BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22596_g3_i2 len=1081 path=[2548:0-269 2818:270-330 2879:331-352
2901:353-394 8572:395-401 2950:402-535 3084:536-634 6785:635-808
4947:809-832 4971:833-878 5017:879-910 8336:911-930 5073:931-954
5097:955-1080]

Length=1081
                                                                      Score     E

ref|XP_009588439.1|  PREDICTED: protein RALF-like 27                  52.8    4e-05   



>ref|XP_009588439.1| PREDICTED: protein RALF-like 27 [Nicotiana tomentosiformis]
Length=117

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = -1

Query  460  ECRGVTVGDCMETGGEEFLLDSETAGRLHSVGKRGSISYGAEQRGPICNAQRGYGSCLGE  281
            EC G+++GDC+   G+EFL++SET+  L + GK G+++Y + Q+  ICNA +  G+C+G 
Sbjct  42   ECNGISIGDCV-VDGDEFLVESETSTLLLANGK-GTLTYRSLQKPAICNA-KIIGNCIGA  98

Query  280  QKN  272
            Q N
Sbjct  99   QLN  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2533093496640