPNR 
Sbjct  206   TSGQDWPTVTDMVAKNHRLLVFTSDASKESSEGIAYQWRYLLENESGDPGIDPSSCPNRR  265

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   + SL + N+F ++P+E  AC +NS  L  MV TCY AAGNR  N++AV+FY 
Sbjct  266   ESQPLNSRSVSLFMQNYFPTIPVESEACKENSVGLPQMVQTCYAAAGNRIPNYIAVNFY-  324

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG F+  DR+NG  LCG + + 
Sbjct  325   ---------------------------------MRSDGGGVFDVQDRINGLTLCGCNSIA  351

Query  275   SCVGGSK*GGCR  240
             +C  G+  G C+
Sbjct  352   ACQAGAPTGACK  363



>ref|XP_004956306.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Setaria italica]
Length=426

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/376 (52%), Positives = 244/376 (65%), Gaps = 41/376 (11%)
 Frame = -3

Query  1364  SACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAF  1188
             SA  G++C        DCG G++C +CP  G + P C+R  A     ++   LPFN+Y++
Sbjct  26    SAQVGDSC----SSARDCGTGLYCGNCPASGRTKPSCIRDLAIQPTSIVKG-LPFNRYSW  80

Query  1187  LTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGG  1008
             L THN+FSI G  SRTGV  V   NQEDSVT QL NGVRGLMLD+YDF  DVWLCHS  G
Sbjct  81    LVTHNSFSILGEPSRTGVERVTFYNQEDSVTNQLRNGVRGLMLDMYDFNNDVWLCHSLQG  140

Query  1007  KCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPV  828
             +C++FTAF PA +TLKE+EAFLS NPSEIVTI +EDYV +P GL+KVFT A LMKYW+P+
Sbjct  141   QCYNFTAFVPAVETLKEVEAFLSENPSEIVTIFIEDYVRSPMGLSKVFTAADLMKYWYPI  200

Query  827   SNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDC  648
             S MP NG DWP V+DMVAKN RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+  G C
Sbjct  201   SEMPTNGKDWPSVTDMVAKNHRLLVFTSDSSKEASEGIAYQWSYLIENESGDPGIVPGSC  260

Query  647   PNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAV  468
             PNR ES PL   + SL L N+F ++P++  AC +NSG L  M   CY AAGNR  NF+AV
Sbjct  261   PNRKESQPLNSRSASLFLQNYFPTMPVQNEACKENSG-LPQMAQACYAAAGNRIPNFIAV  319

Query  467   DFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGK  288
             +FY                                   RS+GGG F+  DR+NG  LCG 
Sbjct  320   NFY----------------------------------MRSDGGGVFDVQDRINGITLCGC  345

Query  287   DDVHSCVGGSK*GGCR  240
             + + +C  G+  G C+
Sbjct  346   NTIAACQAGAPMGACK  361



>ref|XP_007156783.1| hypothetical protein PHAVU_002G017300g [Phaseolus vulgaris]
 ref|XP_007156784.1| hypothetical protein PHAVU_002G017300g [Phaseolus vulgaris]
 gb|ESW28777.1| hypothetical protein PHAVU_002G017300g [Phaseolus vulgaris]
 gb|ESW28778.1| hypothetical protein PHAVU_002G017300g [Phaseolus vulgaris]
Length=425

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 253/384 (66%), Gaps = 40/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNS  1212
             F   ++AC   NCQVL E C+   DCG G++C +CP LG + P C R  AT    L++  
Sbjct  26    FLTSSAACFNGNCQVL-EACTAATDCGPGLYCGNCPALGRTRPVCTRGQATIVTSLVDG-  83

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY+++ THN+FSI    S  GV  +   NQED+VT QL NGVRGLMLD+YDF  D+
Sbjct  84    LPFNKYSWIMTHNSFSIVDAPSLAGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDI  143

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSFG KC +FTAF+PA +TL+E+EAFL+ NP+EIVTI++EDYV  PKGLT +F++AG
Sbjct  144   WLCHSFGEKCFNFTAFQPAINTLREVEAFLTANPTEIVTIVIEDYVRTPKGLTNLFSNAG  203

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS+MPK G DWP +++MV  ++RLLVFTS  SKE  EGIAYQW YM+EN+ GD
Sbjct  204   LDKYWFPVSDMPKKGEDWPTLTEMVQTSRRLLVFTSDASKEAEEGIAYQWTYMIENESGD  263

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G++ G CP+R ES PL   + SL L N+F + P+E  +C ++S PL DMV TCY AAGN
Sbjct  264   HGVQGGSCPHRKESKPLISRSASLFLQNYFPTYPVEADSCKEHSAPLADMVNTCYKAAGN  323

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                +F+AV+FY                                   RS+GGG F+ VD++
Sbjct  324   VLPSFIAVNFY----------------------------------MRSDGGGVFDIVDKM  349

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG + V +C  G+  G C+
Sbjct  350   NGHSLCGCNTVSACQEGAPFGSCK  373



>gb|KCW51951.1| hypothetical protein EUGRSUZ_J01395 [Eucalyptus grandis]
Length=257

 Score =   375 bits (964),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ++CS   C++LDE    SDC AG++C SCP GFSG +CVRST TDQFKL NNSLPFNKYA
Sbjct  21    ASCSNGECRLLDECSSDSDCVAGLYCFSCPQGFSGSRCVRSTITDQFKLWNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNA++I G    T VP V   NQED+VTQQLNNGVRGLMLD YDF GDVWLCHSF 
Sbjct  81    FLTTHNAYAIDGEPPHTPVPRVTVTNQEDTVTQQLNNGVRGLMLDTYDFEGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C+DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFTDAGLMKYWFP
Sbjct  141   GQCYDFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ  681
             VSNMPKNG DWPLVSDMVA NQRLLVFTS+ SKE+SEGIAYQWNYMVENQ
Sbjct  201   VSNMPKNGQDWPLVSDMVANNQRLLVFTSILSKEQSEGIAYQWNYMVENQ  250



>ref|XP_002984037.1| hypothetical protein SELMODRAFT_119480, partial [Selaginella 
moellendorffii]
 gb|EFJ15049.1| hypothetical protein SELMODRAFT_119480, partial [Selaginella 
moellendorffii]
Length=359

 Score =   379 bits (973),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 236/352 (67%), Gaps = 37/352 (11%)
 Frame = -3

Query  1325  ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSS  1146
             + SDC  G+ C +  L  +  +C+R+ + +   L NNS+PFNKY++LTTHN+FSI G  S
Sbjct  8     QTSDCMPGLACSN--LCTNATRCLRTQSFNVLGL-NNSMPFNKYSWLTTHNSFSIKGSPS  64

Query  1145  RTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDT  966
              TG P +   NQEDSVTQQL NGVRGLMLD+YDF  D+WLCHSF G+C +FTAF+PA +T
Sbjct  65    LTGTPILTFDNQEDSVTQQLQNGVRGLMLDMYDFMNDIWLCHSFQGQCQNFTAFQPAINT  124

Query  965   LKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVS  786
             L+EIE F+S NPSE++TI +EDYV     ++ +F +AGL KYWFPVS MPK+G DWP V+
Sbjct  125   LREIETFMSQNPSEVITIFIEDYVRRSNAVSTLFANAGLRKYWFPVSRMPKDGSDWPSVA  184

Query  785   DMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTK  606
             +MVA NQRL+VFTS+ SKE SEGIAYQW Y+VENQYGDGG++ G C  R ES  L +   
Sbjct  185   NMVANNQRLVVFTSISSKESSEGIAYQWRYVVENQYGDGGLQPGQCSKRAESTALDNKGV  244

Query  605   SLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYT  426
             SL L N+F + P +  AC  NS PL  ++  C+ AAGNRWANFLAVDFYK          
Sbjct  245   SLFLENYFPTNPADTQACRDNSRPLSQVISACHNAAGNRWANFLAVDFYK----------  294

Query  425   IHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                     RS GGG+F+AVD LNG +LCG  DVH C
Sbjct  295   ------------------------RSTGGGSFQAVDVLNGNILCGCGDVHEC  322



>ref|XP_010667419.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Beta 
vulgaris subsp. vulgaris]
Length=421

 Score =   381 bits (979),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 249/384 (65%), Gaps = 40/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPLG-FSGPKCVRSTATDQFKLLNNS  1212
             F  ++ ACSG NCQ+L E CS   DC  G++C +CP      P C R+       +++  
Sbjct  21    FFTLSLACSGGNCQLL-ESCSAANDCAPGLYCGNCPAANKRQPVCTRAQVNIPTSIVS-G  78

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY +L THNAFS       TGV  +   NQED+VT QL NGVRG MLD+YDF  D+
Sbjct  79    LPFNKYTWLVTHNAFSNVNSPPLTGVQRITFYNQEDTVTNQLRNGVRGFMLDMYDFEDDI  138

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF G+C++ TAF PA ++L+EIEA+++ NPSEIVTII+EDYV++PKGL+++F +AG
Sbjct  139   WLCHSFQGRCYNITAFGPAINSLREIEAYMTENPSEIVTIIIEDYVHSPKGLSRLFANAG  198

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYW+P+S MPK G DWP V+DM+ +N RLLVFTS  SKEE+EGIAYQW YMVENQ GD
Sbjct  199   LEKYWYPISKMPKKGEDWPTVNDMIQQNHRLLVFTSDASKEEAEGIAYQWRYMVENQPGD  258

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+K+G CPNR ES  L     SL L+N+F + P+E  AC +NS PL DMVGTCY +AGN
Sbjct  259   PGVKQGSCPNRKESKKLNSKGASLFLMNYFPTFPIEDEACKENSAPLSDMVGTCYKSAGN  318

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             R  NF+AV+FY                                   RS+G G F+ +D++
Sbjct  319   RMPNFVAVNFY----------------------------------MRSDGPGVFDVMDKM  344

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG   V +C  GS  G C+
Sbjct  345   NGQTLCGCSTVTACQPGSPPGVCK  368



>ref|XP_003581234.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Brachypodium distachyon]
Length=404

 Score =   380 bits (977),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 240/369 (65%), Gaps = 40/369 (11%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
              V++   GE C +      +C AG+HC +C   G   P+C R T  D  +  +  LPFN+
Sbjct  29    AVSARKVGETCAL----GRNCDAGLHCETCVADGNVRPRCTRVTPVDP-QTKDRGLPFNR  83

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y++LTTHN+F+  G  S+TG       NQ+D+VTQQLNNGVRGLMLD+YDFR D+WLCHS
Sbjct  84    YSWLTTHNSFARLGTRSQTGTAIATAWNQQDTVTQQLNNGVRGLMLDMYDFRNDIWLCHS  143

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             +GG C +FTAF PA D L+EIEAFL+ NPSE+VTI +EDYV +P+GLT+VF  +GL +Y 
Sbjct  144   YGGACQNFTAFTPAVDVLREIEAFLAANPSEVVTIFIEDYVESPRGLTRVFNASGLTRYL  203

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FP   MPKNGGDWPL+ DMV  N RLLVFTS  +KE SEG A++W Y+VENQYG  GM +
Sbjct  204   FPAWRMPKNGGDWPLLGDMVRDNHRLLVFTSRSAKEASEGFAHEWRYVVENQYGSKGMVK  263

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CPNR ES  ++D ++SLVLVN+F  +P  P AC  NS  L+ M+  C+ AAGNRWANF
Sbjct  264   GSCPNRAESAAMSDLSRSLVLVNYFRDLPNFPEACKDNSAQLLAMLDACHAAAGNRWANF  323

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             +AVDFYK                                  RS+GGG  EA D+ NGGL+
Sbjct  324   VAVDFYK----------------------------------RSDGGGAAEATDKANGGLV  349

Query  296   CGKDDVHSC  270
             CG   + +C
Sbjct  350   CGCGSIAAC  358



>gb|KCW51949.1| hypothetical protein EUGRSUZ_J01395 [Eucalyptus grandis]
 gb|KCW51950.1| hypothetical protein EUGRSUZ_J01395 [Eucalyptus grandis]
Length=261

 Score =   375 bits (963),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = -3

Query  1364  SACSGENCQVLDE--ECSDCGAGMHCLSCPLGFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             ++CS   C++LDE    SDC AG++C SCP GFSG +CVRST TDQFKL NNSLPFNKYA
Sbjct  21    ASCSNGECRLLDECSSDSDCVAGLYCFSCPQGFSGSRCVRSTITDQFKLWNNSLPFNKYA  80

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             FLTTHNA++I G    T VP V   NQED+VTQQLNNGVRGLMLD YDF GDVWLCHSF 
Sbjct  81    FLTTHNAYAIDGEPPHTPVPRVTVTNQEDTVTQQLNNGVRGLMLDTYDFEGDVWLCHSFK  140

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C+DFTAFEPA DTLKEIEAFLS NP+EIVT+ILEDYV AP GLTKVFTDAGLMKYWFP
Sbjct  141   GQCYDFTAFEPAIDTLKEIEAFLSANPAEIVTLILEDYVQAPNGLTKVFTDAGLMKYWFP  200

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQ  681
             VSNMPKNG DWPLVSDMVA NQRLLVFTS+ SKE+SEGIAYQWNYMVENQ
Sbjct  201   VSNMPKNGQDWPLVSDMVANNQRLLVFTSILSKEQSEGIAYQWNYMVENQ  250



>ref|XP_009772482.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Nicotiana sylvestris]
Length=415

 Score =   381 bits (978),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 238/361 (66%), Gaps = 38/361 (11%)
 Frame = -3

Query  1343  CQVLDEECS--DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHN  1173
             C  + E CS  +C  G+ C +CP  G +  +C R   T     +   LPFNKY++LTTHN
Sbjct  27    CLTIGETCSSSNCDEGLVCSTCPANGNTRSRCTRVRPTIPTTKVKG-LPFNKYSWLTTHN  85

Query  1172  AFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDF  993
             +F+++G  S TG   +AP NQEDS+T QL NGVRGLMLD+YDF  D+WLCHSFGGKC++ 
Sbjct  86    SFALSGSKSATGSSILAPTNQEDSITSQLKNGVRGLMLDMYDFNDDIWLCHSFGGKCYNV  145

Query  992   TAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPK  813
             TAF+PA ++LKEI+ FL  NPSE+VTI +EDYV++PKGL+KVF  +GL KYWFPVS MPK
Sbjct  146   TAFQPAINSLKEIQVFLEQNPSEVVTIFIEDYVSSPKGLSKVFNASGLNKYWFPVSRMPK  205

Query  812   NGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGE  633
              G DWP V DMV +NQRL+VFTS  SKE SEGIAY+W Y+VENQYG+GGMK G CP+R E
Sbjct  206   KGEDWPTVDDMVKQNQRLVVFTSKSSKEASEGIAYEWRYVVENQYGNGGMKVGSCPSRSE  265

Query  632   SPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKV  453
             SPP++ ++ SLVL N+F   P    ACV NS PL++M  TC+ AAG RW NF+AVDFY  
Sbjct  266   SPPMSTSSISLVLQNYFPDNPNITAACVDNSAPLVNMTKTCFEAAGKRWPNFIAVDFY--  323

Query  452   VKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHS  273
                                             Q+S+GGG  EAVD  NG L C    +  
Sbjct  324   --------------------------------QKSDGGGAPEAVDEANGQLACNCSSIAY  351

Query  272   C  270
             C
Sbjct  352   C  352



>gb|KEH31448.1| pi-PLC X domain plant-like protein [Medicago truncatula]
Length=428

 Score =   381 bits (979),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 249/384 (65%), Gaps = 40/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNS  1212
             F   ++ACS  NCQVL E CS   DCG+G+ C +CP LG + P C R         +N  
Sbjct  27    FFTSSTACSNGNCQVL-EACSAATDCGSGLFCGNCPALGLNQPICTRGQPVIPTSAVN-G  84

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY+++ THNAFSI       GV  +   NQED+VT QL NGVRGLMLD+YDF  D+
Sbjct  85    LPFNKYSWIVTHNAFSIVDSPPLPGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDI  144

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF GKC +FTAF+PA +TLKE+EAFL+ NP+EIVTII+EDYV+ PKGLT +FT AG
Sbjct  145   WLCHSFQGKCFNFTAFQPAINTLKEVEAFLTQNPTEIVTIIIEDYVHTPKGLTNLFTSAG  204

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS MPK G DWP V++MV  N RL+VFTS  SKE  EGIAYQW ++VEN+ GD
Sbjct  205   LDKYWFPVSKMPKKGNDWPTVTEMVQANHRLVVFTSDASKEAGEGIAYQWKHVVENESGD  264

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+++G+CP+R ES  L   + SL L+N+F + P++  +C ++S PL +MV TCY AAGN
Sbjct  265   PGVQKGNCPHRKESKALNSKSSSLFLMNYFPTYPVQADSCKEHSAPLAEMVNTCYKAAGN  324

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NF+AV+FY                                   RS+GGG F+ VD++
Sbjct  325   VVPNFIAVNFY----------------------------------MRSDGGGVFDIVDKM  350

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG   V +C  G+  G C+
Sbjct  351   NGHSLCGCSTVAACQAGASFGSCK  374



>gb|KDP31946.1| hypothetical protein JCGZ_12407 [Jatropha curcas]
Length=418

 Score =   381 bits (978),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/368 (53%), Positives = 238/368 (65%), Gaps = 39/368 (11%)
 Frame = -3

Query  1334  LDEECSD---CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAF  1167
             L E CS    C +G+ C +CP  G + P+C R    +    +   L FNKY++LTTHN+F
Sbjct  32    LGETCSSNSVCDSGLSCETCPANGNTRPRCTRIQPLNPTSKVK-GLAFNKYSWLTTHNSF  90

Query  1166  SITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTA  987
             ++   +S TG   +AP NQE SVT QL NGVRGLMLD+YDF+ D+WLCHSF G C++FTA
Sbjct  91    ALMNATSETGSVLLAPTNQEHSVTIQLKNGVRGLMLDMYDFQNDIWLCHSFRGTCYNFTA  150

Query  986   FEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNG  807
             F+PA + LKEIE FL+ NPSEIVTI +EDYV +P+GLTKVF  +GL KYWFPVS MPKNG
Sbjct  151   FQPAINVLKEIETFLAANPSEIVTIFIEDYVTSPQGLTKVFNASGLSKYWFPVSKMPKNG  210

Query  806   GDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESP  627
              DWP V DMV  N+RL+VFTS  +KE SEGIAY W Y+VENQYGD GMK G CPNR ESP
Sbjct  211   EDWPTVDDMVQNNERLVVFTSKSNKEASEGIAYNWKYVVENQYGDDGMKAGSCPNRAESP  270

Query  626   PLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVK  447
             P+   T SLVL N+F S P    AC+ NS PLI M  +CY AAG RW NF+AVDFY    
Sbjct  271   PMNTKTISLVLQNYFPSNPNLTEACLDNSAPLISMTNSCYEAAGKRWPNFIAVDFY----  326

Query  446   SLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCV  267
                                           QR++GGG  EA+D++NG L CG +++  C 
Sbjct  327   ------------------------------QRNDGGGAPEALDQVNGQLTCGCENIAYCK  356

Query  266   GGSK*GGC  243
               +  G C
Sbjct  357   ANATRGTC  364



>ref|XP_004975627.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Setaria italica]
Length=417

 Score =   380 bits (977),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 243/369 (66%), Gaps = 40/369 (11%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             VV++   G+ C  LD    +C AG+HC +C   G   P+C R T  D  +     LPFN+
Sbjct  37    VVSARTIGQTC-ALDR---NCAAGLHCETCVANGNVRPRCTRVTPVDP-QTKARDLPFNR  91

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             YA+LTTHN+F+  G  S+TGV    P NQ+D+VT+QLNNGVRGLMLD+YDFR D+WLCHS
Sbjct  92    YAWLTTHNSFARLGQKSQTGVAIATPWNQQDTVTEQLNNGVRGLMLDMYDFRNDIWLCHS  151

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             FGG C +FTAF+PA + L+E+E FLS NP+E+VTI +EDYV +P GLT+V   +GL +Y 
Sbjct  152   FGGICQNFTAFQPAVNVLREVERFLSRNPAEVVTIFVEDYVESPMGLTRVLNASGLARYM  211

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPVS MPK+GGDWPL+SDMV  N RLLVFTS  +KE +EGIAY+W Y+VENQYG  GM +
Sbjct  212   FPVSRMPKSGGDWPLLSDMVRDNHRLLVFTSKSAKEAAEGIAYEWRYVVENQYGTKGMVK  271

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G C NR ES  + D ++SLVLVN+F  +P  P AC  NS PL+D++  C+  +G+RWANF
Sbjct  272   GTCHNRAESAAMNDLSRSLVLVNYFRDLPNFPEACKDNSAPLMDVLNVCHAKSGDRWANF  331

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             +AVDFYK                                  RS+ GG  EA D+ NGGL+
Sbjct  332   IAVDFYK----------------------------------RSDRGGAAEATDKANGGLV  357

Query  296   CGKDDVHSC  270
             CG   + +C
Sbjct  358   CGCGSISAC  366



>ref|XP_006487053.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Citrus sinensis]
Length=402

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 239/380 (63%), Gaps = 40/380 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C V D  C +   G+HC +C    +  P+C R    D    +   LPF
Sbjct  17    FGLSSALKEGQTC-VADSSCDN---GLHCETCVANKNFRPRCTRIHPVDPISKVK-GLPF  71

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             N+Y++LTTHN+F+     S  G   +AP+ Q+DS+T QLNNGVRGLMLD YDF  D+WLC
Sbjct  72    NRYSWLTTHNSFAKLRAKSPIGSVIIAPECQQDSITSQLNNGVRGLMLDTYDFMNDIWLC  131

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKC++FTAF+PA + LKE++AFL  NP+EIVTII+EDYV +P GLT VF  AGL K
Sbjct  132   HSFGGKCYNFTAFQPAINVLKEVQAFLEANPTEIVTIIIEDYVTSPNGLTNVFNAAGLKK  191

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MPKNG +WP + DM+ KNQRL+VFTS  +KE SEGIAYQW YMVENQYG+GGM
Sbjct  192   YWFPVSRMPKNGENWPTIDDMIQKNQRLVVFTSKSAKEASEGIAYQWRYMVENQYGNGGM  251

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR ES P+   +KSLVLVN+F   P    AC  NS PL  MV TCY AAG RW 
Sbjct  252   KDGSCPNRAESSPMNTKSKSLVLVNYFPDTPNFAEACKHNSAPLASMVNTCYEAAGKRWP  311

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AV++YK                                  RS+GGG  E VD  NG 
Sbjct  312   NFIAVNYYK----------------------------------RSDGGGAPETVDVANGR  337

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             L+CG  ++  C      G C
Sbjct  338   LVCGCGNIAYCKANMTYGAC  357



>ref|XP_009621227.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Nicotiana tomentosiformis]
Length=409

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 236/350 (67%), Gaps = 36/350 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C    +  P+C R    +    +   LPFN+Y++LTTHN+F+     S T
Sbjct  41    NCDSGLHCETCIANANVRPRCTRIQPVNPLSKVK-GLPFNRYSWLTTHNSFAKLKTKSGT  99

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T+QLNNGVRGLMLD+YDF  D+WLCHS+GGKC+++TAF+PA + L+
Sbjct  100   GSVILAPMNQQDSITEQLNNGVRGLMLDMYDFNNDIWLCHSYGGKCYNYTAFQPAINVLR  159

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI  FL  NPS+IVT+I+EDYV +P GLTKVF  AGL K+WFPVS MPKNGG+WP V DM
Sbjct  160   EIGVFLEANPSDIVTVIIEDYVRSPNGLTKVFDAAGLRKFWFPVSRMPKNGGEWPTVDDM  219

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             V +NQRL+VFTS  +KE SEGIAY+W Y+VENQYG+GG+K G CPNR ES  + + TKSL
Sbjct  220   VQRNQRLVVFTSKSAKEPSEGIAYEWRYLVENQYGNGGIKPGSCPNRAESSAMDNKTKSL  279

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F   P    AC  NS PLIDM+ TC+ AAG RW NF+AVDFYK            
Sbjct  280   VLMNYFPDAPDFAQACRHNSAPLIDMMNTCHEAAGKRWPNFIAVDFYK------------  327

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                   RS+GGG  EAVD  NG L+CG  ++ SC
Sbjct  328   ----------------------RSDGGGAPEAVDVANGHLVCGCTNIASC  355



>ref|XP_009406115.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=440

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/389 (50%), Positives = 243/389 (62%), Gaps = 65/389 (17%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSGP-KCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C    +G  +C R   +D  K     LPFN+Y++LTTHN+F+  G  SRT
Sbjct  40    NCDAGLHCETCVASGNGLFRCTRIQPSDP-KSKGTGLPFNRYSWLTTHNSFAKLGQKSRT  98

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAF--------  984
             G P +  +NQ+DS+T QLNNGVRGLMLD+YDF  D+WLCHS GGKC++FTAF        
Sbjct  99    GTPVITLENQQDSITDQLNNGVRGLMLDMYDFLDDIWLCHSTGGKCYNFTAFVSAATVAL  158

Query  983   ---------------------EPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKV  867
                                  +PA D LKEI+ FL  NPSE+VTII+EDYV +P GLTKV
Sbjct  159   PSRIIRVFFFFVESLLFLVLQQPAIDVLKEIQVFLEANPSEVVTIIIEDYVTSPMGLTKV  218

Query  866   FTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVE  687
             F  +GL+KYWFPVS MPKNG DWPL+SDM+++NQRLLVFTS  +KE SEGIAY+W Y+VE
Sbjct  219   FNASGLLKYWFPVSRMPKNGRDWPLLSDMISRNQRLLVFTSKSAKEASEGIAYEWTYIVE  278

Query  686   NQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCY  507
             NQYGDGGM+ G CPNR ES P+  T++SLVL+N+F ++P    AC  NS PL+ M+ TC+
Sbjct  279   NQYGDGGMEAGACPNRAESSPMNTTSRSLVLMNYFPTIPNLATACKHNSAPLLSMLNTCH  338

Query  506   LAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFE  327
               + NRW NF+AVDFYK                                  RS GGG  E
Sbjct  339   NLSANRWPNFIAVDFYK----------------------------------RSNGGGAPE  364

Query  326   AVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
             A D  NG L+CG D++  C   +  G C 
Sbjct  365   ATDVANGHLVCGCDNIAYCKVNASFGVCE  393



>ref|XP_008241483.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Prunus 
mume]
Length=430

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 201/383 (52%), Positives = 244/383 (64%), Gaps = 39/383 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSL  1209
             F  +++ACS   CQVL+     +DCG G++C +CP  G + P C R  AT    ++N  L
Sbjct  28    FVTISAACSNGACQVLEACAAATDCGPGLYCGNCPASGKNQPVCTRGQATAPTSIING-L  86

Query  1208  PFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVW  1029
             PFNKY +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLDVYDF  D+W
Sbjct  87    PFNKYTWLVTHNSFSIVDAPPLPGVQRLTFFNQEDTVTNQLRNGVRGLMLDVYDFENDIW  146

Query  1028  LCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGL  849
             LCHSF G+C +FTAF+PA +TL E+EAFLS NP+EIVTIILEDYV APKGLT +FT AGL
Sbjct  147   LCHSFRGQCFNFTAFQPAINTLTEVEAFLSQNPTEIVTIILEDYVKAPKGLTTLFTKAGL  206

Query  848   MKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDG  669
              KYWFPVS MP+ G DWP V++MV +N RLLVFTS  SKE  EGIAYQW YMVEN+ GD 
Sbjct  207   DKYWFPVSKMPRKGEDWPAVTEMVQENHRLLVFTSDGSKEALEGIAYQWKYMVENESGDP  266

Query  668   GMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNR  489
             G+K G CP R ES PL   + SL   N+F + P+E  AC ++S  L +MVGTCY AAG  
Sbjct  267   GVKPGSCPKRKESKPLNSKSVSLFFQNYFPTYPVEAEACKEHSTSLEEMVGTCYKAAGTM  326

Query  488   WANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLN  309
               NFLAV+FY                                   RS+G G F+AVDR+N
Sbjct  327   -PNFLAVNFY----------------------------------MRSDGVGVFDAVDRMN  351

Query  308   GGLLCGKDDVHSCVGGSK*GGCR  240
             G  LCG   V +C  G+  G C+
Sbjct  352   GRTLCGCSTVSACQAGAPFGSCK  374



>ref|XP_010550360.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Tarenaya hassleriana]
Length=425

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 243/373 (65%), Gaps = 39/373 (10%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             NCQVLD     +DC  G++C +CP  G + P C R  A+    ++N  LPFNKY +L TH
Sbjct  37    NCQVLDSCSTATDCATGLYCGNCPAAGKTHPICTRGQASIPTSIING-LPFNKYTWLVTH  95

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI       G   +   NQEDSVT QL NGVRGLMLD+YDF  D+WLCHSF G+C +
Sbjct  96    NSFSIVDAPPLPGSQRLTFYNQEDSVTNQLRNGVRGLMLDMYDFDNDIWLCHSFRGQCFN  155

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TLKE+EAFLS NP+EIVTII+EDYV  PK L+ +F +AGL KY FPV  MP
Sbjct  156   FTAFQPAINTLKEVEAFLSQNPTEIVTIIIEDYVKTPKALSTLFANAGLEKYQFPVLKMP  215

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V++MV +N RLLVFTSV +KEE EG+AYQW YMVEN+ GD G+KRG CPNR 
Sbjct  216   KKGEDWPTVTEMVQENHRLLVFTSVAAKEEEEGVAYQWRYMVENESGDPGVKRGSCPNRK  275

Query  635   ESPPL-TDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
             ES PL + ++ SL L+N+F + P+E  AC  +S PL +MVGTC  A+GNR  NFLAV+FY
Sbjct  276   ESQPLASKSSSSLFLMNYFPTYPVEREACEAHSAPLAEMVGTCLKASGNRMPNFLAVNFY  335

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS+GGG FE +DR+NG +LCG   +
Sbjct  336   ----------------------------------MRSDGGGVFEVLDRMNGPVLCGCSTI  361

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G C+
Sbjct  362   SACQPGAPFGSCK  374



>ref|XP_009621228.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Nicotiana tomentosiformis]
Length=419

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 236/350 (67%), Gaps = 36/350 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C +G+HC +C    +  P+C R    +    +   LPFN+Y++LTTHN+F+     S T
Sbjct  41    NCDSGLHCETCIANANVRPRCTRIQPVNPLSKVK-GLPFNRYSWLTTHNSFAKLKTKSGT  99

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T+QLNNGVRGLMLD+YDF  D+WLCHS+GGKC+++TAF+PA + L+
Sbjct  100   GSVILAPMNQQDSITEQLNNGVRGLMLDMYDFNNDIWLCHSYGGKCYNYTAFQPAINVLR  159

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI  FL  NPS+IVT+I+EDYV +P GLTKVF  AGL K+WFPVS MPKNGG+WP V DM
Sbjct  160   EIGVFLEANPSDIVTVIIEDYVRSPNGLTKVFDAAGLRKFWFPVSRMPKNGGEWPTVDDM  219

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             V +NQRL+VFTS  +KE SEGIAY+W Y+VENQYG+GG+K G CPNR ES  + + TKSL
Sbjct  220   VQRNQRLVVFTSKSAKEPSEGIAYEWRYLVENQYGNGGIKPGSCPNRAESSAMDNKTKSL  279

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VL+N+F   P    AC  NS PLIDM+ TC+ AAG RW NF+AVDFYK            
Sbjct  280   VLMNYFPDAPDFAQACRHNSAPLIDMMNTCHEAAGKRWPNFIAVDFYK------------  327

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                   RS+GGG  EAVD  NG L+CG  ++ SC
Sbjct  328   ----------------------RSDGGGAPEAVDVANGHLVCGCTNIASC  355



>ref|XP_002980707.1| hypothetical protein SELMODRAFT_420210 [Selaginella moellendorffii]
 gb|EFJ18358.1| hypothetical protein SELMODRAFT_420210 [Selaginella moellendorffii]
Length=340

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 233/359 (65%), Gaps = 42/359 (12%)
 Frame = -3

Query  1361  ACSGENCQVLDEEC---SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ACS  +C++  E C    DC  G+HC SCP  G   P C+RS AT    L    LPFNKY
Sbjct  19    ACSNHSCKI-GERCLNNEDCATGLHCSSCPAAGIIEPICIRSNAT---LLARTDLPFNKY  74

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             A+LTTHN+F+I+    R  VP  AP NQ+D+VT QL NGVRGLMLD+YDF+ D+WLCHSF
Sbjct  75    AWLTTHNSFAISTEKQRFPVPRFAPTNQDDTVTSQLQNGVRGLMLDLYDFKNDIWLCHSF  134

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
             GG C+DFTAF+PA +TL+E+EAFL+ NP E++TI +EDYV     +T VF  AGL K+WF
Sbjct  135   GGICYDFTAFQPAVETLREVEAFLAANPREVITIFIEDYVRTQNDVTNVFKAAGLDKFWF  194

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MPK+GG+WP ++DM+A NQRLLVFTS ++KE +EGIAYQW Y  ENQYGD GMK G
Sbjct  195   PVSKMPKSGGNWPTLADMIASNQRLLVFTSSQAKEATEGIAYQWRYTSENQYGDDGMKNG  254

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              C NR ESPPL   + SL + N+F + P EP  C  +   L  M+  C  ++GNR+ANFL
Sbjct  255   SCRNRDESPPLASRSVSLFVENYFPTTPFEPRECKDHGQSLRAMLDVCAKSSGNRYANFL  314

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             AV+FY                                   +SEGGGTF+AVD LN  L+
Sbjct  315   AVNFYA----------------------------------QSEGGGTFQAVDTLNSKLM  339



>ref|XP_009387239.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 242/377 (64%), Gaps = 40/377 (11%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             C   +CQ+LD  CS   DC AG++C SCP  G   P CVR+ A      +   LPFN+Y 
Sbjct  28    CPPRSCQLLDS-CSTADDCAAGLYCGSCPASGNVQPACVRALAYQPTAFVK-GLPFNRYT  85

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THN+FSI    S TGV  V   NQED+VT QL NGVRGLMLD+YDF  D+WLCHSF 
Sbjct  86    WLVTHNSFSIVDEPSYTGVQRVTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHSFQ  145

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C++FTAFEPA +TLKE+E FL+ NP EIVTII+EDYV APKGLTK+FTDAGL+K+W+P
Sbjct  146   GQCYNFTAFEPAINTLKEVEEFLTENPLEIVTIIIEDYVRAPKGLTKLFTDAGLVKFWYP  205

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS MP NG DWP V+DMVAKN RLLVFTS  SKE +EGIAYQW YMVEN+ GD G+  G 
Sbjct  206   VSEMPMNGMDWPSVTDMVAKNHRLLVFTSDASKEANEGIAYQWRYMVENEPGDPGVVPGS  265

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL     SL L N+F ++P++  AC ++S    +MV  CY AAGN   NFLA
Sbjct  266   CPNRKESQPLNSRYASLFLQNYFPTIPVQNEACKEHSVGFAEMVDACYRAAGNIMPNFLA  325

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V+FY                                   RS GGG F+  DR+NG  LCG
Sbjct  326   VNFY----------------------------------MRSNGGGVFDIQDRINGLALCG  351

Query  290   KDDVHSCVGGSK*GGCR  240
                + +C  G+  G C+
Sbjct  352   CGTITACQAGAPMGVCK  368



>ref|XP_002307272.2| hypothetical protein POPTR_0005s18330g [Populus trichocarpa]
 gb|EEE94268.2| hypothetical protein POPTR_0005s18330g [Populus trichocarpa]
Length=430

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 239/361 (66%), Gaps = 36/361 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             ++CG G++C +CP LG + P C R  A     ++N  LPFNKY +L THN+FSI      
Sbjct  45    TNCGVGLYCGNCPALGKTQPICTRGQAIIPNSIIN-GLPFNKYTWLVTHNSFSIVDAPPL  103

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
              GV  +   NQED+VT QL NGVRGLMLD+YDF GD+WLCHSF G+C +FTAF+PA +TL
Sbjct  104   PGVQRLTFYNQEDTVTNQLRNGVRGLMLDLYDFEGDIWLCHSFRGQCFNFTAFQPAINTL  163

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             +E+E+FLS NP+EIVTII+EDYV+ PKGL  +FT+AGL KYWFPVS MPK G DWP V++
Sbjct  164   REVESFLSENPTEIVTIIIEDYVHTPKGLINLFTNAGLDKYWFPVSKMPKKGEDWPTVTE  223

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV +N RL+VFTSV SKE  EGIAYQW YM+EN+ GD G+K G CPNR ES PL     S
Sbjct  224   MVQENHRLVVFTSVASKEAEEGIAYQWKYMLENEAGDPGVKPGSCPNRKESKPLNSKRAS  283

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             L L+N+F + P+E  AC ++S PL  MVGTCY AA N   NFLAV+FY            
Sbjct  284   LFLMNYFPTYPVETEACKEHSTPLAQMVGTCYKAARNVMPNFLAVNFY------------  331

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG F+A+DR+NG  LCG + V +C  G+  G C
Sbjct  332   ----------------------MRSDGGGVFDALDRMNGQTLCGCNTVTACQFGAPFGSC  369

Query  242   R  240
             +
Sbjct  370   K  370



>ref|XP_006422992.1| hypothetical protein CICLE_v10028578mg [Citrus clementina]
 gb|ESR36232.1| hypothetical protein CICLE_v10028578mg [Citrus clementina]
 gb|KDO59726.1| hypothetical protein CISIN_1g015707mg [Citrus sinensis]
Length=402

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/380 (51%), Positives = 239/380 (63%), Gaps = 40/380 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F++ ++   G+ C V D  C +   G+HC +C    +  P+C R    D    +   LPF
Sbjct  17    FSLSSALKEGQTC-VADSSCDN---GLHCETCVANKNFRPRCTRIHPVDPISKVK-GLPF  71

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             N+Y++LTTHN+F+     S  G   +AP+ Q+DS+T QLNNGVRGLMLD YDF  D+WLC
Sbjct  72    NRYSWLTTHNSFAKLRAKSPIGSVIIAPECQQDSITSQLNNGVRGLMLDTYDFMNDIWLC  131

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGGKC++FTAF+PA + LKE++AFL  NP+EIVTII+EDYV +P GLT VF  AGL K
Sbjct  132   HSFGGKCYNFTAFQPAINVLKEVQAFLEANPTEIVTIIIEDYVTSPNGLTNVFNAAGLKK  191

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MPKNG +WP + DM+ KNQRL+VFTS  +KE SEGIAYQW YMVENQYG+GGM
Sbjct  192   YWFPVSRMPKNGENWPTIDDMIQKNQRLVVFTSKSAKEASEGIAYQWRYMVENQYGNGGM  251

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR ES P+   +K LVLVN+F   P    AC  NS PL  MV TCY AAG RW 
Sbjct  252   KDGSCPNRAESSPMNTKSKPLVLVNYFPDTPNFAEACKHNSAPLASMVNTCYEAAGKRWP  311

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AV++YK                                  RS+GGG  E VD  NG 
Sbjct  312   NFIAVNYYK----------------------------------RSDGGGAPETVDVANGR  337

Query  302   LLCGKDDVHSCVGGSK*GGC  243
             L+CG  ++  C      G C
Sbjct  338   LVCGCGNIAYCKANMTYGAC  357



>ref|XP_004509132.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Cicer arietinum]
Length=428

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 249/384 (65%), Gaps = 40/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNS  1212
             F  +++ACS  NCQVL E CS   DCG+G+ C +CP LG + P C R         +N  
Sbjct  28    FFTISTACSNGNCQVL-EPCSSPTDCGSGLFCGNCPALGLNQPICTRGQPLLPTSTVN-G  85

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY+++ THN+FSI       GV  +   NQEDSVT QL NGVRGLMLD+YDF+ D+
Sbjct  86    LPFNKYSWIVTHNSFSIVDSPPLPGVQRLTFYNQEDSVTNQLRNGVRGLMLDMYDFQNDI  145

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF G+C +FTAF+PA +TLKE+E FL+ NP+EIVTII+EDYV+ PKGLT +FT AG
Sbjct  146   WLCHSFRGQCFNFTAFQPAINTLKEVETFLTQNPTEIVTIIIEDYVHTPKGLTNLFTSAG  205

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS MPK G DWP V++MV  N+RL+VFTS  SKE  EGIAYQW +MVEN+ GD
Sbjct  206   LDKYWFPVSKMPKKGDDWPTVTEMVQANRRLVVFTSDASKEAEEGIAYQWKHMVENESGD  265

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+++G CP+R ES  L   + SL L+N+F + P++  +C ++S PL +MV TCY  AGN
Sbjct  266   PGVQKGSCPHRKESKALNSKSASLFLMNYFPTYPVQADSCKEHSAPLAEMVNTCYKDAGN  325

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NF+AV+FY                                   RS+GGG F+ VDR+
Sbjct  326   VVPNFIAVNFY----------------------------------MRSDGGGVFDIVDRM  351

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG   V +C  G+  G C+
Sbjct  352   NGHTLCGCSTVAACQAGAPFGSCK  375



>ref|XP_010500524.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Camelina sativa]
Length=359

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 236/358 (66%), Gaps = 38/358 (11%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFSG--PKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             +C AG+HC +C +  SG  P+C R+   +        LPFNKY++LTTHN+F+  G  SR
Sbjct  38    NCDAGLHCETC-IANSGFRPRCSRTQPINPISK-TKGLPFNKYSWLTTHNSFARLGEVSR  95

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T QLNNGVRG MLD+YDF+ DVWLCHSF G C +FTAF+PA + L
Sbjct  96    TGSVILAPTNQQDSITSQLNNGVRGFMLDMYDFQNDVWLCHSFNGMCFNFTAFQPAINIL  155

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             +E + FL  N  E+VTII+EDYV +PKGLTKVF  AGL K+ FPV+ MPKNGGDWP + D
Sbjct  156   REFQVFLEKNTEEVVTIIIEDYVKSPKGLTKVFDAAGLRKFMFPVARMPKNGGDWPRLDD  215

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV +NQRLLVFTS   KE +EGIAYQWNYMVENQYG+GG+K G CPNR +S P++D +KS
Sbjct  216   MVRQNQRLLVFTSDSRKEATEGIAYQWNYMVENQYGNGGLKVGACPNRAQSKPMSDKSKS  275

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN F       +AC QNS  L++ + TCY AAG RW NF+AVDFYK           
Sbjct  276   LVLVNHFPDAADLIVACKQNSASLLESIKTCYQAAGQRWPNFIAVDFYK-----------  324

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*G  249
                                    RS+GGG  +AVD  NG L+CG D+  +C    K G
Sbjct  325   -----------------------RSDGGGAPQAVDIANGNLMCGCDNFAACKADGKCG  359



>ref|NP_564553.1| PI-PLC X domain-containing protein [Arabidopsis thaliana]
 gb|AAG13060.1|AC011807_19 Unknown protein [Arabidopsis thaliana]
 gb|AAM13007.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47915.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32470.1| PI-PLC X domain-containing protein [Arabidopsis thaliana]
Length=359

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 233/358 (65%), Gaps = 36/358 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             S+C AG+HC +C       P+C R+   +        LPFNKY++LTTHN+F+  G  SR
Sbjct  37    SNCDAGLHCETCIANTDFRPRCSRTQPINPITKAK-GLPFNKYSWLTTHNSFARLGEVSR  95

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T QLNNGVRG MLD+YDF+ D+WLCHSF G C +FTAF+PA + L
Sbjct  96    TGSAILAPTNQQDSITSQLNNGVRGFMLDMYDFQNDIWLCHSFDGTCFNFTAFQPAINIL  155

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             +E + FL  N  E+VTII+EDYV +PKGLTKVF  AGL K+ FPVS MPKNGGDWP + D
Sbjct  156   REFQVFLEKNKEEVVTIIIEDYVKSPKGLTKVFDAAGLRKFMFPVSRMPKNGGDWPRLDD  215

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV KNQRLLVFTS   KE +EGIAYQW YMVENQYG+GG+K G CPNR +S P++D +KS
Sbjct  216   MVRKNQRLLVFTSDSHKEATEGIAYQWKYMVENQYGNGGLKVGVCPNRAQSAPMSDKSKS  275

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN F       +AC QNS  L++ + TCY AAG RW NF+AVDFYK           
Sbjct  276   LVLVNHFPDAADVIVACKQNSASLLESIKTCYQAAGQRWPNFIAVDFYK-----------  324

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*G  249
                                    RS+GGG  +AVD  NG L+CG D+  +C    K G
Sbjct  325   -----------------------RSDGGGAPQAVDVANGNLICGCDNFAACKADGKCG  359



>gb|KHF99292.1| hypothetical protein F383_18663 [Gossypium arboreum]
Length=423

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 237/358 (66%), Gaps = 42/358 (12%)
 Frame = -3

Query  1301  MHCLSCPL-GFSGPKCVR---STATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGV  1134
             + C +C   G + P+C R    + T + K     LPFNKY++LTTHN+F++ G  S TG 
Sbjct  50    LTCQTCAANGNTRPRCTRIQPVSPTSKVK----GLPFNKYSWLTTHNSFALKGVKSETGS  105

Query  1133  PNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEI  954
               +AP NQED++T QL NGVRGLMLD+YDF GD+WLCHSFGG+C + TAF+PA + LKEI
Sbjct  106   SIIAPTNQEDTITNQLKNGVRGLMLDMYDFNGDIWLCHSFGGQCFNATAFQPAINVLKEI  165

Query  953   EAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVA  774
             +AFL  NPSEI+TI +EDYV +P+GLTKVF  +GL +YWFPVS MPKNG DWP V +MV 
Sbjct  166   QAFLEANPSEIITIFIEDYVVSPQGLTKVFNASGLRQYWFPVSKMPKNGEDWPTVDEMVK  225

Query  773   KNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVL  594
             +NQRL+VFTS  +KE SEGIAY+W Y+VENQYGD GMK G CPNR ES P+   ++SL+L
Sbjct  226   QNQRLVVFTSKSAKEASEGIAYEWRYVVENQYGDDGMKAGSCPNRAESSPMNTKSRSLIL  285

Query  593   VNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*  414
              N+F + P E  AC +NS PL+ M+ TC+ AAG+RW NF+AVDFY               
Sbjct  286   QNYFPTNPNETAACAENSAPLVKMLDTCHKAAGDRWPNFIAVDFY---------------  330

Query  413   TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                QR++GGG  EA+D  NG L CG D++  C   +  G C 
Sbjct  331   -------------------QRNDGGGASEALDVANGHLTCGCDNIAYCKANATSGTCE  369



>ref|XP_004509131.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Cicer arietinum]
Length=429

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/384 (50%), Positives = 248/384 (65%), Gaps = 39/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNS  1212
             F  +++ACS  NCQ + E CS   DCG+G+ C +CP LG + P C R         +N  
Sbjct  28    FFTISTACSNGNCQQVLEPCSSPTDCGSGLFCGNCPALGLNQPICTRGQPLLPTSTVN-G  86

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY+++ THN+FSI       GV  +   NQEDSVT QL NGVRGLMLD+YDF+ D+
Sbjct  87    LPFNKYSWIVTHNSFSIVDSPPLPGVQRLTFYNQEDSVTNQLRNGVRGLMLDMYDFQNDI  146

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF G+C +FTAF+PA +TLKE+E FL+ NP+EIVTII+EDYV+ PKGLT +FT AG
Sbjct  147   WLCHSFRGQCFNFTAFQPAINTLKEVETFLTQNPTEIVTIIIEDYVHTPKGLTNLFTSAG  206

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS MPK G DWP V++MV  N+RL+VFTS  SKE  EGIAYQW +MVEN+ GD
Sbjct  207   LDKYWFPVSKMPKKGDDWPTVTEMVQANRRLVVFTSDASKEAEEGIAYQWKHMVENESGD  266

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+++G CP+R ES  L   + SL L+N+F + P++  +C ++S PL +MV TCY  AGN
Sbjct  267   PGVQKGSCPHRKESKALNSKSASLFLMNYFPTYPVQADSCKEHSAPLAEMVNTCYKDAGN  326

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NF+AV+FY                                   RS+GGG F+ VDR+
Sbjct  327   VVPNFIAVNFY----------------------------------MRSDGGGVFDIVDRM  352

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG   V +C  G+  G C+
Sbjct  353   NGHTLCGCSTVAACQAGAPFGSCK  376



>ref|NP_001132240.1| uncharacterized protein LOC100193675 precursor [Zea mays]
 gb|ACF81012.1| unknown [Zea mays]
Length=420

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/379 (51%), Positives = 247/379 (65%), Gaps = 41/379 (11%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             V+ S+  G++C  +     DCG G++C +CP  G +   C+R  A     ++   LPFN+
Sbjct  23    VLCSSQVGDSCSSV----RDCGTGLYCGNCPAAGRTKLSCIRDLAIQPTSIVKG-LPFNR  77

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y++L THN+FSI G  SRTGV  V   NQEDSVT QL NGVRGLMLD+YDF  DVWLCHS
Sbjct  78    YSWLVTHNSFSILGEPSRTGVERVTFYNQEDSVTNQLRNGVRGLMLDMYDFNDDVWLCHS  137

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
               G+C++FTAF PA DTLKE+EAFLS NP+EI+TI +EDYV++P GL+KVFT A LMKYW
Sbjct  138   LQGQCYNFTAFVPAVDTLKEVEAFLSENPTEIITIFIEDYVHSPMGLSKVFTAADLMKYW  197

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             +P+S MP +G DWP V+DMVAKN+RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+  
Sbjct  198   YPISEMPTSGKDWPSVTDMVAKNRRLLVFTSDASKEASEGIAYQWSYLLENEPGDPGIVP  257

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CPNR ES PL     SL L N+F ++P++  AC +NSG L  M   CY AAGNR  NF
Sbjct  258   GSCPNRKESQPLNSRPASLFLQNYFPTIPVQNEACKENSG-LPQMAQACYAAAGNRIPNF  316

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             +AV+FY                                   RS+GGG F+  DR+NG  L
Sbjct  317   IAVNFY----------------------------------MRSDGGGVFDVQDRINGRTL  342

Query  296   CGKDDVHSCVGGSK*GGCR  240
             CG D + +C  G+  G C+
Sbjct  343   CGCDTIAACQAGAPMGACK  361



>emb|CDP02505.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   380 bits (976),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 236/358 (66%), Gaps = 38/358 (11%)
 Frame = -3

Query  1307  AGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRTGVP  1131
             AG+ C SCP+ G + P+C R    +    +   LPFN+Y++LTTHN+++++G +S TG  
Sbjct  81    AGLICGSCPVNGNTRPRCTRIQPLNPTSKVK-GLPFNRYSWLTTHNSYALSGSNSATGSV  139

Query  1130  NVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIE  951
              +AP NQED+VT QL NGVRGLMLD+YDF  D+WLCHSFG KC++FTAF+PA + LKEI+
Sbjct  140   ILAPTNQEDTVTNQLQNGVRGLMLDMYDFNNDIWLCHSFGRKCYNFTAFQPAINVLKEIQ  199

Query  950   AFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAK  771
              FL  NP+EIVTI +EDYV +P+GLTKVF  +GL KYWFPVS MPK G DWP V DMV +
Sbjct  200   VFLEENPTEIVTIFIEDYVQSPQGLTKVFNASGLSKYWFPVSRMPKGGQDWPTVDDMVQQ  259

Query  770   NQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLV  591
             NQRL+VFTS+ SKE +EGIAY+W Y+VENQYGDGGM  G CP+R ES P+   T SLVL 
Sbjct  260   NQRLVVFTSISSKEATEGIAYEWKYVVENQYGDGGMINGSCPSRSESSPMDTKTISLVLE  319

Query  590   NFFGSVPLEPM--ACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD  417
             NFF + P   +  AC  NS PL+ M  TCY AAGNRW NF+AVDFY              
Sbjct  320   NFFPTNPNTNITEACANNSAPLVSMTRTCYKAAGNRWPNFIAVDFY--------------  365

Query  416   *TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                 QRS+GGG  EAVD  NG L CG D +  C   +  G C
Sbjct  366   --------------------QRSDGGGAPEAVDEANGHLTCGCDSIAYCKANATLGTC  403



>ref|XP_009387240.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=395

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 242/377 (64%), Gaps = 40/377 (11%)
 Frame = -3

Query  1358  CSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYA  1191
             C   +CQ+LD  CS   DC AG++C SCP  G   P CVR+ A  Q       LPFN+Y 
Sbjct  28    CPPRSCQLLDS-CSTADDCAAGLYCGSCPASGNVQPACVRALAY-QPTAFVKGLPFNRYT  85

Query  1190  FLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFG  1011
             +L THN+FSI    S TGV  V   NQED+VT QL NGVRGLMLD+YDF  D+WLCHSF 
Sbjct  86    WLVTHNSFSIVDEPSYTGVQRVTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHSFQ  145

Query  1010  GKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFP  831
             G+C++FTAFEPA +TLKE+E FL+ NP EIVTII+EDYV APKGLTK+FTDAGL+K+W+P
Sbjct  146   GQCYNFTAFEPAINTLKEVEEFLTENPLEIVTIIIEDYVRAPKGLTKLFTDAGLVKFWYP  205

Query  830   VSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGD  651
             VS MP NG DWP V+DMVAKN RLLVFTS  SKE +EGIAYQW YMVEN+ GD G+  G 
Sbjct  206   VSEMPMNGMDWPSVTDMVAKNHRLLVFTSDASKEANEGIAYQWRYMVENEPGDPGVVPGS  265

Query  650   CPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLA  471
             CPNR ES PL     SL L N+F ++P++  AC ++S    +MV  CY AAGN   NFLA
Sbjct  266   CPNRKESQPLNSRYASLFLQNYFPTIPVQNEACKEHSVGFAEMVDACYRAAGNIMPNFLA  325

Query  470   VDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCG  291
             V+FY                                   RS GGG F+  DR+NG  LCG
Sbjct  326   VNFY----------------------------------MRSNGGGVFDIQDRINGLALCG  351

Query  290   KDDVHSCVGGSK*GGCR  240
                + +C  G+  G C+
Sbjct  352   CGTITACQAGAPMGVCK  368



>ref|XP_002446665.1| hypothetical protein SORBIDRAFT_06g020050 [Sorghum bicolor]
 gb|EES10993.1| hypothetical protein SORBIDRAFT_06g020050 [Sorghum bicolor]
Length=422

 Score =   379 bits (972),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 238/361 (66%), Gaps = 37/361 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             SDCG G++C SCP  G +   C+R  A     ++   LPFN+Y++L THN+FSI G  SR
Sbjct  37    SDCGTGLYCGSCPAAGRTKLSCIRDLAIQPTSIVKG-LPFNRYSWLVTHNSFSILGEPSR  95

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TGV  V   NQEDSVT QL NGVRGLMLD+YDF  DVWLCHS  G+C++FTAF PA +TL
Sbjct  96    TGVERVTFYNQEDSVTNQLRNGVRGLMLDMYDFNDDVWLCHSLQGQCYNFTAFVPAVETL  155

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             KE+EAFLS NP+EI+TI +EDYV +P GL+KVFT A LMKYW+P+S MP  G DWP V+D
Sbjct  156   KEVEAFLSENPTEIITIFIEDYVQSPMGLSKVFTAADLMKYWYPISEMPTGGKDWPSVTD  215

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MVAKN+RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+  G CPNR ES PL   + S
Sbjct  216   MVAKNRRLLVFTSDDSKEASEGIAYQWSYLLENESGDPGIVPGSCPNRKESQPLNSKSAS  275

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             L L N+F ++P++  AC +NSG L  M   CY AAGNR  NF+AV+FY            
Sbjct  276   LFLQNYFPTMPVQNEACKENSG-LPQMAQACYAAAGNRIPNFIAVNFY------------  322

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGC  243
                                    RS+GGG F+  DR+NG  LCG D + +C  G+  G C
Sbjct  323   ----------------------MRSDGGGVFDVQDRINGRTLCGCDTIAACQAGAPMGAC  360

Query  242   R  240
             +
Sbjct  361   K  361



>ref|XP_006661031.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Oryza brachyantha]
Length=415

 Score =   378 bits (971),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 246/373 (66%), Gaps = 41/373 (11%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTT  1179
             +CQV D  CS   DCGAG++C +C   G + P C+R+ A     ++   LPFN+Y++L T
Sbjct  22    SCQVGDS-CSSARDCGAGLYCGNCAATGKARPSCIRALAIQPTSIVK-GLPFNRYSWLVT  79

Query  1178  HNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCH  999
             HN+FSI G  S TGV  V   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS  G+C+
Sbjct  80    HNSFSIVGEPSHTGVERVTFYNQEDTVTNQLRNGVRGLMLDMYDFNDDIWLCHSLQGQCY  139

Query  998   DFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNM  819
             +FTAF+PA DTLKE+EAFLS NP+EI+TI +EDYV++P GL+K+F  A LMKYW+P+S M
Sbjct  140   NFTAFQPAIDTLKEVEAFLSENPTEIITIFIEDYVHSPMGLSKLFIAADLMKYWYPISEM  199

Query  818   PKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNR  639
             P NG DWP V+DMVAKN RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+  G CPNR
Sbjct  200   PTNGNDWPSVTDMVAKNHRLLVFTSDASKEASEGIAYQWSYLLENESGDPGIT-GSCPNR  258

Query  638   GESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
              ES PL   + SL L N+F ++P+E  AC +NS  L  MV TCY AAGNR  NF+AV++Y
Sbjct  259   KESQPLNSRSASLFLQNYFPTIPVENEACKENSVGLPQMVQTCYAAAGNRIPNFIAVNYY  318

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS GGG F+  DR+NG  LCG + +
Sbjct  319   ----------------------------------MRSNGGGVFDVQDRINGLTLCGCNTI  344

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G C+
Sbjct  345   AACQAGTPAGSCK  357



>ref|XP_002976966.1| hypothetical protein SELMODRAFT_443348 [Selaginella moellendorffii]
 gb|EFJ22076.1| hypothetical protein SELMODRAFT_443348 [Selaginella moellendorffii]
Length=340

 Score =   375 bits (964),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 232/359 (65%), Gaps = 42/359 (12%)
 Frame = -3

Query  1361  ACSGENCQVLDEEC---SDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKY  1194
             ACS  +C++  E C    DC  G+HC SC   G   P C+RS AT    L    LPFNKY
Sbjct  19    ACSNHSCKI-GERCFNNEDCATGLHCSSCAAAGIIEPICIRSNAT---LLARTDLPFNKY  74

Query  1193  AFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSF  1014
             A+LTTHN+F+I+    R  VP  AP NQ+D+VT QL NGVRGLMLD+YDF+ D+WLCHSF
Sbjct  75    AWLTTHNSFAISTEKQRFPVPRFAPTNQDDTVTSQLQNGVRGLMLDLYDFKNDIWLCHSF  134

Query  1013  GGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWF  834
             GG C+DFTAF+PA +TL+E+EAFL+ NP E++TI +EDYV    G+T VF  AGL K WF
Sbjct  135   GGICYDFTAFQPAVETLREVEAFLAANPREVITIFIEDYVRTQNGVTNVFKAAGLDKLWF  194

Query  833   PVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRG  654
             PVS MPK+GGDWP ++DM+A NQRLLVFTS ++KE +EGIAYQW Y  ENQYGD GM+ G
Sbjct  195   PVSKMPKSGGDWPTLADMIASNQRLLVFTSSQAKEATEGIAYQWRYTSENQYGDDGMENG  254

Query  653   DCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFL  474
              C NR ESPPL   + SL + N+F + P EP  C  +   L  M+  C  ++GNR+ANFL
Sbjct  255   SCRNRDESPPLASRSVSLFVENYFPTTPFEPRECKDHGQSLFAMLDVCAKSSGNRYANFL  314

Query  473   AVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             AV+FY                                   +SEGGGTF+AVD LN  L+
Sbjct  315   AVNFYA----------------------------------QSEGGGTFQAVDTLNSKLM  339



>ref|XP_009795144.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Nicotiana 
sylvestris]
Length=414

 Score =   378 bits (971),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 245/374 (66%), Gaps = 36/374 (10%)
 Frame = -3

Query  1358  CSGENCQVLDEECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLT  1182
             C+    Q      +DCGAG++C +CP LG + P C+R  AT+   +++  LPFNKY++L 
Sbjct  25    CANSQLQNSCASATDCGAGLYCGNCPELGKNQPFCIRGQATEPTSVIS-GLPFNKYSWLV  83

Query  1181  THNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKC  1002
             THNAFSI      TG   +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHSF G+C
Sbjct  84    THNAFSIVNAPLLTGPQRITFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHSFRGQC  143

Query  1001  HDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSN  822
             ++FTAFEPA +TLKE+EAFLS NP+EIVTII+EDYV+ PKGLT+VFTDAGL KY FPVS 
Sbjct  144   YNFTAFEPAINTLKEVEAFLSANPTEIVTIIIEDYVHTPKGLTRVFTDAGLDKYRFPVSK  203

Query  821   MPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPN  642
             MPK G DWP V+DMV KN RLLVFTS  SKE +EGIAYQW YMVEN+ GD G+  G C +
Sbjct  204   MPKKGDDWPTVNDMVKKNHRLLVFTSDSSKEAAEGIAYQWRYMVENEPGDPGVVPGACSS  263

Query  641   RGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDF  462
             R ES PL   + SL L+N+F +V ++  AC ++S  L+D VG C+ AAGN   N++AV+F
Sbjct  264   RKESKPLNSRSASLFLMNYFPTVAVQNGACKEHSTQLVDTVGACFKAAGNLMPNYVAVNF  323

Query  461   YKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDD  282
             Y                                   RS+GGG F+ +DR+NG  LCG   
Sbjct  324   Y----------------------------------MRSDGGGVFDVLDRMNGQTLCGCPT  349

Query  281   VHSCVGGSK*GGCR  240
             V +C  G + G CR
Sbjct  350   VTACQAGERFGVCR  363



>gb|KFK35981.1| hypothetical protein AALP_AA4G062800 [Arabis alpina]
Length=359

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 239/371 (64%), Gaps = 40/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C V      +C  G+HC +C    +  P+C R+   +    +   LPF
Sbjct  21    FEISSALKEGQTCIVN----KNCDTGLHCETCLANSNLRPRCSRTQPINPISKVK-GLPF  75

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY++LTTHN+F+  G  SRTG   +AP NQ+DS+T QLNNGVRG MLD+YDF  DVWLC
Sbjct  76    NKYSWLTTHNSFARLGEVSRTGSVVLAPTNQQDSITSQLNNGVRGFMLDMYDFENDVWLC  135

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSFGG C++ TAF PA D L+EI+ FL  N  E+VTII+EDYV +PKGLTKVF  AGL K
Sbjct  136   HSFGGTCYNVTAFRPAIDVLREIQVFLENNNEEVVTIIIEDYVKSPKGLTKVFNAAGLQK  195

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             + FPV+ MP NGGDWP + DMV +NQRLLVFTS + KE SEGIAYQW Y VENQYG+GG+
Sbjct  196   FMFPVTRMPNNGGDWPTLDDMVRQNQRLLVFTSDRGKEASEGIAYQWKYTVENQYGNGGL  255

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR ES P++D +KSLV+VN F   P   +AC QNS  L++ + TCY AAG RW 
Sbjct  256   KAGVCPNRDESAPMSDKSKSLVVVNHFPDAPDLVIACKQNSASLLESIKTCYQAAGQRWP  315

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             N++AVDFYK                                  RS+GGG  +AVD  NG 
Sbjct  316   NYIAVDFYK----------------------------------RSDGGGAPQAVDVTNGN  341

Query  302   LLCGKDDVHSC  270
             L+CG D+  +C
Sbjct  342   LICGCDNFAAC  352



>gb|KHN36237.1| PI-PLC X domain-containing protein [Glycine soja]
Length=403

 Score =   377 bits (969),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 219/323 (68%), Gaps = 34/323 (11%)
 Frame = -3

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFN+Y++LTTHN++++ G  S TG   VAP NQED+V +QL NGVRG MLD+YDF+ D+
Sbjct  59    LPFNRYSWLTTHNSYALAGARSATGSVLVAPMNQEDTVAEQLKNGVRGFMLDMYDFQKDI  118

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF  KC +FTAF+PA + LK++  FL  NPSEI+TI +EDYV AP+GLTKVF D+G
Sbjct  119   WLCHSFQSKCFNFTAFQPAINVLKDMRTFLDGNPSEIITIFIEDYVTAPQGLTKVFKDSG  178

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KY FPVS MPKNGGDWP V DMV KNQRL+VFTS  +KE SE IAYQW Y+VENQYGD
Sbjct  179   LSKYIFPVSRMPKNGGDWPTVDDMVQKNQRLVVFTSKSAKEASENIAYQWTYVVENQYGD  238

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CP+R ESP +   ++SLVLVN+F S P    AC  NS PL+DM  TC+ AAGN
Sbjct  239   DGMKAGSCPSRAESPAMNTESRSLVLVNYFHSAPNRSQACADNSAPLLDMTKTCHEAAGN  298

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RWANF+AVD+Y                                  QRS+GGG   AVD  
Sbjct  299   RWANFIAVDYY----------------------------------QRSDGGGAPLAVDEA  324

Query  311   NGGLLCGKDDVHSCVGGSK*GGC  243
             NG L CG D++  C   +K G C
Sbjct  325   NGHLTCGCDNIAYCKENAKFGTC  347



>dbj|BAJ96824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 237/362 (65%), Gaps = 38/362 (10%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             +CQV D      DCG G++C  C   G + P C+R  A     ++   LPFN+Y++L TH
Sbjct  27    SCQVGDSCLAARDCGVGLYCGDCAAAGRTRPSCIRDLAIQPTSIVKG-LPFNRYSWLVTH  85

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI G  SRTGV  V   NQED+VT QL NGVRGLMLD+YDF GDVWLCHS  G+C++
Sbjct  86    NSFSIVGEPSRTGVERVTFYNQEDTVTNQLRNGVRGLMLDMYDFSGDVWLCHSLQGQCYN  145

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAFEPA DTLKE+EAFLS NP+EIVTI +EDYV+AP  L+K+FT A LMKYW+P+S MP
Sbjct  146   FTAFEPAIDTLKEVEAFLSENPTEIVTIFIEDYVHAPMRLSKLFTAADLMKYWYPISEMP  205

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
              +G DWP V+DMVAKN RLLVFTS  SKE SEGIAYQW Y++EN+ GD G+    CPNR 
Sbjct  206   TSGQDWPTVTDMVAKNHRLLVFTSDASKESSEGIAYQWRYLLENESGDPGIDPSSCPNRR  265

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   + SL + N+F ++P+E  AC +NS  L  MV TCY AAGNR  N++AV+FY 
Sbjct  266   ESQPLNSRSVSLFMQNYFPTIPVESEACKENSVGLPQMVQTCYAAAGNRIPNYIAVNFY-  324

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG F+  DR+NG  LCG + + 
Sbjct  325   ---------------------------------MRSDGGGVFDVQDRINGLTLCGCNSIA  351

Query  275   SC  270
             +C
Sbjct  352   AC  353



>gb|EMT29159.1| PI-PLC X domain-containing protein [Aegilops tauschii]
Length=412

 Score =   378 bits (970),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 244/373 (65%), Gaps = 40/373 (11%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTT  1179
             +CQV D  CS   DCG G++C  C   G + P C+R  A  Q   +   LPFN+ ++L T
Sbjct  24    SCQVGDS-CSAARDCGVGLYCGDCAAAGRTRPSCIRDLAI-QPTTIVKGLPFNRSSWLVT  81

Query  1178  HNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCH  999
             HN+FSI G  SRTGV  V   NQED+VT QL NGVRGLMLD+YDF GDVWLCHS  G+C+
Sbjct  82    HNSFSIVGEPSRTGVERVTFYNQEDTVTNQLRNGVRGLMLDMYDFGGDVWLCHSLQGQCY  141

Query  998   DFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNM  819
             +FTAFEPA DTLKE+EAFLS NP+EIVTI +EDYV+AP  L+K+FT A LMKYW+P+S M
Sbjct  142   NFTAFEPAIDTLKEVEAFLSENPTEIVTIFIEDYVHAPMRLSKLFTAADLMKYWYPISEM  201

Query  818   PKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNR  639
             P +G +WP V+DMVAKN RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+    CPNR
Sbjct  202   PTSGQEWPTVTDMVAKNHRLLVFTSDASKESSEGIAYQWSYLLENESGDPGIDPSACPNR  261

Query  638   GESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
              ES PL   + SL + N+F ++P+E  AC +NS  L  MV TCY AAGNR  NF+AV+FY
Sbjct  262   KESQPLNSRSASLFMQNYFPTIPVESEACKENSVGLPQMVQTCYAAAGNRIPNFIAVNFY  321

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS+GGG F+  DR+NG  LCG + +
Sbjct  322   ----------------------------------MRSDGGGVFDVQDRINGLTLCGCNTI  347

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G C+
Sbjct  348   AACQAGAPAGACK  360



>ref|XP_010690604.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score =   378 bits (971),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 234/370 (63%), Gaps = 39/370 (11%)
 Frame = -3

Query  1340  QVLDEEC---SDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHN  1173
             Q L E C    +C  G+HC +C    +   +C R    + F  +   LPFNKY++LTTHN
Sbjct  46    QNLGETCISDRNCDQGLHCETCLANRNLRLRCTRIQPINPFSKVR-GLPFNKYSWLTTHN  104

Query  1172  AFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDF  993
             +F+  G  S TG   VAP NQ+DSVT QLNNGVRG MLD+YDF  DVWLCHSFGG+C+++
Sbjct  105   SFARFGQKSATGSVIVAPSNQQDSVTSQLNNGVRGFMLDMYDFENDVWLCHSFGGQCYNY  164

Query  992   TAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPK  813
             TAF+PA + L E++ FL  NPSEI+TI +EDYV +PKGLTK+F  AGL K+WFPVS MPK
Sbjct  165   TAFKPAKEVLNEMQTFLEANPSEIITIFIEDYVTSPKGLTKLFDSAGLRKFWFPVSRMPK  224

Query  812   NGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGE  633
             NGG+WP V DM+ KNQRLLVFTS   KE +EGIAY W Y++ENQYGDGGM+ G CPNR E
Sbjct  225   NGGNWPTVDDMIQKNQRLLVFTSKAHKEAAEGIAYNWRYVLENQYGDGGMQAGSCPNRAE  284

Query  632   SPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKV  453
             S P+  +T SLVLVN+F + P    AC  NS PL  M+ TCY  +G RWAN++ VDFYK 
Sbjct  285   SRPMNTSTISLVLVNYFPTAPNLASACKHNSAPLESMLSTCYNESGKRWANYVTVDFYK-  343

Query  452   VKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHS  273
                                              RS+GGG   AVD +NG L+CG   +  
Sbjct  344   ---------------------------------RSDGGGASAAVDEMNGHLVCGCASIAE  370

Query  272   CVGGSK*GGC  243
             C      G C
Sbjct  371   CRANMTFGSC  380



>ref|XP_009367285.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=424

 Score =   378 bits (971),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 244/385 (63%), Gaps = 39/385 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             ++ACS  NCQVLD     +DCG G++C +CP  G + P C R  A     ++N  LPFNK
Sbjct  32    STACSNGNCQVLDACAAATDCGPGLYCGNCPASGKNQPVCTRGQAIVPTSIING-LPFNK  90

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS
Sbjct  91    YTWLATHNSFSIVDAPPVPGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHS  150

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G+C +FTAF+PA +TL E+E FLS NP+EIVTII+EDYV  PKGLT +FT+AGL KYW
Sbjct  151   FKGQCFNFTAFQPAINTLTEVETFLSQNPTEIVTIIIEDYVKTPKGLTTLFTNAGLNKYW  210

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPV+ MP+ G DWP V++MV +N RLLVFTS  SKE  EG+AYQW YMVEN+ GD G+K 
Sbjct  211   FPVAKMPRKGEDWPTVTEMVQENHRLLVFTSDASKEAQEGVAYQWKYMVENEAGDPGVKP  270

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CP R ES PL   + SL   N+F + P+E  AC ++S PL  MV TCY AAG    NF
Sbjct  271   GSCPKRKESKPLNSKSASLFFQNYFPTYPVEAEACEEHSTPLEQMVSTCYKAAG-VMPNF  329

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAV+FY                                   RS+GGG F+AVDR+NG ++
Sbjct  330   LAVNFY----------------------------------MRSDGGGVFDAVDRMNGPVV  355

Query  296   CGKDDVHSCVGGSK*GGCRRWNTRT  222
             CG   V +C  G+  G C+  +  T
Sbjct  356   CGCSTVSACQAGAPSGSCKNISVPT  380



>ref|XP_008338332.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Malus domestica]
Length=424

 Score =   378 bits (971),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 244/385 (63%), Gaps = 39/385 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLD--EECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             T+ACS  NCQVL+     +DCG G++C +CP  G + P C R  A     ++N  LPFNK
Sbjct  32    TTACSNGNCQVLEXCAAATDCGPGLYCGNCPASGRNQPVCTRGQAIVPTSIIN-XLPFNK  90

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCHS
Sbjct  91    YTWLVTHNSFSIVXAPPVAGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCHS  150

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G+C++FTAF+PA +TLKE+E FLS NP+EIVTII+EDYV  PKGLT +FT+AGL KYW
Sbjct  151   FKGQCYNFTAFQPAINTLKEVETFLSQNPTEIVTIIIEDYVKTPKGLTTLFTNAGLDKYW  210

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FP + MP  G +WP V++MV +N RLLVFTS  SKE  EG+AYQW YMVEN+ GD G++ 
Sbjct  211   FPAAKMPIKGEEWPTVTEMVQENHRLLVFTSDASKEAQEGVAYQWKYMVENEAGDPGVRP  270

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CP R ES PL   + SL   N+F + P+E  AC ++S PL  MVGTCY AAG    NF
Sbjct  271   GSCPKRKESKPLNSKSASLFFQNYFPTYPVEAEACKEHSTPLEQMVGTCYKAAG-VMPNF  329

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAV+FY                                   RS+GGG F+AVDR+NG  L
Sbjct  330   LAVNFY----------------------------------MRSDGGGVFDAVDRMNGQXL  355

Query  296   CGKDDVHSCVGGSK*GGCRRWNTRT  222
             CG   V +C  G+  G C+  +  T
Sbjct  356   CGCSTVSACQAGAPSGSCKNISVPT  380



>ref|XP_011016278.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like, 
partial [Populus euphratica]
Length=243

 Score =   371 bits (953),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 205/275 (75%), Gaps = 34/275 (12%)
 Frame = -3

Query  1091  QLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTI  912
             QLNNG R LMLD YDFRGDVWLCHSF G+CHD+TAF PA DTL+EIEAFLST+PSEIVTI
Sbjct  3     QLNNGARALMLDTYDFRGDVWLCHSFKGQCHDYTAFGPAIDTLREIEAFLSTHPSEIVTI  62

Query  911   ILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSK  732
             ILEDYV AP GLTKVFTDAGLMKYWFPV+NMPKNG DWPLV+DMV  NQRLLVFTS++SK
Sbjct  63    ILEDYVQAPNGLTKVFTDAGLMKYWFPVTNMPKNGQDWPLVNDMVQNNQRLLVFTSIQSK  122

Query  731   EESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMAC  552
             E SEGIAYQWN+MVENQYG+ GMK G C NR ES  L D ++SLVLVN+F  +P++ ++C
Sbjct  123   EASEGIAYQWNFMVENQYGNVGMKAGSCTNRKESSSLNDKSRSLVLVNYFRCIPMKKLSC  182

Query  551   VQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**  372
               NS  LI M+ TC  AA NRWANF+AVD+YK                            
Sbjct  183   EDNSRNLIKMLHTCSGAAANRWANFVAVDYYK----------------------------  214

Query  371   QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCV  267
                   RSEGGG+F+AVD LNG LLCG DD+H+CV
Sbjct  215   ------RSEGGGSFQAVDLLNGKLLCGCDDIHACV  243



>ref|XP_008788843.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Phoenix 
dactylifera]
Length=413

 Score =   377 bits (969),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 247/384 (64%), Gaps = 40/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNS  1212
             F   T++CS  +C++LD  CS   DC  G++C +CP  G + P C R  AT    ++   
Sbjct  16    FPSSTASCSPRSCKLLDS-CSTADDCAPGLYCGTCPASGKTRPSCTRGRATVPTSIVK-G  73

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY +L THN+FSI   +S TGV  +   NQED+VT QL NGVRGLMLD+YDF+ D+
Sbjct  74    LPFNKYTWLVTHNSFSIVNETSYTGVQRITFYNQEDTVTNQLRNGVRGLMLDMYDFKDDI  133

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHS  G+C+DFTAFEPA +TL+E+EAFL+ NPSEIVTII+EDYV+APKGLTK+F +AG
Sbjct  134   WLCHSLQGRCYDFTAFEPAINTLREVEAFLTENPSEIVTIIIEDYVHAPKGLTKLFMNAG  193

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L+KYW+PVS MP NG +WP V+DM  KN RLLVFTS  SKE  EGIAYQW YM+EN+ GD
Sbjct  194   LVKYWYPVSEMPTNGREWPSVTDMAVKNHRLLVFTSDASKEADEGIAYQWRYMLENEPGD  253

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G+    CPNR ES PL     SL L N+F ++P+E  AC ++S  L +MV  CY AAGN
Sbjct  254   PGIVPASCPNRKESQPLNSRYASLFLQNYFPTIPVENEACKEHSLGLAEMVDACYKAAGN  313

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NF+AV+FY                                   RS+G G F+  DR+
Sbjct  314   LMPNFVAVNFY----------------------------------MRSDGRGVFDIQDRM  339

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG   V +C  G+  G C+
Sbjct  340   NGINLCGCSTVTACQAGAPSGSCK  363



>ref|XP_006393219.1| hypothetical protein EUTSA_v10011609mg [Eutrema salsugineum]
 gb|ESQ30505.1| hypothetical protein EUTSA_v10011609mg [Eutrema salsugineum]
Length=358

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 235/350 (67%), Gaps = 36/350 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C  G+HC +C    +  P+C R+   +    +   LPFNKY++LTTHN+F+  G  S+T
Sbjct  37    NCDTGLHCETCLANNNLRPRCSRTQPINPISKVK-GLPFNKYSWLTTHNSFARLGAISKT  95

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QL NGVRG MLD+YDF+ D+WLCHSFGG C +FTAF+PA + L+
Sbjct  96    GSVILAPTNQQDSITSQLTNGVRGFMLDMYDFKNDIWLCHSFGGMCFNFTAFQPAINVLR  155

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             EI+ FL +N  E+VTII+EDYV +P GLTKVF  AGL K+ FPV+ MPKNGGDWP + DM
Sbjct  156   EIQVFLESNKEEVVTIIIEDYVKSPMGLTKVFDTAGLRKFMFPVTRMPKNGGDWPTLEDM  215

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             + +NQRLLVFTS + KE +EGIAYQWN+MVENQYG+GG+K G CPNR +S P++D +KSL
Sbjct  216   IRQNQRLLVFTSDRRKEATEGIAYQWNFMVENQYGNGGLKVGVCPNRAQSAPMSDKSKSL  275

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VLVN F   P   +AC QNS PL++ +  CY AAG RW N++AVDFYK            
Sbjct  276   VLVNHFPDAPDLVVACKQNSAPLLESIKACYQAAGQRWPNYIAVDFYK------------  323

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSC  270
                                   RS+GGG  +AVD  NG L+CG D+  +C
Sbjct  324   ----------------------RSDGGGAPQAVDVANGNLICGCDNFAAC  351



>ref|XP_009343282.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=424

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/385 (51%), Positives = 244/385 (63%), Gaps = 39/385 (10%)
 Frame = -3

Query  1367  TSACSGENCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNK  1197
             ++ACS  NCQVLD     +DCG G++C +CP  G + P C R  A     ++N  LPFNK
Sbjct  32    STACSNGNCQVLDACAAATDCGPGLYCGNCPASGKNQPVCTRGQAIVPTSIIN-GLPFNK  90

Query  1196  YAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHS  1017
             Y +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLD+Y+F  D+WLCHS
Sbjct  91    YTWLATHNSFSIVDAPPVPGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYNFENDIWLCHS  150

Query  1016  FGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYW  837
             F G+C +FTAF+PA +TL E+E FLS NP+EIVTII+EDYV  PKGLT +FT+AGL KYW
Sbjct  151   FKGQCFNFTAFQPAINTLTEVETFLSQNPTEIVTIIIEDYVKTPKGLTTLFTNAGLNKYW  210

Query  836   FPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKR  657
             FPV+ MP+ G DWP V++MV +N RLLVFTS  SKE  EG+AYQW YMVEN+ GD G+K 
Sbjct  211   FPVAKMPRKGEDWPTVTEMVQENHRLLVFTSDASKEAQEGVAYQWKYMVENEAGDPGVKP  270

Query  656   GDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANF  477
             G CP R ES PL   + SL   N+F + P+E  AC ++S PL  MV TCY AAG    NF
Sbjct  271   GSCPKRKESKPLNSKSASLFFQNYFPTYPVEAEACEEHSTPLEQMVSTCYKAAG-VMPNF  329

Query  476   LAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLL  297
             LAV+FY                                   RS+GGG F+AVDR+NG +L
Sbjct  330   LAVNFY----------------------------------MRSDGGGVFDAVDRMNGPVL  355

Query  296   CGKDDVHSCVGGSK*GGCRRWNTRT  222
             CG   V +C  G+  G C+  +  T
Sbjct  356   CGCSTVSACQAGAPSGSCKNISVPT  380



>ref|XP_003576905.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Brachypodium 
distachyon]
Length=415

 Score =   376 bits (966),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 237/360 (66%), Gaps = 36/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             DCG G++C  C   G + P C+R  A     ++   LPFN+Y++L THN+FSI G  SRT
Sbjct  35    DCGTGLYCGDCAATGRTRPSCIRDLAIQPTSIVKG-LPFNRYSWLVTHNSFSIVGEPSRT  93

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             GV  V   NQED+VT QL NG RGLMLD+YDF GDVWLCHS  G+C++FTAFEPA DTL+
Sbjct  94    GVERVTFYNQEDTVTNQLRNGARGLMLDMYDFGGDVWLCHSLQGQCYNFTAFEPAIDTLQ  153

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E+E+FLS NP+EIVTI +EDYV++P GL+K+FT A LMKYW+P+  MP NG DWP V+DM
Sbjct  154   EVESFLSENPTEIVTIFIEDYVHSPMGLSKLFTAANLMKYWYPILEMPTNGKDWPSVTDM  213

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VAKN RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G   G CPNR ES PL   + SL
Sbjct  214   VAKNHRLLVFTSDASKEASEGIAYQWSYLLENESGDPGTVPGSCPNRKESQPLNARSASL  273

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             +L N+F S+P++  AC +NS  L  MV TCY AAGNR  N++AV+FY             
Sbjct  274   LLQNYFPSIPVQNEACKENSVGLPQMVQTCYAAAGNRIPNYIAVNFY-------------  320

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS+GGG F+  DR+NG  LCG + + +C  G+    C+
Sbjct  321   ---------------------MRSDGGGVFDVQDRINGLTLCGCNTISACQAGAPTSACK  359



>ref|XP_009343292.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
 ref|XP_009343293.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=413

 Score =   376 bits (966),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 236/362 (65%), Gaps = 39/362 (11%)
 Frame = -3

Query  1343  CQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             C  + E CS   DC AG+ C +C   G + P+C R   T     +   LPFN+Y++LTTH
Sbjct  25    CLQIGETCSKDSDCDAGLSCQTCAANGNTRPRCTRIQPTSPTSKVKG-LPFNRYSWLTTH  83

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++  G  S TG   VAP NQ D+V  QL NGVRGLMLD+YDF  DVWLCHS+GGKC++
Sbjct  84    NSYAQAGVRSATGSLIVAPMNQNDTVANQLKNGVRGLMLDMYDFNNDVWLCHSYGGKCYN  143

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + L++I+ FL +NPSEIVTI +EDYV +P GLTKVF  A L K+WFPV+ MP
Sbjct  144   FTAFQPAINVLRDIKTFLESNPSEIVTIFIEDYVESPSGLTKVFEAADLKKFWFPVAQMP  203

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V DMV  NQRL+VFTS K+KE SEGIAY+WNY+VENQYG+GGM  G CP+R 
Sbjct  204   KNGSDWPTVDDMVQNNQRLVVFTSKKAKEASEGIAYEWNYVVENQYGNGGMVPGSCPSRA  263

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P+  T+KSLVLVN+F  +P    +C+ NS PL+  + TCY AAG RW NF+AVD+Y 
Sbjct  264   ESSPMDTTSKSLVLVNYFRDLPNASASCMDNSAPLLSELKTCYEAAGKRWPNFIAVDYY-  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              Q+S+GGG  EAVD  +G L CG D + 
Sbjct  323   ---------------------------------QKSDGGGAPEAVDEASGHLTCGCDRIT  349

Query  275   SC  270
              C
Sbjct  350   YC  351



>ref|XP_002310130.2| hypothetical protein POPTR_0007s10840g [Populus trichocarpa]
 gb|EEE90580.2| hypothetical protein POPTR_0007s10840g [Populus trichocarpa]
Length=433

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 243/371 (65%), Gaps = 39/371 (11%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             + QVL    E ++CG G++C +CP LG + P C R  A      +N  LPFNKY +L TH
Sbjct  34    HAQVLQSCTEATNCGPGLYCGNCPALGKTQPICTRGQAIIPNSFIN-GLPFNKYTWLVTH  92

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF GD+WLCHSF G+C++
Sbjct  93    NSFSIVDAPPLPGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFEGDIWLCHSFRGQCYN  152

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TLKE+E+FLS NP+EIVTII+EDYV+ PKGL  +FT+AGL KYWFPVS MP
Sbjct  153   FTAFQPAINTLKEVESFLSENPNEIVTIIIEDYVHTPKGLINLFTNAGLDKYWFPVSKMP  212

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V++MV +N RL+VFTS+ SKE  EG+AYQW YM+EN+ GD G+K G CP+R 
Sbjct  213   KKGEDWPTVTEMVQENHRLVVFTSIASKEAEEGVAYQWKYMLENEAGDPGVKPGSCPSRK  272

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   + SL L+N+F + P+E  AC ++S PL  MVGTCY AAGN   NFLAV+FY 
Sbjct  273   ESKPLNSKSASLFLMNYFPTYPVETEACKEHSTPLAQMVGTCYKAAGNVMPNFLAVNFY-  331

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG F+A+DR+NG   CG   V 
Sbjct  332   ---------------------------------MRSDGGGVFDAMDRMNGQ-ACGCSTVT  357

Query  275   SCVGGSK*GGC  243
             +C  G+  G C
Sbjct  358   ACQAGAPFGSC  368



>ref|XP_002306474.2| hypothetical protein POPTR_0005s18250g [Populus trichocarpa]
 gb|EEE93470.2| hypothetical protein POPTR_0005s18250g [Populus trichocarpa]
Length=378

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 231/362 (64%), Gaps = 45/362 (12%)
 Frame = -3

Query  1334  LDEECSD---CGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNSLPFNKYAFLTTH  1176
             + E CS    C AG+ C SC   G +  +C +    + T + K     L FNKY++LTTH
Sbjct  23    IGETCSSNSTCDAGLSCQSCSANGNTRQRCTKIQPLSPTSKVK----GLAFNKYSWLTTH  78

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+F++T   S TG   +A KNQED+VT QL NGVRGLMLD+YDF  D+WLCHSF G C++
Sbjct  79    NSFALTNAQSDTGSALIATKNQEDTVTSQLKNGVRGLMLDMYDFMNDIWLCHSFNGNCYN  138

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA D LKEIE FL+ NPSEIVTI +EDYV +P+GLTKVF  +GL  YWFPVS MP
Sbjct  139   FTAFQPAIDVLKEIETFLAANPSEIVTIFIEDYVTSPQGLTKVFNASGLGIYWFPVSKMP  198

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V +MV +NQRL+VFTS  SKE +EGIAY W Y+VENQYGD GMK G CPNR 
Sbjct  199   KNGEDWPTVDEMVQQNQRLVVFTSKSSKEATEGIAYNWKYVVENQYGDDGMKAGSCPNRA  258

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P+   T SLVL N+F + P E   C+ NS PLI M  TCY AAG RW NF+ VDFY 
Sbjct  259   ESSPMNTKTISLVLQNYFPTNPNESGVCLDNSAPLISMTNTCYEAAGKRWPNFITVDFY-  317

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD  NG L CG D++ 
Sbjct  318   ---------------------------------QRSDGGGAPEAVDEANGHLTCGCDNIA  344

Query  275   SC  270
              C
Sbjct  345   YC  346



>ref|XP_008367979.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Malus domestica]
Length=412

 Score =   376 bits (965),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 231/362 (64%), Gaps = 39/362 (11%)
 Frame = -3

Query  1343  CQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             C  + E CS   DC AG  C +C   G + P+C R   T     +   LPFN+Y++LTTH
Sbjct  25    CLKIGETCSKDRDCDAGSSCQTCAANGNTRPRCTRIQPTSPTSXVK-GLPFNRYSWLTTH  83

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             NAFS  G  S TG   +AP NQ D+V  QL NGVRG MLD+YDF  D+WLCHS GGKC++
Sbjct  84    NAFSQAGVRSSTGSLIIAPMNQNDTVANQLKNGVRGFMLDMYDFNNDIWLCHSSGGKCYN  143

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TL+EI+AFL  NPSEIVTI +EDYV +P GLTKVF  AGL  +WFP++ MP
Sbjct  144   FTAFQPAINTLREIKAFLEANPSEIVTIFIEDYVESPSGLTKVFEGAGLKNFWFPIARMP  203

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V DMV  NQRL+VFTS ++KE SEGIAY+WNY+VENQYG GG+  G CPNR 
Sbjct  204   KNGEDWPTVDDMVQNNQRLVVFTSKRAKEASEGIAYEWNYVVENQYGSGGIIPGSCPNRA  263

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P+   ++SLVLVNFF  +P    +C+ NS PL+    TCY AAG RW NF+AVD+Y 
Sbjct  264   ESSPMNTKSRSLVLVNFFRDLPNASASCMDNSAPLLSASKTCYEAAGKRWPNFIAVDYY-  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              ++S+GGG  EAVD  NG L CG D + 
Sbjct  323   ---------------------------------EKSDGGGASEAVDEANGHLTCGCDRIT  349

Query  275   SC  270
              C
Sbjct  350   YC  351



>ref|XP_011043520.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Populus euphratica]
Length=433

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 242/371 (65%), Gaps = 39/371 (11%)
 Frame = -3

Query  1346  NCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             + QVL    E ++CG G++C +CP LG + P C R  A      +N  LPFNKY +L TH
Sbjct  34    HAQVLQSCTEATNCGPGLYCGNCPALGKTQPICTRGQAIIPNSFING-LPFNKYTWLVTH  92

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF GD+WLCHSF G+C++
Sbjct  93    NSFSIVDAPPLPGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFEGDIWLCHSFRGQCYN  152

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TLKE+EAFLS NP+EIVTII+EDYV+ PKGL  +F +AGL KYWFPVS MP
Sbjct  153   FTAFQPAINTLKEVEAFLSENPTEIVTIIIEDYVHTPKGLINLFINAGLDKYWFPVSKMP  212

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V++MV +N RL+VFTS+ SKE  EG+AYQW YM+EN+ GD G+K G CP+R 
Sbjct  213   KKGEDWPTVTEMVQENHRLVVFTSIASKEAEEGVAYQWKYMLENEAGDPGVKPGSCPSRK  272

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES PL   + SL L+N+F + P+E  AC ++S PL  MVGTCY AAGN   NFLAV+FY 
Sbjct  273   ESKPLNSKSASLFLMNYFPTYPVETEACKEHSTPLAQMVGTCYKAAGNVMPNFLAVNFY-  331

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                               RS+GGG F+A+DR+NG   CG   V 
Sbjct  332   ---------------------------------MRSDGGGVFDAMDRMNGQ-ACGCSTVT  357

Query  275   SCVGGSK*GGC  243
             +C  G+  G C
Sbjct  358   ACQAGAPFGSC  368



>ref|XP_004511913.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Cicer arietinum]
Length=431

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 192/380 (51%), Positives = 244/380 (64%), Gaps = 40/380 (11%)
 Frame = -3

Query  1367  TSACSGENCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFN  1200
             ++AC   NCQ+L + CS   DCG G++C  CP LG + P C R  AT    ++N  LPFN
Sbjct  34    STACFNGNCQIL-QPCSAATDCGPGLYCGHCPGLGRTQPVCTRGQATLVTSIVN-GLPFN  91

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY+++ THN+FSI    S  GV  +   NQED+VT QL NGVRGLMLD+YDF  D+WLCH
Sbjct  92    KYSWIMTHNSFSIMDAPSLNGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLCH  151

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C +FTAF+PA  TL+E+E+FL+ NP EIVTI++EDYV  P  L  +F +AGL KY
Sbjct  152   SFQGQCFNFTAFQPAIKTLEEVESFLTENPMEIVTIVIEDYVRTPNALINLFRNAGLDKY  211

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFP+S+MPK G DWP ++ MV +N+RLLVFTS  SKE  EGIAYQW YMVEN+ GD G++
Sbjct  212   WFPLSDMPKGGEDWPTITQMVQENRRLLVFTSDASKEAEEGIAYQWRYMVENESGDPGVQ  271

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
             RG CP+R ES PL   + SL L N+F + P+E  +C +NSGPL DMV TCY  AGN   N
Sbjct  272   RGSCPHRKESKPLNSRSASLFLQNYFPTYPVEADSCRENSGPLADMVNTCYKNAGNMLPN  331

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             F+AV+FY                                   RS GGG F+ VDR+NG  
Sbjct  332   FIAVNFY----------------------------------MRSNGGGVFDIVDRINGHT  357

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG   + +C  G+  G C+
Sbjct  358   LCGCSTITTCQEGAPFGSCK  377



>ref|XP_002277922.2| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Vitis 
vinifera]
 emb|CBI21414.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   376 bits (965),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/363 (54%), Positives = 230/363 (63%), Gaps = 48/363 (13%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPL-GFSGPKCVR---STATDQFKLLNNSLPFNKYAFLTTHNAFSITGW  1152
             S C AG+ C +C   G + P+C R     AT + K     L FNKYA+LTTHN+F+    
Sbjct  38    STCDAGLTCQTCSANGNTRPRCTRIQPVNATSKVK----GLAFNKYAWLTTHNSFA----  89

Query  1151  SSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAG  972
               RTG  +V P NQEDSVT QL NGVRGLMLD+YDF  D+WLCHSFGG C++FTAF+PA 
Sbjct  90    --RTGESSVGPANQEDSVTNQLQNGVRGLMLDMYDFNDDIWLCHSFGGTCYNFTAFQPAI  147

Query  971   DTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPL  792
             + LKEI+AFL  NPSEIVTI +EDYV + +GLTKVF  +GL KYWFPVS MP NG DWP 
Sbjct  148   NVLKEIQAFLEANPSEIVTIFIEDYVTSSQGLTKVFNASGLSKYWFPVSRMPNNGDDWPT  207

Query  791   VSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDT  612
             V DM  +NQRL+VFTS KSKE SEGIAY+W+Y+VENQYGD GM  G CPNR ES P+   
Sbjct  208   VDDMAQQNQRLVVFTSKKSKEASEGIAYEWSYVVENQYGDDGMIAGSCPNRAESSPMNTK  267

Query  611   TKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRI  432
             T+SL++ N+F   P    AC  NS PL  M+ TCY AAGNRW NF+AVDFY         
Sbjct  268   TRSLIIQNYFPDNPNSTEACADNSAPLTSMMKTCYEAAGNRWPNFIAVDFY---------  318

Query  431   YTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*  252
                                      QRS+GGG  EAVD  NG L CG   +  C   +  
Sbjct  319   -------------------------QRSDGGGAPEAVDEANGQLTCGCTSISYCKENATF  353

Query  251   GGC  243
             G C
Sbjct  354   GSC  356



>ref|XP_009345958.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=414

 Score =   376 bits (965),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 232/362 (64%), Gaps = 39/362 (11%)
 Frame = -3

Query  1343  CQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             C  + E CS   DC AG  C +C   G + P+C R   T     +   LPFN+Y++LTTH
Sbjct  25    CLKIGETCSKDSDCDAGSSCQTCAANGNTRPRCTRIQPTSPTSKVKG-LPFNRYSWLTTH  83

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             NAFS  G  S TG   +AP NQ D+V  QL NGVRG MLD+YDF  D+WLCHS GGKC++
Sbjct  84    NAFSQAGVRSSTGSLIIAPMNQNDTVANQLKNGVRGFMLDMYDFNNDIWLCHSSGGKCYN  143

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TL++I+AFL  NPSEIVTI +EDYV +P GLTKVF  AGL  +WFP++ MP
Sbjct  144   FTAFQPAINTLRDIKAFLEANPSEIVTIFIEDYVESPSGLTKVFEGAGLKNFWFPIARMP  203

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V DMV  NQRL+VFTS K+KE SEGIAY+WNY+VENQYG GG+  G CPNR 
Sbjct  204   KNGEDWPTVDDMVQNNQRLVVFTSKKAKEASEGIAYEWNYVVENQYGSGGIIPGSCPNRA  263

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P++  ++SLVLVNFF  +P    +C+ NS PL+    TCY AAG RW NF+AVD+Y 
Sbjct  264   ESSPMSTKSRSLVLVNFFRDLPNASASCMDNSAPLLSASKTCYEAAGKRWPNFIAVDYY-  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              ++S+GGG  EAVD  NG L CG D + 
Sbjct  323   ---------------------------------EKSDGGGASEAVDEANGHLTCGCDRIT  349

Query  275   SC  270
              C
Sbjct  350   YC  351



>ref|XP_009343170.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Pyrus x bretschneideri]
Length=414

 Score =   376 bits (965),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 232/362 (64%), Gaps = 39/362 (11%)
 Frame = -3

Query  1343  CQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             C  + E CS   DC AG  C +C   G + P+C R   T     +   LPFN+Y++LTTH
Sbjct  25    CLKIGETCSKDSDCDAGSSCQTCAANGNTRPRCTRIQPTSPTSKVK-GLPFNRYSWLTTH  83

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             NAFS  G  S TG   +AP NQ D+V  QL NGVRG MLD+YDF  D+WLCHS GGKC++
Sbjct  84    NAFSQAGVRSSTGSLIIAPMNQNDTVANQLKNGVRGFMLDMYDFNNDIWLCHSSGGKCYN  143

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA +TL++I+AFL  NPSEIVTI +EDYV +P GLTKVF  AGL  +WFP++ MP
Sbjct  144   FTAFQPAINTLRDIKAFLEANPSEIVTIFIEDYVESPSGLTKVFEGAGLKNFWFPIARMP  203

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V DMV  NQRL+VFTS K+KE SEGIAY+WNY+VENQYG GG+  G CPNR 
Sbjct  204   KNGEDWPTVDDMVQNNQRLVVFTSKKAKEASEGIAYEWNYVVENQYGSGGIIPGSCPNRA  263

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P++  ++SLVLVNFF  +P    +C+ NS PL+    TCY AAG RW NF+AVD+Y 
Sbjct  264   ESSPMSTKSRSLVLVNFFRDLPNASASCMDNSAPLLSASKTCYEAAGKRWPNFIAVDYY-  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              ++S+GGG  EAVD  NG L CG D + 
Sbjct  323   ---------------------------------EKSDGGGASEAVDEANGHLTCGCDRIT  349

Query  275   SC  270
              C
Sbjct  350   YC  351



>ref|XP_008661429.1| PREDICTED: uncharacterized protein LOC100193675 isoform X1 [Zea 
mays]
 gb|ACN26081.1| unknown [Zea mays]
Length=423

 Score =   376 bits (965),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 238/360 (66%), Gaps = 37/360 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             DCG G++C +CP  G +   C+R  A     ++   LPFN+Y++L THN+FSI G  SRT
Sbjct  41    DCGTGLYCGNCPAAGRTKLSCIRDLAIQPTSIVK-GLPFNRYSWLVTHNSFSILGEPSRT  99

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             GV  V   NQEDSVT QL NGVRGLMLD+YDF  DVWLCHS  G+C++FTAF PA DTLK
Sbjct  100   GVERVTFYNQEDSVTNQLRNGVRGLMLDMYDFNDDVWLCHSLQGQCYNFTAFVPAVDTLK  159

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E+EAFLS NP+EI+TI +EDYV++P GL+KVFT A LMKYW+P+S MP +G DWP V+DM
Sbjct  160   EVEAFLSENPTEIITIFIEDYVHSPMGLSKVFTAADLMKYWYPISEMPTSGKDWPSVTDM  219

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             VAKN+RLLVFTS  SKE SEGIAYQW+Y++EN+ GD G+  G CPNR ES PL     SL
Sbjct  220   VAKNRRLLVFTSDASKEASEGIAYQWSYLLENEPGDPGIVPGSCPNRKESQPLNSRPASL  279

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
              L N+F ++P++  AC +NSG L  M   CY AAGNR  NF+AV+FY             
Sbjct  280   FLQNYFPTIPVQNEACKENSG-LPQMAQACYAAAGNRIPNFIAVNFY-------------  325

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*GGCR  240
                                   RS+GGG F+  DR+NG  LCG D + +C  G+  G C+
Sbjct  326   ---------------------MRSDGGGVFDVQDRINGRTLCGCDTIAACQAGAPMGACK  364



>ref|XP_003524647.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 isoform 
X1 [Glycine max]
 gb|KHN12048.1| PI-PLC X domain-containing protein [Glycine soja]
Length=431

 Score =   376 bits (966),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 242/373 (65%), Gaps = 40/373 (11%)
 Frame = -3

Query  1346  NCQVLDEECS---DCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTT  1179
             N Q+L E CS   DCG G+ C +CP LG   P C R  AT    ++N  LPFNKY ++ T
Sbjct  37    NSQIL-EACSAATDCGPGLFCGNCPALGLKQPICTRGQATLPTSIVNG-LPFNKYTWIVT  94

Query  1178  HNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCH  999
             HN+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF+ D+WLCHSF G+C+
Sbjct  95    HNSFSIVDAPPLPGVQRMTFYNQEDTVTNQLRNGVRGLMLDMYDFQNDIWLCHSFRGQCY  154

Query  998   DFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNM  819
             +FTAF+PA +TLKE+EAFL+ NP+EIVTI++EDYV+ PKGLT VFT AGL KYWFPVS M
Sbjct  155   NFTAFQPAVNTLKEVEAFLTENPTEIVTIVIEDYVHTPKGLTNVFTSAGLDKYWFPVSKM  214

Query  818   PKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNR  639
             PK G DWP V++MV  N RL+VFTS  SKE  EGIAYQW +MVEN+ GD G+++G CP+R
Sbjct  215   PKKGEDWPTVTEMVQANHRLVVFTSDASKEAGEGIAYQWKHMVENESGDPGVQQGSCPHR  274

Query  638   GESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFY  459
              ES  L     SL L+N+F + P+E  +C ++S PL +MV TCY AAGN   NF+AV+FY
Sbjct  275   KESKALNSKRHSLFLMNYFPTYPVEVDSCKEHSAPLAEMVNTCYKAAGNLLPNFIAVNFY  334

Query  458   KVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDV  279
                                                RS+GGG F+ VD++NG  LCG   V
Sbjct  335   ----------------------------------MRSDGGGVFDIVDKMNGHTLCGCSTV  360

Query  278   HSCVGGSK*GGCR  240
              +C  G+  G C+
Sbjct  361   TACQAGAPFGSCK  373



>ref|XP_009107283.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X2 [Brassica rapa]
Length=358

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 240/371 (65%), Gaps = 40/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C + D    +C AG+HC +C    +  P+C R+   +    +   LPF
Sbjct  20    FEISSALQEGKTCILND----NCDAGLHCETCLANNNLRPRCSRTQPINPISKVK-GLPF  74

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYA+LTTHN+F+  G  S+TG   +AP NQ+DSVT QL NGVRG MLD+YDF  D+WLC
Sbjct  75    NKYAWLTTHNSFARLGQVSKTGSVILAPTNQQDSVTSQLANGVRGFMLDMYDFENDIWLC  134

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G C +FTAF+PA + L+EI+ FL  N  E+VTII+EDYV +PKGLTKVF  AGL K
Sbjct  135   HSFDGTCFNFTAFQPAVNVLREIQVFLENNKDEVVTIIIEDYVKSPKGLTKVFNAAGLQK  194

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             + FPV+ MPK GGDWP +  M+ +NQRLL FTS +SKE +EGIAYQW YMVENQYG+GG+
Sbjct  195   FMFPVTRMPKIGGDWPTLDHMIQQNQRLLFFTSDRSKEATEGIAYQWKYMVENQYGNGGL  254

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR +S P++D +KSLVLVN F   P   +AC QNS PL++ +  CY AAG RW 
Sbjct  255   KVGACPNRAQSAPMSDKSKSLVLVNHFPDAPDLVVACRQNSAPLLESIKACYRAAGQRWP  314

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG  +AVD  NG 
Sbjct  315   NFIAVDFYK----------------------------------RSDGGGAPQAVDVSNGN  340

Query  302   LLCGKDDVHSC  270
             L+CG D+  +C
Sbjct  341   LICGCDNFAAC  351



>ref|XP_008457757.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Cucumis 
melo]
Length=433

 Score =   376 bits (966),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 247/380 (65%), Gaps = 39/380 (10%)
 Frame = -3

Query  1370  VTSACSGENCQVLDE--ECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFN  1200
             ++ AC   NCQVL+     +DCG+G++C +CP  G + P C R  A     ++N  LPFN
Sbjct  29    ISFACFNGNCQVLEACTAATDCGSGLYCGNCPASGKNQPVCTRGQAIVPTSVING-LPFN  87

Query  1199  KYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCH  1020
             KY +L THN+FSI       GV  +   NQED+VT QL NGVRGLMLD+YDF+ D+WLCH
Sbjct  88    KYTWLVTHNSFSIVDAPQLDGVQRLTFYNQEDTVTNQLRNGVRGLMLDMYDFQNDIWLCH  147

Query  1019  SFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKY  840
             SF G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTII+EDYV+ PKGL  +FT+AGL KY
Sbjct  148   SFRGQCFNFTAFQPAINTLREVEAFLTENPTEIVTIIIEDYVHTPKGLITLFTNAGLDKY  207

Query  839   WFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMK  660
             WFPVS MPK G DWP V+DMV +N RLLVF+S+ SKE  EGIAYQW YM+EN+ GD G+ 
Sbjct  208   WFPVSKMPKKGEDWPTVTDMVQQNHRLLVFSSIASKEAEEGIAYQWKYMLENEPGDPGVV  267

Query  659   RGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWAN  480
              G CPNR ES PL   + SL L N+F + P+E  AC +++ PL +M+ TCY A+G    N
Sbjct  268   PGSCPNRRESKPLRSRSSSLFLQNYFPTYPVEAEACKEHANPLFNMISTCYKASG-ILPN  326

Query  479   FLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGL  300
             FLAV+FY                                   RSEGGG F+A+D++NG  
Sbjct  327   FLAVNFY----------------------------------MRSEGGGVFDALDKINGQT  352

Query  299   LCGKDDVHSCVGGSK*GGCR  240
             LCG   + +C  G+  G C+
Sbjct  353   LCGCSTLAACQAGAPPGTCK  372



>ref|XP_009107282.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
isoform X1 [Brassica rapa]
Length=367

 Score =   374 bits (960),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 240/371 (65%), Gaps = 40/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C + D    +C AG+HC +C    +  P+C R+   +    +   LPF
Sbjct  20    FEISSALQEGKTCILND----NCDAGLHCETCLANNNLRPRCSRTQPINPISKVK-GLPF  74

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKYA+LTTHN+F+  G  S+TG   +AP NQ+DSVT QL NGVRG MLD+YDF  D+WLC
Sbjct  75    NKYAWLTTHNSFARLGQVSKTGSVILAPTNQQDSVTSQLANGVRGFMLDMYDFENDIWLC  134

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G C +FTAF+PA + L+EI+ FL  N  E+VTII+EDYV +PKGLTKVF  AGL K
Sbjct  135   HSFDGTCFNFTAFQPAVNVLREIQVFLENNKDEVVTIIIEDYVKSPKGLTKVFNAAGLQK  194

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             + FPV+ MPK GGDWP +  M+ +NQRLL FTS +SKE +EGIAYQW YMVENQYG+GG+
Sbjct  195   FMFPVTRMPKIGGDWPTLDHMIQQNQRLLFFTSDRSKEATEGIAYQWKYMVENQYGNGGL  254

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR +S P++D +KSLVLVN F   P   +AC QNS PL++ +  CY AAG RW 
Sbjct  255   KVGACPNRAQSAPMSDKSKSLVLVNHFPDAPDLVVACRQNSAPLLESIKACYRAAGQRWP  314

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG  +AVD  NG 
Sbjct  315   NFIAVDFYK----------------------------------RSDGGGAPQAVDVSNGN  340

Query  302   LLCGKDDVHSC  270
             L+CG D+  +C
Sbjct  341   LICGCDNFAAC  351



>ref|XP_009138476.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Brassica 
rapa]
Length=414

 Score =   375 bits (964),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 234/371 (63%), Gaps = 40/371 (11%)
 Frame = -3

Query  1352  GENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             GE C       S C AG+ C SCP  G +G  C R    +    +N  LPFNKY++LTTH
Sbjct  32    GETC----SSSSRCDAGLSCQSCPTNGNTGSTCSRIRPLNPTSKVNG-LPFNKYSWLTTH  86

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N++SIT   S  G   ++P+NQEDS+T QL NGVRG+MLDVYDFR D+WLCHS GG C +
Sbjct  87    NSYSITSAKSTIGSFIISPRNQEDSITNQLKNGVRGIMLDVYDFRNDIWLCHSAGGTCFN  146

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + LKEI  FL +N SEIVTIILEDYV + +GLTKVF  +GL K+ FPVS MP
Sbjct  147   FTAFQPAVNALKEINDFLESNLSEIVTIILEDYVTSSRGLTKVFKASGLSKFLFPVSRMP  206

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K+G DWP V DMV +NQRL+VFTS K KE SEG AYQW+YMVENQYG+ GM  G C NR 
Sbjct  207   KDGKDWPTVDDMVKQNQRLVVFTSKKGKEASEGFAYQWDYMVENQYGNDGMNDGSCTNRN  266

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ESPPL   ++SLVL N+F + P    AC  NS PLI M+ TC+ AAG RW NF+AVDFY 
Sbjct  267   ESPPLDTKSRSLVLQNYFITNPNATQACADNSSPLIKMMTTCHEAAGKRWPNFIAVDFY-  325

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD  NG L CG D + 
Sbjct  326   ---------------------------------QRSDGGGAAEAVDAANGRLTCGCDSLS  352

Query  275   SCVGGSK*GGC  243
              C   +  G C
Sbjct  353   LCKTNAAFGTC  363



>ref|XP_002891530.1| phospholipase C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67789.1| phospholipase C [Arabidopsis lyrata subsp. lyrata]
Length=359

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 232/358 (65%), Gaps = 36/358 (10%)
 Frame = -3

Query  1319  SDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSR  1143
             S+C  G+HC +C       P+C R+   +        LPFNKY++LTTHN+F+  G  SR
Sbjct  37    SNCDVGLHCETCIANTDFRPRCSRTQPINPISKAK-GLPFNKYSWLTTHNSFARLGEVSR  95

Query  1142  TGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTL  963
             TG   +AP NQ+DS+T QLNNGVRG MLD+YDF  D+WLCHSF G C +FTAF+PA + L
Sbjct  96    TGSVILAPTNQQDSITSQLNNGVRGFMLDMYDFENDIWLCHSFDGTCFNFTAFQPAINIL  155

Query  962   KEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSD  783
             +E + FL  N  E+VTII+EDYV +PKGLTKVF  AGL K+ FPV+ MPKNGGDWP + D
Sbjct  156   REFQVFLEKNTEEVVTIIIEDYVKSPKGLTKVFDAAGLRKFMFPVARMPKNGGDWPRLDD  215

Query  782   MVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKS  603
             MV +NQRLLVFTS   KE +EGIAYQW YMVENQYG+GG+K G CPNR +S P++D +KS
Sbjct  216   MVRQNQRLLVFTSDSHKEATEGIAYQWKYMVENQYGNGGLKVGVCPNRAQSAPMSDKSKS  275

Query  602   LVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTI  423
             LVLVN F       +AC QNS  L++ + TCY AAG RW NF+AVDFYK           
Sbjct  276   LVLVNHFPDAADLIVACKQNSASLLESIKTCYQAAGQRWPNFIAVDFYK-----------  324

Query  422   HD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*G  249
                                    RS+GGG  +AVD  NG L+CG D+  +C G  K G
Sbjct  325   -----------------------RSDGGGAPQAVDVANGNLICGCDNFAACKGDGKCG  359



>ref|XP_006339877.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Solanum tuberosum]
Length=437

 Score =   376 bits (966),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 248/381 (65%), Gaps = 38/381 (10%)
 Frame = -3

Query  1373  VVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSLPF  1203
             + ++ACS  NCQ+LD     +DCG  ++C +CP LG   P C+R  A +   +++  LPF
Sbjct  41    ICSTACSNGNCQLLDSCASATDCGPSLYCGNCPELGKDQPFCIRGQAIESTSIISG-LPF  99

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY++L THNAFS+      TG   +   NQED+VT QL NGVRGLMLD+YDF  D+WLC
Sbjct  100   NKYSWLVTHNAFSMVNAPLLTGPQRITFYNQEDTVTNQLRNGVRGLMLDMYDFENDIWLC  159

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G+C++FTAF+PA +TLKE+EAFLS NP+EIVTII+EDYV++PKGLT+VF DAGL K
Sbjct  160   HSFRGQCYNFTAFQPAINTLKEVEAFLSANPTEIVTIIIEDYVHSPKGLTRVFADAGLGK  219

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             YWFPVS MP+ G DWP V+DMV KN RLLVFTS  SKE +EGIAYQW YMVEN+ GD G+
Sbjct  220   YWFPVSKMPRKGDDWPTVNDMVKKNYRLLVFTSDSSKEAAEGIAYQWRYMVENEPGDPGV  279

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
               G C +R ES  L   + SL L+N+F +V ++  AC ++S   +D VG CY AAGN   
Sbjct  280   VPGSCSSRKESKALNSRSASLFLMNYFPTVAVQDGACKEHSTQFVDTVGACYKAAGNMMP  339

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             N++AV+FY                                   RS+GGG F+ +D++NG 
Sbjct  340   NYVAVNFY----------------------------------MRSDGGGVFDVLDQMNGR  365

Query  302   LLCGKDDVHSCVGGSK*GGCR  240
              LCG   V +C  G   G C+
Sbjct  366   TLCGCPTVTACQAGVHFGVCK  386



>ref|XP_009367216.1| PREDICTED: PI-PLC X domain-containing protein At5g67130 [Pyrus 
x bretschneideri]
Length=413

 Score =   375 bits (964),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 236/362 (65%), Gaps = 39/362 (11%)
 Frame = -3

Query  1343  CQVLDEECS---DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             C  + E CS   DC AG+ C +C   G + P+C R   T     +   LPFN+Y++LTTH
Sbjct  25    CLQIGETCSKDSDCDAGLSCQTCAANGNTRPRCTRIQPTGPTSKVKG-LPFNRYSWLTTH  83

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+++  G  S TG   VAP NQ D+V  QL NGVRGLMLD+YDF  DVWLCHS+GGKC++
Sbjct  84    NSYAQAGVRSATGSLIVAPMNQNDTVANQLKNGVRGLMLDMYDFNNDVWLCHSYGGKCYN  143

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
             FTAF+PA + L++I+ FL +NPSEIVTI +EDYV +P GLTKVF  A L K+WFPV+ MP
Sbjct  144   FTAFQPAINVLRDIKTFLESNPSEIVTIFIEDYVESPSGLTKVFEAADLKKFWFPVAQMP  203

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             KNG DWP V DMV  NQRL+VFTS K+KE SEGIAY+WNY+VENQYG+GGM  G CP+R 
Sbjct  204   KNGSDWPTVDDMVQNNQRLVVFTSKKAKEASEGIAYEWNYVVENQYGNGGMVPGSCPSRA  263

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES P+  T+KSLVLVN+F  +P    +C+ NS PL+  + TCY AAG RW NF+AVD+Y 
Sbjct  264   ESSPMDTTSKSLVLVNYFRDLPNASASCMDNSAPLLSELKTCYEAAGKRWPNFIAVDYY-  322

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              Q+S+GGG  EAVD  +G L CG D + 
Sbjct  323   ---------------------------------QKSDGGGAPEAVDEASGHLTCGCDRIT  349

Query  275   SC  270
              C
Sbjct  350   YC  351



>ref|XP_007047288.1| PLC-like phosphodiesterases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOX91445.1| PLC-like phosphodiesterases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=351

 Score =   373 bits (958),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 239/365 (65%), Gaps = 42/365 (12%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPL-GFSGPKCVRS---TATDQFKLLNNS  1212
             F++ +S   GE C       S C +G+ C +C + G + P+C R    + T + K     
Sbjct  25    FSMSSSLKIGETCSSSSSSNSACDSGLSCQTCSVNGNTRPRCTRIQPLSPTSKVK----G  80

Query  1211  LPFNKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             LPFNKY++LTTHN+F++ G     G   +AP NQEDS+T QL NGVRGLMLD+YDF GD+
Sbjct  81    LPFNKYSWLTTHNSFALKGAIPAIGPAIIAPANQEDSITNQLKNGVRGLMLDMYDFNGDI  140

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSFGG+C++ TAF+PA + LKEI+AFL  NPSEI+TI +EDYV +P+GLTKVF  AG
Sbjct  141   WLCHSFGGQCYNVTAFQPAINVLKEIQAFLEANPSEIITIFIEDYVASPQGLTKVFNAAG  200

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPV+ MPKNG DWP V DMV +N+RL+VFTS  +KE SEGIAY+W Y+VEN+YG+
Sbjct  201   LKKYWFPVAKMPKNGEDWPTVDDMVKQNERLVVFTSKSAKEASEGIAYEWRYVVENEYGN  260

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              GMK G CPNR ES P+   T+SLVL N+F + P +  AC +NS PL+ M+ TC+ AAGN
Sbjct  261   DGMKAGSCPNRAESSPMNTKTRSLVLENYFPTNPNQTTACSENSAPLVSMLNTCHKAAGN  320

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
             RW NF+AVDFY                                  QRS+GGG  EA+  +
Sbjct  321   RWPNFIAVDFY----------------------------------QRSDGGGAPEAISGV  346

Query  311   NGGLL  297
               GL 
Sbjct  347   TWGLF  351



>emb|CDY51044.1| BnaA06g03070D [Brassica napus]
Length=358

 Score =   373 bits (958),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 243/371 (65%), Gaps = 40/371 (11%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDEECSDCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPF  1203
             F + ++   G+ C +L++   +C AG+HC +C    +  P+C R    +    +   LPF
Sbjct  20    FEISSALKEGKTC-ILNK---NCDAGLHCETCLASNNLRPRCSRIQPINPISKVK-GLPF  74

Query  1202  NKYAFLTTHNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLC  1023
             NKY++LTTHN+F+  G  S+TG   +AP NQ+DSVT QL NGVRG MLD+YDF  DVWLC
Sbjct  75    NKYSWLTTHNSFARLGEVSKTGSVILAPTNQQDSVTTQLANGVRGFMLDMYDFENDVWLC  134

Query  1022  HSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMK  843
             HSF G C +FTAF+PA + L+EI+ FL  N  E+VT+I+EDYV +PKGLT+VF  AGL K
Sbjct  135   HSFDGTCFNFTAFQPAVNVLREIQVFLENNKDEVVTVIIEDYVKSPKGLTRVFDTAGLRK  194

Query  842   YWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGM  663
             + FPV+ MPKNGGDWP + DM+ +NQRLLVFTS +SKE +EGIAYQW YMVENQYG+GG+
Sbjct  195   FMFPVTRMPKNGGDWPKLDDMIPQNQRLLVFTSDRSKEATEGIAYQWKYMVENQYGNGGL  254

Query  662   KRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWA  483
             K G CPNR +S P++D +KSLVL N F   P   +AC QNS PL++ +  CY AAG RW 
Sbjct  255   KAGVCPNRAQSAPMSDKSKSLVLANHFPDAPDFVVACKQNSAPLLESIKACYQAAGQRWP  314

Query  482   NFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGG  303
             NF+AVDFYK                                  RS+GGG  +AVD  NG 
Sbjct  315   NFIAVDFYK----------------------------------RSDGGGAPQAVDVANGN  340

Query  302   LLCGKDDVHSC  270
             L+CG D+  +C
Sbjct  341   LICGCDNFTAC  351



>ref|XP_003538811.2| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Glycine max]
Length=428

 Score =   375 bits (964),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 251/384 (65%), Gaps = 39/384 (10%)
 Frame = -3

Query  1379  FNVVTSACSGENCQVLDE--ECSDCGAGMHCLSCP-LGFSGPKCVRSTATDQFKLLNNSL  1209
             F   ++AC   NCQVL+     +DCG G++C +CP LG + P C R  AT    L+N  L
Sbjct  30    FLTSSAACFNGNCQVLEACTAATDCGPGLYCGNCPALGRTRPVCTRGQATIVTSLVN-GL  88

Query  1208  PFNKYAFLTTHNAFSITGWSSRTG-VPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDV  1032
             PFNKY+++ THN+FSI       G V  +   NQED+VT QL NG RGLMLD+YDF  D+
Sbjct  89    PFNKYSWIMTHNSFSIVDAPPLPGGVQRLTFYNQEDTVTNQLRNGARGLMLDMYDFENDI  148

Query  1031  WLCHSFGGKCHDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAG  852
             WLCHSF G+C +FTAF+PA +TL+E+EAFL+ NP+EIVTI++EDYV+ PKGLT +F +AG
Sbjct  149   WLCHSFRGQCFNFTAFQPAINTLREVEAFLTQNPTEIVTIVIEDYVHTPKGLTNLFRNAG  208

Query  851   LMKYWFPVSNMPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGD  672
             L KYWFPVS+MPK G DWP V++MV  N RLLVFTS  SKE  EGIAYQW+YMVEN+ GD
Sbjct  209   LDKYWFPVSDMPKKGEDWPTVTEMVQVNHRLLVFTSDASKEAEEGIAYQWSYMVENESGD  268

Query  671   GGMKRGDCPNRGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGN  492
              G++ G CP+R ES PL   + SL L N+F + P+E  +C ++S PL+DMV TCY AAGN
Sbjct  269   PGVEGGSCPHRKESKPLNSRSASLFLQNYFPTDPVEADSCKEHSVPLVDMVNTCYKAAGN  328

Query  491   RWANFLAVDFYKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRL  312
                NFLAV+FY                                   RS+GGG F+ VD++
Sbjct  329   VLPNFLAVNFY----------------------------------MRSDGGGVFDIVDKM  354

Query  311   NGGLLCGKDDVHSCVGGSK*GGCR  240
             NG  LCG + + +C  G+  G C+
Sbjct  355   NGHSLCGCNTISACQEGAPFGSCK  378



>ref|XP_004230771.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Solanum lycopersicum]
Length=409

 Score =   375 bits (963),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 237/373 (64%), Gaps = 41/373 (11%)
 Frame = -3

Query  1343  CQVLDEECS-----DCGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLT  1182
             C+ L E  S      C AG+HC +C   G   P+C R    +    +   LPFN+Y++LT
Sbjct  27    CEALKEGQSCVANGSCDAGLHCETCLANGNVRPRCTRLQPVNPLSKVK-GLPFNRYSWLT  85

Query  1181  THNAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKC  1002
             THN+F+     S TG   +AP NQ+D++T+QLNNGVRGLMLD+YDF  D+WLCHSFG KC
Sbjct  86    THNSFAKLKAKSGTGGVILAPMNQQDTITEQLNNGVRGLMLDMYDFDNDIWLCHSFGAKC  145

Query  1001  HDFTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSN  822
             +++TAF+ A + L+EI  FL  NPSEIVTII+EDYV +P GL KVF  AGL K+WFPVS 
Sbjct  146   YNYTAFQTAINVLREIGVFLEANPSEIVTIIIEDYVTSPNGLNKVFDAAGLRKFWFPVSR  205

Query  821   MPKNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPN  642
             MPKNGG+WP V DM+  NQRL+VFTS  +KE SEGIAY+W Y+VENQYG+GGMK G CPN
Sbjct  206   MPKNGGEWPTVDDMIQHNQRLVVFTSKSAKESSEGIAYEWRYLVENQYGNGGMKPGSCPN  265

Query  641   RGESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDF  462
             R ES  +   +KSLVL+N+F   P    AC  NS PLIDM+ TC+ AAG RW NF+AVDF
Sbjct  266   RAESSAMNTKSKSLVLMNYFTDAPDFAQACKHNSAPLIDMMNTCHEAAGKRWPNFIAVDF  325

Query  461   YKVVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDD  282
             Y+                                  RS+GGG  EAVD  NG L+CG  +
Sbjct  326   YR----------------------------------RSDGGGAPEAVDLANGHLVCGCAN  351

Query  281   VHSCVGGSK*GGC  243
             + SC      G C
Sbjct  352   IVSCKENMTFGAC  364



>ref|XP_006305174.1| hypothetical protein CARUB_v10009541mg [Capsella rubella]
 gb|EOA38072.1| hypothetical protein CARUB_v10009541mg [Capsella rubella]
Length=359

 Score =   373 bits (957),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 233/357 (65%), Gaps = 36/357 (10%)
 Frame = -3

Query  1316  DCGAGMHCLSCPLGFS-GPKCVRSTATDQFKLLNNSLPFNKYAFLTTHNAFSITGWSSRT  1140
             +C AG+HC +C    S  P+C R+   +        LPFNKY++LTTHN+F+  G  SRT
Sbjct  37    NCDAGLHCETCIANSSFRPRCSRTQPINPISKAK-GLPFNKYSWLTTHNSFARLGEVSRT  95

Query  1139  GVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHDFTAFEPAGDTLK  960
             G   +AP NQ+DS+T QLNNGVRG MLD+YDF  DVWLCHSF G C +FTAF+PA + L+
Sbjct  96    GSVILAPTNQQDSITSQLNNGVRGFMLDMYDFLNDVWLCHSFDGMCFNFTAFQPAINILR  155

Query  959   EIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMPKNGGDWPLVSDM  780
             E + FL  N  E+VTII+EDYV +P+GLTKVF  AGL K+ FPV+ MPKNGGDWP + DM
Sbjct  156   EFQVFLEKNTEEVVTIIIEDYVKSPQGLTKVFDAAGLRKFMFPVARMPKNGGDWPRLDDM  215

Query  779   VAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRGESPPLTDTTKSL  600
             V +NQR+LVFTS   KE +EGIAYQWNYMVENQYG+GG+K G CPNR +S P++D +KSL
Sbjct  216   VRQNQRMLVFTSDLRKEATEGIAYQWNYMVENQYGNGGLKAGACPNRPQSKPMSDKSKSL  275

Query  599   VLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYKVVKSLVRIYTIH  420
             VLVN F       +AC QNS  L++ + TCY AAG RW NF+AVDFYK            
Sbjct  276   VLVNHFPDAADVIVACRQNSASLLESIKTCYQAAGQRWPNFIAVDFYK------------  323

Query  419   D*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVHSCVGGSK*G  249
                                   RS+GGG  +AVD  NG L+CG D+  SC    K G
Sbjct  324   ----------------------RSDGGGAPQAVDIANGNLMCGCDNFASCKADGKCG  358



>ref|XP_004231851.1| PREDICTED: PI-PLC X domain-containing protein At5g67130-like 
[Solanum lycopersicum]
Length=412

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 237/362 (65%), Gaps = 38/362 (10%)
 Frame = -3

Query  1346  NCQVLDEECSD--CGAGMHCLSCPL-GFSGPKCVRSTATDQFKLLNNSLPFNKYAFLTTH  1176
             +C  + E C+D  C  G+ C +CP  G + P+C R   T     +   LPFNKY++LTTH
Sbjct  27    SCLKIGETCTDSNCDEGLVCSTCPANGNTRPRCTRIQPTIPTTKVK-GLPFNKYSWLTTH  85

Query  1175  NAFSITGWSSRTGVPNVAPKNQEDSVTQQLNNGVRGLMLDVYDFRGDVWLCHSFGGKCHD  996
             N+F+I+G +S TG   +AP NQEDS+T QL NGVRGLMLD+YDF  D+WLCHSFGGKC++
Sbjct  86    NSFAISGSTSATGSDILAPTNQEDSITNQLKNGVRGLMLDMYDFNNDIWLCHSFGGKCYN  145

Query  995   FTAFEPAGDTLKEIEAFLSTNPSEIVTIILEDYVNAPKGLTKVFTDAGLMKYWFPVSNMP  816
              T+F+PA ++LKEI+ FL  NPSE+VTI +EDYV+ PK L+KVF D+GL KYWFP+S MP
Sbjct  146   VTSFQPAINSLKEIQGFLEKNPSEVVTIFIEDYVSTPKALSKVFNDSGLNKYWFPISRMP  205

Query  815   KNGGDWPLVSDMVAKNQRLLVFTSVKSKEESEGIAYQWNYMVENQYGDGGMKRGDCPNRG  636
             K G DWP V DMV +NQRL+VFTS  SKE S+GIAY+W Y+VENQYG+ GMK G CP+R 
Sbjct  206   KKGEDWPTVDDMVKQNQRLVVFTSKSSKEASDGIAYEWRYVVENQYGNDGMKEGSCPSRS  265

Query  635   ESPPLTDTTKSLVLVNFFGSVPLEPMACVQNSGPLIDMVGTCYLAAGNRWANFLAVDFYK  456
             ES  L+ +  SLVL N+F   P +  +C+ NS PLI M  TC+ AAG RW NF+AVDFY 
Sbjct  266   ESSALSTSGISLVLQNYFPDNPNKTESCLDNSAPLITMTKTCFEAAGKRWPNFIAVDFY-  324

Query  455   VVKSLVRIYTIHD*TERLFGSLLKGS**QVMLLQRSEGGGTFEAVDRLNGGLLCGKDDVH  276
                                              QRS+GGG  EAVD+ NG L C    + 
Sbjct  325   ---------------------------------QRSDGGGAPEAVDQANGQLTCNCSSIA  351

Query  275   SC  270
              C
Sbjct  352   YC  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4225902233412