BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22579_g2_i1 len=1066 path=[1450:0-66 1517:67-1065]

Length=1066
                                                                      Score     E

emb|CDP18035.1|  unnamed protein product                                452   5e-153   
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          451   2e-152   
gb|AFK79031.1|  cytochrome P450 CYP736A54                               442   6e-149   
emb|CDP12931.1|  unnamed protein product                                451   1e-146   
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          434   5e-146   
emb|CDP12853.1|  unnamed protein product                                431   8e-146   
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    432   4e-145   
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          431   8e-145   
ref|XP_009600860.1|  PREDICTED: cytochrome P450 CYP736A12-like          428   8e-144   
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          425   2e-142   
ref|XP_009586899.1|  PREDICTED: cytochrome P450 CYP736A12-like          425   2e-142   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          425   3e-142   
ref|XP_010099912.1|  Cytochrome P450 71A1                               422   2e-141   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          422   3e-141   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             421   6e-141   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               421   7e-141   Vitis vinifera
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             421   8e-141   
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          421   8e-141   
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          421   8e-141   
emb|CBI21487.3|  unnamed protein product                                424   1e-140   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          420   2e-140   
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         419   4e-140   
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         419   5e-140   
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          419   7e-140   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          418   1e-139   
gb|AJD25256.1|  cytochrome P450 CYP736A121                              418   2e-139   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          417   3e-139   
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               417   4e-139   
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          416   1e-138   
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                415   2e-138   
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          415   2e-138   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               415   3e-138   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               414   5e-138   Vitis vinifera
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          414   5e-138   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 414   6e-138   
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          413   9e-138   
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               413   1e-137   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   412   1e-137   Vitis arizonica x Vitis rupestris
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   412   2e-137   Vitis arizonica x Vitis rupestris
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             412   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             412   2e-137   
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          412   3e-137   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          412   3e-137   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             411   5e-137   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             410   2e-136   
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          410   2e-136   
ref|XP_009629564.1|  PREDICTED: cytochrome P450 CYP736A12-like          407   2e-136   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          410   2e-136   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         409   5e-136   
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              409   6e-136   
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                409   7e-136   
ref|XP_006354701.1|  PREDICTED: cytochrome P450 84A1-like               408   8e-136   
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          407   2e-135   
ref|XP_009631554.1|  PREDICTED: cytochrome P450 CYP736A12-like          407   3e-135   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          407   3e-135   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    406   3e-135   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          406   4e-135   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    405   9e-135   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              405   9e-135   
ref|XP_002310015.1|  cytochrome P450 family protein                     405   1e-134   Populus trichocarpa [western balsam poplar]
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          405   1e-134   
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               405   2e-134   
ref|XP_011090597.1|  PREDICTED: cytochrome P450 CYP736A12-like          404   3e-134   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             404   5e-134   Populus trichocarpa [western balsam poplar]
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          404   6e-134   
emb|CDP12933.1|  unnamed protein product                                403   7e-134   
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               403   8e-134   
ref|XP_003596030.1|  Cytochrome P450                                    402   9e-134   
gb|AJD25258.1|  cytochrome P450 CYP736A123                              402   1e-133   
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    402   2e-133   
ref|XP_006354705.1|  PREDICTED: cytochrome P450 750A1-like              402   3e-133   
ref|XP_004143571.1|  PREDICTED: cytochrome P450 71A1-like               398   4e-133   
ref|XP_004143567.1|  PREDICTED: cytochrome P450 71A1-like               396   5e-133   
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          400   7e-133   
ref|XP_002310014.1|  cytochrome P450 family protein                     400   8e-133   Populus trichocarpa [western balsam poplar]
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             400   8e-133   Populus trichocarpa [western balsam poplar]
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             400   1e-132   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               400   1e-132   
ref|XP_006346619.1|  PREDICTED: cytochrome P450 71A1-like               400   1e-132   
emb|CDP01387.1|  unnamed protein product                                400   1e-132   
ref|XP_006354707.1|  PREDICTED: cytochrome P450 71A1-like               395   2e-132   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  400   2e-132   Ricinus communis
ref|XP_006365795.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    400   2e-132   
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             399   2e-132   
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               399   3e-132   
gb|KEH15707.1|  cytochrome P450 family 71 protein                       396   5e-132   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             398   6e-132   Populus trichocarpa [western balsam poplar]
gb|KHN38214.1|  Cytochrome P450 71A1                                    394   3e-131   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          397   3e-131   
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                395   7e-131   
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               397   7e-131   
ref|XP_002310007.2|  cytochrome P450 family protein                     395   8e-131   Populus trichocarpa [western balsam poplar]
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          395   9e-131   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    395   1e-130   
gb|EYU24037.1|  hypothetical protein MIMGU_mgv1a005167mg                394   3e-130   
ref|XP_009588170.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   3e-130   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              394   3e-130   
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   4e-130   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   4e-130   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   4e-130   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          393   6e-130   
ref|XP_011090604.1|  PREDICTED: cytochrome P450 CYP736A12-like          393   8e-130   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          392   2e-129   
ref|XP_006366158.1|  PREDICTED: cytochrome P450 750A1-like              391   3e-129   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             391   3e-129   
gb|EYU24036.1|  hypothetical protein MIMGU_mgv1a005182mg                391   4e-129   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               390   5e-129   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             391   5e-129   
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          390   7e-129   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             390   1e-128   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             389   3e-128   
ref|XP_004252295.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   3e-128   
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    389   4e-128   
ref|XP_011090598.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   4e-128   
ref|XP_007048087.1|  Cytochrome P450                                    389   6e-128   
gb|KHN29102.1|  Cytochrome P450 71A1                                    388   7e-128   
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          387   2e-127   
ref|XP_002310009.2|  hypothetical protein POPTR_0007s06300g             382   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               386   3e-127   
emb|CBI21489.3|  unnamed protein product                                389   3e-127   
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               385   8e-127   
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          385   1e-126   
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          382   1e-125   
ref|XP_008344234.1|  PREDICTED: cytochrome P450 CYP736A12-like          382   2e-125   
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                382   3e-125   
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                381   4e-125   
ref|XP_004252382.1|  PREDICTED: cytochrome P450 CYP736A12               380   6e-125   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   1e-124   
ref|XP_003630098.1|  Cytochrome P450                                    378   2e-124   
gb|EYU31073.1|  hypothetical protein MIMGU_mgv1a004944mg                379   3e-124   
gb|AJD25257.1|  cytochrome P450 CYP736A122                              379   4e-124   
emb|CDP01384.1|  unnamed protein product                                377   1e-123   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             377   1e-123   
ref|XP_010319819.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   3e-123   
ref|XP_004172515.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    375   5e-123   
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                375   1e-122   
ref|XP_004143572.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    375   1e-122   
ref|XP_009372715.1|  PREDICTED: cytochrome P450 CYP736A12-like          374   2e-122   
ref|XP_004153472.1|  PREDICTED: cytochrome P450 71B13-like              374   2e-122   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             373   5e-122   
ref|XP_009372727.1|  PREDICTED: cytochrome P450 CYP736A12-like          371   2e-121   
ref|XP_009372726.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   4e-121   
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             365   4e-119   
ref|XP_009372725.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   1e-118   
ref|XP_004143566.1|  PREDICTED: cytochrome P450 750A1-like              363   3e-118   
ref|XP_004162326.1|  PREDICTED: cytochrome P450 750A1-like              363   3e-118   
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   5e-118   
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   2e-117   
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   2e-117   
gb|KEH15895.1|  cytochrome P450 family 71 protein                       353   1e-116   
ref|XP_004153471.1|  PREDICTED: cytochrome P450 71A1-like               357   9e-116   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              356   2e-115   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               355   3e-115   
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              355   4e-115   
ref|XP_006365796.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    354   6e-115   
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   1e-114   
ref|XP_004169555.1|  PREDICTED: cytochrome P450 71A1-like               351   2e-114   
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   2e-114   
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   3e-114   
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          352   6e-114   
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         352   9e-114   
ref|XP_008346791.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    347   2e-113   
gb|AAL66194.1|AF386512_1  cytochrome P450                               351   2e-113   Pyrus communis
ref|XP_008346790.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    347   2e-113   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          351   2e-113   
emb|CBI15435.3|  unnamed protein product                                348   3e-113   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          350   5e-113   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          350   8e-113   
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                349   1e-112   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               349   2e-112   Vitis vinifera
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          347   2e-111   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          346   2e-111   
ref|XP_003630097.1|  Cytochrome P450                                    343   4e-111   
gb|KGN49699.1|  hypothetical protein Csa_5G076690                       338   4e-111   
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          343   2e-110   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               343   3e-110   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             343   4e-110   
gb|KHN20714.1|  Cytochrome P450 71D10                                   341   2e-109   
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          340   2e-109   Vitis vinifera
ref|XP_003627829.1|  Cytochrome P450                                    343   5e-109   
ref|XP_004162328.1|  PREDICTED: flavonoid 3'-monooxygenase-like         339   8e-109   
dbj|BAD15331.1|  cytochrome P450                                        338   2e-108   Panax ginseng [Chinese ginseng]
ref|XP_004143569.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    338   3e-108   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 71A1-like               337   4e-108   
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12        337   4e-108   
ref|XP_008449122.1|  PREDICTED: cytochrome P450 CYP736A12-like          335   4e-108   
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          336   2e-107   
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          335   1e-106   
gb|KHF97324.1|  Cytochrome P450                                         332   9e-106   
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              343   2e-105   
ref|XP_007152786.1|  hypothetical protein PHAVU_004G159500g             329   6e-105   
gb|KHG07950.1|  Cytochrome P450                                         329   9e-105   
ref|XP_008385728.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   1e-104   
gb|KCW83844.1|  hypothetical protein EUGRSUZ_B00712                     326   2e-104   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          327   5e-104   
ref|XP_010094782.1|  Cytochrome P450 71A1                               326   1e-103   
ref|XP_010045641.1|  PREDICTED: cytochrome P450 CYP736A12-like          326   1e-103   
ref|XP_003615678.1|  Cytochrome P450                                    326   2e-103   
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          326   2e-103   
ref|XP_007152783.1|  hypothetical protein PHAVU_004G159300g             325   2e-103   
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  325   2e-103   Ricinus communis
ref|XP_010045642.1|  PREDICTED: cytochrome P450 CYP736A12-like          325   4e-103   
gb|KCW79058.1|  hypothetical protein EUGRSUZ_C00484                     323   1e-102   
ref|XP_010663583.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X2    322   2e-102   
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    323   2e-102   Vitis vinifera
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               322   3e-102   
ref|XP_010047217.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   4e-102   
gb|KHN32024.1|  Cytochrome P450 71A1                                    320   5e-102   
ref|XP_010036875.1|  PREDICTED: cytochrome P450 CYP736A12-like          321   7e-102   
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    322   7e-102   
emb|CAN69565.1|  hypothetical protein VITISV_033534                     320   1e-101   Vitis vinifera
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    322   2e-101   
ref|XP_010094781.1|  Cytochrome P450 71D8                               320   2e-101   
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          320   2e-101   
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                  320   4e-101   Ricinus communis
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             318   9e-101   
ref|XP_004301062.1|  PREDICTED: cytochrome P450 71A1-like               318   1e-100   
ref|XP_010111002.1|  Cytochrome P450 71D10                              317   1e-100   
ref|XP_007036499.1|  Cytochrome P450, putative                          318   2e-100   
gb|AES98630.2|  cytochrome P450 family 71 protein                       320   4e-100   
ref|XP_003615666.1|  Cytochrome P450                                    317   4e-100   
gb|AES98625.2|  cytochrome P450 family 71 protein                       317   4e-100   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          317   5e-100   
ref|XP_004490599.1|  PREDICTED: uncharacterized protein LOC101502297    328   9e-100   
ref|XP_009631573.1|  PREDICTED: cytochrome P450 CYP736A12-like          304   9e-99    
ref|XP_003615665.1|  Cytochrome P450                                    313   9e-99    
gb|KCW48536.1|  hypothetical protein EUGRSUZ_K02211                     313   9e-99    
ref|XP_003615672.1|  Cytochrome P450                                    319   1e-98    
ref|XP_006350392.1|  PREDICTED: cytochrome P450 71A1-like               313   1e-98    
ref|XP_007152787.1|  hypothetical protein PHAVU_004G159600g             312   2e-98    
gb|KDO35964.1|  hypothetical protein CISIN_1g036473mg                   302   2e-98    
ref|XP_010036876.1|  PREDICTED: cytochrome P450 CYP736A12-like          313   3e-98    
gb|ACN40174.1|  unknown                                                 313   3e-98    Picea sitchensis
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          311   5e-98    
gb|EYU31077.1|  hypothetical protein MIMGU_mgv1a024906mg                301   1e-97    
ref|XP_004490596.1|  PREDICTED: uncharacterized protein LOC101501242    322   2e-97    
ref|XP_010537441.1|  PREDICTED: cytochrome P450 CYP736A12-like          310   3e-97    
ref|XP_008374965.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    313   4e-97    
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              320   4e-97    
gb|KHG22812.1|  Cytochrome P450                                         308   6e-97    
ref|XP_006493869.1|  PREDICTED: cytochrome P450 71A1-like               298   7e-97    
ref|XP_004308347.1|  PREDICTED: cytochrome P450 71A1-like               308   7e-97    
gb|AFK79030.1|  cytochrome P450 CYP736A53                               308   8e-97    
emb|CBI15434.3|  unnamed protein product                                320   1e-96    
gb|ABR16640.1|  unknown                                                 307   2e-96    Picea sitchensis
ref|XP_010537439.1|  PREDICTED: cytochrome P450 CYP736A12-like          307   3e-96    
gb|KHN20715.1|  Cytochrome P450 71A1                                    306   3e-96    
ref|XP_003615667.1|  Cytochrome P450                                    318   4e-96    
gb|KEH27058.1|  cytochrome P450 family 71 protein                       306   5e-96    
gb|KHN32025.1|  Cytochrome P450 71A1                                    311   8e-96    
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             305   9e-96    
ref|XP_003534174.2|  PREDICTED: cytochrome P450 750A1-like              317   2e-95    
gb|KHN32022.1|  Cytochrome P450 71A1                                    304   3e-95    
gb|AES98632.2|  cytochrome P450 family 71 protein                       303   8e-95    
ref|XP_004237368.1|  PREDICTED: cytochrome P450 CYP736A12-like          302   2e-94    
ref|XP_003615674.1|  Cytochrome P450                                    304   2e-94    
gb|ABR18406.1|  unknown                                                 301   4e-94    Picea sitchensis
ref|XP_010537440.1|  PREDICTED: cytochrome P450 CYP736A12-like          301   5e-94    
gb|ABR18060.1|  unknown                                                 300   1e-93    Picea sitchensis
ref|XP_010537437.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   3e-93    
ref|XP_003525259.2|  PREDICTED: cytochrome P450 750A1-like              298   4e-93    
ref|XP_009605506.1|  PREDICTED: cytochrome P450 CYP736A12-like          291   7e-93    
emb|CAN69566.1|  hypothetical protein VITISV_033535                     313   7e-93    Vitis vinifera
gb|KEH21372.1|  cytochrome P450 family protein                          290   1e-92    
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               297   2e-92    
ref|XP_009795378.1|  PREDICTED: cytochrome P450 CYP736A12-like          292   3e-92    
gb|KHG22550.1|  Cytochrome P450                                         296   5e-92    
gb|KCW78883.1|  hypothetical protein EUGRSUZ_C00326                     294   2e-91    
ref|XP_004512940.1|  PREDICTED: cytochrome P450 71A1-like               294   2e-91    
ref|XP_010694276.1|  PREDICTED: cytochrome P450 CYP736A12-like          294   3e-91    
ref|XP_006585306.1|  PREDICTED: cytochrome P450 750A1-like isofor...    291   4e-91    
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  292   4e-91    Ricinus communis
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              293   6e-91    
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               293   6e-91    
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             293   6e-91    Populus trichocarpa [western balsam poplar]
gb|KEH27062.1|  cytochrome P450 family 71 protein                       285   6e-91    
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         293   1e-90    
ref|XP_003630840.1|  Cytochrome P450                                    284   2e-90    
ref|XP_006829159.1|  hypothetical protein AMTR_s00001p00269980          292   3e-90    
ref|XP_007036494.1|  Cytochrome P450                                    286   3e-90    
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               291   4e-90    
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    291   6e-90    
ref|XP_009626636.1|  PREDICTED: geraniol 8-hydroxylase-like             290   6e-90    
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            291   7e-90    
ref|NP_001062713.1|  Os09g0264400                                       290   1e-89    
ref|XP_010933756.1|  PREDICTED: cytochrome P450 84A1-like               290   1e-89    
gb|EAZ09260.1|  hypothetical protein OsI_31533                          290   2e-89    
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         289   3e-89    
gb|AAW50817.1|  ferulate-5-hydroxylase                                  289   4e-89    
gb|EYU36856.1|  hypothetical protein MIMGU_mgv1a009393mg                283   4e-89    
ref|XP_007036498.1|  Cytochrome P450                                    281   5e-89    
gb|KHG07602.1|  Cytochrome P450                                         285   7e-89    
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              288   8e-89    
emb|CDP12932.1|  unnamed protein product                                278   8e-89    
gb|ABR16143.1|  unknown                                                 286   8e-89    
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         288   1e-88    
gb|ACN40749.1|  unknown                                                 288   1e-88    
ref|XP_008351916.1|  PREDICTED: cytochrome P450 CYP736A12-like          288   1e-88    
gb|AIB06740.1|  flavanone 3'-hydroxylase                                288   1e-88    
gb|KHF98693.1|  Cytochrome P450                                         284   1e-88    
ref|XP_010113394.1|  Cytochrome P450 84A1                               287   2e-88    
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              287   2e-88    
ref|XP_006354703.1|  PREDICTED: cytochrome P450 84A1-like               276   2e-88    
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         287   2e-88    
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               287   2e-88    
emb|CDP12826.1|  unnamed protein product                                283   2e-88    
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               286   2e-88    
emb|CDP17539.1|  unnamed protein product                                287   2e-88    
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                286   3e-88    
ref|XP_009624917.1|  PREDICTED: geraniol 8-hydroxylase-like             286   3e-88    
gb|ABR17055.1|  unknown                                                 285   3e-88    
gb|AJD25214.1|  cytochrome P450 CYP92A73                                286   3e-88    
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               286   3e-88    
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               286   4e-88    
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               286   5e-88    
dbj|BAK04187.1|  predicted protein                                      286   5e-88    
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               286   5e-88    
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                286   5e-88    
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                286   5e-88    
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      286   6e-88    
gb|AAO47857.1|  flavonoid 3'-hydroxylase                                280   6e-88    
gb|ABK25581.1|  unknown                                                 286   6e-88    
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                285   6e-88    
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         285   6e-88    
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g             285   8e-88    
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               286   8e-88    
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                285   9e-88    
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               285   9e-88    
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               285   1e-87    
ref|XP_009626597.1|  PREDICTED: geraniol 8-hydroxylase-like             285   1e-87    
ref|XP_009782145.1|  PREDICTED: geraniol 8-hydroxylase-like             285   1e-87    
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            285   1e-87    
ref|NP_001274347.1|  uncharacterized protein LOC101314754               285   1e-87    
ref|XP_008791649.1|  PREDICTED: cytochrome P450 84A1-like               281   1e-87    
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              285   2e-87    
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      284   2e-87    
gb|EAZ09259.1|  hypothetical protein OsI_31532                          284   2e-87    
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               284   2e-87    
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             284   2e-87    
ref|NP_001063285.1|  Os09g0441400                                       284   2e-87    
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                284   2e-87    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                284   2e-87    
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                284   3e-87    
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 284   3e-87    
ref|NP_001063284.1|  Os09g0441100                                       284   3e-87    
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               284   3e-87    
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               284   4e-87    
gb|KHN39623.1|  Flavonoid 3',5'-hydroxylase                             278   4e-87    
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                283   4e-87    
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              283   4e-87    
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                283   4e-87    
emb|CDX69984.1|  BnaA10g23330D                                          283   4e-87    
gb|ACR14867.1|  flavonoid 3' hydroxylase                                283   5e-87    
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                283   5e-87    
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         283   5e-87    
ref|XP_010271496.1|  PREDICTED: cytochrome P450 84A1-like               283   5e-87    
ref|XP_006648650.1|  PREDICTED: flavonoid 3'-monooxygenase-like         283   5e-87    
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          283   5e-87    
gb|ABG74350.1|  cytochrome P450                                         283   5e-87    
gb|AJD25177.1|  cytochrome P450 CYP75B79                                283   6e-87    
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                283   6e-87    
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          283   6e-87    
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                283   7e-87    
ref|XP_010919382.1|  PREDICTED: cytochrome P450 84A1                    283   8e-87    
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        283   8e-87    
gb|ADC34701.1|  flavonoid 3' hydroxylase                                283   9e-87    
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                282   1e-86    
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         282   1e-86    
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 282   1e-86    
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                282   1e-86    
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               282   1e-86    
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         282   1e-86    
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         282   1e-86    
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        282   1e-86    
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               282   1e-86    
gb|AAO47851.1|  flavonoid 3'-hydroxylase                                276   1e-86    
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                282   1e-86    
ref|XP_010029715.1|  PREDICTED: cytochrome P450 84A1-like               282   1e-86    
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               282   1e-86    
ref|XP_010689571.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   1e-86    
ref|XP_009780649.1|  PREDICTED: geraniol 8-hydroxylase-like             281   1e-86    
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         282   2e-86    
gb|AET01782.2|  cytochrome P450 family protein                          282   2e-86    
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              282   2e-86    
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             281   2e-86    
gb|AHA49900.1|  flavonoid 3' hydroxylase                                281   2e-86    
ref|XP_010526785.1|  PREDICTED: cytochrome P450 84A1                    281   2e-86    
emb|CDP19009.1|  unnamed protein product                                281   3e-86    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         281   3e-86    
ref|XP_006354702.1|  PREDICTED: cytochrome P450 84A1-like               271   3e-86    
emb|CDP19008.1|  unnamed protein product                                281   3e-86    
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             281   3e-86    
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                281   3e-86    
gb|ABR16325.1|  unknown                                                 281   3e-86    
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                281   3e-86    
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                281   3e-86    
ref|XP_008796879.1|  PREDICTED: cytochrome P450 84A1-like               281   3e-86    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             281   4e-86    
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      278   4e-86    
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         281   4e-86    
ref|XP_010550444.1|  PREDICTED: cytochrome P450 84A1-like               281   5e-86    
gb|AET05316.2|  cytochrome P450 family 71 protein                       273   5e-86    
gb|AGI98132.1|  cytochrome P450                                         280   5e-86    
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                281   5e-86    
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               280   6e-86    
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         280   6e-86    
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             280   6e-86    
ref|XP_009777846.1|  PREDICTED: geraniol 8-hydroxylase-like             278   6e-86    
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                280   6e-86    
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         280   6e-86    
ref|XP_002313762.1|  cytochrome P450 family protein                     280   6e-86    
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   280   7e-86    
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               280   7e-86    
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             280   7e-86    
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                280   8e-86    
ref|XP_004156155.1|  PREDICTED: cytochrome P450 84A1-like               270   8e-86    
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             280   8e-86    
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      280   9e-86    
ref|XP_006493374.1|  PREDICTED: cytochrome P450 71A1-like               280   9e-86    
ref|XP_007156106.1|  hypothetical protein PHAVU_003G259200g             280   9e-86    
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               280   1e-85    
ref|XP_006365963.1|  PREDICTED: geraniol 8-hydroxylase-like             279   1e-85    
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               280   1e-85    
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           280   1e-85    
ref|XP_004142334.1|  PREDICTED: cytochrome P450 84A1-like               269   1e-85    
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         279   1e-85    
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                279   1e-85    
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               279   1e-85    
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              279   1e-85    
ref|XP_004287841.1|  PREDICTED: cytochrome P450 84A1-like               280   1e-85    
gb|EYU24083.1|  hypothetical protein MIMGU_mgv1a025005mg                279   2e-85    
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       279   2e-85    
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              279   2e-85    
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              279   2e-85    
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             279   2e-85    
gb|ADO16185.1|  cytochrome P450 mono-oxygenase                          279   2e-85    
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              279   2e-85    
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       279   2e-85    
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               279   2e-85    
ref|XP_002523235.1|  cytochrome P450, putative                          279   2e-85    
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               279   2e-85    
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               279   3e-85    
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              279   3e-85    
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               279   3e-85    
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                278   3e-85    
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                278   3e-85    
gb|ABC69381.1|  CYP92A2v2                                               278   3e-85    
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                278   3e-85    
gb|AGI98131.1|  cytochrome P450 CYP92                                   278   3e-85    
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             278   3e-85    
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                279   3e-85    
gb|AFK47419.1|  unknown                                                 278   3e-85    
emb|CDP12827.1|  unnamed protein product                                278   3e-85    
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                278   3e-85    
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         278   3e-85    
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      278   3e-85    
gb|ACU45738.1|  ferulate 5-hydroxylase                                  279   4e-85    
gb|ABC69383.1|  CYP92A2v4                                               278   4e-85    
gb|AGJ03150.1|  valencene oxidase                                       278   4e-85    
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                278   4e-85    
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               278   4e-85    
gb|KHG15722.1|  Cytochrome P450                                         278   4e-85    
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                278   4e-85    
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                278   4e-85    
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                278   4e-85    
gb|ABC69382.1|  CYP92A2v2                                               278   5e-85    
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                          278   6e-85    
ref|XP_009338655.1|  PREDICTED: cytochrome P450 84A1-like               278   6e-85    
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               278   6e-85    
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    278   6e-85    
ref|XP_009346304.1|  PREDICTED: cytochrome P450 84A1-like               278   6e-85    
gb|AHX24369.1|  CYP76A26-like protein                                   278   7e-85    
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                278   7e-85    
ref|XP_009378215.1|  PREDICTED: cytochrome P450 84A1-like               278   7e-85    
ref|XP_011047458.1|  PREDICTED: cytochrome P450 84A1-like               278   7e-85    
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              278   7e-85    
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               277   7e-85    
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                277   8e-85    
ref|XP_003607058.1|  Ferulate 5-hydroxylase                             278   8e-85    
ref|XP_009384541.1|  PREDICTED: cytochrome P450 84A1-like               278   8e-85    
ref|XP_010042459.1|  PREDICTED: cytochrome P450 CYP736A12-like          267   9e-85    
ref|XP_009372722.1|  PREDICTED: cytochrome P450 CYP736A12-like          267   1e-84    
ref|XP_007155244.1|  hypothetical protein PHAVU_003G1855001g            271   1e-84    
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              277   1e-84    
ref|XP_007155245.1|  hypothetical protein PHAVU_003G1855001g            273   1e-84    
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              277   1e-84    
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             277   1e-84    
ref|XP_007155243.1|  hypothetical protein PHAVU_003G1855001g            273   1e-84    
emb|CAN62887.1|  hypothetical protein VITISV_025543                     276   1e-84    
gb|AJA79074.1|  flavonoid 3' hydroxylase                                277   1e-84    
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               277   1e-84    
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         278   1e-84    
ref|XP_008784472.1|  PREDICTED: cytochrome P450 71A2-like               283   1e-84    
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                275   1e-84    
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    277   2e-84    
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                276   2e-84    
emb|CDX99037.1|  BnaC09g47980D                                          282   2e-84    
gb|KGN58498.1|  hypothetical protein Csa_3G651820                       274   2e-84    
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               276   2e-84    
ref|XP_007203643.1|  hypothetical protein PRUPE_ppa004260mg             277   2e-84    



>emb|CDP18035.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   452 bits (1163),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 260/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY DKE  E+GFKA I E ++++A PNLGDY+P LG LD+QGLTRRMKA+GK+FD
Sbjct  185  MVLGKKYADKEFDERGFKAVIKEGMQLSATPNLGDYYPYLGVLDIQGLTRRMKAIGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EKII++HE+  ++   +   DFV TML +MKSGE+  QF R+H+K+V+LD+L  S+D
Sbjct  245  EFFEKIIDEHEQYANQ--TRHVDDFVYTMLALMKSGETEFQFDRRHIKAVLLDMLAGSMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++V+EW ++EL +   +MKKV++E++  VGLDRMVEESDL++ +YL++V+KE+LR+HP
Sbjct  303  TSATVVEWIMAELLKNSRVMKKVQQELDEKVGLDRMVEESDLDNLRYLDMVVKEALRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAA EDC VDGFHIPK S V +NVWAIGRDP  WSDP+ F PERF+ +S++ R
Sbjct  363  VAPLLIPHAAIEDCTVDGFHIPKDSRVIINVWAIGRDPNAWSDPDMFIPERFSGNSIDIR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CPG+QLG+TVVRL+VAQL+HCF W LPNGMLP +L+MTEEFGL +
Sbjct  423  GHDFQLLPFGSGRRGCPGIQLGLTVVRLLVAQLVHCFTWELPNGMLPSELDMTEEFGLVV  482

Query  902  NRAEHLMAIPTYRL  943
             RA+HLMA+PTYRL
Sbjct  483  TRAKHLMAVPTYRL  496



>ref|XP_004236729.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=501

 Score =   451 bits (1159),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 260/317 (82%), Gaps = 1/317 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D+E G KGFK+ ++E +++ A PNLGD+FP LGKLD+QGLTRRMKAV K+FD
Sbjct  185  MIFGKKYKDEEFGCKGFKSVVNEGLQLAAAPNLGDFFPFLGKLDLQGLTRRMKAVSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII++HEE+  KG+ Q   DFVDTML IMKSGE+  QF R HVK+++LD+LIAS+D
Sbjct  245  NFLEKIIDEHEESDKKGQHQNNKDFVDTMLNIMKSGETEFQFDRGHVKAILLDMLIASMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W +SEL RQP IMKK+++E E  +G+ RMVEE DLE  +YL +VIKESLR+HP
Sbjct  305  TSATTIDWILSELLRQPNIMKKLQKEFEEKIGMKRMVEELDLEKLEYLNMVIKESLRLHP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVW-SDPEKFFPERFNKSSVEY  718
            V PLL+PH + EDC +DG+ IPK S + VN +AIGRDPKVW ++P++F PERF  SS++ 
Sbjct  365  VAPLLLPHQSIEDCTIDGYFIPKKSRILVNTYAIGRDPKVWPNNPDEFIPERFVGSSIDL  424

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG DFE LPFGSGRR CPG+QLG+ ++RL+VAQL+HCFDW LPNGMLP DL+M EEFGL 
Sbjct  425  RGHDFELLPFGSGRRRCPGLQLGLIIIRLIVAQLVHCFDWELPNGMLPNDLDMGEEFGLV  484

Query  899  LNRAEHLMAIPTYRLHI  949
            ++RA+H+MAIP YRL +
Sbjct  485  VSRAKHVMAIPNYRLSM  501



>gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense]
Length=497

 Score =   442 bits (1136),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 252/315 (80%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK++DKE  E+GFK  I   +++    NLGDYFP LG LD+QGL +RMKA+ K++D
Sbjct  184  MVFGKKFEDKEFDERGFKGVIQVGMQMAVAFNLGDYFPYLGALDLQGLNKRMKAIAKVWD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +FLEKI++DH+++   G+   T DFVDTML+IMKSGES  +F R HVK+ ++D+  AS D
Sbjct  244  QFLEKILDDHDQSKEPGQ---TKDFVDTMLDIMKSGESEFEFDRSHVKATLMDMFAASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEWT+SEL R P +M KV++E+E  VG++RMVEESDLE  +YL +VIKE++R+HP
Sbjct  301  TSSTTIEWTLSELLRHPRVMNKVQKELEQVVGMNRMVEESDLESLEYLGMVIKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH A EDC VDGF IPK S V VNVWAIGRD  VWSD EKF PERF  S+++ R
Sbjct  361  VAPLLLPHLAIEDCTVDGFFIPKNSRVVVNVWAIGRDSNVWSDAEKFLPERFIGSNIDLR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE LPFGSGRR CPGMQLG+TVVRLVVAQLLHCFDW+LPNGM P +L+MTEEFGL +
Sbjct  421  GRDFELLPFGSGRRGCPGMQLGLTVVRLVVAQLLHCFDWDLPNGMQPSELDMTEEFGLLV  480

Query  902  NRAEHLMAIPTYRLH  946
             RA+HLMAIPT RL 
Sbjct  481  GRAKHLMAIPTCRLQ  495



>emb|CDP12931.1| unnamed protein product [Coffea canephora]
Length=980

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 257/314 (82%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  E+GFKA + EA+++ A PNLGDY+P LG LD QGLTRRMKAVGK+FD
Sbjct  662  MVFGKKYAEKEFDERGFKAVMKEAMQLAATPNLGDYYPYLGVLDPQGLTRRMKAVGKVFD  721

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EKII++HE+  S  K +   DFV TML + KSGE+  QF R H+K+++LD+L  S+D
Sbjct  722  EFFEKIIDEHEQ--SANKVRQADDFVYTMLALKKSGETEFQFDRPHIKAILLDMLAGSMD  779

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EWT++EL + P +MKK+++E+   VGLDRMVEESDL++ +YL++V+KE+LR+HP
Sbjct  780  TSATTVEWTLAELLKNPRVMKKLRQELNEKVGLDRMVEESDLDNLQYLDMVVKEALRLHP  839

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAAREDC VDGFHIPK S V +NVW IGRDP  W DPEKF PERF  ++++ R
Sbjct  840  VAPLLIPHAAREDCTVDGFHIPKDSRVIINVWTIGRDPNAWPDPEKFIPERFVGNNIDVR  899

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CPG QLG+TVVRL+VAQL+HCF+W LPNGMLP +L+MTEEFGL +
Sbjct  900  GHDFQLLPFGSGRRGCPGTQLGLTVVRLLVAQLVHCFNWKLPNGMLPSELDMTEEFGLVV  959

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+A+PTYRL
Sbjct  960  TRAKHLVAVPTYRL  973


 Score =   247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 165/211 (78%), Gaps = 3/211 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGK+Y DK+  ++GF+  I E++ + ALPNLGDYFPLLG LD+QGLTRR KA+ K+FD
Sbjct  441  MIFGKRYMDKDFDDRGFREVIQESLHVAALPNLGDYFPLLGVLDLQGLTRRFKALAKVFD  500

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F +KII++H E  SK   QT  DFVD M+ I++S  S   F R+HVK+++LD+L+AS+D
Sbjct  501  KFFDKIIDEHLE--SKEHKQTK-DFVDIMMGIIQSETSEFDFDRRHVKAILLDMLLASMD  557

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            +S++ +EW +SEL R PE M+K+++E+E  VGL R+VEESDLE  +YL++V+KES+R+HP
Sbjct  558  SSATAVEWAMSELLRHPEAMQKLQKELEEKVGLKRIVEESDLEGLEYLDMVVKESMRLHP  617

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNV  634
            V PL++PH + EDC++D FHI K + + +NV
Sbjct  618  VGPLMLPHESMEDCKIDDFHIQKNTRIIINV  648


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELG--EKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKL  175
            M+FGK   DK+    ++GF+  I EA+ + A+ NL DYFP L  LD+Q   R +KA+ K+
Sbjct  125  MIFGKMCMDKDFDFDDRGFREVIEEALHVAAMANLCDYFPQLRVLDLQRFARWLKALSKV  184

Query  176  FDEFLEKIINDHEEA  220
            FD F +KIIN H E+
Sbjct  185  FDNFPKKIINKHLES  199



>ref|XP_009607201.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=498

 Score =   434 bits (1117),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 257/316 (81%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D++LG+KGFKA I + + I ALPN  ++FP L  LD+QG  RRMK + KLFD
Sbjct  186  MIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFFPFLRVLDLQGFARRMKELAKLFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++I++H ++T + +A+   D VDT++ IM+S E+  +F R+H+K+++LD+LIAS+D
Sbjct  246  EFLERVIDEHVQSTEQKQAK---DMVDTLMSIMQSKEAEFEFDRRHIKAILLDLLIASMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEWT++EL R PE+MKK++ E+E  VG +RMVEESDLE  +YL++VIKE  R+HP
Sbjct  303  TSSTTIEWTLTELLRHPEVMKKLQNELEQVVGRNRMVEESDLESLEYLDMVIKEGCRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC VDGFH+PKGS + +NVWAIGRD   W +PEKF PERF  S+V+ R
Sbjct  363  VAPLLLPHESIEDCTVDGFHLPKGSRLLLNVWAIGRDSDTWIEPEKFKPERFQGSNVDLR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+++E LPFGSGRR CPG+QLG+T+VRLVVAQL+HCFDW LPNGMLPKD++MTE+FGL  
Sbjct  423  GRNYELLPFGSGRRGCPGLQLGLTIVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVT  482

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLMA PTYRLH+
Sbjct  483  ARAQHLMATPTYRLHM  498



>emb|CDP12853.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   431 bits (1109),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 260/314 (83%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I EA+++ A PNLGDY+P L  LD++GLTRRMK VGK+FD
Sbjct  120  MVFGKKYADKEFDERGFKAVIKEAMQLMATPNLGDYYPFLKVLDLRGLTRRMKTVGKIFD  179

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++HE+  S  +A+   DFV T+L +MKS E+  +F R+H+K+V++D+L A++D
Sbjct  180  EFLEKIIDEHEQ--SANQARHADDFVYTILALMKSKETEFEFDRRHIKAVLVDLLTAAMD  237

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+++ +EW ++EL + P +MKKV++E++  VGL RMVEES+LE+  YL++V+KE+LR+HP
Sbjct  238  TTATTVEWILAELLKNPRVMKKVQQELDEKVGLHRMVEESELENLTYLDMVVKEALRLHP  297

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PHAA EDC VDGFHIPK S VT+N W IGRDP  WSDPEKF PERF  S+++ R
Sbjct  298  VVPLLLPHAALEDCIVDGFHIPKDSRVTINAWTIGRDPNAWSDPEKFTPERFIGSNIDVR  357

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ +PFGSGRR CPGMQLG+TVVRL++A+++HCF+W LPNGMLP +L+MTEEFGL +
Sbjct  358  GHDFQLIPFGSGRRICPGMQLGLTVVRLMLARMVHCFNWELPNGMLPSELDMTEEFGLVM  417

Query  902  NRAEHLMAIPTYRL  943
             RA+HLMAIPTYRL
Sbjct  418  TRAKHLMAIPTYRL  431



>ref|XP_006363549.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
 ref|XP_006363550.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=499

 Score =   432 bits (1111),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 254/316 (80%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D E  E+GFK  I E + +TA PN+G++FP L   D+QG+ RRMK + K+FD
Sbjct  186  MVFGKKYMDDEFDERGFKYVIQETLVLTATPNIGEFFPFLNVFDLQGVVRRMKELSKIFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF E+II++H + + K K   T D VDTM+ IM+SGES  +F R+HVK+++LD+LIAS+D
Sbjct  246  EFFERIIDEHVQDSKKEKQ--TKDIVDTMMNIMQSGESEFEFDRRHVKAILLDMLIASMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I+W  +EL R P+++KK+++E+E  VG++RMVEESDLE  +YL++VIKE  R+HP
Sbjct  304  TSSTAIDWIFTELLRHPKVIKKLQKELEQIVGMNRMVEESDLEKLEYLDMVIKEGFRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC +DGF IPKGS + VN WAIGRDP++WS+PEKF PERF  S+++ R
Sbjct  364  VAPLLIPHESIEDCTIDGFDIPKGSRLLVNTWAIGRDPEIWSEPEKFMPERFVGSNIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G +F+ LPFGSGRRSCPG+QLG+T VRLV+AQ++HCFDW LPNGM+P DL+MTE+FGL +
Sbjct  424  GNNFQLLPFGSGRRSCPGLQLGLTTVRLVLAQMVHCFDWKLPNGMMPNDLDMTEKFGLVM  483

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLM IPTYRL++
Sbjct  484  TRAQHLMVIPTYRLNV  499



>ref|XP_009770873.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   431 bits (1109),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 257/316 (81%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D++LG+KGFKA I + + I ALPN  ++FP L  LD+QG  RRMK + KLFD
Sbjct  186  MIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFFPFLRVLDLQGFARRMKELAKLFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++I++H ++T + K     D VDT+++IM+S E+  +F R+H+K+++LD+LIAS+D
Sbjct  246  EFLERVIDEHVQSTEEQK--QAKDMVDTLMDIMQSKEAEFEFDRRHIKAILLDLLIASMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW ++EL R PE+MKK++ E+E  VG +RMVEESDL++ +YL++VIKE  R+HP
Sbjct  304  TSSTTIEWILTELLRHPEVMKKLQNELEQVVGKNRMVEESDLKNLQYLDMVIKEGCRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC VDGFH+PKGS + +NVWAIGRD   W +PEKF PERF  S+V+ R
Sbjct  364  VAPLLLPHESIEDCTVDGFHLPKGSRLLLNVWAIGRDSDTWLEPEKFKPERFQGSNVDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+++E LPFGSGRR CPG+QLG+TVVRLVVAQL+HCFDW LPNGMLPKD++MTE+FGL  
Sbjct  424  GRNYELLPFGSGRRGCPGLQLGLTVVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVT  483

Query  902  NRAEHLMAIPTYRLHI  949
             RA++LMAIPTYRLHI
Sbjct  484  ARAQNLMAIPTYRLHI  499



>ref|XP_009600860.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=487

 Score =   428 bits (1101),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 250/316 (79%), Gaps = 6/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++LGEKGFKA + E ++I ++P LGDY P L     QGLTRRMK + KLFD
Sbjct  177  MVFGKKYMDEDLGEKGFKALVQETMRIISMPKLGDYIPFL-----QGLTRRMKELAKLFD  231

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++IN+H + ++    Q   D VDT++ IM+S E+  +F R+HVK+++LD+L+AS+D
Sbjct  232  EFLERVINEHVQQSTNELKQAK-DIVDTLMGIMQSEEAEFEFDRRHVKAILLDLLMASMD  290

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW +SEL R P +MKK++ E+E  VG +RMVEESDLE+ +YLE+VIKE  R+HP
Sbjct  291  TSSTTVEWILSELIRHPNVMKKLQNELEQVVGKNRMVEESDLENLEYLEMVIKEGFRLHP  350

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLLIPH + +DC VDGFHI KGS + VNVWAIGRDP VWS+PEKF PERF   +++ +
Sbjct  351  VVPLLIPHESIKDCTVDGFHIRKGSRILVNVWAIGRDPDVWSEPEKFIPERFLGCNIDLK  410

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFG GRRSCP +QLG+T+VRL++AQL+HCFDW LPN MLPKDLNM E+FGL  
Sbjct  411  GHSFQLLPFGFGRRSCPSLQLGLTIVRLLIAQLVHCFDWKLPNNMLPKDLNMNEKFGLVT  470

Query  902  NRAEHLMAIPTYRLHI  949
             R +HLMAIPTYRLHI
Sbjct  471  TRVQHLMAIPTYRLHI  486



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 254/314 (81%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKEL EKGFKA + E + + A PN GDY P L  LD+QGLT+RMK V K+FD
Sbjct  184  MVFGKKYKDKELDEKGFKAVVQEGMHLAATPNFGDYIPFLAPLDLQGLTKRMKVVHKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++TS+ + +   DFVD ML  M S ES  +  R ++K++MLD+L  S+D
Sbjct  244  DFFEKIIDEHLQSTSEERPK---DFVDVMLGFMGSVESEYRIERSNIKAIMLDMLSGSMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+++  EWT+SEL + P++MKKV++EIE+ VG++RMVEESDLE  +YL+ V+KE++R+HP
Sbjct  301  TTATSTEWTLSELLKHPQVMKKVQKEIENVVGMERMVEESDLEKLEYLDKVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC V+GFHIP  S + +N+WAIGR+P VW+D +KF PERF+ S++++R
Sbjct  361  VAPLLLPHAAIEDCNVNGFHIPGKSRIMINIWAIGRNPSVWTDADKFIPERFDGSNIDFR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+F+PFGSGRR CPGMQLGIT+V L+VAQL+HCFDW LPN MLP +L+MTEEFGL++
Sbjct  421  GRDFQFIPFGSGRRGCPGMQLGITMVLLLVAQLVHCFDWELPNNMLPTELDMTEEFGLTV  480

Query  902  NRAEHLMAIPTYRL  943
             RA HL+A+PTYRL
Sbjct  481  PRANHLLALPTYRL  494



>ref|XP_009586899.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=500

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 251/316 (79%), Gaps = 1/316 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GFK  I E + ITA PN+G++FP   + D+QG   RMK + K+FD
Sbjct  186  MVFGKKYMDEEFDERGFKDVIQETLVITATPNIGEFFPFFDRFDLQGFVPRMKKLAKIFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +FLEKII++H   + +   Q   D VDTM+ IM+SGE+  +F R+HVK++MLD+LIAS+D
Sbjct  246  DFLEKIIDEHVHDSKRENKQAK-DIVDTMMSIMQSGEAEFEFDRRHVKAIMLDLLIASMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+S+ I+WT +EL R P++MKK++ E+E  VG +RMVEE+DLE  +YL++VIKE  R+HP
Sbjct  305  TASTAIDWTFTELLRHPKVMKKLQNELEQVVGTNRMVEETDLEKLEYLDMVIKEGFRLHP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC VDGF IPKGS + VN WAIGRDP+ W +PEKF PERF  S+++ R
Sbjct  365  VAPLLIPHESIEDCIVDGFDIPKGSRILVNTWAIGRDPEAWPEPEKFRPERFVGSNIDLR  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPG+QLG+T+V LV+AQL+HCFDW LPNGM+P+DL+MTE+FGL  
Sbjct  425  GRDFQLLPFGSGRRSCPGLQLGLTIVLLVLAQLVHCFDWELPNGMMPEDLDMTEKFGLVT  484

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HL+AIPTYRLH+
Sbjct  485  ARAQHLVAIPTYRLHV  500



>ref|XP_011078642.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 250/316 (79%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY+DK++ E+GFK  I E +K+ A+PNLGDYFP LG LD+QGLTR+MKA+ K++D
Sbjct  186  MVFGKKYEDKDIDERGFKTVIQEGMKLAAVPNLGDYFPFLGILDIQGLTRKMKALSKVYD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGES-PVQFTRQHVKSVMLDILIASI  358
            +F EK+IN+H      G  + T D VDTM+ IM+SG++   QF R+HVK++MLD+L  S+
Sbjct  246  DFFEKVINEHVRDWDHG--EQTKDIVDTMMSIMQSGQTREFQFDRRHVKAIMLDMLAGSM  303

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DT++S +EW +SEL R P  MKKV++E+E  VGL+RMVEESD++  +YL++V+KE+ R+H
Sbjct  304  DTAASSVEWILSELLRNPTTMKKVQKELEEVVGLERMVEESDIDQLEYLDMVVKETFRLH  363

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PV PLLIPH A EDC V+G+ IPK S + +N  AIGRDP  WS+PEKF PERF  S ++ 
Sbjct  364  PVAPLLIPHYAMEDCTVNGYDIPKASRIIINTHAIGRDPDAWSEPEKFIPERFVGSEIDV  423

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RGQ F+ LPFGSGRR CPGMQLG+  VRL+V+QL+HCFDW LPNG+LPK+L+M EEFGL 
Sbjct  424  RGQHFQLLPFGSGRRGCPGMQLGLIQVRLIVSQLVHCFDWRLPNGVLPKELDMAEEFGLV  483

Query  899  LNRAEHLMAIPTYRLH  946
            +NRA HLMAIPT+RL 
Sbjct  484  VNRANHLMAIPTFRLQ  499



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 246/315 (78%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GFKA + E + + A PNLGDY P +  LD+QG T+RMK V ++FD
Sbjct  186  MVFGKKYSDEEFDERGFKAVVQEGMHLAATPNLGDYIPFIAPLDLQGFTKRMKKVRRVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EKII++H +  SK  A  T DFVD ML  M S ES  +  R ++K+++LD++  S+D
Sbjct  246  EFFEKIIDEHIQ--SKDDAGKTKDFVDVMLSFMGSKESEYRIERTNIKAIILDMVAGSMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+  EW ISEL + P ++KKV++E+E+ VG+DR VEESDLE  +YL++V+KE+LR+HP
Sbjct  304  TSSTATEWAISELIKNPRVLKKVQKELETVVGMDRTVEESDLERLEYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAA EDC V+GFHIP  S V +NV+AIGRDP  W+DPEKFFPERF  SSV+ R
Sbjct  364  VAPLLIPHAAMEDCIVNGFHIPNKSRVMINVYAIGRDPNSWTDPEKFFPERFVGSSVDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR CPGMQLG+TVVRL+VAQL+HCFDW LPNGMLP +L+M EEFGL+ 
Sbjct  424  GRDFQLIPFGSGRRGCPGMQLGLTVVRLLVAQLVHCFDWELPNGMLPAELDMEEEFGLTT  483

Query  902  NRAEHLMAIPTYRLH  946
             RA HLMAIPT RL 
Sbjct  484  PRANHLMAIPTCRLQ  498



>ref|XP_004237154.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=499

 Score =   422 bits (1085),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 252/316 (80%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D E  E+GFK  I EA+ I A PN+GD+FP L K D QGL  R K + K+FD
Sbjct  186  MIFGKKYMDDEFNERGFKDVIQEALIIAATPNIGDFFPFLDKFDFQGLIPRTKKLAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++I++H + + + K   T D VDTM+ IM+SGE+  +F R+H+K+++LD+LIASID
Sbjct  246  EFLERVIDEHVQNSKEEK--QTKDIVDTMMNIMQSGEAEFEFDRRHIKAILLDLLIASID  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W  SEL R P++MKK+++E+E  VG++R+VEESDLE  KYL+++IKE  R+HP
Sbjct  304  TSATSIDWIFSELVRHPKVMKKLQKELEQVVGMNRIVEESDLEKLKYLDMIIKEGFRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            + PLLIPH + +DC +DGF+I +GS + VN WAIGRDP+VW +PEKF PERF  S ++ R
Sbjct  364  IAPLLIPHESIKDCIIDGFNITRGSRILVNTWAIGRDPEVWPEPEKFMPERFVGSDIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPF SGRRSCPG+QLG+ VVRLV+AQL+HCFDW LPN M+P DL+MTE+FGL +
Sbjct  424  GRDFQLLPFSSGRRSCPGLQLGLIVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFGLVV  483

Query  902  NRAEHLMAIPTYRLHI  949
            +RA+HL+AIPTYRLH+
Sbjct  484  SRAQHLVAIPTYRLHV  499



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   421 bits (1083),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 254/315 (81%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I E + + A PN GD+ P +  LD+QGLT+RMK V K+FD
Sbjct  185  MVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H ++T +   + T DFVD ML  M S ES  +  R ++K+++LD+L  ++D
Sbjct  245  AFFEKIIDEHIQSTDQ---ERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+++ IEWT+SEL + P +MKKV++E+E+ VG++R VEESDLE  +YL++V+KE++R+HP
Sbjct  302  TTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC V+GFHIP+ S V +N++AIGRDP +W+D EKF PERF+ S++++R
Sbjct  362  VAPLLLPHAAIEDCNVNGFHIPRKSRVIINIFAIGRDPSIWTDAEKFIPERFDGSNIDFR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+F+PFGSGRR CPGMQLGIT+V+LVVAQL+HCFDW LPN MLP +L+MTEEFGL++
Sbjct  422  GRDFQFIPFGSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTV  481

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+A+PTYRL 
Sbjct  482  PRAKHLLAVPTYRLQ  496



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   421 bits (1082),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 251/315 (80%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L E+GFKA I EA+++ A PN+GDY P L  LD+QGLTRR+KA GK+FD
Sbjct  181  MVFGKKYMDKDLDERGFKAVIQEAMQLAATPNIGDYIPCLLGLDLQGLTRRIKATGKVFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H     K + QT  D VD ML++M S E+     R ++K++ LD++ AS+D
Sbjct  241  DFFEKIIDEHIH-KPKEEGQTK-DLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS+++IEW +SEL + P +MKKV  E+E  VG++RMVEESDLE  +YL +V+KE+LR+HP
Sbjct  299  TSATMIEWALSELIKHPPMMKKVINELEKVVGMERMVEESDLESLEYLNMVVKETLRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC VDGFHIP+ S V VNVWAIGRDP  W+D +KF PERF +S +++R
Sbjct  359  VAPLLIPHESMEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F+F+PFGSGRR CPGMQLG+TVVRLV+AQL+HCFDW LP+ MLP +L+MTEEFGL+L
Sbjct  419  GQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTL  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIPT RLH
Sbjct  479  PRAKHLVAIPTCRLH  493



>ref|XP_007213194.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
 gb|EMJ14393.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
Length=494

 Score =   421 bits (1082),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 251/315 (80%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+EL E+GFK+ I E +++ A PNLGDY P + +LD+QG T+RMKA+ K FD
Sbjct  182  MVLGKKYRDEELDERGFKSLIKEGMQLAAAPNLGDYIPCIAQLDLQGFTKRMKAINKAFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H ++  + +   T DFVD M+ IM S ES  +  R ++K+++LD+L+AS+D
Sbjct  242  NFFEKIIDEHLQSKDEYR---TKDFVDVMVGIMGSAESQYRIERSNIKAIILDMLVASMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SEL R P +MKKV++E+E  VGL+RMVEESDLE  +YL+IV+KE+LR+HP
Sbjct  299  TSSTTIEWVLSELMRHPHVMKKVRKELEDVVGLERMVEESDLEKLEYLDIVVKETLRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAA EDC V+GFHIPK S V +NVW+IGRDP  W+D EKF PERF  S+++ R
Sbjct  359  VAPLLIPHAAIEDCTVNGFHIPKASRVIINVWSIGRDPSAWTDAEKFIPERFVGSNIDVR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  FE +PFGSGRR CPG+QL +T+V+L+VAQL+HCFDW LPN MLP +L+M+EEFGL++
Sbjct  419  GNHFELIPFGSGRRRCPGIQLRLTMVQLMVAQLVHCFDWELPNSMLPNELDMSEEFGLTV  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIP+YRLH
Sbjct  479  PRAKHLLAIPSYRLH  493



>ref|XP_009802012.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   421 bits (1082),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 249/316 (79%), Gaps = 1/316 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GFK  I E + ITA PN+G++FP L + D+QG   RMK + K+FD
Sbjct  186  MVFGKKYMDEEFDERGFKDVIQETLVITATPNIGEFFPFLDRFDLQGFVPRMKKLAKIFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H + + +   Q   D VDTM+ IM+SGE+  +F R+H+K+V+LD+LIAS+D
Sbjct  246  DFFEKIIDEHVQDSKRENKQAK-DIVDTMMAIMQSGEAEFEFDRRHIKAVLLDMLIASMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+S+ I+WT +EL R P +MKK++ E+E  VG +RMVEESDLE   YL++V+KE  R+HP
Sbjct  305  TASTAIDWTFTELLRHPNVMKKLQNELEQVVGTNRMVEESDLEKLDYLDMVVKEGFRLHP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+P  + EDC VDGF IPKGS + VN WAIGRDP+ W +PEKF PERF  S+++ R
Sbjct  365  VAPLLLPRESIEDCIVDGFDIPKGSRILVNTWAIGRDPEAWPEPEKFKPERFVGSNIDLR  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPG+QLG+T+VRLV+AQL+HCFDW LPNGM P+DL+MTE+FGL  
Sbjct  425  GRDFQLLPFGSGRRSCPGLQLGLTIVRLVLAQLVHCFDWELPNGMAPEDLDMTEKFGLVT  484

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HL+AIPTY+LH+
Sbjct  485  ARAQHLVAIPTYQLHV  500



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   421 bits (1082),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 258/315 (82%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D++L ++GFK+ + E V + A PNLGD+FP LG LD+QGLT R+KA+ K+FD
Sbjct  183  MVFGKKFMDEDLDKRGFKSIVQEVVHLAATPNLGDFFPYLGVLDLQGLTSRLKALSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++  +   + T DFVDTM+ IM+SGE+  +F R+H+K+V+LD+L+AS+D
Sbjct  243  EFLEKIIDEHVQSKEQ---RETEDFVDTMMAIMQSGEAGFEFDRRHIKAVLLDMLMASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EWT++EL R P +MKK+++E+E  VGLDRMVEESDLE+ KYL++VIKE+LR+H 
Sbjct  300  TSATSVEWTLTELLRHPHVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLHS  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLI H + EDC VDGF++ KGS + VNV+A  RDP  W +P+KFFPERF +S+V+ R
Sbjct  360  AAPLLI-HESIEDCVVDGFYVQKGSRIIVNVYAAQRDPNAWPEPDKFFPERFVESNVDLR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRRSCPGMQLGI +VRLVVAQL+HCFDW LPNGM P +L+M+E+FG+  
Sbjct  419  GHDFQLLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVT  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+A+PTY+LH
Sbjct  479  CRAKHLIAVPTYKLH  493



>emb|CBI21487.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   424 bits (1091),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 251/315 (80%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L E+GFKA I EA+++ A PN+GDY P L  LD+QGLTRR+KA GK+FD
Sbjct  295  MVFGKKYMDKDLDERGFKAVIQEAMQLAATPNIGDYIPCLLGLDLQGLTRRIKATGKVFD  354

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H     K + QT  D VD ML++M S E+     R ++K++ LD++ AS+D
Sbjct  355  DFFEKIIDEHIH-KPKEEGQTK-DLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASMD  412

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS+++IEW +SEL + P +MKKV  E+E  VG++RMVEESDLE  +YL +V+KE+LR+HP
Sbjct  413  TSATMIEWALSELIKHPPMMKKVINELEKVVGMERMVEESDLESLEYLNMVVKETLRLHP  472

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC VDGFHIP+ S V VNVWAIGRDP  W+D +KF PERF +S +++R
Sbjct  473  VAPLLIPHESMEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFR  532

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F+F+PFGSGRR CPGMQLG+TVVRLV+AQL+HCFDW LP+ MLP +L+MTEEFGL+L
Sbjct  533  GQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTL  592

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIPT RLH
Sbjct  593  PRAKHLVAIPTCRLH  607


 Score =   208 bits (530),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L E+GFKA   E +++ A PN+GDY P L  LD+QGLTRR KA GK+FD
Sbjct  77   MVFGKKYMDKDLDERGFKAMFQEVMQLAATPNIGDYIPCLLGLDLQGLTRRTKATGKVFD  136

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H     K + QT  D VD ML +M S  +     R  +K++  D+L  S++
Sbjct  137  DFFEKIIDEHIH-NPKEEGQTK-DLVDVMLVLMGSEGTGYNIERASIKAISFDMLAGSME  194

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSSS I+W ++EL R P +MKKV+ E+E  VG++RMVEESDLE  +YL +V+KE+LR++P
Sbjct  195  TSSSSIDWAVAELIRHPRVMKKVQSELEKVVGMERMVEESDLESLEYLNMVVKETLRLYP  254

Query  542  VVPLLIPHAAREDC  583
              PLL+PH + EDC
Sbjct  255  AGPLLVPHESMEDC  268



>ref|XP_009607200.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=497

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 250/316 (79%), Gaps = 0/316 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D++LGEKGFKA I + + + ALPN+ ++FP L  LD+QG + RMK + +LFD
Sbjct  181  MIFGKKYMDEDLGEKGFKALIQDILHLAALPNVAEFFPFLRVLDLQGFSHRMKELAQLFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
              LE+++++H    S  + +   D VDT++ IM+S E+  +F R+HVK+V+LD+LIAS D
Sbjct  241  GLLERVVDEHVVVQSTEQQKQATDMVDTLMGIMQSKEAEFEFDRRHVKAVLLDLLIASTD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW ++EL R P++MKK++ E+E  VG +RMVEE D E+ +YL++VIKES R+HP
Sbjct  301  TSSTTIEWILTELLRHPDVMKKLQCELEQVVGKNRMVEELDFENLQYLDMVIKESCRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC +DGFHIPKGS + VNVWAIGRD   W +PEKF PERF  S+++  
Sbjct  361  VAPLLIPHESIEDCVIDGFHIPKGSRLLVNVWAIGRDSDTWLEPEKFKPERFQGSNIDLG  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ+F+ LPFGSGRRSCPG+QLG+T+VRLVVAQL+HCFDW LPNGMLP+ ++MTE+FGL  
Sbjct  421  GQNFQLLPFGSGRRSCPGLQLGLTIVRLVVAQLIHCFDWELPNGMLPEHIDMTEKFGLVT  480

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLMAIPTYRLH+
Sbjct  481  ARAQHLMAIPTYRLHM  496



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   419 bits (1077),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 250/315 (79%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFK  I EA+ + A+PNLGD+ P +  LD+QG T+RMK V K+FD
Sbjct  186  MVFGKKYLDKEFDERGFKVVIQEAMHLAAIPNLGDFIPFIAPLDLQGYTKRMKVVAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII DH    SK +   T DFVD ML +M+S +S  +  R ++K+VMLD+L+AS+D
Sbjct  246  DFFEKIIEDH--ILSKDEDSKTKDFVDVMLSLMESADSEYRIERPNIKAVMLDMLVASMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS+S IEW ISEL +QP ++ KV++E+E+ VG++RMVEE+DLE  +YL++V+KE+LR+HP
Sbjct  304  TSASAIEWAISELIKQPRVLMKVQKELETVVGMERMVEETDLEMLEYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPL   HAA E+C ++GFHIPK S V VN WAIGRDP  W+DPEKF PERF  SS++ +
Sbjct  364  VVPLF-HHAAMEECTINGFHIPKKSRVIVNAWAIGRDPNAWNDPEKFIPERFLGSSIDLK  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFG+GRR CPG+QLG+ VV+LVVAQL+HCFDW LPNG++P +L+MTEEFGL+ 
Sbjct  423  GRDFQLIPFGAGRRHCPGLQLGLIVVKLVVAQLVHCFDWELPNGVIPTELDMTEEFGLTT  482

Query  902  NRAEHLMAIPTYRLH  946
             RA HL+AIPTYRLH
Sbjct  483  PRANHLLAIPTYRLH  497



>ref|XP_006354708.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=493

 Score =   419 bits (1076),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 190/316 (60%), Positives = 245/316 (78%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY D++LGEKGF A I + + I  LPN  ++FP L  LD+QG TRR K + KLFD
Sbjct  181  MIFGKKYMDEDLGEKGFNALIQDILCIAGLPNFAEFFPFLRVLDLQGFTRRSKELAKLFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++I++H        +    D VDT++EIM+SGE    F R+HVK+++LD+L+AS+D
Sbjct  241  EFLERVIDEH---VCDKFSHEHKDMVDTLMEIMQSGEGEFDFDRRHVKAILLDLLVASMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W ++EL R P +MKK++ E+E  VG +RMVEESDLE+ +YLE+VIKES R+HP
Sbjct  298  TSATTIDWILAELLRHPNVMKKLQNELEQVVGKNRMVEESDLENLEYLEMVIKESSRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDCEVDGFHIPKGS + +NVW IGRDP +W +PE F PERF  S+++ R
Sbjct  358  VAPLLIPHESIEDCEVDGFHIPKGSRLLINVWTIGRDPDIWVEPENFKPERFQGSNIDLR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+ FE LPFGSGRRSCPG+QLG+T VRLV+AQL+HCFDW LPNGM PKD++MTE+FGL  
Sbjct  418  GRHFELLPFGSGRRSCPGLQLGLTTVRLVLAQLVHCFDWKLPNGMTPKDIDMTEKFGLVT  477

Query  902  NRAEHLMAIPTYRLHI  949
             R +HL  IP YRLHI
Sbjct  478  TRVQHLRLIPKYRLHI  493



>ref|XP_011100884.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=496

 Score =   419 bits (1076),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 249/315 (79%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+KY D++L EKGFKA I E V I A  NL DYFP +G LD+QG+ R MK + K+FD
Sbjct  183  MIFGRKYADRDLDEKGFKAVISETVAIAAKFNLADYFPGIGVLDLQGMNRNMKRLSKIFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII+DH +  +K + + T DFVD M+ IM+SGE+  +F R++VK+V+LD+LIA +D
Sbjct  243  GFLEKIIDDHVQ--NKQEKKETEDFVDIMMAIMESGEAEFEFDRRNVKAVLLDLLIAGMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++  EW  SEL R P++MKK++ E+E+ VGL++MVEES L+  +YL+ V+KE+LR+HP
Sbjct  301  TSAAATEWAFSELIRHPQVMKKLQNELETVVGLEQMVEESHLDRLEYLDFVVKETLRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + +DC +DGFHIPKGS   VN+WAIGRDP VW DPE F PERF  S+++ R
Sbjct  361  VAPLLVPHESMQDCVIDGFHIPKGSRTMVNIWAIGRDPNVWPDPEAFKPERFIGSNIDIR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF  +PFGSGRR CPG+QLG+T+VRL+VAQL+HCFDW LPN MLP DL+M+E FGL  
Sbjct  421  GRDFRLIPFGSGRRGCPGLQLGLTMVRLLVAQLVHCFDWELPNCMLPSDLDMSEHFGLVT  480

Query  902  NRAEHLMAIPTYRLH  946
            +RA+HLMAIP YRLH
Sbjct  481  SRAKHLMAIPRYRLH  495



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 252/315 (80%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I E + + A PN GD+ P +  LD+QGLT+RMK V K+FD
Sbjct  185  MVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H ++  +   + T DFVD ML  M S ES  +  R ++K+++LD+L  ++D
Sbjct  245  AFFEKIIDEHIQSKDQ---ERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+++ IEWT+SEL + P +MKKV++E+E+ VG++R VEESDLE  +YL++V+KE++R+HP
Sbjct  302  TTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC V GFHIP+ S V +N++AIGRDP +W+D EKF PERF+ S++++R
Sbjct  362  VAPLLLPHAAIEDCNVSGFHIPRKSRVMINIFAIGRDPSIWTDAEKFIPERFDGSNIDFR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+F+PFGSGRR CPGMQLGIT+V+LVVAQL+HCFDW LPN MLP +L+MTEEFGL++
Sbjct  422  GRDFQFIPFGSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTV  481

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+A+PTYRL 
Sbjct  482  PRAKHLLAVPTYRLQ  496



>gb|AJD25256.1| cytochrome P450 CYP736A121 [Salvia miltiorrhiza]
Length=496

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 246/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKYDD+++ E+GFK  I E +K+ A+PNLGDYFP LG LD+QGLTR+MKA+ K+FD
Sbjct  184  MVFGKKYDDQDIDERGFKKVIQEGMKLAAVPNLGDYFPFLGVLDLQGLTRKMKALAKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EK+I DH  A   G+   T D VDTM+ IM+SGE   QF R+HVK++MLD+L AS+D
Sbjct  244  DFFEKVIEDHVGAGDHGE---TKDIVDTMMSIMQSGECEFQFDRRHVKAIMLDMLAASMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+++ ++W +SEL R P +M+KVK+E+E  VGL RMVEESDL+  +YL +V+KE+ R+HP
Sbjct  301  TAAASVDWILSELLRNPAVMEKVKKELEQVVGLKRMVEESDLDRLEYLNMVVKETYRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH ARE+  VDG++IPK S + VN +AIGRDP  W+DPEKF PERF  S ++ R
Sbjct  361  VAPLLIPHYAREESTVDGYNIPKESRIIVNTYAIGRDPNAWTDPEKFLPERFVGSDIDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F+ LPFGSGRR CPG+QLG+  VRL+V+QL+HCFDW LPN M PK+LNM E+F L +
Sbjct  421  GQHFQLLPFGSGRRGCPGIQLGLIQVRLIVSQLVHCFDWQLPNDMPPKELNMDEDFSLVV  480

Query  902  NRAEHLMAIPTYRLH  946
             RA  LMAIP++RL 
Sbjct  481  TRANPLMAIPSFRLQ  495



>ref|XP_008440675.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=494

 Score =   417 bits (1072),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 247/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY+D+E  E+GFK+ I EA+++ A PNLGD+ P +  LD+QGL RR KA+ K+FD
Sbjct  182  MVFGKKYEDQEFDERGFKSVIQEAMQLVASPNLGDFIPQIAGLDLQGLDRRSKAISKIFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II++H E+ ++ K   TMDFVD MLEIM S E+  Q  R ++K+++LD+L+A++D
Sbjct  242  GFLERIIDEHLESKNENK---TMDFVDVMLEIMGSQETEYQIERSNIKALILDMLVAAMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I W I EL + P +MKK+++E+E  VGLDR VEE+DL+H +YL++V+KE LR+HP
Sbjct  299  TSATTIGWAIPELIKHPHVMKKMQDELEKVVGLDRKVEETDLDHLEYLDMVVKEILRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+PH A EDC VDGF+IPK S + VN WAIGRDP  W DPEKFFPERF  S V+ R
Sbjct  359  PAPLLVPHEALEDCIVDGFYIPKKSRIIVNGWAIGRDPNFWIDPEKFFPERFIGSQVDVR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR CPGMQ+G+TVVRLV+AQL+HCFDW LPNG LP  L+MTEEFGL+ 
Sbjct  419  GRDFQLIPFGSGRRGCPGMQMGLTVVRLVIAQLVHCFDWELPNGTLPVKLDMTEEFGLTC  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+ LM  P YRLH
Sbjct  479  PRAQDLMVTPIYRLH  493



>ref|XP_006346716.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   417 bits (1071),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 247/316 (78%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGK+Y D E  E+GFK  I EA+ I   PN+G++FP L K D+QGL  RMK + K+FD
Sbjct  186  MIFGKEYMDDEFDERGFKDVIQEALIIAGTPNIGEFFPFLDKFDLQGLIPRMKKLAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE++I++H + + + K   T D VDTM+ IM+SGE+  +F R+HVK+++LD+LIASID
Sbjct  246  EFLERVIDEHVQNSKEEK--QTKDIVDTMMNIMQSGEAEFEFDRRHVKAILLDLLIASID  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W  SEL R P IMKK+++E+E  VG++RMVEESDL   +YL ++IKE  R+HP
Sbjct  304  TSATSIDWIFSELLRHPNIMKKLQKELEQVVGMNRMVEESDLGKLEYLNMIIKEGFRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            + PLLIP  + EDC +DGF+IP+GS + VN WAIGRD +VW +PEKF PERF  S ++ R
Sbjct  364  IAPLLIPRESMEDCIIDGFNIPRGSRILVNTWAIGRDSEVWPEPEKFMPERFVGSDIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPF SGRR CPG+QLG+TVVRLV+AQL+HCFDW LPN M+P DL+MTE+F L +
Sbjct  424  GHDFQLLPFSSGRRRCPGLQLGLTVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFSLVV  483

Query  902  NRAEHLMAIPTYRLHI  949
            +RA+HLMAIPTYRLH+
Sbjct  484  SRAQHLMAIPTYRLHV  499



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 251/315 (80%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D++L ++GFK+ + E   +   PNLGD+FP LG LD+QGLT R+KA+ K FD
Sbjct  183  MVFGKKFMDEDLDKRGFKSIVQEVAHLAVTPNLGDFFPYLGVLDLQGLTGRLKALSKFFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII +H ++  +   + T DFVDTM+ IM+SGE+  +F R+HVK+++LD+L AS+D
Sbjct  243  EFLEKIIEEHVQSKEQ---RETEDFVDTMMAIMQSGEAGFEFDRRHVKAILLDMLTASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW +SEL R P++MKK+++E+E  VGLDRMVEESDLE+ KYL++VIKE+LR+H 
Sbjct  300  TSATSVEWILSELLRHPQVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLHS  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL  H + EDC VDGF + KGS + VNV+A  RD   W +P+KFFPERF +S+V+ R
Sbjct  360  VAPLL-NHESIEDCVVDGFFVQKGSRIIVNVYAAQRDSNAWPEPDKFFPERFVESNVDLR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRRSCPGMQLGI +VRLVVAQL+HCFDW LPNGM P +L+M+E+FGL  
Sbjct  419  GHDFQLLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGLVT  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+HLMA+PTYRLH
Sbjct  479  YRAKHLMAVPTYRLH  493



>gb|EYU24035.1| hypothetical protein MIMGU_mgv1a020942mg [Erythranthe guttata]
Length=499

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 246/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+KYDD +LGE GFK+   E  +I+A  NL DYFP +G LD+QGL  R+K +GK+FD
Sbjct  185  MVFGRKYDDSDLGEMGFKSVFMETAEISAKFNLADYFPFIGALDLQGLNSRIKELGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII+DH +   K + + T DFVDTM+ +M SGE+  +F R+HVK+V+ D+LIA  D
Sbjct  245  GFLEKIIDDHLQ--EKPEKKETKDFVDTMMAVMNSGEAGFEFDRRHVKAVLQDMLIAGTD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW ISEL R P IMKK+++E+ES VGL+ MVEES LE  +YL+ V+KE+LR+HP
Sbjct  303  TSSTSVEWAISELIRHPSIMKKLQKELESTVGLNHMVEESHLEKLEYLDFVVKETLRLHP  362

Query  542  VVPLLIPHAAREDCEVDG-FHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
              PLLIP  + EDC ++G FHIPK S   VNVWAIGRDP  W++PE F+PERF  S V+ 
Sbjct  363  PAPLLIPRESMEDCTINGIFHIPKKSRAIVNVWAIGRDPSAWANPETFWPERFAGSDVDS  422

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ +PFGSGRRSCPG QLG+TVV+L++AQL+HCFDW LPNGMLP DL+M+E FG+ 
Sbjct  423  RGRDFQLIPFGSGRRSCPGQQLGLTVVKLMLAQLVHCFDWELPNGMLPSDLDMSEHFGVV  482

Query  899  LNRAEHLMAIPTYRL  943
            ++RAEHLM IP YRL
Sbjct  483  MSRAEHLMLIPKYRL  497



>ref|XP_009770688.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 250/315 (79%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKK+ D++LG++GFK+ + E   + A PNLGD+FP  G +D+QGLTRRMK + K+FD
Sbjct  184  MIFGKKFMDEDLGKRGFKSLVQEVTHLAATPNLGDFFPFFGIIDIQGLTRRMKDISKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF+EKII++H + T + K   T DFVDTM+ IM+SGE+  QF R+HVK+++LD+L+ASID
Sbjct  244  EFVEKIIDEHVQTTDQKK---TKDFVDTMMSIMQSGEAEFQFDRRHVKAILLDMLVASID  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW +SEL + P +M+K+++E+E  VGL+RMVEESDL++ KYL +V KES R+H 
Sbjct  301  TSSTSVEWMLSELLKNPNVMEKLQKELEEVVGLNRMVEESDLDNLKYLNMVFKESFRLHA  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+ H A EDC VD F+I KGS V VN ++I  DP VW + +KF PERF +S+V+ R
Sbjct  361  AAPLLL-HEAMEDCIVDDFYIQKGSQVIVNSYSIHMDPNVWPEADKFLPERFLESNVDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPGM L + +VRLVVAQL+HCFDW LPNGM PKDL+MTE+FG+  
Sbjct  420  GRDFQLLPFGSGRRSCPGMHLALIIVRLVVAQLVHCFDWKLPNGMQPKDLDMTEKFGIVT  479

Query  902  NRAEHLMAIPTYRLH  946
             RA+HLMAIPTYRLH
Sbjct  480  GRAKHLMAIPTYRLH  494



>ref|XP_004304846.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   415 bits (1066),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 246/314 (78%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +VFGKKY DKE  EKGF+A I E + +   PN GDY P L   D+QGLT+RMKAV K+FD
Sbjct  185  LVFGKKYMDKEFDEKGFQAWIVEGMHLAGTPNFGDYLPFLAPFDLQGLTKRMKAVRKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H    S+   + T DFVD ML  M S ES  +  R ++K+++LD++  ++D
Sbjct  245  DFFEKIIDEH--IKSQDDQERTKDFVDVMLCFMGSKESEYKIERSNIKAIILDMVAGAMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL R P +MKKV++E+E  VG+DRMV+ESDLE  +YL +V+KE+LR+HP
Sbjct  303  TSATAIEWTLSELMRHPRVMKKVQKELEDVVGMDRMVDESDLEKLEYLNMVVKENLRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAA EDC V+GFHIPK S V VNVWA+GRDP  W+DP+KF PERF  S+++ R
Sbjct  363  VAPLLIPHAAIEDCTVNGFHIPKKSRVMVNVWAVGRDPSAWTDPDKFIPERFVGSNIDLR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRR CPGM LG+TVV LVVAQL+HCFDW LP+ +LP +L+MTEEFGL++
Sbjct  423  GRDFQLLPFGSGRRGCPGMHLGLTVVHLVVAQLVHCFDWELPDNILPTELDMTEEFGLTV  482

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  483  PRAKHLLAIPSYRL  496



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 248/315 (79%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DK++ E+GFKA I E +++   PN+GDY P +  LD+QGL RRMKA+ K+FD
Sbjct  185  MIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYIPFVAPLDLQGLARRMKAISKVFD  244

Query  182  EFLEKIINDH-EEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
             F EKII+DH  E   +G+ +   D +D ML  M S E+  Q  R ++K+++LD+L  S+
Sbjct  245  AFFEKIIDDHIHEPKEEGQPK---DLIDVMLGYMGSKENEFQIERSNIKALVLDMLAGSM  301

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS++ IEW ++EL + P IMKKV+EE+E  VG++R VEESDLE  +YL++V+KE+LR+H
Sbjct  302  DTSATAIEWALAELLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLRLH  361

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PV PLLIPH + EDC V+GFHIP+ S V VN +AIGRDP VW+D EKF PERF  SS++ 
Sbjct  362  PVAPLLIPHESLEDCTVNGFHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFIGSSIDL  421

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ +PFGSGRR CPGMQLG+TVVRLV+AQL+HCFDW LPNGM+P +L+MTEEFGL+
Sbjct  422  RGRDFQLIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLT  481

Query  899  LNRAEHLMAIPTYRL  943
            + RA+H++A+PTYRL
Sbjct  482  VPRAKHILAVPTYRL  496



>ref|XP_004237435.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=500

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 190/316 (60%), Positives = 253/316 (80%), Gaps = 4/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D +L ++GFK+ + E V + A PNLGD+FP LG LD+QG+T R+K + K+FD
Sbjct  189  MVFGKKFMDDDLDKRGFKSLVQEVVHLAATPNLGDFFPYLGVLDLQGITSRLKTLSKVFD  248

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H E+  +   + T DFVDTM++IM+SGE+  +F R+HVK+V+LD+L+AS+D
Sbjct  249  EFLEKIIDEHVESKEQ---RETKDFVDTMMDIMQSGEAGFEFDRRHVKAVLLDMLMASMD  305

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E+E  VGLDRMV+ESDLE+  YL++VIKE+LR+H 
Sbjct  306  TSATSVEWILTELLRHPHVMKKLQKELEQVVGLDRMVDESDLENLNYLDMVIKEALRLHS  365

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLI H + EDC VDGF + KGS + VNV+A  RDP  W +P+KF PERF +SSV+ R
Sbjct  366  AAPLLI-HESIEDCVVDGFFVQKGSRIVVNVYAAQRDPNAWPEPDKFLPERFVESSVDLR  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRRSCPGMQLGI +VRLVVAQL+HCFDW LPNGM P +L+M+E+FG+  
Sbjct  425  GHDFQLLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVT  484

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLMAIPTYRL +
Sbjct  485  CRAKHLMAIPTYRLQL  500



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   414 bits (1063),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 244/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+E  E+GFK+ + EA+++ + PNLGDY   +  LD+QG T+RMK+V K FD
Sbjct  183  MVLGKKYRDEEFDERGFKSVVREAIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
               EKII +H +       + TMDFVD M+  M S ES  +  R H+K++MLD+L+AS+D
Sbjct  243  NLFEKIIEEHLQPND---GERTMDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW +SEL R P+ MKKV++E+E+ VGLD+MVEESDLE   YL +V+KE+ R+HP
Sbjct  300  TSATTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHA+ EDC V+G+HIPK S V +NVWAIGRDP  W+D EKF PERF  SSV+ R
Sbjct  360  VAPLLIPHASIEDCTVNGYHIPKKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+LV+AQL+HCFDW LPN MLP++L+MTEEFGL++
Sbjct  420  GNHFQLIPFGSGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTV  479

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  480  PRAKHLLAIPSYRL  493



>ref|XP_009615258.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   413 bits (1062),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 255/314 (81%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFKA + + + + A PNLGD+FP LG +D+QGLTR++K + K+FD
Sbjct  183  MVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++  +   + T DFVDTM+EIM+SGE+  QF R+H+K+++LD+L+A++D
Sbjct  243  EFLEKIIDEHVQSHDQ---KQTKDFVDTMMEIMQSGEAEFQFDRRHIKAILLDMLMAAMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E++  VG++RMVEESDLE+ KYL++V+KE LR+H 
Sbjct  300  TSATSVEWILTELLRHPNVMKKLQKELDEVVGIERMVEESDLENLKYLDMVVKEGLRLHS  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVP++  H A EDC VDGFHI KGS + +N +A+ RDP VW +PEKFFPERF  SSV+ R
Sbjct  360  VVPIM-HHEAMEDCVVDGFHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSSVDIR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPGMQLG+T+VRLVVAQL+HCFDW +PNGM P DL + E+FGL  
Sbjct  419  GRDFQLLPFGSGRRSCPGMQLGVTIVRLVVAQLVHCFDWEIPNGMQPLDLEIDEQFGLVT  478

Query  902  NRAEHLMAIPTYRL  943
             + + LMAIPTYRL
Sbjct  479  CKEKPLMAIPTYRL  492



>ref|XP_006365792.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 247/316 (78%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY ++E  E+GFK  + E V + A PN+G++FP L   D+QG   RMK + K+FD
Sbjct  187  MVLGKKYMEEEFDERGFKNIMEETVVLAASPNIGEFFPFLSVFDLQGFIGRMKELAKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EK+I++H ++  + KA+   D +DTM+ IM+SGE+  +F R+HVK+V+LD+LIAS D
Sbjct  247  DFFEKVIDEHVQSKDQKKAK---DIIDTMMTIMQSGEAEFKFDRRHVKAVLLDLLIASTD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T S+ I+W  SEL R P++MKK++ E+E  VG++RMVEESDLE  +YL++VIKE LR+HP
Sbjct  304  TISTAIDWIFSELLRHPKVMKKLQNELEQAVGINRMVEESDLERLEYLDMVIKEGLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL PH + EDC VDGF +PKGS + VNVWAIGRDP+ W DPEKF PERF  S+++ R
Sbjct  364  PSPLLTPHESIEDCIVDGFDVPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFIDSNIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRRSCPG+QLG+T+VRLV+AQL+HCFDW LPNGM+P  ++MTE+FGL  
Sbjct  424  GHDFQLLPFGSGRRSCPGLQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVT  483

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLMAIPTYRL++
Sbjct  484  PRAQHLMAIPTYRLNV  499



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 247/315 (78%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L E+GFKA I E +++ A PN+GDY P L  LD+QGLTRR+KA  K+FD
Sbjct  182  MVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H     K + QT  D VD ML++M S E+     R ++K++ LD++ AS+D
Sbjct  242  DFFEKIIDEHIH-KPKEEGQTK-DLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW +SEL + P +MKKV+ E+E  VG++RMVEESDLE  +YL +V+KE+LR+HP
Sbjct  300  TSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLLIPH + EDC VDGFHIP+ S V VNVWAIGRDP  W+D +KF PERF +S +++R
Sbjct  360  VVPLLIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F+F+PFGSGRR CPGMQLG+TVVRLV+AQL+HCFDW LP+ ML  +L+M EEFGL+L
Sbjct  420  GQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTL  479

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIPT R H
Sbjct  480  PRAKHLVAIPTCRFH  494



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 247/315 (78%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L E+GFKA I E +++ A PN+GDY P L  LD+QGLTRR+KA  K+FD
Sbjct  182  MVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H     K + QT  D VD ML++M S E+     R ++K++ LD++ AS+D
Sbjct  242  DFFEKIIDEHIH-KPKEEGQTK-DLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW +SEL + P +MKKV+ E+E  VG++RMVEESDLE  +YL +V+KE+LR+HP
Sbjct  300  TSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLLIPH + EDC VDGFHIP+ S V VNVWAIGRDP  W+D +KF PERF +S +++R
Sbjct  360  VVPLLIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F+F+PFGSGRR CPGMQLG+TVVRLV+AQL+HCFDW LP+ ML  +L+M EEFGL+L
Sbjct  420  GQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTL  479

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIPT R H
Sbjct  480  PRAKHLVAIPTCRFH  494



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   412 bits (1059),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 249/315 (79%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L E+GFK+ + E + ++A PNLGDY P +G LD+QGLT+RMKA+ K+ D
Sbjct  181  MVFGKKYLDEDLDERGFKSVMQEVMHLSAAPNLGDYIPQIGALDLQGLTKRMKAISKVLD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+ KII++H +   KGK +   DFVD ML  MKS E+     +  +K++MLD+L  S+D
Sbjct  241  LFVSKIIDEHAQYQEKGKNK---DFVDVMLSCMKSEENEYLVDQGCMKAIMLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+VI+W  SEL + P +MKKV++E+E  VG  RMVEESDLE  +YL++V+KE+ R+HP
Sbjct  298  TSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMVEESDLESLEYLDMVVKETFRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH A EDC V+GFHIPK S V +NVWAIGRDPK W+D E F+PERF  S ++ R
Sbjct  358  VGPLLIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAENFYPERFVGSDIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++F+ +PFG+GRRSCPGMQLG+TVVRLV+AQL+HCFDW LPNG+LP +++MTEEFGL +
Sbjct  418  GRNFQLIPFGAGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVI  477

Query  902  NRAEHLMAIPTYRLH  946
             R++HL+AIPTYRL+
Sbjct  478  CRSKHLVAIPTYRLN  492



>ref|XP_007211842.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
 gb|EMJ13041.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
Length=497

 Score =   412 bits (1059),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 241/314 (77%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+E  E+GFK+ + E +++ + PNLGDY P +  LD+QG T+RMK+V K FD
Sbjct  183  MVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
               EK I +H +       + T DFVD M+  M S ES  +  R H+K++MLD+L+AS+D
Sbjct  243  NLFEKSIEEHLQPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SEL R P+ MKKV++E+E+ VGLD+MVEESDLE   YL +V+KE+ R+HP
Sbjct  300  TSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHA+ EDC V+G+HIPK S V +NVWAIGRDP  W+DPEKF PERF  SSV+ R
Sbjct  360  VAPLLVPHASIEDCTVNGYHIPKNSRVLINVWAIGRDPNAWTDPEKFIPERFEGSSVDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+LV+AQL+HCFDW LPN MLP +L+MTEEFG ++
Sbjct  420  GNHFQLIPFGSGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPDELDMTEEFGFTV  479

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  480  PRAKHLLAIPSYRL  493



>ref|XP_004253509.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=493

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 243/315 (77%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D +L ++GFK  + E   + A PNLGD+FP LG +D+QGLTRRMK   K+ D
Sbjct  181  MVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRRMKDTSKVLD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+EKII++H  A  + K +   DFVDTM++IM+SGE+  QF R+HVK+VMLD+L+ASID
Sbjct  241  PFVEKIIDEHVNAKEQKKNK---DFVDTMMDIMQSGEAEFQFDRRHVKAVMLDMLVASID  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSSS IEW +SEL R P+IMKK++ E+E  VGL+RMV+ESDLE+ KYL +V KES R+H 
Sbjct  298  TSSSSIEWMLSELLRNPDIMKKLQRELEEVVGLNRMVQESDLENLKYLNMVFKESFRLHA  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+ H A EDC VD F+I KGS V VN + I RDP  W+D +KF PERF +S+V+ R
Sbjct  358  AAPLLL-HEAMEDCVVDDFYIKKGSQVIVNAYTIHRDPNFWTDADKFMPERFLESNVDVR  416

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+D++ LPFGSGRRSCPGMQL + +VRLVVAQL+HCFDW LPN M PKDL+MTE+FG+  
Sbjct  417  GRDYQLLPFGSGRRSCPGMQLALIIVRLVVAQLVHCFDWELPNEMNPKDLDMTEQFGIVT  476

Query  902  NRAEHLMAIPTYRLH  946
             RA HLMA+PTYRL 
Sbjct  477  GRANHLMAVPTYRLQ  491



>ref|XP_008440668.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   412 bits (1059),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 246/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D++  E+GFKA I E +++ A PNLGD+ P +  LD+QG TR+MK+V K++D
Sbjct  187  MAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFIPAIAWLDLQGFTRKMKSVHKVYD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H  A    K   T DFVD ML+++ S ++  Q  R  +K++MLD+L A++D
Sbjct  247  EFLEKIINEHLVARGGKK---TRDFVDVMLDLIDSQQTEYQIDRSTIKAIMLDMLAAAMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I W +SEL RQP++MKK++ E++  VGLDRMVEESDL   +YLE+V+KE +R++P
Sbjct  304  TSSTTIGWAMSELIRQPDVMKKMQSELQKVVGLDRMVEESDLVSLEYLEMVVKEIMRLYP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLIPH + EDC V+GFHIPK S + VN WAIGRDP VW+DP KFFPERF  S ++ +
Sbjct  364  AGPLLIPHESLEDCTVNGFHIPKKSRLIVNAWAIGRDPSVWNDPHKFFPERFIGSQIDLK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFG+GRR CPGMQLG+T+VRL++AQL+HCFDW LPNGMLP +L+MTEEFGL+ 
Sbjct  424  GKDFELIPFGAGRRGCPGMQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMTEEFGLTC  483

Query  902  NRAEHLMAIPTYRLH  946
             RA+ LM IPT+RL+
Sbjct  484  PRAQDLMVIPTFRLY  498



>ref|XP_007212357.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
 gb|EMJ13556.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
Length=497

 Score =   411 bits (1057),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 241/314 (77%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+E  E+GFK+ + E +++ + PNLGDY P +  LD+QG T+RMK+V K FD
Sbjct  183  MVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
               EKII +H +       + T DFVD M+  M S ES  +  R H+K++MLD+L+AS+D
Sbjct  243  NLFEKIIEEHLQPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SEL R P+ MKKV++E+E+ VGLD+MVEESDLE   YL +V+KE+ R+HP
Sbjct  300  TSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHA+ EDC V+G+HIPK S V +NVWAIGRDP  W+D EKF PERF  SSV+ R
Sbjct  360  VAPLLVPHASIEDCTVNGYHIPKKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+LV+AQL+HCFDW LPN MLP  L+MTEEFGL++
Sbjct  420  GNHFQLIPFGSGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPDGLDMTEEFGLTV  479

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  480  PRAKHLLAIPSYRL  493



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   410 bits (1054),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 249/316 (79%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D E  E+GFK  I E +++ A PNLGDY P +  LD+QGLT+RMK+V K+FD
Sbjct  186  MVFGKKYSDDEFDERGFKTVIQEGMELAAKPNLGDYIPQIAGLDLQGLTKRMKSVAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII++H ++  + +   T DFVD ML    S E+  +  R+H+K+++LD+L A++D
Sbjct  246  GFLEKIIDEHVQSKDENR---TKDFVDVMLSFEGSEETEHKIEREHIKAIILDMLSAAMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW +SEL + P++MKK+++E+E  VGL RMVEESDLE+ +YL++V+KE+LR+HP
Sbjct  303  TSATAVEWALSELIKHPKVMKKLQKELEKIVGLCRMVEESDLENLEYLDMVVKETLRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC V+GF+IPK S V VNVWAIGRD + WSDPE FFPERF  SS++ R
Sbjct  363  VAPLLIPHESTEDCTVNGFYIPKNSRVIVNVWAIGRDTESWSDPEIFFPERFVGSSIDLR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CPGMQLG+T+V+ V+AQL+HCFDW LP GMLP +L++TEEF L  
Sbjct  423  GHDFQLLPFGSGRRGCPGMQLGLTIVKQVIAQLVHCFDWELPGGMLPTELDLTEEFSLVT  482

Query  902  NRAEHLMAIPTYRLHI  949
             +A+HL+AIP+YRL+I
Sbjct  483  PKAKHLLAIPSYRLNI  498



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 251/315 (80%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELG-EKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            MVF +KY DK+L  EKGFK  I EA++     NL DYFP +G  D+QG+ R+MK++ K F
Sbjct  206  MVFRRKYADKDLDHEKGFKTLIMEALEFAGKFNLADYFPYVGFFDLQGMNRKMKSLSKTF  265

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D FLEK+I+DH    +K K + T DFVDTM+EIM+SG +  QF R+HVK+V+LDILIA I
Sbjct  266  DRFLEKLIDDH--VKNKQKKKQTKDFVDTMMEIMESGNAEFQFDRRHVKAVLLDILIAGI  323

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS+S IEW ++EL R P +MKK+++E+E+ VG+D+MVEES L   +YL+ V+KE+LR+H
Sbjct  324  DTSTSAIEWALAELIRHPRVMKKLQKELETVVGMDQMVEESHLHGLEYLDFVVKETLRLH  383

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PV PLLIPH + EDC +DG+HIPKGS   VNVWAIGRDP VW DPE F PERF  S+++ 
Sbjct  384  PVGPLLIPHESMEDCVIDGYHIPKGSRAIVNVWAIGRDPNVWPDPEVFKPERFIGSNIDL  443

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ LPFGSGRRSCPG+QLG+T+V+LV++QL+HCFDW LPNGM P DL+M+E FGL+
Sbjct  444  RGRDFQLLPFGSGRRSCPGLQLGLTMVQLVLSQLVHCFDWQLPNGMQPSDLDMSEHFGLT  503

Query  899  LNRAEHLMAIPTYRL  943
            + RA+HL+AIP+YRL
Sbjct  504  VARAKHLVAIPSYRL  518



>ref|XP_009629564.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=431

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 250/314 (80%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++  ++GFKA + E V     PNLGD+FP LG +D+QGL R++K + K+FD
Sbjct  120  MVFGKKYMDEDFDKRGFKAVVQEVVHFGGRPNLGDFFPFLGVIDLQGLNRKLKDLSKVFD  179

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++  +   + T DFVDTM+EIM+SGE+  QF RQH+K++++D+LIA+ D
Sbjct  180  EFLEKIIDEHVQSHDQ---KQTKDFVDTMMEIMQSGEAEFQFDRQHIKAILVDMLIAATD  236

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E++  VG++RMV+ESDLE+ KYL++VIKE LR+H 
Sbjct  237  TSATSVEWILTELIRHPHVMKKLQKELDEVVGIERMVDESDLENMKYLDMVIKEGLRLHS  296

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            +VP+L  H A EDC VDGFHI KGS + +N +AI RDP VW +PEKFFPERF  SSV+ R
Sbjct  297  IVPVL-HHEAMEDCVVDGFHIQKGSRIMINCYAIQRDPNVWPEPEKFFPERFVGSSVDIR  355

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSG+RSCPGMQLGIT+VRLVVAQL+HCFDW L NGM P DL++ E+FG+  
Sbjct  356  GRDFQLLPFGSGKRSCPGMQLGITIVRLVVAQLVHCFDWELQNGMQPLDLDIDEQFGMVA  415

Query  902  NRAEHLMAIPTYRL  943
             + + LMAIPTYRL
Sbjct  416  CKEKPLMAIPTYRL  429



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 242/314 (77%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+E  E+GFK+ + E +++ + PNLGDY   +  LD+QG T+RMK+V K FD
Sbjct  183  MVLGKKYRDEEFDERGFKSVVRELIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
               EKII +H +       + TMDFVD M+  M S ES  +  R H K++MLD+L+AS+D
Sbjct  243  NLFEKIIEEHLQPND---GERTMDFVDVMVGFMGSEESEYRIERPHTKAIMLDMLVASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW +SEL R P+ MKKV++E+E+ VGLD+MVEESDLE   YL +V+KE+ R+HP
Sbjct  300  TSATTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHA+ EDC V+G+HIPK S V +NVWAIGRDP  W+D EKF PERF  SSV+ R
Sbjct  360  VAPLLVPHASIEDCTVNGYHIPKKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+LV+AQL+HCFDW LPN MLP++L+MTEEFGL++
Sbjct  420  GNHFQLIPFGSGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTV  479

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  480  PRAKHLLAIPSYRL  493



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 242/314 (77%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D E   +GFK  I E +K+ A PNLGDY P +  LD+QGLT+RMKAV K+FD
Sbjct  187  MVFGKKYMDDEFDARGFKVVIQEGMKLAAAPNLGDYIPQIAWLDLQGLTKRMKAVSKVFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H +   + +   T DFVD MLE + S  S     R H+K+++LD+L  S+D
Sbjct  247  GFFEKIIDEHIQFKDESR---TKDFVDVMLEFVGSEVSEYHIGRDHIKAIILDMLAGSMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VIEW +SEL + P IMKKV++E+E  VGL++MVEESDLE+ +YLE+VIKE+ R+HP
Sbjct  304  TSAAVIEWALSELLKHPRIMKKVQKELELKVGLNKMVEESDLENLEYLEMVIKETFRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH A +D  VDG+ IPK S + +N WAIGRDP  W+DPE+F PERF  ++V++R
Sbjct  364  VAPLLIPHQATQDTIVDGYLIPKNSHIVINTWAIGRDPSAWTDPERFLPERFAGNNVDFR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRR CPG+QLG+TVVRLV+AQL+HCFDW LPN MLP +L+M+EEF L  
Sbjct  424  GRDFQLLPFGSGRRGCPGIQLGVTVVRLVLAQLVHCFDWELPNDMLPNELDMSEEFSLVT  483

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+A+PTYRL
Sbjct  484  PRAKHLLALPTYRL  497



>ref|XP_006354704.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=497

 Score =   409 bits (1050),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 242/315 (77%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D +L ++GFK  + E   + A PNLGD+FP LG +D+QGLTRRMK   K+ D
Sbjct  185  MVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRRMKDTSKVLD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+EKII++H  A    K +   DFVDTM+EIM+SGE+  QF R+HVK+VMLD+L+ASID
Sbjct  245  PFVEKIIDEHVNAKDHKKNK---DFVDTMMEIMQSGEAEFQFDRRHVKAVMLDMLVASID  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSSS IEW +SEL R P+IMKK+++E+E  VGL+RMV+ESDLE+ KYL +V KES R+H 
Sbjct  302  TSSSSIEWMLSELLRNPDIMKKLQKELEEVVGLNRMVQESDLENLKYLNMVFKESFRLHA  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+ H A EDC VD F+I KGS V VN + I RDP  W+D +KF PERF +S+V+ R
Sbjct  362  AAPLLL-HEAMEDCMVDDFYIKKGSQVIVNAYTIHRDPNFWTDADKFLPERFLESNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+D++ LPFGSGRRS PGMQL + +VRLVVAQL+HCFDW LPN M PKDL+MTE+FG+  
Sbjct  421  GRDYQLLPFGSGRRSFPGMQLALIIVRLVVAQLVHCFDWELPNEMQPKDLDMTEQFGIVT  480

Query  902  NRAEHLMAIPTYRLH  946
             RA HLMA+PTYRL 
Sbjct  481  GRANHLMAVPTYRLQ  495



>gb|EYU24031.1| hypothetical protein MIMGU_mgv1a004909mg [Erythranthe guttata]
Length=505

 Score =   409 bits (1050),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 248/320 (78%), Gaps = 9/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY+DK++G +GFK+ I E +K+ ALPNLGDYFP LG  D+QG   +MK + K +D
Sbjct  187  MVFGKKYEDKDMGGRGFKSVIEEGMKLAALPNLGDYFPFLGIFDLQGFKSKMKKIAKAYD  246

Query  182  EFLEKIINDHEEATSK------GKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDI  343
            +F EK+I++H    ++      GKA+   D VDT++ IM+SG++  QF R HVK++MLD+
Sbjct  247  DFFEKVIDEHVNGAAEAADRADGKAR---DIVDTLMSIMQSGDAEFQFDRGHVKAIMLDM  303

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            L AS+DT++S +EW ++ L + P++MKKV+EE+E  VGL+RMVEESDL+  KYL++V+KE
Sbjct  304  LAASMDTAASTVEWILALLIKNPKVMKKVQEELEQVVGLERMVEESDLDQLKYLDMVVKE  363

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNK  703
            + R+HPV PLLIPH + EDC V+G+HIPK S V VN  AIGRDP VW+ P +FFPERF  
Sbjct  364  TFRLHPVAPLLIPHYSTEDCTVNGYHIPKESRVIVNTHAIGRDPNVWARPNEFFPERFVG  423

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S ++ RGQ FE LPFGSGRR CPGMQLG+  VRL+V+QL+HCFDW LP GMLP++L+MTE
Sbjct  424  SEIDLRGQHFELLPFGSGRRGCPGMQLGLIQVRLIVSQLVHCFDWKLPEGMLPEELDMTE  483

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            EF L ++RA  L+AIPT+RL
Sbjct  484  EFSLVVSRANPLIAIPTFRL  503



>ref|XP_006354701.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=496

 Score =   408 bits (1049),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 251/316 (79%), Gaps = 4/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D++L ++GFK  + E V + A PNLGD+FP LG LD+QG+T R+KA+ K+FD
Sbjct  185  MVFGKKFMDEDLDKRGFKYLVQEVVHLAATPNLGDFFPYLGVLDLQGITSRLKALSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H E+  +   + T DFVDTM++IM+SGE+  +F R HVK+V+LD+L+ S+D
Sbjct  245  EFLEKIIDEHVESKEQ---KETKDFVDTMMDIMQSGEAGFKFDRCHVKAVLLDMLMTSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E+E  VGLDRMVEESDLE+  YL++VIKE+LR+H 
Sbjct  302  TSATSVEWILTELLRHPHVMKKLQKELEQVVGLDRMVEESDLENLNYLDMVIKEALRLHS  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLI H + +DC VDGF + KGS + VNV+A  RDP  W +P+KF PERF +S+V+ R
Sbjct  362  AAPLLI-HESIQDCVVDGFFVQKGSRIIVNVYAAQRDPNAWPEPDKFLPERFVESTVDLR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPF SGRRSCPGMQLGI +VRLVVAQL+HCFDW LPNGM P +L+M+E+FG+  
Sbjct  421  GHDFQLLPFSSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVN  480

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HLMAIPTYRL +
Sbjct  481  CRAKHLMAIPTYRLQL  496



>ref|XP_009782203.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=494

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 252/314 (80%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D +L ++GFKA + + V + A PNLGD+FP LG +D+QGLTR++K + K+FD
Sbjct  183  MVFGKKYMDADLDKRGFKAVVQDVVHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII+DH ++      + T DFVDTM+EIM+SGE+  QF  +++K+++LD+L+A+ID
Sbjct  243  EFLEKIIDDHVQSHDD---KQTKDFVDTMMEIMQSGEAEFQFDCRNIKAILLDMLMAAID  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E+E  VG+++MVEESDLE+ KYL++V+KE LR+H 
Sbjct  300  TSATSVEWILTELLRHPHVMKKLQKELEELVGIEKMVEESDLENLKYLDMVVKEGLRLHS  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            +VP++  H A EDC VDGFHI KGS + +N +A+ RDP VW +PEKFFPERF  S+V+ R
Sbjct  360  IVPIM-HHEAMEDCVVDGFHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSNVDTR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPGMQLGIT+V LVVAQL+HCFDW +PNGM P DL++ E+FGL  
Sbjct  419  GRDFQLLPFGSGRRSCPGMQLGITIVSLVVAQLVHCFDWEIPNGMQPLDLDIDEQFGLVT  478

Query  902  NRAEHLMAIPTYRL  943
             + + LMAIPTYRL
Sbjct  479  CKEKPLMAIPTYRL  492



>ref|XP_009631554.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=503

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 247/315 (78%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D++L ++GFK+ + E   + A PNLGD+FP  G +D+QGLTRRMK + K+FD
Sbjct  192  MVFGKKFMDEDLDKRGFKSLVQEVTHLAATPNLGDFFPFFGVIDIQGLTRRMKDISKVFD  251

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF+EKII++H + T + K   T DFVDTM+ IM+SGE+  QF R+HVK+V+LD+L+ASID
Sbjct  252  EFVEKIIDEHVQTTDQKK---TKDFVDTMMSIMQSGEAEFQFDRRHVKAVLLDMLVASID  308

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW +SEL + P +M+K+++E+E  V LDRMVEESDL+  KYL +V KES R+H 
Sbjct  309  TSSTSVEWMLSELLKNPNVMEKLQKELEEVVVLDRMVEESDLDKLKYLNMVFKESFRLHA  368

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+ H A EDC VD F+I KGS V VN ++I  DP VW + +KF PERF +S+V+ R
Sbjct  369  AAPLLL-HEAMEDCMVDDFYIQKGSQVIVNSYSIHMDPNVWPEADKFLPERFLESNVDVR  427

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPGM L + +VRLVVAQL+HCFDW LPNG+ PKDL+MTE+FG+  
Sbjct  428  GRDFQLLPFGSGRRSCPGMHLALIIVRLVVAQLVHCFDWKLPNGIQPKDLDMTEKFGIVT  487

Query  902  NRAEHLMAIPTYRLH  946
             RA++LMAIPTYRLH
Sbjct  488  GRAKNLMAIPTYRLH  502



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 240/314 (76%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D+E  E+GFK+ + E +++ + PNLGDY P +  LD+QG T+RMK+V K FD
Sbjct  183  MVLGKKYKDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
               EKII +H +       + T DFVD M+  M S ES  +  R H+K++MLD+L+AS+D
Sbjct  243  NLFEKIIEEHLKPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SEL R P+ MKKV++E+E+ VGLD+MVEESDL    YL +V+KE+ R+HP
Sbjct  300  TSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLGKLDYLNMVVKETFRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHA+ EDC V+G+HIPK S V +NVWA GRDP  W+D EKF PERF  SSV+  
Sbjct  360  VAPLLVPHASTEDCTVNGYHIPKKSRVLINVWATGRDPNAWTDAEKFIPERFEGSSVDVT  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+LV+AQL+HCFDW LPN MLP++L+MTEEFGL++
Sbjct  420  GNHFQLIPFGSGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTV  479

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+AIP+YRL
Sbjct  480  PRAKHLLAIPSYRL  493



>ref|XP_011025622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Populus euphratica]
Length=493

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 249/315 (79%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L E+GFK+ + E + ++A P+LGDY P +  LD+QGLT+RMKA+ K+ D
Sbjct  181  MVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVLD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             +L KII++H +   KGK +   DFVD ML  MKS E+     +  +K++MLD+L  S+D
Sbjct  241  VYLNKIIDEHAQYQEKGKNK---DFVDVMLSFMKSEENEHLVDQGCMKAIMLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VI+W  SEL + P +MKK+++E+E  VG  RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  298  TSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMVEESDLERLEYLDMVVKETLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL+IPH A EDC V+GFHIPK S V +NVWAIGRDPK W+D EKF+PERF  S ++ R
Sbjct  358  AGPLMIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++F+ +PFG+GRRSCPGMQLG+TVVRLV+AQL+HCFDW LPNG+LP +++MTEEFGL +
Sbjct  418  GRNFQLIPFGTGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVM  477

Query  902  NRAEHLMAIPTYRLH  946
             R++HL+AIPTYRL+
Sbjct  478  CRSKHLVAIPTYRLN  492



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   406 bits (1044),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 249/315 (79%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L E+GFK+ + E + ++A P+LGDY P +  LD+QGLT+RMKA+ K+ D
Sbjct  181  MVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVLD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             +L KII++H +   KGK +   DFVD ML  MKS E+     +  +K++MLD+L  S+D
Sbjct  241  VYLNKIIDEHAQYQEKGKNK---DFVDVMLSFMKSEENEHLVDQGCMKAIMLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VI+W  SEL + P +MKK+++E+E  VG  RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  298  TSATVIDWAFSELIKNPRVMKKLQKELEEAVGKQRMVEESDLERLEYLDMVVKETLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL+IPH A EDC V+GFHIPK S V +NVWAIGRDPK W+D EKF+PERF  S ++ R
Sbjct  358  AGPLMIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++F+ +PFG+GRRSCPGMQLG+TVVRLV+AQL+HCFDW LPNG+LP +++MTEEFGL +
Sbjct  418  GRNFQLIPFGTGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVM  477

Query  902  NRAEHLMAIPTYRLH  946
             R++HL+AIPTYRL+
Sbjct  478  CRSKHLVAIPTYRLN  492



>ref|XP_008364815.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=499

 Score =   405 bits (1042),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 245/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GF A + E +K++A PNLGDY P +  LD+QG T++MKA+ K FD
Sbjct  187  MVFGKKYKDEEFDERGFTAVMKEGLKLSAGPNLGDYIPCIAPLDLQGFTKKMKAINKAFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EKII+ H ++  +   + T DFVD M+  M S +S  +  R ++K++MLD+   S+D
Sbjct  247  EFFEKIIDXHLQSKDE---ERTKDFVDVMVAFMGSEDSDYRIERTNIKAIMLDMFAGSMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+S+ +EW +SEL R P++MKKV++E+E+ VGL+RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  304  TTSTTVEWALSELMRHPQVMKKVQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC VDG+H+PK S V +N WAIGRD   W D EKF PERF  ++V+ R
Sbjct  364  VAPLLVPHAAIEDCIVDGYHVPKKSLVIINAWAIGRDQSAWEDAEKFVPERFEGNNVDVR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+ V+AQL+HCFDW LP+ MLP DL+MTE+FGL++
Sbjct  424  GNHFQLIPFGSGRRRCPGIQLGLTVVQFVLAQLVHCFDWELPDNMLPNDLDMTEDFGLTV  483

Query  902  NRAEHLMAIPTYRLH  946
            +RA+HL+AIP+YRL 
Sbjct  484  SRAKHLLAIPSYRLQ  498



>ref|XP_004504031.1| PREDICTED: cytochrome P450 750A1-like [Cicer arietinum]
Length=502

 Score =   405 bits (1042),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 187/315 (59%), Positives = 243/315 (77%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DK+L EKGFK+ I E + + A PN+GDY P +  LD+QGLTRRMK +GK+FD
Sbjct  186  MVFGKKYMDKDLDEKGFKSVIQEGMHLAATPNIGDYIPYIAPLDLQGLTRRMKTIGKIFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +  S  K   T DFVD ML  + + ES  +  R ++K++MLD+L  S+D
Sbjct  246  DFFEKIIDEHIQ--SDNKDDKTKDFVDVMLGFVGTQESEYRIERPNIKAIMLDMLAGSMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ISEL R P +MKKV++E+E  VGL R V ESDL+  +YL++VIKE+ R+HP
Sbjct  304  TSATSVEWAISELLRNPRVMKKVQKELEIVVGLKRKVVESDLDKLEYLDMVIKENFRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC V+ F IPK S V VN W++ RDP  W+DPEKF+PERF  S+++ +
Sbjct  364  VAPLLIPHQSLEDCMVEDFFIPKKSRVIVNAWSVMRDPNAWTDPEKFWPERFEGSNIDVK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+F+PFGSGRR CPG+QLG+TVVRLVVAQL+HCFDW L N MLP DL+M EEFGL++
Sbjct  424  GRDFQFIPFGSGRRGCPGIQLGLTVVRLVVAQLVHCFDWRLCNHMLPSDLDMEEEFGLTM  483

Query  902  NRAEHLMAIPTYRLH  946
             RA HL+AIPTYRL+
Sbjct  484  PRANHLIAIPTYRLY  498



>ref|XP_002310015.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90465.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   405 bits (1042),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 244/316 (77%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  EKGFK   HEA+++TA  NLGDY P +  LD+QGLT+RMKAVGK+FD
Sbjct  185  MVFGKKYLEKEFDEKGFKPLTHEAMRLTASFNLGDYIPPIAPLDLQGLTKRMKAVGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DFVD ML+ + S E+  +  R ++K+++LD+L+ S+D
Sbjct  245  DFFEKIIDEHIQIKDENR---TKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TSAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC +DGF IP+ + V VNVWAIGRD   W+D  KF PERF  S+++ R
Sbjct  362  VAPLLVPHESMEDCTIDGFLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCPGM LG+T+VR +VAQL+HCF+W LPN MLP++L+MTE F L  
Sbjct  422  GRDFQLLPFGSGRRSCPGMHLGLTMVRQIVAQLVHCFEWELPNNMLPEELDMTEAFSLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  482  PRANHLCATPTYRLHL  497



>ref|XP_009372714.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   405 bits (1041),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 244/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY  +E  E+GF A + EA+K++A PNLGDY P +  LD+QG T++MKA+ K FD
Sbjct  187  MVFGKKYKYEEFDERGFTAVMKEALKLSAGPNLGDYIPCIAPLDLQGFTKKMKAINKAFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EKIIN+H ++  +   + T DFVD M++ M S +S  +    ++K++MLD+   S+D
Sbjct  247  EFFEKIINEHLQSKDE---ERTKDFVDVMVDFMGSEDSDYRIEHTNIKAIMLDMFAGSMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T+S+ +EW +SEL R P++MK V++E+E+ VGL+RMVEESDLE   YL++V+KE+LR+HP
Sbjct  304  TTSTTVEWALSELMRHPQVMKTVQKELENVVGLNRMVEESDLEKLDYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC VDG+H+PK S V +N WAIGRDP  W D EKF PERF  +SV+ R
Sbjct  364  VAPLLVPHAAIEDCIVDGYHVPKKSRVIINAWAIGRDPSAWEDAEKFVPERFEGNSVDVR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+ V+AQL+HCFDW LP+ MLP DL+MTE FG+++
Sbjct  424  GNHFQLIPFGSGRRRCPGIQLGLTVVKFVLAQLVHCFDWELPDNMLPNDLDMTEGFGITV  483

Query  902  NRAEHLMAIPTYRLH  946
            +RA+HL+AIP+YRL 
Sbjct  484  SRAKHLLAIPSYRLQ  498



>ref|XP_004143568.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 243/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E+ E+GFKA I E ++++A PNLGD+ P +  LD+QG TR+MK V K++D
Sbjct  188  MAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVYD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H  A    K   T DFVD ML+++ S ++  Q  R  +K++MLD+L  ++D
Sbjct  248  EFLEKIINEHLVARGGKK---TRDFVDVMLDLIGSQQTEYQIDRSAIKAIMLDMLAGAMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I W +SEL R P++MKK+++E++  VGL RMV+ESDL + +YLE+V+KE +R++P
Sbjct  305  TSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVNLEYLEMVVKEIMRLYP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL IP  + EDC VDGFHIPK S V VNVWAIGRDP VW+DP KFFPERF  S ++ +
Sbjct  365  AGPLSIPRESLEDCTVDGFHIPKKSRVIVNVWAIGRDPSVWNDPHKFFPERFIGSQIDLK  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DFE +PFG GRR CPGMQLG+T+VRL++AQL+HCFDW LPNGMLP +L+MTEEFGL+ 
Sbjct  425  GNDFELIPFGGGRRGCPGMQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMTEEFGLTC  484

Query  902  NRAEHLMAIPTYRLH  946
             RAE LM IPT+RL+
Sbjct  485  PRAEDLMVIPTFRLN  499



>ref|XP_011090597.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=495

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 246/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D +L EKGFKA I E +++ ALPN+ DYFP L  LD+QGLTRRMK + K FD
Sbjct  183  MVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYFPFLAALDLQGLTRRMKELSKTFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II+DH +  +K + +   DF DTM+ IM+SGE+  +F R+HVK+V+L I++A   
Sbjct  243  GFLERIIDDHIQ--NKQEKKHAQDFADTMITIMESGEAGFEFDRRHVKAVLLVIILAXXX  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+V+EW +SEL R P+ MKK+++E+E  VG+D++VEES L+  +YL++V+KE+LR+HP
Sbjct  301  TSSTVVEWALSELIRHPKAMKKLQQELEQAVGMDQIVEESHLDRLEYLDMVVKETLRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             VPLLI H + EDC VD FH+PKGS V VNVW+IG+DP  W +P+KF PERF  S+++ R
Sbjct  361  AVPLLI-HESLEDCVVDQFHVPKGSRVIVNVWSIGKDPNAWREPQKFLPERFIGSNIDLR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQDF+ +PFGSGRR CPG+QLG+TVVRLV+AQL+HCFDW LP+GM+  +L+M E FGL  
Sbjct  420  GQDFQLIPFGSGRRGCPGLQLGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVT  479

Query  902  NRAEHLMAIPTYRL  943
             R  HL+A+PTYRL
Sbjct  480  CRENHLLAVPTYRL  493



>ref|XP_002310008.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
 gb|EEE90458.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
Length=493

 Score =   404 bits (1037),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 249/315 (79%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L E+GFK+ + E + ++A P+LGDY P +  LD+QGLT+RMKA+ K+ D
Sbjct  181  MVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVLD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FL+KII++H +   KGK +   DFVD ML  MKS E+     +  +K+ MLD+L+ S+D
Sbjct  241  VFLDKIIDEHVQYQEKGKNK---DFVDVMLSFMKSEENEYLVDQGCMKATMLDMLVGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VI+W  SEL + P +MKK+++E+E  VG  RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  298  TSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMVEESDLERLEYLDMVVKETLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL+IPH A EDC V+ FHIPK S V +NVWAIGRDPK W+D EKF+PERF  S ++ R
Sbjct  358  AGPLMIPHEATEDCVVNDFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFG+GRRSCPGMQLG+T+VRLV+AQ++HCFDW LPNG+LP +++M+EEFGL L
Sbjct  418  GRDFQLIPFGTGRRSCPGMQLGLTMVRLVLAQMVHCFDWELPNGILPSEVDMSEEFGLVL  477

Query  902  NRAEHLMAIPTYRLH  946
             R++HL++IPTYRL+
Sbjct  478  CRSKHLVSIPTYRLN  492



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   404 bits (1037),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 241/316 (76%), Gaps = 4/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GFKA + E + +TA PN+GDY P L   D+QGLT+RMKAV ++FD
Sbjct  184  MVFGKKYMDREFDERGFKAVVQEVMVLTATPNIGDYVPFLASFDLQGLTKRMKAVSRVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H E T K + QT  DFVD ML IM   E      R H+K+++LD+L  S+D
Sbjct  244  AFFEKIIDEHLE-TKKEEGQTK-DFVDVMLGIMGLNEGEYHIDRPHIKAIILDMLAGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW ++EL + P  MKK++EE+E   GL+R+VEESDLE   YL +VIKE++R+HP
Sbjct  302  TSATAIEWAMAELIKHPRAMKKLREELEKAAGLNRVVEESDLEGLDYLHMVIKETMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS--DPEKFFPERFNKSSVE  715
            V PLL+PH A EDC V+GFHIP  S V VNVW+IGRDPKVW+  DPE+F PERF  SSV+
Sbjct  362  VAPLLLPHEATEDCTVNGFHIPYKSRVIVNVWSIGRDPKVWTTHDPEEFVPERFLGSSVD  421

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF+ LPFG+GRR CPGMQLG+TVVR VVAQL+HCFDW LP+GM P +L+MTE+FGL
Sbjct  422  VKGRDFQLLPFGTGRRGCPGMQLGLTVVRFVVAQLVHCFDWELPSGMSPSELDMTEKFGL  481

Query  896  SLNRAEHLMAIPTYRL  943
            +  RA+HL+  P YRL
Sbjct  482  ATPRAKHLVVTPRYRL  497



>emb|CDP12933.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   403 bits (1036),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 245/314 (78%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DK+  ++GF+  I E + + A+PNLGDYFPLLG LD+QGLTRR K + K+FD
Sbjct  185  MIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYFPLLGVLDLQGLTRRFKDLAKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++    + + T DFVD M+ IM+SGE+  +F R+HVK+++LD+L+AS+D
Sbjct  245  KFFEKIIDEHLQSQ---EHKQTKDFVDIMMGIMQSGEAEFEFDRRHVKAILLDLLVASMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS + +EW ISEL R PE M+K+++E+E  VGL+R+VEESD+E  +YL++VIKES+R+HP
Sbjct  302  TSVTAVEWAISELLRHPEAMRKLQKELEEKVGLERIVEESDIEGLEYLDMVIKESMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC VD FHI K S + +N++ IGRDP VW DPE F PERF  S+++ R
Sbjct  362  VAPLLLPHESMEDCTVDDFHIQKKSRIIINIYTIGRDPNVWPDPETFNPERFKDSNIDLR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQDF  +PFGSGRRSCPG+QLG+ +VR V+AQL+HCF+W L + + P DL+M+E FG+  
Sbjct  422  GQDFRLIPFGSGRRSCPGLQLGLLLVRFVLAQLVHCFNWELADNIRPTDLDMSEAFGIVT  481

Query  902  NRAEHLMAIPTYRL  943
            +RA HL  IPTYRL
Sbjct  482  SRATHLRVIPTYRL  495



>ref|XP_006354722.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=494

 Score =   403 bits (1035),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 248/315 (79%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFK+ + + V + A PNLGD+FP +G +D+QGLTR++K + K+FD
Sbjct  183  MVFGKKYMDEDLDKRGFKSVVQDVVHLAATPNLGDFFPFIGAIDLQGLTRKLKDLSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H  +  +   + T DFVDTM+ IM+SGE+  QF R+H+K+++ D+LIA++D
Sbjct  243  EFLEKIIDEHVHSHDQ---KQTKDFVDTMMGIMQSGEAEFQFDRRHIKAILFDMLIAAMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T++S  EW ++EL R P++MKK+++E++  VGL+RMVEESDLE+ KYL +V+KE LR+HP
Sbjct  300  TTASSTEWILTELLRHPQVMKKLQKELQEVVGLERMVEESDLENLKYLNMVVKEGLRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPL   H + EDC VDGFHI KGS V VN +A  RDP VW DPEKF PERF  S +++R
Sbjct  360  VVPLFY-HESMEDCVVDGFHIQKGSRVMVNCYAAQRDPNVWPDPEKFLPERFVGSCIDFR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRRSCPGMQL + VVRLVVAQL+HCF+W LPNGM P DL++ E+FG+  
Sbjct  419  GRDFQLVPFGSGRRSCPGMQLAVMVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGIVT  478

Query  902  NRAEHLMAIPTYRLH  946
             R + LMAIPTY L+
Sbjct  479  CREKPLMAIPTYNLN  493



>ref|XP_003596030.1| Cytochrome P450 [Medicago truncatula]
 gb|AES66281.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   402 bits (1033),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 244/314 (78%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +VFGKKY DK+L EKGFKA++ E + + A PN+ D+ P +G LD+ GLTRRMKA+GK+FD
Sbjct  161  IVFGKKYSDKDLNEKGFKASMQELMSLAATPNIADFIPYIGALDLNGLTRRMKAIGKIFD  220

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++ +K   +T  DFVD ML  + + ES  +  R ++K +M+D+LI S D
Sbjct  221  EFLEKIIDEHIQSENKDDNKTK-DFVDVMLGFVGTEESDYRIERSNIKGIMMDMLIGSTD  279

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWTISEL + P +MKKV++E+E+ VG+ R VEESDL+  +YL +VIKESLR+HP
Sbjct  280  TSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKVEESDLDKLEYLNMVIKESLRIHP  339

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PH + EDC V+ F IPK S + VN WAI RDP  W+DPEKF+PERF  ++++  
Sbjct  340  VVPLLVPHQSMEDCTVEDFFIPKNSRIIVNGWAIMRDPNSWTDPEKFWPERFEGNNIDVG  399

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ +PFGSGRR CPG+ LG+T+VRLVVAQ++HCFD  LPN MLP DL+MTE FG+++
Sbjct  400  GHDFQLIPFGSGRRGCPGLHLGLTMVRLVVAQIVHCFDLKLPNDMLPSDLDMTEAFGITM  459

Query  902  NRAEHLMAIPTYRL  943
             RA HL+A+P YRL
Sbjct  460  PRANHLIALPVYRL  473



>gb|AJD25258.1| cytochrome P450 CYP736A123 [Salvia miltiorrhiza]
Length=488

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 239/317 (75%), Gaps = 6/317 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEK-GFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+KY D++L E+ GFKA   EA+ ITA  NL DYFP +G LD+ GL RRMK +  +F
Sbjct  177  MILGRKYSDRDLDEQDGFKALFSEALDITAQFNLADYFPYIGGLDLHGLNRRMKRLSNVF  236

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D FLEKI+ DH       K Q + DFVDTM+ IM SGE+  +F R H+K+V+LD+LIA +
Sbjct  237  DGFLEKIMEDHLH-----KKQQSHDFVDTMMAIMDSGEAGFEFDRTHIKAVLLDLLIAGM  291

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS++  EWT+SEL R P +MKK++EE+ES VGL+ MVEES L+  +YLE V+KE +R+H
Sbjct  292  DTSATATEWTMSELLRHPTVMKKLQEELESMVGLESMVEESHLDKLEYLECVVKEVMRLH  351

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PV PLLIPH + EDCE+ GFHIPK S V VNVWAIGRDP VW++P+ F PERF  S ++ 
Sbjct  352  PVAPLLIPHESMEDCELQGFHIPKKSRVMVNVWAIGRDPDVWANPDSFTPERFVGSDIDM  411

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+ FE +PF SGRR CPGMQLG  +V+L+VAQL+HCF W LPNGM P D++M+E FGL 
Sbjct  412  RGRHFELIPFSSGRRGCPGMQLGSALVKLLVAQLVHCFHWELPNGMKPHDIDMSEHFGLV  471

Query  899  LNRAEHLMAIPTYRLHI  949
              RA+ LMA+PTYRLHI
Sbjct  472  TARAKRLMAVPTYRLHI  488



>ref|XP_003531375.1| PREDICTED: cytochrome P450 750A1-like isoform X1 [Glycine max]
Length=498

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 246/315 (78%), Gaps = 1/315 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++L EKGFKA + E + + A PN+GDY P +GKLD+QGL +RMKAV K+FD
Sbjct  181  MVLGKKYMDQDLDEKGFKAVVQEVMHLLATPNIGDYIPYIGKLDLQGLIKRMKAVRKIFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF +KII++H + + KG+     DFVD ML  + S E   +  R ++K+++LD+L+ S+D
Sbjct  241  EFFDKIIDEHIQ-SDKGQDNKVKDFVDVMLGFVGSEEYEYRIERPNIKAILLDMLLGSMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VIEWT+SEL + P +MKKV+ E+E+ VG+ R V+ESDL+  +YL++VIKE++R+HP
Sbjct  300  TSATVIEWTLSELLKNPRVMKKVQMELETVVGMQRKVKESDLDKLEYLDMVIKENMRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH +REDC V  F IP+ S V +N WAI RD  VWS+ EKF+PERF  S+++ R
Sbjct  360  VAPLLIPHQSREDCMVGDFFIPRKSRVVINAWAIMRDSSVWSEAEKFWPERFEGSNIDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+F+PFGSGRR+CPGMQ+G+T+VRL VAQL+HCF W LP+ MLP  L+MTEEFGL++
Sbjct  420  GHDFQFIPFGSGRRACPGMQMGLTMVRLTVAQLVHCFHWKLPSDMLPDHLDMTEEFGLTM  479

Query  902  NRAEHLMAIPTYRLH  946
             RA HL+A+PTYRLH
Sbjct  480  PRANHLLAVPTYRLH  494



>ref|XP_006354705.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=504

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 241/315 (77%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKK+ D++L ++GFK  + E   + A PNLGD+FP LG +D+QGLTRRMK   K+ D
Sbjct  192  MVFGKKFTDEDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRRMKDTSKVLD  251

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+EKII++H  A    K +   DFVDTM++IM+SGE   QF R+HVK+VMLD+L+ASI 
Sbjct  252  PFVEKIIDEHVNAKDHKKNK---DFVDTMMDIMQSGEVEFQFDRRHVKAVMLDMLVASIG  308

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSSS IEW +SEL + P+IMKK+++E+E  VGL+RMVEESDLE+ KYL +V KES R+H 
Sbjct  309  TSSSSIEWMLSELLKNPDIMKKLQKELEEVVGLNRMVEESDLENLKYLNMVFKESFRLHV  368

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLL+ H A EDC VD F++ KGS V VN + I RDP  W++ +KF PERF +S+V+ R
Sbjct  369  AAPLLL-HEAMEDCMVDDFYVKKGSQVIVNAYTIHRDPNFWTNADKFLPERFLESNVDVR  427

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+D++ LPFGSGRRSCPGMQL + +VRLVVAQL+ CFDW LPN M PKDL+MTE+FG+  
Sbjct  428  GRDYQLLPFGSGRRSCPGMQLALIIVRLVVAQLVQCFDWELPNEMQPKDLDMTEQFGMVT  487

Query  902  NRAEHLMAIPTYRLH  946
             RA HLMA+PTYRL 
Sbjct  488  GRASHLMAVPTYRLQ  502



>ref|XP_004143571.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus]
Length=414

 Score =   398 bits (1023),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 241/319 (76%), Gaps = 7/319 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E  E+GFK+ I EA++I A PNLGD+ P +  LD+QGL RR KAV K+FD
Sbjct  98   MVFGKKYKDQEFDERGFKSVIQEAMQIVASPNLGDFIPQIAVLDLQGLDRRSKAVSKIFD  157

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKS----VMLDILI  349
            EF E+II++H E+  + K   T DFVD MLEIM S  +  Q  R   +S    + +D+L+
Sbjct  158  EFFERIIDEHLESRYENK---TKDFVDVMLEIMDSHGTEYQIERSIKESRRIWLTVDMLV  214

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
            A++DTS++ I W I EL + P +MKK+++E++  VGLDR VEE+DL+H +YL++V+KE L
Sbjct  215  AAMDTSATTIGWAIPELIKHPHVMKKMQDELQKVVGLDRKVEETDLDHLQYLDMVVKEIL  274

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSS  709
            R+HP  PLL+PH A EDC VDGF+IPK S + VN WAIGRDP  W DPEKFFPERF  S 
Sbjct  275  RLHPPAPLLVPHEALEDCIVDGFYIPKKSRIIVNGWAIGRDPNFWIDPEKFFPERFIGSQ  334

Query  710  VEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEF  889
            V+ RG+DF+ +PFGSGRR CPGMQ+G+TVVRLV+AQL+HCFDW LPNG LP +L+MTEEF
Sbjct  335  VDVRGKDFQLIPFGSGRRGCPGMQMGLTVVRLVIAQLVHCFDWELPNGTLPVELDMTEEF  394

Query  890  GLSLNRAEHLMAIPTYRLH  946
            GL+  RA+ LM  P YRL+
Sbjct  395  GLTCPRAQDLMVTPIYRLN  413



>ref|XP_004143567.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=359

 Score =   396 bits (1017),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 245/331 (74%), Gaps = 19/331 (6%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E+ E+GFKA I E ++++A PNLGD+ P +  LD+QG TR+MK V K++D
Sbjct  22   MAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVYD  81

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H  A    K   T DFVD ML+++ S ++  Q  R  +K++MLD+L A++D
Sbjct  82   EFLEKIINEHLVARGGKK---TRDFVDVMLDLIGSQQTEYQIDRSAIKAIMLDMLAAAMD  138

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIE----------------SHVGLDRMVEESDLEH  493
            TSS+ I W +SEL R P++MKK+++E+E                  VGL RMV+ESDL +
Sbjct  139  TSSTTIGWAMSELIRHPDVMKKMQDELELIRHPDVMKKMQDELQEVVGLHRMVQESDLVN  198

Query  494  FKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP  673
             +YLE+V+KE +R++P  PLLIP  + EDC VDGFHIPK S V VNVWAIGRDP VW+DP
Sbjct  199  LEYLEMVVKEIMRLYPAGPLLIPRESLEDCTVDGFHIPKKSRVIVNVWAIGRDPSVWNDP  258

Query  674  EKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNG  853
             KFFPERF  S ++ +G DFE +PFG GRR CPG+QLG+T+VRL++AQL+HCFDW LPNG
Sbjct  259  HKFFPERFIGSQIDLKGNDFELIPFGGGRRGCPGIQLGLTMVRLLLAQLVHCFDWKLPNG  318

Query  854  MLPKDLNMTEEFGLSLNRAEHLMAIPTYRLH  946
            MLP +L+MTEEFGL+  RA+ LM IPT+RL+
Sbjct  319  MLPSELDMTEEFGLTCPRAKDLMVIPTFRLN  349



>ref|XP_008364814.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=498

 Score =   400 bits (1029),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 241/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +GF + + E +K+ A PNLGD+ P +  LD+QGLT++MKAV K FD
Sbjct  186  MVFGKKYKDEEFGGRGFASVMKEGMKLAAAPNLGDFIPCIAPLDLQGLTKKMKAVNKAFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EK+I++H +   K   + T DF+D ML  M S  S  +  R ++K++M D+  AS D
Sbjct  246  EFFEKVIDEHLQYKDK---ERTKDFIDAMLAHMGSEGSDYRIERLNIKAMMSDMFAASAD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ ++W +SEL R P++MKKV++E+E+ VGL RMVEESD+E  +YL++V+KE++R+HP
Sbjct  303  TSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMVEESDMEKLEYLDMVVKETMRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PHAA EDC VDG+HIPK S V VN WAIGRDP  W D EKF PERF  ++V+ R
Sbjct  363  VVPLLLPHAAIEDCTVDGYHIPKKSRVIVNAWAIGRDPSAWEDAEKFVPERFEGNNVDVR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR C GMQLGITVV  V+AQL+HCFDW LP+ MLP +L+MTEEFGL +
Sbjct  423  GHHFQLVPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVV  482

Query  902  NRAEHLMAIPTYRLH  946
            +RA++L+AIP+YRL 
Sbjct  483  SRAKNLLAIPSYRLQ  497



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 240/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  EKGFK   HE +++ A  NLGDY P +  LD+QGLT+RMKAVGK+FD
Sbjct  185  MVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKAVGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DFVD ML+ + S E+     R ++K+++LD+L+ S+D
Sbjct  245  DFFEKIIDEHIQFKDENR---TKDFVDVMLDFLGSEETEYSIGRDNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL R P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL PH + EDC +DGF IP+ + V VNVWAIGRD   W+D  KF PERF  S+++ R
Sbjct  362  VAPLLGPHESMEDCTIDGFLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPGM LG+T+VR +VAQL+HCFDW LPN MLP++L+MTE FGL  
Sbjct  422  GRDFQLLPFGAGRRGCPGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  482  PRANHLCATPTYRLHL  497



>ref|XP_002310005.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
 gb|EEE90455.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
Length=500

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 244/309 (79%), Gaps = 3/309 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L E+GFK+ + E + +TA P+LGDY P +  LD+QGLT+RM A+ K+FD
Sbjct  181  MVFGKKYVDEDLDERGFKSVMQEVMHLTAAPHLGDYIPQIAALDLQGLTKRMNAISKVFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FL+KII++H +   KGK +   DFVD ML +MKS E+     +  +K+ MLD+L+ S+D
Sbjct  241  VFLDKIIDEHVQYQEKGKNK---DFVDVMLSLMKSEENEYLVDQGCMKATMLDMLVGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VI+W  SEL + P +MKK+++EIE  VG  RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  298  TSATVIDWAFSELIKNPRVMKKLQKEIEEVVGKQRMVEESDLERLEYLDMVVKETLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL+IPH A EDC V+GFHIPK S V +NVWAIGRDPK W+D EKF+PERF  S ++ R
Sbjct  358  AGPLMIPHEATEDCVVNGFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFG+GRRSCPGMQLG+TVVRLV+AQL+HCFDW LPNG+LP +++MTEEFGL L
Sbjct  418  GRDFQLIPFGTGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVL  477

Query  902  NRAEHLMAI  928
             R++HL+ I
Sbjct  478  CRSKHLIKI  486



>ref|XP_006428070.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
 ref|XP_006493870.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41310.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
Length=498

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 240/314 (76%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKK  D E  E+GF+  + E +++   PNLGDY P +  LD+QGLT+R KAV K +D
Sbjct  186  MVLGKKCSDDEFDERGFENVVQEGMELVGKPNLGDYIPQITGLDLQGLTKRSKAVAKAYD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII++H ++  + +   T DFVD ML    S ++  +  R+H+K+++LD+L  ++D
Sbjct  246  AFLEKIIDEHVQSKDENR---TEDFVDVMLSFEGSEDTEKKIEREHIKAILLDMLAGAMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS +V+EW +SEL + P +MKK++ E+E+ VGL RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  303  TSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVKETLRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL+ PH + EDC V+GFHIPK S V VN WAIGRDPK W+DPEKFFPERF  SSV+ R
Sbjct  363  VAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFIGSSVDVR  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRR+CPGMQL +TVV+ V AQL+HCFDW LP GMLP +L+MTEEFGL  
Sbjct  423  GRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVT  482

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+A+P+YRL
Sbjct  483  YRAKHLLAVPSYRL  496



>ref|XP_004162313.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E+ E+GFKA I E ++++A PNLGD+ P +  LD+QG TR+MK V K++D
Sbjct  188  MAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVYD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H  A    K   T DFVD ML+++ S ++  Q  R  +K++MLD+L A++D
Sbjct  248  EFLEKIINEHLVARGGKK---TRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAAAMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I W +SEL R P++MKK+++E++  VGL RMV+ESDL   +YLE+V+KE +R++P
Sbjct  305  TSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVSLEYLEMVVKEIMRLYP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLIP  + EDC VDGFHIPK S V VNVW IGRDP VW+DP KFFPERF  S ++ +
Sbjct  365  AGPLLIPRESVEDCTVDGFHIPKKSRVIVNVWTIGRDPSVWNDPHKFFPERFIGSKIDLK  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DFE +PFG GRR CPG+QLG+T+VRL++AQL+HCFDW LPNGMLP +L+M EEFGL+ 
Sbjct  425  GNDFELIPFGGGRRGCPGIQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMIEEFGLTC  484

Query  902  NRAEHLMAIPTYRLH  946
             RA+ LM IPT+RL+
Sbjct  485  PRAKDLMVIPTFRLN  499



>ref|XP_006346619.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=493

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 249/315 (79%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++  ++GFKA + E V + A+ NLGD+FP LG +D+QGLTRR+K + K+FD
Sbjct  181  MVFGKKYMDQDFDKRGFKAVLQEVVHLAAITNLGDFFPFLGVIDLQGLTRRLKDLSKVFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H E+  + +++   DFVDTML+IM+SG+   QF R H+K+V+ D+++A+ID
Sbjct  241  EFLEKIINEHVESRDENQSK---DFVDTMLDIMQSGKMEFQFDRIHIKAVLFDMIVAAID  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W ++EL R P +MKK++ E+E  VGL+RMV+ESDLE+ KYL++V+KE +R+H 
Sbjct  298  TSATSIDWILTELLRHPHVMKKLQNELEQVVGLERMVKESDLENLKYLDMVVKEGMRLHS  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVP+     A EDC VDGF+I KG+ + +N +AI RDP VWS+PEKFFPERF  SSV+ R
Sbjct  358  VVPV-TQREAMEDCVVDGFNIRKGTRIMINHYAIQRDPNVWSEPEKFFPERFIGSSVDVR  416

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPF SGRRSCP +QLGI VVRLVVAQL+HCFDW LPN M P DL++ E FG+  
Sbjct  417  GRDFQLLPFNSGRRSCPAIQLGIIVVRLVVAQLVHCFDWELPNDMQPCDLDLEEHFGIVT  476

Query  902  NRAEHLMAIPTYRLH  946
            ++ +HLMAIPTYRL+
Sbjct  477  SKEKHLMAIPTYRLN  491



>emb|CDP01387.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 244/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DK+  ++GF+  I EA+++ A PNLGDYFPLLG LD+QGLTRR K + K+FD
Sbjct  185  MIFGKKYMDKDFDDRGFRDVIQEALRLGATPNLGDYFPLLGVLDLQGLTRRFKDLAKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++      + T D VD M+ IM+SGE+  +F R+HVK+V+LD+L+AS+D
Sbjct  245  KFFEKIIDEHLQSQEH---KQTKDVVDIMMGIMQSGEAEFEFDRRHVKAVLLDLLVASMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS + +EW ISEL R+PE M+K+++E+E  VGL+R VEESD+E  +YL++VIKE++R+HP
Sbjct  302  TSVTAVEWAISELLRRPEAMRKLQKELEDKVGLERTVEESDVEGLEYLDMVIKETMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC VD FHI K S + +NV+AIG DP VW DPE F PERF  S+++ R
Sbjct  362  VAPLLLPHESMEDCAVDDFHIQKKSRIIINVYAIGHDPNVWPDPETFIPERFKDSNIDLR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQDF+ +PFGSGRR CPG+QLGI +VR V+AQL+HCF+W   + + P DL+M+E FGL L
Sbjct  422  GQDFQLIPFGSGRRGCPGLQLGILLVRFVLAQLVHCFNWEPADNIKPTDLDMSETFGLVL  481

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL  +PTYRL 
Sbjct  482  ARAKHLKVVPTYRLQ  496



>ref|XP_006354707.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=383

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 237/315 (75%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY++ +     FK  + E  ++ A PNL + FP L  +D QG   RMK + K  D
Sbjct  70   MVIGKKYNNVD---GDFKDMVKETSRMAATPNLAELFPFLRFIDFQGSIHRMKQIAKSCD  126

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE +I++H    S  +++T+ D VDT++EIM+SGE+  +F R+HVK+++LD+L+AS+D
Sbjct  127  EFLENVIDEHARQYSSDQSKTSTDMVDTLMEIMQSGEAEFEFDRRHVKAILLDLLVASMD  186

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SELFR P +MKK++ E++  VG   +VEE DLE+  YL +VIKE  R+HP
Sbjct  187  TSSTSIEWILSELFRHPNVMKKLQSELDYVVGQKGIVEEKDLENLDYLNMVIKEGFRLHP  246

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC +DGFHIPKGS V VNVWAIGRDP VW +PEKF PERF +S+++ R
Sbjct  247  VAPLLLPHESIEDCTLDGFHIPKGSRVLVNVWAIGRDPDVWHEPEKFIPERFVESTIDVR  306

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ+F+ LPFGSGRRSCPG+QLG+T+VRLVVAQL+H FDW  PNGM+  D+NMTE+FGL  
Sbjct  307  GQNFQLLPFGSGRRSCPGLQLGLTIVRLVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVT  366

Query  902  NRAEHLMAIPTYRLH  946
             RA  LMAIP YRLH
Sbjct  367  ARALSLMAIPIYRLH  381



>ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 239/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I E + + A PNLG+Y P +  LD+QGLT+RMKAV K+FD
Sbjct  193  MVFGKKYMDKEFDERGFKAVIQEGMHLGAAPNLGNYIPQIAGLDLQGLTKRMKAVSKVFD  252

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H E   + +   T DFVD ML  M S  S     R ++K+++LD+L  S+D
Sbjct  253  SFFEKIIDEHMEFKDENR---TKDFVDVMLGFMGSEVSEYHIGRDNIKAIILDMLAGSMD  309

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VIEW +SEL + P +MKKV++E+E  VG+ RMVEESD+E  +YLE+VIKE+ R+HP
Sbjct  310  TSAAVIEWALSELLKHPGVMKKVQKELEEKVGMTRMVEESDVEKLEYLEMVIKETFRLHP  369

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH A ED  +DG+ IPK S + +N +AIGRDP  W++ EKF PERF   +++ R
Sbjct  370  VAPLLLPHEAAEDTTIDGYLIPKKSHIIINTFAIGRDPSAWTEAEKFLPERFLGRNIDIR  429

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPG+QLG+TVVRLVVAQL+HCFDW LPNGMLP +L+MTEEF L  
Sbjct  430  GRDFQLLPFGAGRRGCPGIQLGMTVVRLVVAQLVHCFDWELPNGMLPTELDMTEEFSLVT  489

Query  902  NRAEHLMAIPTYRLHI  949
             RA+HL AIP YRLHI
Sbjct  490  PRAKHLEAIPNYRLHI  505



>ref|XP_006365795.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY ++E  E+GFK   +EA  + A PN+ ++FP L   D+QG   RMK + K+FD
Sbjct  187  MVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEFFPFLSVFDLQGFIARMKDLAKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EK+I++H ++  + +A+   D VDTM+ IM+SGE+  +  R+ VK+V+LD+L+AS D
Sbjct  247  EFFEKVIDEHVQSKEQNQAK---DMVDTMMTIMQSGEAEFKIDRRDVKAVLLDLLLASTD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
              S  I+W +SEL R P++MKK++ E+E  VG++RMVEESDLE  +YL++VI+E LR+HP
Sbjct  304  NVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRMVEESDLERLEYLDMVIREGLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
               LL PH + EDC VDGF IPKGS + VNVWAIGRDP+ W DPEKF PERF  S+++ R
Sbjct  364  PSTLLTPHESIEDCIVDGFDIPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRRSCPG+QLG+T+VRLV+AQL+HCFDW LPNGM+P  ++MTE+FGL  
Sbjct  424  GHDFQLLPFGSGRRSCPGLQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVT  483

Query  902  NRAEHLMAIPTYRLH  946
             RA+HLMAIPTYRL+
Sbjct  484  PRAQHLMAIPTYRLN  498



>ref|XP_006380462.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
 gb|ERP58259.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
Length=497

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 240/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  EKGFK   HE +++ A  NLGDY P +  LD+QGLT+RMK VGK+FD
Sbjct  185  MVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKVVGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DFVD ML+ + S E+  +  R ++K+++LD+L+ S+D
Sbjct  245  DFFEKIIDEHIQFKDENR---TKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL R P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL PH + EDC +DGF IP+ + V VNVWAIGRD   W+D  KF PERF  S+++ R
Sbjct  362  VAPLLGPHESMEDCTIDGFLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPGM LG+T+VR +VAQL+HCFDW LPN MLP++L+MTE FGL  
Sbjct  422  GRDFQLLPFGAGRRGCPGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  482  PRANHLCATPTYRLHL  497



>ref|XP_004162327.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=504

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 240/315 (76%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D++  E+GFKA I E ++  A PNLGD+ P +  LD+QG TR+MK V K++D
Sbjct  188  MEFGKKYGDEDFDERGFKAVIQEGMQFAAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVYD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKIIN+H  A    K   T DFVD ML+++ S ++  Q  R  +K++MLD+L  ++D
Sbjct  248  EFLEKIINEHLVARGGKK---TRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAGAMD  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I W +SEL R P++MKK+++E++  VGL RMV+ESDL + +YLE+V+KE +R++P
Sbjct  305  TSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVNLEYLEMVVKEIMRLYP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PL IP  + EDC VDGFHIPK S V VNVWAIGRDP VW+DP KFFPERF  S ++ +
Sbjct  365  AGPLSIPRESLEDCTVDGFHIPKKSRVIVNVWAIGRDPSVWNDPHKFFPERFIGSQIDLK  424

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DFE +PFG GRR CPGMQLG+T+VRL++AQL+HCFDW LPNGMLP +L+MTEEFGL+ 
Sbjct  425  GNDFELIPFGGGRRGCPGMQLGLTMVRLLLAQLVHCFDWELPNGMLPPELDMTEEFGLTC  484

Query  902  NRAEHLMAIPTYRLH  946
             RAE LM IPT+RL+
Sbjct  485  PRAEDLMVIPTFRLN  499



>gb|KEH15707.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=430

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 242/313 (77%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGK Y DK L EKGFKA + E + + A PN+ DY P +G LD++GL++RMK + K+FD
Sbjct  118  MVFGKNYLDKGLYEKGFKAVVQELMNLAATPNISDYIPYIGALDLKGLSKRMKEISKIFD  177

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++ +K   +T  DFVD ML+ + + +S  +  R ++K++M+D+LI ++D
Sbjct  178  EFLEKIIDEHVQSQNKDDDKTK-DFVDVMLDFVGTEQSEYRIERSNIKAIMMDMLIGAMD  236

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWTISEL + P +MKKV++E+E+ VG+ R VEESDL+  +YL IVIKESLR+HP
Sbjct  237  TSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKVEESDLDKLEYLNIVIKESLRIHP  296

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PH + EDC V+ F IPK S + VN WAI RDP  W+DPEKF+PERF  ++++  
Sbjct  297  VVPLLVPHQSMEDCTVEEFFIPKNSMIVVNAWAIMRDPNSWTDPEKFWPERFEGNNIDVG  356

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ +PF SGRR CPG+QLG+T+VRLVVAQL+HCFD+ LPN MLP DL+M E FG+++
Sbjct  357  GHDFQLIPFSSGRRGCPGLQLGLTMVRLVVAQLVHCFDFKLPNHMLPSDLDMAEAFGVTM  416

Query  902  NRAEHLMAIPTYR  940
             RA HL+AIP YR
Sbjct  417  RRANHLIAIPVYR  429



>ref|XP_002310016.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
 gb|EEE90466.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
Length=497

 Score =   398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 240/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  EKGFK   HE +++ A  NLGDY P +  LD+QGLT+RMKAVGK+FD
Sbjct  185  MVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKAVGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DFVD ML+ + S E+  +  R ++K+++LD+L+ S+D
Sbjct  245  DFFEKIIDEHIQFKDENR---TKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL R P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL PH + EDC +DGF IP+ + V VNVWAIGRD   W+D  +F PERF  S+++ R
Sbjct  362  VAPLLGPHESMEDCTIDGFLIPQKTRVIVNVWAIGRDQSAWTDANRFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPGM LG T+VR +VAQL+HCFDW LPN MLP++L+MTE FGL  
Sbjct  422  GRDFQLLPFGAGRRGCPGMHLGQTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  482  PRANHLCATPTYRLHL  497



>gb|KHN38214.1| Cytochrome P450 71A1 [Glycine soja]
Length=436

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 240/314 (76%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++L EKGFKA + E + + A PN+GDY P +  LD+QGLT+RMK VGK+FD
Sbjct  120  MVLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYIPYIAALDLQGLTKRMKVVGKIFD  179

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H + + KG+ +T  DFVD ML+ + + ES  +  R ++K+++LD+L  S+D
Sbjct  180  DFFEKIIDEHLQ-SEKGEDRTK-DFVDVMLDFVGTEESEYRIERPNIKAILLDMLAGSMD  237

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKKV+ E+E+ VG+ R VEESDL+   YL++V+KES+R+HP
Sbjct  238  TSATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKVEESDLDKLVYLDMVVKESMRLHP  297

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC V    IPK S V VN WAI RDP  W + EKF+PERF  SS++ R
Sbjct  298  VAPLLIPHQSTEDCMVGDLFIPKKSRVIVNAWAIMRDPSAWDEAEKFWPERFEGSSIDVR  357

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++FE +PFGSGRR CPG+QLG+TVVRL VAQ++HCFDW LP  +LP DL+M EEFGL++
Sbjct  358  GREFELIPFGSGRRGCPGLQLGLTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTM  417

Query  902  NRAEHLMAIPTYRL  943
             RA HL AIPTYRL
Sbjct  418  PRANHLHAIPTYRL  431



>ref|XP_008440671.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D++  E+GFKA I E +++ A PNLGD+ P +  LD+QG TR++K V K++D
Sbjct  187  MAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFIPTIAWLDLQGFTRKIKRVHKVYD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +FL+KIIN+H  A  + K   T DFVD ML+++ S ++  Q  R  +K++MLD+L A++D
Sbjct  247  DFLDKIINEHLVARGRKK---TRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAAAMD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ I W +SEL R P +MKK+++E++  VGL RMVEESDL   +YLE+V+KE +R++P
Sbjct  304  TSSTTIGWAMSELIRHPYVMKKMQDELQKVVGLHRMVEESDLVCLEYLEMVVKEIMRLYP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLIPH + EDC V+GFHIPK S + VN WAIGRDP VW+DP KFFPERF  S ++ +
Sbjct  364  AAPLLIPHESLEDCTVNGFHIPKKSRLIVNAWAIGRDPSVWNDPHKFFPERFIGSQIDLK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFG+GRR CPGMQLG+T+VRL++AQL+HCFDW LPNGMLP +L+M EEFGL+ 
Sbjct  424  GKDFELIPFGAGRRGCPGMQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMIEEFGLTC  483

Query  902  NRAEHLMAIPTYRLH  946
             RA+ LM IP +RL+
Sbjct  484  PRAQDLMIIPIFRLN  498



>gb|EYU27291.1| hypothetical protein MIMGU_mgv1a023536mg [Erythranthe guttata]
Length=497

 Score =   395 bits (1016),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 239/315 (76%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+KY D +LG+KGFKA I EA+ I A PNLGDYFP +G +D+QGLTRRMK + K+FD
Sbjct  186  MVFGRKYGDSDLGDKGFKAVIEEALDIAAAPNLGDYFPFMGTIDLQGLTRRMKQLSKIFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FL KII++H       + + T DFVDTM+ IM SGE+  +F  +HVK+V+LD+LI   D
Sbjct  246  GFLGKIIDNH---VQNKQEKETQDFVDTMIAIMDSGEAGFEFDHRHVKAVLLDMLIGGTD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS+  + W ++EL R P+IMKK+++E++  VG+D  +EES L+   YL  VIKE+ R+HP
Sbjct  303  TSAVTVNWALAELIRHPQIMKKLQQELDKVVGMDEYIEESHLDKLDYLNFVIKETFRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            +VPL I H   ED  V+ FH+PKGS+V VNVW+I +DP VW DPEKF+PERF++++V+ +
Sbjct  363  IVPL-IGHKTMEDLTVENFHVPKGSSVFVNVWSIHKDPNVWEDPEKFWPERFSETNVDLQ  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF  LPFGSGRR CPG QLG+TVVRLV+A+L+HCFDW LPNGMLP +L+M E F   +
Sbjct  422  GRDFRLLPFGSGRRVCPGYQLGLTVVRLVLARLVHCFDWELPNGMLPNELDMAEHFRFVM  481

Query  902  NRAEHLMAIPTYRLH  946
            +R + LMAIP YRLH
Sbjct  482  SREKPLMAIPVYRLH  496



>ref|XP_006367702.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=542

 Score =   397 bits (1020),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 246/314 (78%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++  ++GFK  + +AV + A+PNLGD+FP LG +D+QG TR++K + K+FD
Sbjct  227  MVFGKKYMDEDFDKRGFKTVVQDAVHLAAMPNLGDFFPFLGVIDLQGFTRKLKDLSKVFD  286

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE+II++H E   +   + T DFVDTM++IMKSGE+   F R H+K+++LD+L+AS+D
Sbjct  287  EFLERIIDEHVEYHDR---KQTKDFVDTMMDIMKSGEAEFPFDRTHIKAILLDMLLASMD  343

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T++S  +W ++EL R P++MKK+++E++  VG++RMVEESDL +  YLE+V+KE +R+HP
Sbjct  344  TTASSTDWILAELLRHPQVMKKLQKELQEVVGVERMVEESDLVNLNYLEMVVKEGMRLHP  403

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL   H A EDC VDGF I KGS   +N +A+ RDP VW +PEKFFPERF  SS+++R
Sbjct  404  VGPLFY-HEAMEDCVVDGFQIHKGSRTVINCYAVQRDPNVWPEPEKFFPERFFGSSIDFR  462

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ +PFGSGRRSCPGMQLG+TVVRLVVAQL+HCF+W LPNG+ P DL++ E FG+  
Sbjct  463  GNDFQLVPFGSGRRSCPGMQLGVTVVRLVVAQLVHCFEWELPNGIQPCDLDIDEHFGIVT  522

Query  902  NRAEHLMAIPTYRL  943
             R + L+AIPTYRL
Sbjct  523  CREKPLLAIPTYRL  536



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   395 bits (1016),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 239/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY +KE  +KGFK  IHE +++ A  N GDY P +  LD+QGLT+RMKAVGK+FD
Sbjct  185  MVFGKKYMEKEFDDKGFKPVIHEGMRLAASFNFGDYIPPIAPLDLQGLTKRMKAVGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +FLEKII++H +   + +   T DFVD ML+ + S E+     R ++K+++LD+L+ S+D
Sbjct  245  DFLEKIIDEHIQFKDENR---TKDFVDVMLDFLGSEETEYSIGRDNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKKV++E+E  +G+DR VEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TSATAIEWTLSELIKHPRVMKKVQKELEEKIGMDRTVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC +DGF IP+ + V VNVWAIGRD   W+D  KF PERF  S+++ R
Sbjct  362  VAPLLIPHESMEDCTIDGFLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPGM LG+T+V  +VAQL+HCFDW LPN MLP++L+MTE FGL  
Sbjct  422  GRDFQLLPFGAGRRGCPGMHLGLTMVLQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYR H+
Sbjct  482  PRANHLCATPTYRHHL  497



>ref|XP_009372721.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   395 bits (1015),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 240/315 (76%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G  + + E +K+ A PNLGD+ P +  LD+QGLT++MKAV K FD
Sbjct  184  MVFGKKYKDEEFGGRGIASVMKEGMKLAAAPNLGDFIPCIAPLDLQGLTKKMKAVNKAFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EK+I++H +   K   + T DF+D +L  M S  S  +  R ++K++M D+  AS D
Sbjct  244  EFFEKVIDEHLQYKDK---ERTKDFIDALLAHMGSEGSDYRIERLNIKAMMSDMFAASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ ++W +SEL R P++MKKV++E+E+ VGL RMVEESD+E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMVEESDMEKLEYLDMVLKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PHAA EDC VDG+HIPK S + +N WAIGRDP  W D EKF PERF  ++V+ R
Sbjct  361  VVPLLLPHAAIEDCTVDGYHIPKKSRIIINAWAIGRDPSAWEDAEKFVPERFEDNNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR C GMQLGITVV  V+AQL+HCFDW LP+ MLP +L+MTEEFGL +
Sbjct  421  GHHFQLVPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVV  480

Query  902  NRAEHLMAIPTYRLH  946
            +RA++L+AIP+YRL 
Sbjct  481  SRAKNLLAIPSYRLQ  495



>ref|XP_003524281.2| PREDICTED: cytochrome P450 71A1-like isoform X1 [Glycine max]
 ref|XP_006580303.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Glycine max]
 ref|XP_006580304.1| PREDICTED: cytochrome P450 71A1-like isoform X3 [Glycine max]
Length=497

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 240/314 (76%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++L EKGFKA + E + + A PN+GDY P +  LD+QGLT+RMK VGK+FD
Sbjct  181  MVLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYIPYIAALDLQGLTKRMKVVGKIFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H + + KG+ +T  DFVD ML+ + + ES  +  R ++K+++LD+L  S+D
Sbjct  241  DFFEKIIDEHLQ-SEKGEDRTK-DFVDVMLDFVGTEESEYRIERPNIKAILLDMLAGSMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKKV+ E+E+ VG+ R VEESDL+   YL++V+KES+R+HP
Sbjct  299  TSATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKVEESDLDKLVYLDMVVKESMRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC V    IPK S V VN WAI RDP  W + EKF+PERF  SS++ R
Sbjct  359  VAPLLIPHQSTEDCMVGDLFIPKKSRVIVNAWAIMRDPSAWDEAEKFWPERFEGSSIDVR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR CPG+QLG+TVVRL VAQ++HCFDW LP  +LP DL+M EEFGL++
Sbjct  419  GRDFELIPFGSGRRGCPGLQLGLTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTM  478

Query  902  NRAEHLMAIPTYRL  943
             RA HL AIPTYRL
Sbjct  479  PRANHLHAIPTYRL  492



>gb|EYU24037.1| hypothetical protein MIMGU_mgv1a005167mg [Erythranthe guttata]
Length=494

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 249/314 (79%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+KY DK+  +KGFK    EA++I+A  NL DYFP +G LD+QG+ RRMK +  +FD
Sbjct  181  MIFGRKYADKDFDDKGFKDVFMEAMEISAKFNLADYFPYIGVLDLQGMNRRMKELSNIFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II++H +   K + + T DFVDTM+ IM SGE+  +F R+HVK+V+LD+LIA +D
Sbjct  241  GFLEQIIDEHLQ--EKPEKEETKDFVDTMMAIMDSGEAGFEFDRRHVKAVLLDLLIAGMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW ISEL R P +MKK++ E+ES VG+DR VEES L++ +YL++V+KE+LR+HP
Sbjct  299  TSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTVEESHLDNLEYLDLVVKETLRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC +DG+HIPK S   VNVWAIGRDP VW+ PE F PERF+ S ++ R
Sbjct  359  VAPLLIPHESMEDCTIDGYHIPKKSRAIVNVWAIGRDPSVWAHPETFSPERFSGSDIDLR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFGSGRRSCP +QLG+ +V+LV+AQL+HCFDW LPNGMLP DL+M+E FG+  
Sbjct  419  GRDFQLLPFGSGRRSCPALQLGLVLVKLVLAQLVHCFDWELPNGMLPSDLDMSEHFGIVT  478

Query  902  NRAEHLMAIPTYRL  943
            +RAEH+MAIP YRL
Sbjct  479  SRAEHIMAIPKYRL  492



>ref|XP_009588170.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=494

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 250/314 (80%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFKA + + + + A PNLGD+FP LG +D+QGLTR++K + K+FD
Sbjct  183  MVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++  +   + T DFVDTM+EIM+SGE+  QF RQH+K+++ D+L+A++D
Sbjct  243  EFLEKIIDEHLQSHDQ---KQTNDFVDTMMEIMQSGEAEFQFDRQHIKAIIQDMLMAAMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW ++EL R P +MKK+++E++  VG++++V+E DLE+ KYL++V KE LR+H 
Sbjct  300  TSATSVEWILTELLRHPNVMKKLQKELDEVVGIEKIVKEPDLENLKYLDMVAKEGLRLHS  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPL+  H A E+C V+GFHI KGS + +N +A+ RDP VW +PEKFFPERF  SS++ R
Sbjct  360  VVPLM-HHEAMEECVVNGFHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSSIDIR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
             +DF+ LPFGSGRRSCPGMQLG+T++RLVVAQL+HCFDW + NGM P DL + E+FGL  
Sbjct  419  RRDFQLLPFGSGRRSCPGMQLGVTIIRLVVAQLVHCFDWEISNGMQPLDLEIDEQFGLVT  478

Query  902  NRAEHLMAIPTYRL  943
             + + LMAIPTYRL
Sbjct  479  CKEKPLMAIPTYRL  492



>ref|XP_003532846.1| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=500

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 239/316 (76%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ GKKY D++L +KGFKA + E + + A PN+GDY P +GKLD+QGL RRMK + ++FD
Sbjct  182  MILGKKYMDQDLDQKGFKAVMQEVLHLAAAPNIGDYIPYIGKLDLQGLIRRMKTLRRIFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF +KII++H + + KG+     DFVD ML+ + + ES  +  R ++K+++LD+L+ SID
Sbjct  242  EFFDKIIDEHIQ-SDKGEVNKGKDFVDAMLDFVGTEESEYRIERPNIKAILLDMLVGSID  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWTISEL + P +MKK++ E+E+ VG+ R V ESDL+  KYLE+V+KE LR+HP
Sbjct  301  TSATAIEWTISELLKNPRVMKKLQRELETVVGMKRKVGESDLDKLKYLEMVVKEGLRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH +REDC V  + IPK S V VN W I RDP  W + EKF+PERF  S+++ R
Sbjct  361  VAPLLLPHHSREDCMVGEYFIPKNSRVIVNAWTIMRDPSAWDEAEKFWPERFEGSNIDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF FLPFGSGRR CPG+QLG+  V L VAQL+HCFDW LPN MLP +L+MTEEFGLS+
Sbjct  421  GKDFRFLPFGSGRRVCPGLQLGLNTVLLTVAQLVHCFDWKLPNNMLPCELDMTEEFGLSM  480

Query  902  NRAEHLMAIPT-YRLH  946
             RA HL+ IPT YRLH
Sbjct  481  PRANHLLVIPTYYRLH  496



>ref|XP_004237505.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 248/315 (79%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFKA + + V +  +PNLGD+FP LG +D+QG+TR++K + K+FD
Sbjct  183  MVFGKKYMDEDLDKRGFKAIVQDVVHLAGMPNLGDFFPFLGAIDLQGITRKLKDLSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H  A    + +   DFVDTM++IM+SG++  QF R H+K+++ D+LIA++D
Sbjct  243  EFLEKIIDEHVYAHEHKQNK---DFVDTMMDIMQSGDAKFQFDRHHIKAILFDMLIAAMD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T++S  EW ++EL R P++MK++++E++  VGLDRMVEESDLE+ KYL++V+KE LR+HP
Sbjct  300  TTASSTEWILTELLRHPQVMKELQKELQEVVGLDRMVEESDLENLKYLDMVVKEGLRLHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL   H + EDC VDGFHI KG+ + +N +AI  DP VW DPEKF PERF  SSV++R
Sbjct  360  VAPLFY-HESIEDCVVDGFHIQKGTRIIINCYAIHMDPNVWPDPEKFLPERFVGSSVDFR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRRSCPGMQL + VVRLVVAQL+HCF+W LPNG+   DL++ E+FG+  
Sbjct  419  GRDFQLVPFGSGRRSCPGMQLAVMVVRLVVAQLVHCFEWELPNGIESCDLDIDEKFGIVT  478

Query  902  NRAEHLMAIPTYRLH  946
             R + L+AIPTY+L+
Sbjct  479  CREKPLLAIPTYKLN  493



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 240/321 (75%), Gaps = 14/321 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I E + + A PN+GDY P L + D+QGLT+RMKAV K+FD
Sbjct  185  MVFGKKYMDKEFDERGFKAVIQEGMVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFD  244

Query  182  EFLEKIINDH-----EEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDIL  346
             F EKII++H     EE  SK       DFVD ML  M   E      R H+K+++LD+L
Sbjct  245  AFFEKIIDEHMKSMKEEGESK-------DFVDVMLGFMGLNEGEYHIDRPHIKAIILDML  297

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              S+DTS++ I+W ++EL R P  MK+V++E+E  VG++R VEESDLE   YL++VIKE+
Sbjct  298  SGSMDTSATAIDWAMTELVRHPSAMKRVQDELEKAVGMNRAVEESDLEGLHYLDMVIKET  357

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS--DPEKFFPERFN  700
            +R+HPV PLL+PH A EDC V+GFHIP  S V VNVW+IGRDPKVW+  DPE+F PERF 
Sbjct  358  MRLHPVAPLLLPHEATEDCTVNGFHIPLKSRVIVNVWSIGRDPKVWTTHDPEEFIPERFL  417

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             SS++ +G+DF+ LPFG+GRR CPGMQLG+T+VR V+AQL+HCFDW+LP G+ P +L+MT
Sbjct  418  GSSMDVKGRDFQLLPFGAGRRGCPGMQLGLTIVRFVLAQLVHCFDWDLPAGISPSELDMT  477

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            EEFGL+  RA+HL+ +P YRL
Sbjct  478  EEFGLTAPRAKHLVVMPRYRL  498



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 238/315 (76%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++   +GF++ I E +++    NL DY P +  LD+QG T+RMK+V K FD
Sbjct  184  MVLGKKYRDEDFDTRGFRSVIKEGLQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII +H ++      + T DFVD M+  M S ES  Q  R H+K++++D+L+AS+D
Sbjct  244  TFFEKIIEEHLQSND---GERTKDFVDVMVGFMGSEESEYQIERPHIKAIIMDMLVASMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ ++W +SEL R P+ MK+V++E+E  VGL+RMVEESDLE   YL +V+KE+LR+HP
Sbjct  301  TSSTTVDWALSELMRHPKAMKQVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC V+G+HIPK S V +N WAIGRDP  W+D E+F PERF  S V+ R
Sbjct  361  VAPLLVPHAATEDCTVNGYHIPKKSRVIINAWAIGRDPSAWTDAEEFIPERFEGSDVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+L++AQL+HCFDW LPN MLP++L+M+E FG+++
Sbjct  421  GNHFQLIPFGSGRRRCPGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSEVFGITV  480

Query  902  NRAEHLMAIPTYRLH  946
             RA+ L+AIP+YRLH
Sbjct  481  ARAKRLIAIPSYRLH  495



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 241/316 (76%), Gaps = 4/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY DKE  E+GFKA I E + + A PN+GDY P L + D+QGLT+RMKAV K+FD
Sbjct  185  MVFGKKYMDKEFDERGFKAVIQEFMVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H +  SK +   + DFVD ML  M   E      R H+K+++LD+L+ S+D
Sbjct  245  AFFEKIIDEHMK--SKKEEGESKDFVDVMLGFMGLNEGEYHIDRPHIKAIILDMLLGSMD  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W ++EL R P  MKKV++E+E  VG++R VEESDLE   YL++VIKE++R+HP
Sbjct  303  TSATAIDWAMTELVRHPSAMKKVQDELEKAVGMNRAVEESDLEGLHYLDMVIKETMRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS--DPEKFFPERFNKSSVE  715
            V PLL+PH A EDC V+GFH+P  S V VNVW+IGRDPKVW+  +PE+F PERF   S++
Sbjct  363  VAPLLLPHEATEDCTVNGFHMPLKSRVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSMD  422

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF+ LPFG+GRR CPGMQLG+TVVR V+AQL+HCFDW+LP G+ P +L+MTEEFGL
Sbjct  423  VKGRDFQLLPFGAGRRGCPGMQLGLTVVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGL  482

Query  896  SLNRAEHLMAIPTYRL  943
            +  RA+HL+ +P YRL
Sbjct  483  TTPRAKHLVVMPQYRL  498



>ref|XP_011090604.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=497

 Score =   393 bits (1009),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 240/315 (76%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+KY DK+L ++G K  + E V+  A  NLGDYFP L  LD+QG  RR+K + K+FD
Sbjct  184  MVFGRKYADKDLNDEGLKEVMKETVEEAAAFNLGDYFPYLRGLDLQGSARRLKKLSKIFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II+DH +   K K Q++ DFVDTM+ IM+SGE+   F R+HVK+V+LD+L+A ID
Sbjct  244  RFLERIIDDHVQ-NKKEKQQSSQDFVDTMMGIMESGEAGFDFDRRHVKAVLLDMLLAGID  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW +SE+ R P + KK+++E+E  VGLD+ V ES L   KYL+ V++ES+R+HP
Sbjct  303  TSTAAVEWALSEVIRHPVVTKKLQKELEEVVGLDQTVNESHLSSLKYLDYVVRESMRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLI     EDCEVDGFHI K S V VNVWAIGRDP  W+DPE FFPERF  S+V+ R
Sbjct  363  VSPLLI-REGMEDCEVDGFHIQKKSQVLVNVWAIGRDPDAWTDPETFFPERFLGSNVDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+D + +PFG+GRR CPG+QLG+T+V+L+VAQL+HCFDW LP GM P +L+M+E FGL  
Sbjct  422  GRDSQLIPFGTGRRGCPGLQLGLTIVQLMVAQLVHCFDWELPEGMQPDELDMSENFGLIT  481

Query  902  NRAEHLMAIPTYRLH  946
             RA+HL+AIP YRLH
Sbjct  482  ARAKHLVAIPKYRLH  496



>ref|XP_009378500.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 238/315 (76%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D E  E+GF A + EA+++ A PNL D+ P L  LD+QGLT++MK + K FD
Sbjct  187  MVFGKKYKDDEFDERGFTAVMKEAIQLVAAPNLNDHIPFLAPLDLQGLTKKMKTINKAFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F +KII+DH ++  + +   T DF+D ML  M S ES  +  R HVK++MLD+  AS+D
Sbjct  247  AFFDKIIDDHLQSKDEDR---TKDFIDVMLGHMGSEESDYRIERVHVKALMLDMFAASVD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T S+ I W  SEL R P++MKKV++E+E+ VGL+RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  304  TPSTAILWAFSELLRHPQVMKKVQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PH + EDC VDG+HIPK S + +N WAIGRDP  W DPEKF PERF  S+++ +
Sbjct  364  VVPLLLPHLSIEDCTVDGYHIPKNSRLIINAWAIGRDPSAWEDPEKFVPERFEGSNIDVK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+ F+ +PFGSGRR C GMQLG+TV++ V+AQ++HCFDW LP+ MLP +L+MTE FGL +
Sbjct  424  GKHFQLVPFGSGRRRCAGMQLGLTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVV  483

Query  902  NRAEHLMAIPTYRLH  946
            +R + L+ IP+YRL 
Sbjct  484  SRTKDLLLIPSYRLQ  498



>ref|XP_006366158.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=498

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 243/314 (77%), Gaps = 4/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFKA + E   + A PNLG++FP LG +D+QGLTRR+K + K+FD
Sbjct  185  MVFGKKYMDEDLDKRGFKALVKEVEHLAATPNLGEFFPFLGVIDLQGLTRRIKDLSKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++  + +++   DFVDTML+IM+SGE+  QF R+H+K+++ D+LIA++ 
Sbjct  245  DFFEKIIDEHVQSRDQKQSK---DFVDTMLDIMQSGEAEFQFDRRHIKAILFDMLIAAMG  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS S IEW ++EL R P +MKK+++E+E  VGL++MV+ESDLE+  YL++V+KE LR+H 
Sbjct  302  TSPSAIEWILTELLRHPHVMKKLQKELEEVVGLEKMVKESDLENLNYLDMVVKEGLRLHA  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL  PH A EDC V+ F+I KGS + +N +A+ RDP +W +PEKF PERF  SS++ R
Sbjct  362  VAPL-APHEAMEDCVVNSFNIQKGSRIMINFYAVQRDPNIWPEPEKFLPERFVGSSIDIR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CP MQL I +V L+VAQL+HCFDW LPNGM P DL++ E FGL+ 
Sbjct  421  GHDFQLLPFGSGRRRCPAMQLAIVLVYLIVAQLVHCFDWELPNGMQPCDLDVEEHFGLAT  480

Query  902  NRAEHLMAIPTYRL  943
            +R  HLMAIPTYRL
Sbjct  481  SRENHLMAIPTYRL  494



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 237/315 (75%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++   +GF++ I E +++    NL DY P +  LD+QG T+RMK+V K FD
Sbjct  184  MVLGKKYRDEDFDARGFRSVIKEGIQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII +H ++      + T DFVD M+  M S ES  Q  R H+K++++D+L+AS+D
Sbjct  244  VFFEKIIEEHLQSND---GERTKDFVDVMVGFMGSVESEYQIERPHIKAIIMDMLVASMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ ++W +SEL R P+ MK+V++E+E  VGL+RMVEESDLE   YL +V+KE+LR+HP
Sbjct  301  TSSTTVDWALSELMRHPKAMKEVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PHAA EDC V+G+HIPK S V +N WAIGRDP  W+D E+F PERF  S V+ R
Sbjct  361  VAPLLVPHAATEDCIVNGYHIPKKSRVIINAWAIGRDPSAWTDAEEFIPERFEGSDVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QLG+TVV+L++AQL+HCFDW LPN MLP++L+M+E FG+++
Sbjct  421  GNHFQLIPFGSGRRRCPGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSESFGITV  480

Query  902  NRAEHLMAIPTYRLH  946
             R + L+AIP+YRLH
Sbjct  481  ERVKRLIAIPSYRLH  495



>gb|EYU24036.1| hypothetical protein MIMGU_mgv1a005182mg [Erythranthe guttata]
Length=494

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 249/314 (79%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+KY D++  EKGFKA   E V+++A  NL DYFP +G LD+QG+ RRMK + K+FD
Sbjct  181  MIFGRKYADEDFDEKGFKAVFTEVVEMSAKFNLADYFPYIGVLDLQGMNRRMKELSKIFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII++H +   K + + T DFVDTM+ +M+SGE+  +F R+HVK+V+LD+L+A +D
Sbjct  241  GFLEKIIDEHLQ--EKPEKKETKDFVDTMMAVMESGEAGFEFDRRHVKAVLLDLLVAGMD  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ +EW ISEL R P +MKK++ E+ES VG+DR VEES L   +YL+ V+KE+LR+HP
Sbjct  299  TSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTVEESHLNKLEYLDSVVKETLRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLL+PH + EDC +DG+HIPK S   VN+WAIGRDP VW+ PE F PERF+ S ++ R
Sbjct  359  VVPLLVPHESMEDCTIDGYHIPKKSRAIVNMWAIGRDPSVWAHPETFSPERFSGSGIDLR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR+CP +QLG+ +V+LV+AQL+HCFDW LPNGMLP DL+M+E FGL  
Sbjct  419  GRDFQLVPFGSGRRTCPALQLGVVLVKLVLAQLVHCFDWELPNGMLPCDLDMSEHFGLVT  478

Query  902  NRAEHLMAIPTYRL  943
            +RAEH+MAIP YRL
Sbjct  479  SRAEHIMAIPKYRL  492



>ref|XP_006348217.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
 ref|XP_006354706.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=492

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 236/314 (75%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY++ +     FK  + E  ++ A PNL + FP L  +D QG   RMK + K  D
Sbjct  181  MVIGKKYNNVD---GDFKDMVKETSRMAATPNLAELFPFLRFIDFQGSIHRMKQIAKSCD  237

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE +I++H    S  +++T+ D VDT++EIM+SGE+  +F R+HVK+++LD+L+AS+D
Sbjct  238  EFLENVIDEHARQYSSDQSKTSTDMVDTLMEIMQSGEAEFEFDRRHVKAILLDLLVASMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SELFR P +MKK++ E++  VG   +VEE DLE+  YL +VIKE  R+HP
Sbjct  298  TSSTSIEWILSELFRHPNVMKKLQSELDYVVGQKGIVEEKDLENLDYLNMVIKEGFRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC +DGFHIPKGS V VNVWAIGRDP VW +PEKF PERF +S+++ R
Sbjct  358  VAPLLLPHESIEDCTLDGFHIPKGSRVLVNVWAIGRDPDVWHEPEKFIPERFVESTIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ+F+ LPFGSGRRSCPG+QLG+T+VRLVVAQL+H FDW  PNGM+  D+NMTE+FGL  
Sbjct  418  GQNFQLLPFGSGRRSCPGLQLGLTIVRLVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVT  477

Query  902  NRAEHLMAIPTYRL  943
             RA  LMAIP YR+
Sbjct  478  ARALSLMAIPIYRV  491



>ref|XP_006380460.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
 gb|ERP58257.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
Length=497

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/316 (56%), Positives = 240/316 (76%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKK  +KE  E+GF+   HE ++I A  NLGDY P +  LD+QGLT+RMKA+GK+FD
Sbjct  185  MIFGKKDLEKEFDERGFEPLTHEGIRIAASFNLGDYIPPIAPLDLQGLTKRMKAIGKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DF+D ML+ + S E+  +  R ++K+++LD+L+ S+D
Sbjct  245  DFFEKIIDEHIQFKDENR---TKDFLDVMLDFLGSEETEYRIGRGNIKAIILDMLVGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T ++ IEWT+SEL + P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  302  TPAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC +DGF IP+ + V VNVWAIGRD   W+D  KF PERF  S+++ R
Sbjct  362  VAPLLVPHESMEDCTIDGFLIPQKTRVLVNVWAIGRDQSAWTDANKFIPERFAGSNIDVR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ L FG+GRRSCPGM LG+T+VR +VAQL+HCFDW LPN MLP++L+MTE FGL  
Sbjct  422  GRDFQLLTFGAGRRSCPGMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVT  481

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  482  PRANHLCATPTYRLHL  497



>ref|XP_004237615.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=492

 Score =   390 bits (1003),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 244/315 (77%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++L ++GFK+ + + V + A PNLGD+FP LG +D+QGLTR++K + ++FD
Sbjct  180  MVFGKKYMDEDLDKRGFKSIVQDVVHLAATPNLGDFFPFLGAIDLQGLTRKLKDLSEVFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H       + + T DFVDTM+ IM+SG +  Q  R+H+K+++ D+LIA++D
Sbjct  240  EFLEKIIDEH---VHSHEHKQTKDFVDTMMGIMQSGVAEFQLDRRHIKAILFDMLIAAMD  296

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T++S  EW ++EL R P++MKK+++E++  VGL+R VEESDLE+ KYL++V+KE LR+HP
Sbjct  297  TTASSTEWILTELLRHPQVMKKLQKELQEVVGLERTVEESDLENLKYLDMVVKEGLRLHP  356

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPL   H + EDC VDGFHI KGS V VN +A  RDP VW +PE F PERF  S +++R
Sbjct  357  VVPLFY-HESMEDCVVDGFHIKKGSRVMVNCYAAQRDPNVWPEPEMFLPERFVGSCIDFR  415

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRRSCPGMQL + VVRLVVAQL+HCF+W LPNGM P DL++ E+FG+  
Sbjct  416  GRDFQLVPFGSGRRSCPGMQLAVIVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGMVT  475

Query  902  NRAEHLMAIPTYRLH  946
             R + LMAIPTY L+
Sbjct  476  CREKPLMAIPTYNLN  490



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 235/314 (75%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKK  D E    GF+  I E  ++   PNLGDY P +  LD+QGLT+R KAV K+FD
Sbjct  186  MVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSKAVAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+EKII++H ++  + +   T DFVD ML    S ++  +  R+H+K+V++D+L  +ID
Sbjct  246  AFMEKIIDEHIQSKDENR---TEDFVDVMLSFEGSEDTEKKIDREHIKAVVMDMLAGAID  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS +V+EW +SEL + P +MKK++ E+E+ VGL RMVEESDLE+ +YL++V++E+LR+HP
Sbjct  303  TSPTVVEWALSELIKHPTVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVRETLRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL+ PH + EDC V+GFHIPK S V VN WAIGRDP+ W+DPE FFPERF  SSV+  
Sbjct  363  VTPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFVGSSVDVL  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CPG+QL +TVV+ V AQL+HCFDW LP GMLP +L+MTEEFGL  
Sbjct  423  GHDFQLLPFGSGRRGCPGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVT  482

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+A+P+YRL
Sbjct  483  PRAKHLLAVPSYRL  496



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 242/316 (77%), Gaps = 2/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++L EKGFKA + EA+++ A PN+GDY P +  LD+QG+T+R+KA  K+FD
Sbjct  180  MVLGKKYMDQDLDEKGFKAVMQEAMRLLATPNMGDYIPYIAALDLQGITKRLKANHKIFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F +KII++H E + KG+ +T  DFVD ML    + ES  +  R ++K+++ D+L  S+D
Sbjct  240  HFFDKIIDEHME-SDKGEDKTK-DFVDVMLGFYGTQESEYRIERSNIKAILTDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKK++ E+ES VG+++ VEESDLE  +YL++VIKESLR+HP
Sbjct  298  TSATAIEWTLSELLKNPRVMKKLQMELESVVGMEKKVEESDLEKLEYLDMVIKESLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC V  F IPK S + VN WAI RDP  W + EKF+PERF  S+++ R
Sbjct  358  VAPLLIPHQSTEDCMVGDFFIPKKSRLIVNAWAIMRDPDAWIEAEKFWPERFEGSNIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++FE +PFGSGRR CPG+QLG+TV+R  VAQL+HCFDW LPN M+P +L+M +EFGL++
Sbjct  418  GREFELIPFGSGRRGCPGIQLGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTM  477

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL+AIPTYRL I
Sbjct  478  PRANHLLAIPTYRLSI  493



>ref|XP_004252295.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=496

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 246/315 (78%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D++  ++GFKA + E V + A+ NLGD+FP LG +D+QGLTRR+K + K+FD
Sbjct  184  MVFGKKYMDEDFDKRGFKAVLQEVVHLAAITNLGDFFPFLGVIDLQGLTRRLKDLSKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H E+  + +   T DFV TMLE M+SG++  QF R H+K+V+ D+++A+ID
Sbjct  244  EFLEKIIDEHVESHDENQ---TKDFVHTMLEFMQSGKAEFQFDRIHIKAVLFDMIVAAID  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W ++EL R P +MKK++ EI+  VGL+RMV+ESDLE+ KYL++V+KE +R+H 
Sbjct  301  TSATTIDWILTELLRHPHVMKKLQIEIKQVVGLERMVKESDLENLKYLDMVVKEGMRLHS  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVP+     A EDC +DGF+I KGS + +N +AI RDP +WS+PEKF PERF  S+++ R
Sbjct  361  VVPV-TQREAMEDCVIDGFNIRKGSRIMINHYAIQRDPNLWSEPEKFLPERFIGSNIDVR  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPF SGRRSCP +QLGI VVRLVVAQL+HCFDW LPNGM P DL++ E FG+  
Sbjct  420  GRDFQLLPFNSGRRSCPAIQLGIIVVRLVVAQLVHCFDWELPNGMQPCDLDLEEHFGIVT  479

Query  902  NRAEHLMAIPTYRLH  946
            ++ +HLMAIPT RL+
Sbjct  480  SKEKHLMAIPTCRLN  494



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 234/314 (75%), Gaps = 3/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKK  D E    GF+  I E  ++   PNLGDY P +  LD+QGLT+R KAV K+FD
Sbjct  186  MVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSKAVAKVFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F+EKII++H ++  + +   T DFVD ML    S ++  +  R+H+K+V++D+L  +ID
Sbjct  246  AFMEKIIDEHIQSKDENR---TEDFVDVMLSFEGSEDTEKKIDREHIKAVVMDMLAGAID  302

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS +V+EW +SEL + P +MKK++ E+E+ VGL RMVEESDLE  +YL++V++E+LR+HP
Sbjct  303  TSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVRETLRLHP  362

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PL+ PH + EDC V+GFHIPK S V VN WAIGRDP+ W+DPE FFPERF  SSV+  
Sbjct  363  VTPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFVGSSVDVL  422

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF+ LPFGSGRR CPG+QL +TVV+ V AQL+HCFDW LP GMLP +L+MTEEFGL  
Sbjct  423  GHDFQLLPFGSGRRGCPGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVT  482

Query  902  NRAEHLMAIPTYRL  943
             RA+HL+A+P+YRL
Sbjct  483  PRAKHLLAVPSYRL  496



>ref|XP_011090598.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   389 bits (998),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 243/319 (76%), Gaps = 8/319 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D +L EKGFKA I E +++ ALPN+ DYFP L  LD+QGLTRRMK + K FD
Sbjct  183  MVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYFPFLAALDLQGLTRRMKELSKTFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II+DH +  +K + +   DF DTM+ IM+SGE+  +F R+HVK+V+L I++  + 
Sbjct  243  GFLERIIDDHIQ--NKQEKKHAQDFADTMITIMESGEAGFEFDRRHVKAVLLVIILQDLX  300

Query  362  TSS-----SVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
                    +V+EW +SEL R P+ MKK+++E+E  VG+D++VEES L+  +YL++V+KE+
Sbjct  301  XXXXXXXXTVVEWALSELIRHPKAMKKLQQELEKVVGMDQIVEESHLDRLEYLDMVVKET  360

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKS  706
            LR+HP VPLLI H + EDC VD FH+PKGS + VNVW+IG+DP  W +P+KF PERF  S
Sbjct  361  LRLHPAVPLLI-HESLEDCVVDQFHVPKGSRLIVNVWSIGKDPNAWREPQKFLPERFIGS  419

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
            +++ RGQDF+ +PFGSGRR CPG+QLG+TVVRLV+AQL+HCFDW LP+GM+  +L+M E 
Sbjct  420  NIDLRGQDFQLIPFGSGRRGCPGLQLGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEH  479

Query  887  FGLSLNRAEHLMAIPTYRL  943
            FGL   R  HL+A+PTYRL
Sbjct  480  FGLVTCRENHLLAVPTYRL  498



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   389 bits (998),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 245/327 (75%), Gaps = 16/327 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY++ +  EKGF+A I E ++I A  N+ DY PL   LD+QGL +RMKAV K+FD
Sbjct  185  MVLGKKYNNDDFDEKGFEAIIREGMQIGAAFNIADYIPLFKALDLQGLKKRMKAVAKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVML--------  337
            +F EK+I++H ++  + +   T DFVD ML  M S ES  +  R  +K+++L        
Sbjct  245  DFFEKVIDEHVQSKDENR---TKDFVDVMLGFMGSEESEYRVERDTIKAIILALSNYICF  301

Query  338  -----DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKY  502
                 D+L+A++DTS++ IEWT+SEL + P ++KKV++E+E+ VG++R+VEESDLE  +Y
Sbjct  302  SRLLQDMLVAAMDTSATAIEWTLSELIKHPRVIKKVQKELENVVGMERLVEESDLEKLEY  361

Query  503  LEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKF  682
            L++V+KES R+HPV PLL+PHA+ EDC V+GFHIPK S V +N WAIGRDP +W+D EKF
Sbjct  362  LDMVVKESFRIHPVAPLLVPHASVEDCTVNGFHIPKNSRVFINAWAIGRDPNIWTDAEKF  421

Query  683  FPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLP  862
             PERF  S ++ RG+DF+ +PFGSGRR CPGM LG+ +VRLVVAQL+HCFDW LP+GML 
Sbjct  422  IPERFVGSDIDLRGRDFQLIPFGSGRRGCPGMPLGLIMVRLVVAQLVHCFDWELPDGMLA  481

Query  863  KDLNMTEEFGLSLNRAEHLMAIPTYRL  943
             +L+MTEEFGL   RA+HL+A+PT+RL
Sbjct  482  TELDMTEEFGLVSPRAKHLLAMPTWRL  508



>gb|KHN29102.1| Cytochrome P450 71A1 [Glycine soja]
Length=493

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 240/314 (76%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ GKKY D+++  +GFKA I EA+++ A PN+GDY P +G +D+QGLT+R K + ++FD
Sbjct  180  MILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYIPYIGAIDLQGLTKRFKVLYEIFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EK+I++H E + KG+ +T  DFVD ML  + + ES  +  R ++K+++LD+L  S+D
Sbjct  240  DFFEKVIDEHME-SEKGEDKTK-DFVDVMLGFLGTEESEYRIERSNIKAILLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++VIEWT+SEL + P +MKK++ E+E+ VG+ R V ESDL+  KYLE+V+KES+R+HP
Sbjct  298  TSATVIEWTLSELLKNPRVMKKLQMELETVVGMKRKVGESDLDKLKYLEMVVKESMRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLLIPH + EDC V  F IPK S V +N WAI RDP  W + EKF+PERF  S+++ R
Sbjct  358  VVPLLIPHQSTEDCIVGDFFIPKKSRVIINAWAIMRDPSAWVEAEKFWPERFEGSNIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR+CPG+QLG+  VR  VAQL+HCFDW LPN M P DL+MTE FGL++
Sbjct  418  GRDFELIPFGSGRRACPGLQLGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTM  477

Query  902  NRAEHLMAIPTYRL  943
             RA HL AIPTYRL
Sbjct  478  PRANHLHAIPTYRL  491



>ref|XP_008385983.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008359286.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 237/315 (75%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +VFGKKY D E  E+GF A + EA+++ A PNL D+ P L  LD+QGLT++MKA+ K FD
Sbjct  187  LVFGKKYKDVEFDERGFTAVMKEAIQLVAAPNLNDHIPFLAPLDLQGLTKKMKAINKAFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F E II+DH ++  +   + T DFVD  L  M S ES  +  R HVK++MLD+  AS+D
Sbjct  247  AFFENIIDDHLQSKDE---ERTKDFVDVXLGHMGSEESDYRIERXHVKALMLDMFAASVD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T S+VI W  SEL R P++MKK+++E+E+ VGL+RMVEESDLE  +YL++V+KE+LR+HP
Sbjct  304  TPSTVILWAFSELLRHPQVMKKLQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             VPLL+PH + EDC VDG+HIPK S + +N WAIGRDP  W D EKF PERF  S+++ +
Sbjct  364  AVPLLLPHLSIEDCTVDGYHIPKNSRLIINAWAIGRDPSAWEDAEKFVPERFEGSNIDVK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+ F+ +PFGSGRR C GMQLG+TV++ V+AQ++HCFDW LP+ MLP +L+MTE FGL +
Sbjct  424  GKHFQLIPFGSGRRRCAGMQLGLTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVV  483

Query  902  NRAEHLMAIPTYRLH  946
            +R++ L+ IP+YRL 
Sbjct  484  SRSKDLLLIPSYRLQ  498



>ref|XP_002310009.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
 gb|EEE90459.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
Length=371

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 236/316 (75%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY +KE  EKGFK  IHE +++ A  N GDY P +  LD+QGLT+RMKAVGK+FD
Sbjct  59   MVLGKKYMEKEFHEKGFKPVIHEGMRLAASFNFGDYIPPIAPLDLQGLTKRMKAVGKVFD  118

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +   + +   T DFVD ML+ + S E+  +  R ++K++++D+L+ S+D
Sbjct  119  DFFEKIIDEHIQFKDENR---TKDFVDVMLDFLGSEETEYRIVRDNIKAIIMDMLVGSMD  175

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKKV++E+E  +G+DRMVEESDLE  +YL +VIKE+ R+HP
Sbjct  176  TSATAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHP  235

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC +DGF IP+ + V VNVWAIGR+   W+D  KF PERF  S+++ R
Sbjct  236  VAPLLIPHESMEDCTIDGFLIPQKTRVIVNVWAIGREQSAWTDSNKFIPERFAGSNIDVR  295

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ LPFG+GRR CPGM LG+T+   +VAQL+HCFDW L   ML ++++MTE FGL  
Sbjct  296  GRDFQLLPFGAGRRGCPGMHLGLTMDLQIVAQLVHCFDWELRKNMLREEVDMTEAFGLVT  355

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL A PTYRLH+
Sbjct  356  PRANHLCATPTYRLHL  371



>ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=493

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 239/314 (76%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ GKKY D+++  +GFKA I EA+++ A PN+GDY P +G +D+QGLT+R K + ++FD
Sbjct  180  MILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYIPYIGAIDLQGLTKRFKVLYEIFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EK+I++H E + KG+ +T  DFVD ML  + + ES  +  R ++K+++LD+L  S+D
Sbjct  240  DFFEKVIDEHME-SEKGEDKTK-DFVDVMLGFLGTEESEYRIERSNIKAILLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKK++ E+E+ VG+ R V ESDL+  KYLE+V+KES+R+HP
Sbjct  298  TSATAIEWTLSELLKNPRVMKKLQMELETVVGMKRKVGESDLDKLKYLEMVVKESMRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPLLIPH + EDC V  F IPK S V +N WAI RDP  W + EKF+PERF  S+++ R
Sbjct  358  VVPLLIPHQSTEDCIVGDFFIPKKSRVIINAWAIMRDPSAWVEAEKFWPERFEGSNIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR+CPG+QLG+  VR  VAQL+HCFDW LPN M P DL+MTE FGL++
Sbjct  418  GRDFELIPFGSGRRACPGLQLGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTM  477

Query  902  NRAEHLMAIPTYRL  943
             RA HL AIPTYRL
Sbjct  478  PRANHLHAIPTYRL  491



>emb|CBI21489.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 182/339 (54%), Positives = 244/339 (72%), Gaps = 29/339 (9%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DK++ E+GFKA I E +++   PN+GDY P +  LD+QGL RRMKA+ K+FD
Sbjct  213  MIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYIPFVAPLDLQGLARRMKAISKVFD  272

Query  182  EFLEKIINDH-EEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVML-------  337
             F EKII+DH  E   +G+ +   D +D ML  M S E+  Q  R ++K+++L       
Sbjct  273  AFFEKIIDDHIHEPKEEGQPK---DLIDVMLGYMGSKENEFQIERSNIKALVLVSIHTLI  329

Query  338  ------------------DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLD  463
                              D+L  S+DTS++ IEW ++EL + P IMKKV+EE+E  VG++
Sbjct  330  IHISKPSSSQYICCLNFQDMLAGSMDTSATAIEWALAELLKNPRIMKKVQEELEKVVGME  389

Query  464  RMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAI  643
            R VEESDLE  +YL++V+KE+LR+HPV PLLIPH + EDC V+GFHIP+ S V VN +AI
Sbjct  390  RKVEESDLESLEYLDMVVKETLRLHPVAPLLIPHESLEDCTVNGFHIPQKSRVMVNTYAI  449

Query  644  GRDPKVWSDPEKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLL  823
            GRDP VW+D EKF PERF  SS++ RG+DF+ +PFGSGRR CPGMQLG+TVVRLV+AQL+
Sbjct  450  GRDPNVWTDAEKFLPERFIGSSIDLRGRDFQLIPFGSGRRGCPGMQLGLTVVRLVLAQLV  509

Query  824  HCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYR  940
            HCFDW LPNGM+P +L+MTEEFGL++ RA+H++A  + R
Sbjct  510  HCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAYISQR  548



>ref|XP_004488758.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=496

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 235/314 (75%), Gaps = 2/314 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY DKEL EKGFK  + EA+ +   PN+GDY P +G LD+QGLT+RMK + K+FD
Sbjct  182  MVVGKKYMDKELDEKGFKLMMDEAMNLLGTPNIGDYIPYIGLLDLQGLTKRMKVISKIFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F +KII +H    S  K    MDFVD +L  + + E   +  R ++K++M+DI IAS D
Sbjct  242  DFFDKIIEEH--IKSNDKDGEPMDFVDVLLGFLGTEEYDYRIERSNIKAIMMDIFIASTD  299

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEWTISEL + P +MKKV++E+ES VGL R VEESDL+  +YL++VIKES R+HP
Sbjct  300  TSSTTIEWTISELLKNPRVMKKVQKELESVVGLKRKVEESDLDKLEYLDMVIKESFRIHP  359

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
              PLLIPH + EDC V+ F IPK S V VN W+I RD   WSDPEKF+PERF  S+++ +
Sbjct  360  AGPLLIPHQSLEDCMVEDFFIPKNSRVIVNAWSIMRDKMAWSDPEKFWPERFEGSNIDAK  419

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  FE +PFGSGRR CPG++LG+T+VRLVVAQL+HCFD+ LP+ +L  DL+MTE+FGL+L
Sbjct  420  GSYFELIPFGSGRRGCPGLKLGLTIVRLVVAQLVHCFDFKLPDNILSYDLDMTEKFGLNL  479

Query  902  NRAEHLMAIPTYRL  943
             RA HL+ IPTYRL
Sbjct  480  IRANHLLVIPTYRL  493



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 232/316 (73%), Gaps = 5/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E GE+GFKA I EA+++   PNL DY P +   D+QGL RR   VGK FD
Sbjct  183  MAFGKKYRDEEFGERGFKAVIQEAMQLAIAPNLADYIPFVASFDIQGLNRRATFVGKEFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP--VQFTRQHVKSVMLDILIAS  355
             FLE+II +H E+    + +   DFVD +L+IM S +     Q  R ++K++ LD+L A+
Sbjct  243  GFLERIIEEHIESKDGNRNK---DFVDYLLDIMMSSQEADEYQIDRSNIKAIALDVLSAA  299

Query  356  IDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRM  535
            +DTS++ I+W ++EL + P+ MK+++ E+E  VGL+RMVEES LEH KYLE+VIKE LR+
Sbjct  300  MDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLKYLEMVIKEVLRL  359

Query  536  HPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVE  715
            HP  PLL+PH + EDC VDGFHIPK S + VN W+IG+DP VW+DP+KFFPERF  S  +
Sbjct  360  HPPAPLLVPHESLEDCTVDGFHIPKKSRIIVNAWSIGQDPNVWTDPQKFFPERFIHSLTD  419

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF+ +PFGSGRR CPG+QLG+ +V LVVA L+HCFDW LPN ML  DL+M EEFGL
Sbjct  420  VKGRDFQLIPFGSGRRGCPGIQLGLLIVSLVVANLVHCFDWELPNCMLAIDLDMEEEFGL  479

Query  896  SLNRAEHLMAIPTYRL  943
            +  RA+ LM IP YRL
Sbjct  480  TCPRAQELMLIPAYRL  495



>ref|XP_004237617.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 235/315 (75%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY++ +     FK  I +   + A PNL + FP L  +D QG   RMK + +  D
Sbjct  181  MVIGKKYNNVD---GDFKDMIQQTSHMAATPNLAELFPFLRFIDFQGSVLRMKQIAESCD  237

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLE +I++H    S  +++T++D VDT++EIM+SGE+  +F R+HVK+++LD+L+AS+D
Sbjct  238  EFLENVIDEHTRQYSSDQSKTSIDMVDTLMEIMQSGEAEFEFDRRHVKAILLDLLVASMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ IEW +SEL + P +MKK++ E+++      +VEE DL++  YL +VIKE  R+HP
Sbjct  298  TSSTSIEWILSELLKHPNVMKKLQSELDNVFDQKGIVEEKDLKNLDYLNMVIKEGFRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC +DGF +PKGS V VNVWAIGRDP VW +PEKF PERF +S+++ R
Sbjct  358  VAPLLLPHESIEDCTLDGFQMPKGSRVLVNVWAIGRDPDVWREPEKFIPERFVESTIDVR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ+F+ LPFGSGRRSCPG+QLG+T+V LVVAQL+H FDW LPNGM+P D+NMTE+FGL  
Sbjct  418  GQNFQLLPFGSGRRSCPGLQLGLTIVHLVVAQLVHSFDWELPNGMMPNDINMTEKFGLVT  477

Query  902  NRAEHLMAIPTYRLH  946
             RA  LMAIP YRLH
Sbjct  478  ARALPLMAIPIYRLH  492



>ref|XP_008344234.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=496

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 245/315 (78%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G  + + E +K+ A PNLGD+FP +  LD+QGLT++MKAV K+FD
Sbjct  184  MVFGKKYKDEEFGGRGIVSVMKEGLKLAAAPNLGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII+ H ++     A+ T DF D ML  M S ES  +  R ++K++M D+L+AS D
Sbjct  244  DFYEKIIDKHLQSKD---AERTKDFTDAMLSYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ + W +SEL R P++MKKV++E+E+ VGL+RMVEESD E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVLWVLSELMRHPQVMKKVQKELENVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PHAA EDC VDG+HIPK S+V VNVWAIGRDP  W D EKF PERF  S+V+ R
Sbjct  361  VLPLLLPHAAIEDCTVDGYHIPKKSSVIVNVWAIGRDPIAWGDAEKFVPERFEDSNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFGSGRR C GMQLGITVV  V AQL+HCFDW LP+ MLP +L+MTEEFGL++
Sbjct  421  GHHFQILPFGSGRRRCIGMQLGITVVHFVSAQLVHCFDWELPDNMLPNELDMTEEFGLAV  480

Query  902  NRAEHLMAIPTYRLH  946
            +RA++L+AIP+YRL 
Sbjct  481  SRAKNLLAIPSYRLQ  495



>gb|EYU31078.1| hypothetical protein MIMGU_mgv1a004963mg [Erythranthe guttata]
Length=502

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 248/316 (78%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV+G+K+  K+L E+GFK  +   ++  A  N+GDYFP L  LD+QG  RR+K + K+FD
Sbjct  188  MVYGRKFAGKDLDERGFKEVMKMTMEEAAAFNIGDYFPYLRGLDLQGSARRLKKLSKIFD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+II+DH     + K + +MDFVDT++ IM+SGE+   F R+HVK+V+LD+L+A +D
Sbjct  248  GFLERIIDDHAPKKEERK-EISMDFVDTLMSIMESGEAGFDFDRRHVKAVLLDMLLAGMD  306

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ +EW +S+L + P +MKK+++E+E  VG+D+MVEES L + KYL+ V++ES+R+HP
Sbjct  307  TSAAAVEWALSDLVKNPTVMKKLQKELEEIVGMDQMVEESHLPNLKYLDYVVRESMRIHP  366

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKS-SVEY  718
            V PLLI H + EDCEVDGFHIPK + V +NVWAIGRDP  W+ PEKF+PERF +S +V+ 
Sbjct  367  VGPLLI-HESMEDCEVDGFHIPKKTRVLINVWAIGRDPNAWAHPEKFWPERFVESPNVDL  425

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+D++ +PFG+GRR CPG+QLG+T+V+L+VAQL+HCFDW LP+G+   +L+M+E FGL 
Sbjct  426  RGRDYQLIPFGTGRRGCPGLQLGLTIVQLIVAQLVHCFDWELPHGVSASELDMSENFGLV  485

Query  899  LNRAEHLMAIPTYRLH  946
             +RA+HLM IPTYRL+
Sbjct  486  TSRAKHLMVIPTYRLN  501



>gb|EYU31074.1| hypothetical protein MIMGU_mgv1a005121mg [Erythranthe guttata]
Length=496

 Score =   381 bits (978),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 234/317 (74%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    MVFGKKY--DDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKL  175
            MVFG+K+   +      GFK  I E  ++ A PNLGD+FP +G +D+QGLTRRMK +   
Sbjct  181  MVFGRKFAGGELGGSGGGFKYVIDETFQVAAKPNLGDFFPYMGTIDLQGLTRRMKELSTT  240

Query  176  FDEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIAS  355
            FD FLEKII+DH    +K + +   DFVDTM+ IM SGE+  +F R+HVK+V+LD+L+  
Sbjct  241  FDGFLEKIIDDHV-LQNKQQKKENQDFVDTMMAIMDSGEAGFEFDRRHVKAVLLDMLLGG  299

Query  356  IDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRM  535
             DTSS+ I+W ++EL R P+IMKK+++E+E  VGLD+ VEES LE   YL  V+KE+ R+
Sbjct  300  TDTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQYVEESHLEKLDYLNFVVKETFRL  359

Query  536  HPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVE  715
            HPVVPL I H A EDC V+ FHI KG+ + VNVW++ +DP VW DPEKFFPERF  S+++
Sbjct  360  HPVVPLFI-HEALEDCTVEEFHIAKGTRIMVNVWSMSKDPNVWQDPEKFFPERFIGSNLD  418

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
              G DFE LPFGSGRRSCPG+QLG+T VRLV+AQL+HCFDW LPNGM P +L+M+E FGL
Sbjct  419  LHGHDFELLPFGSGRRSCPGLQLGLTTVRLVLAQLVHCFDWELPNGMSPSELDMSEHFGL  478

Query  896  SLNRAEHLMAIPTYRLH  946
               + +H+MAIP  RLH
Sbjct  479  VTGKDKHIMAIPVCRLH  495



>ref|XP_004252382.1| PREDICTED: cytochrome P450 CYP736A12 [Solanum lycopersicum]
Length=493

 Score =   380 bits (976),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 242/315 (77%), Gaps = 4/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+ELG++GFK  + E V + A PNLGD+FP LG +D+QG+TR++K + K+FD
Sbjct  182  MVFGKKYMDEELGKRGFKGILQEVVHLGATPNLGDFFPFLGVIDLQGITRKLKELSKVFD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEKII++H ++  + +++   DFVDTML+IM S +   QF R ++K++++D+L+A+ID
Sbjct  242  AFLEKIIDEHVQSRDQKQSK---DFVDTMLDIMHSRDREFQFDRTNIKAILIDMLVAAID  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ ++W ++EL R P +M K+++E+E  VGL+RMV+ESD E  KYL++V+KE +R+H 
Sbjct  299  TSATSVDWIVTELLRHPHVMTKLQKELEEVVGLERMVKESDFEKLKYLDMVVKEGMRLHS  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVP+     A EDC VDG+HI KGS + +N +AI RDP VW +PEKFFPERF  SS++ R
Sbjct  359  VVPV-TQREAMEDCVVDGYHIRKGSRIMINHYAIQRDPNVWPEPEKFFPERFVGSSIDIR  417

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE LPF SGRRSCP +QLGI VVRL+VAQL+HCFD  LPNGM P DL++ E FG+  
Sbjct  418  GRDFELLPFSSGRRSCPAIQLGIIVVRLMVAQLVHCFDLELPNGMQPCDLDVDEHFGIVT  477

Query  902  NRAEHLMAIPTYRLH  946
            ++  HLM +P YRL+
Sbjct  478  SKENHLMVVPKYRLN  492



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   380 bits (975),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 232/316 (73%), Gaps = 6/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DKE  E  F A + E V + A PN+GDY P L + D+QGLT+RMKAV K+FD
Sbjct  185  MIFGKKYMDKEFDE--FMAVMQEGVVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII++H +A  K +   + DFVD ML IM   E      R H+K+++LD+L AS+D
Sbjct  243  AFFEKIIDEHMKA--KKEEGESKDFVDVMLGIMGLNEGEYHIDRSHIKAIILDMLSASMD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ I+W I+EL R P +MKK+++E+E  VG++R VEESDLE   YL +VIKE +R+HP
Sbjct  301  TSATTIDWAITELTRHPSVMKKLQDELEKAVGMNRAVEESDLEGLHYLNMVIKEIMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS--DPEKFFPERFNKSSVE  715
              P L+P  A EDC V+GFHIP  STV VNVW+IGRDPKVW+  +PE+F PERF   SV+
Sbjct  361  ASPFLLPREATEDCTVNGFHIPSKSTVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSVD  420

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
              G DF+ LPFG+GRR CPG+QLG+TVVR V+AQL+HCFDW+LP G+ P +L+MTEEFGL
Sbjct  421  VMGHDFQLLPFGAGRRGCPGIQLGLTVVRFVLAQLVHCFDWDLPGGISPSELDMTEEFGL  480

Query  896  SLNRAEHLMAIPTYRL  943
            +  RA HL+  P YRL
Sbjct  481  TAPRANHLVVTPRYRL  496



>ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04574.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=477

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 232/314 (74%), Gaps = 18/314 (6%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY DK+L EKGFKA + E + + A PN+GDY P +G LD+QGLTRRMKA+GK+FD
Sbjct  180  MVLGKKYIDKDLDEKGFKAVMQEGMHLAATPNIGDYIPYVGSLDLQGLTRRMKAIGKIFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +  S  K     DFVD ML  + + ES  +  R ++K+++LD+L  S+D
Sbjct  240  DFFEKIIDEHIQ--SDYKDDKNKDFVDVMLGFLGTQESEYRIERPNIKAILLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW ISEL + P +MKKV+ E+E+ VG+ R VEESDLE  +YL++ IKESLR+HP
Sbjct  298  TSATAIEWAISELIKNPIVMKKVQNELETVVGMKRKVEESDLEKLEYLDMAIKESLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+                F IPK + V VN W++ RDP  W+DPE F+PERF +S+++ R
Sbjct  358  VI----------------FSIPKKARVIVNSWSVMRDPNAWTDPEMFWPERFEESNIDVR  401

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR CPG+QLG+TV+RLVVAQL+HCFDW LPN MLP DL+MTEEFGL++
Sbjct  402  GRDFQLIPFGSGRRGCPGLQLGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEEFGLTM  461

Query  902  NRAEHLMAIPTYRL  943
             RA HL AIPTYRL
Sbjct  462  PRANHLTAIPTYRL  475



>gb|EYU31073.1| hypothetical protein MIMGU_mgv1a004944mg [Erythranthe guttata]
Length=503

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 229/315 (73%), Gaps = 2/315 (1%)
 Frame = +2

Query  5    VFGKKYDDKELGE-KGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            VFG+K+ D +L E KGFK+ I E +++ A+PNLGD+FP +G LD+QGLTRRMK V   FD
Sbjct  189  VFGRKFADSDLDETKGFKSVIEEILQLVAIPNLGDFFPYVGWLDLQGLTRRMKQVHNSFD  248

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLEK+I DH     +   +   DFVDTM+ IM SGE+     R+HVK+V+ D+LI   D
Sbjct  249  GFLEKVIEDHGSNNQENTKKDARDFVDTMMAIMDSGEAGFDLDRRHVKAVLADMLIGGTD  308

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T++   +W ++EL R P+IM K+++E+E  VG+++ VEES LE   YL++VIKE+ R+HP
Sbjct  309  TTAVTTDWALAELIRHPQIMNKLQQELEQVVGMEQYVEESHLEKLDYLDLVIKETFRLHP  368

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            +VPLL  H A +DC VD FHIPKG+ V VN+ +I RDP VW +PEKF PERF     +YR
Sbjct  369  IVPLL-NHKAMQDCTVDEFHIPKGTRVIVNLLSISRDPNVWQEPEKFSPERFVGIDTDYR  427

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G DF F+PFGSGRR CPG+ LG+T +RL++AQL+HCFDW LPNG  P +LNM E FGL  
Sbjct  428  GMDFRFIPFGSGRRMCPGIHLGLTSLRLMLAQLIHCFDWELPNGTSPNELNMAEHFGLVT  487

Query  902  NRAEHLMAIPTYRLH  946
            +R EHLMAIP YRLH
Sbjct  488  SRDEHLMAIPIYRLH  502



>gb|AJD25257.1| cytochrome P450 CYP736A122 [Salvia miltiorrhiza]
Length=502

 Score =   379 bits (972),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 242/315 (77%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEK-GFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            MVFG+K+ D++L ++ GFK  I E  ++ A PNLGDYFPL+  LD+QGL RR++ +   F
Sbjct  187  MVFGRKFVDRDLDQELGFKDVIEETTRVAAQPNLGDYFPLVAPLDLQGLNRRVERLSATF  246

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D FL+ II+DH +   + K +   DFVD M+ IM+SG +   F R+HVK+++LD+LI  I
Sbjct  247  DGFLDMIIDDHVKKNEEEKEKKDKDFVDVMMGIMESGAAGFDFDRRHVKAMLLDMLIGGI  306

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DT+S+ ++W +SEL + P +MKK+++EIE  VG+D+MVE+S L   KYL+ V+KESLR+H
Sbjct  307  DTTSTAVDWIMSELMKNPTVMKKLQKEIEEVVGMDQMVEKSHLSSLKYLDCVVKESLRLH  366

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PV PLL  HAA+ DC+V GF IP  + V VNVWAIGRDP VW +PE F P+RF +S+V++
Sbjct  367  PVAPLL-AHAAQGDCQVAGFDIPDKTHVFVNVWAIGRDPHVWPNPETFCPDRFLRSNVDF  425

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ LPFGSGRRSCPG+QLG+T+VR VVAQL+HCFDW LP+GML  +L+M E++G+ 
Sbjct  426  RGRDFQLLPFGSGRRSCPGLQLGLTIVRSVVAQLVHCFDWELPDGMLADELDMFEKYGMV  485

Query  899  LNRAEHLMAIPTYRL  943
            + RA+HL AIPTYRL
Sbjct  486  ITRAKHLRAIPTYRL  500



>emb|CDP01384.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 242/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKKY DK+  ++GF+  I E + + A+PNLGDYFPLLG LD+QGLTRR K + K+FD
Sbjct  185  MIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYFPLLGLLDLQGLTRRFKDLAKVFD  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H  +    + + T DFVD M+ IM+SGE+  +F R HVK+++LD+L+AS+D
Sbjct  245  KFFEKIIDEHLHSQ---EHKQTKDFVDIMMGIMQSGEAEFEFDRSHVKAILLDLLVASMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS + +EW ISEL R PE M+K+++ +E  VGL+R+VEESD+E  +YL++VIKES+R+HP
Sbjct  302  TSVTAVEWAISELLRHPEAMRKLQKALEEKVGLERIVEESDIEGLEYLDMVIKESMRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH + EDC VD FHI K S + +N++ IGRDP VW DP  F PERF  S+++ R
Sbjct  362  VAPLLLPHESMEDCTVDDFHIQKKSRIIINIYTIGRDPNVWPDPATFNPERFKDSNIDLR  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQDF  +PFGSGRRSCPG+QLG+ +VR V+AQL+HCF+W+L + + P DL+M+E FGL  
Sbjct  422  GQDFRLIPFGSGRRSCPGLQLGLLLVRFVLAQLVHCFNWDLADNIQPTDLDMSEAFGLVT  481

Query  902  NRAEHLMAIPTYRLH  946
            +RA+HL  +PT RL 
Sbjct  482  SRAKHLKVVPTCRLQ  496



>ref|XP_007159750.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
 gb|ESW31744.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
Length=497

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 238/315 (76%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ GKKY D+EL E GFKA + E + + A PN+GDY P +GKLD+QGL +RMK + K+FD
Sbjct  181  MILGKKYMDQELDEMGFKAVMKELMYLAAAPNMGDYIPYIGKLDLQGLIKRMKVMRKIFD  240

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF +KII++H + + KG+ +   DFVD ML  + + E   +    ++K+++LD+L+ SID
Sbjct  241  EFFDKIIDEHIQ-SEKGEEEVK-DFVDVMLGFVGTEELGFRVEIPNIKAILLDLLVGSID  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKK++ E+ES VG+ R VEESDLE  +YL++VIKESLR+HP
Sbjct  299  TSATAIEWTLSELLKNPRVMKKLQVELESVVGMKRKVEESDLEKLEYLDMVIKESLRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLL+PH   EDC V  F IPK S + VN WAI RDP  W + EKF+PERF  S+++ R
Sbjct  359  VAPLLVPHQTTEDCMVGDFFIPKNSRLIVNAWAIMRDPGAWIEAEKFWPERFEGSNIDVR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++FE +PFGSGRR CPG+QLG+TV+R  VAQL+HCFDW LPN M+P +L+M +EFGL++
Sbjct  419  GREFELIPFGSGRRGCPGIQLGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTM  478

Query  902  NRAEHLMAIPTYRLH  946
             RA HL+AIP+ RL+
Sbjct  479  PRANHLLAIPSQRLY  493



>ref|XP_010319819.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=304

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 166/280 (59%), Positives = 218/280 (78%), Gaps = 0/280 (0%)
 Frame = +2

Query  107  YFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS  286
            YFP    +D QGL  RMK + K  DEFLE +I++H       +++T++D VDT++EIM+S
Sbjct  23   YFPFFVFIDFQGLILRMKQIAKSCDEFLENVIDEHTGQYLSDQSKTSIDMVDTLMEIMQS  82

Query  287  GESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDR  466
            GE+  +F R+HVK+++LD+L+AS+DTSS+ IEW +SELF+ P +MKK++ E+++ VG   
Sbjct  83   GETEFEFDRRHVKAILLDLLVASMDTSSTSIEWILSELFKHPNVMKKLQSELDNVVGQKG  142

Query  467  MVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIG  646
            +VEE DLE+  YL +VIKE  R+HPV PLL+PH + EDC +DGF IPKGS V VNVWAIG
Sbjct  143  IVEEKDLENLDYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQIPKGSRVLVNVWAIG  202

Query  647  RDPKVWSDPEKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLH  826
            RDP VW +PEKF PERF +S+++ RGQ+F+ LPFGS RRSCPG+QLG+T+VRLVVAQL+H
Sbjct  203  RDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSSRRSCPGLQLGLTIVRLVVAQLVH  262

Query  827  CFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRLH  946
             FDW LPNG +P D+NMTE+FGL   RA  LMAIP YRLH
Sbjct  263  SFDWELPNGTMPNDINMTEKFGLVTARALSLMAIPIYRLH  302



>ref|XP_004172515.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=475

 Score =   375 bits (962),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 224/313 (72%), Gaps = 3/313 (1%)
 Frame = +2

Query  5    VFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDE  184
            VFG+KY DKEL  KGFK  + EA+K+    N+GD+ P +  LD+QGL RR K+V K+FD 
Sbjct  164  VFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFIPFIAPLDLQGLIRRAKSVHKVFDR  223

Query  185  FLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASIDT  364
            FLE+II++H E+ +     +T DFVD MLEIM+S ++  Q  R  +K++MLD+L A +DT
Sbjct  224  FLERIIDEHLESKNN---NSTKDFVDVMLEIMESQQTDYQIDRSTIKAIMLDLLFAGMDT  280

Query  365  SSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPV  544
            +++ I W I+EL R PEIMKKV+ E+E  VGL RMV+ES+L H KYLE+V+KE  R+HP 
Sbjct  281  TTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMVQESELSHLKYLEMVVKEVFRLHPP  340

Query  545  VPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYRG  724
             PLLIPH   +DC V+ FHIPK S V VN WAIGRDP  W+D  +FFPERF  S V+ +G
Sbjct  341  APLLIPHQPLKDCIVNNFHIPKMSRVIVNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKG  400

Query  725  QDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLN  904
              FE +PFGSGRR C G+Q+G+  V  V+A LLHCFDW LPNGMLP DL+ TEEFG+S  
Sbjct  401  NHFELIPFGSGRRGCVGIQMGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCP  460

Query  905  RAEHLMAIPTYRL  943
             A  +M  P YRL
Sbjct  461  LAHDVMVTPIYRL  473



>gb|EYU31075.1| hypothetical protein MIMGU_mgv1a005090mg [Erythranthe guttata]
Length=497

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 232/315 (74%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKY-DDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            MVFG+K+      G  GFK+ I E  ++ A PNLGD+FP +G +D+QGLTRRMK +   F
Sbjct  183  MVFGRKFAGGGLGGSGGFKSVIDETFQVAAKPNLGDFFPYMGTIDLQGLTRRMKELSTTF  242

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D FLEKII+DH    +K + +   DFVDTM+ IM SGE+  +F R+HVK+V+LD+L+   
Sbjct  243  DGFLEKIIDDHV-LQNKQQKKENQDFVDTMMAIMDSGEAGFEFDRRHVKAVLLDMLLGGT  301

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTSS+ I+W ++EL R P+IMKK+++E+E  VGLD+ VEES LE   YL  V+KE+ R+H
Sbjct  302  DTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQYVEESHLEKLDYLNFVVKETFRLH  361

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            PVVPL I H A EDC V+ FHI KG+ + VNVW++ +DP VW DPEKFFPERF  S ++ 
Sbjct  362  PVVPLFI-HEALEDCTVEEFHIAKGTRIMVNVWSMSKDPNVWQDPEKFFPERFIGSDLDL  420

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
             G DFE LPFGSGRRSCPG+QLG+T VRLV+AQL+HCFDW L NGM P +L+M+E FGL 
Sbjct  421  LGHDFELLPFGSGRRSCPGLQLGLTTVRLVLAQLVHCFDWELTNGMSPNELDMSEHFGLV  480

Query  899  LNRAEHLMAIPTYRL  943
              + +H+MAIP  RL
Sbjct  481  TGKDKHIMAIPVCRL  495



>ref|XP_004143572.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=500

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 224/313 (72%), Gaps = 3/313 (1%)
 Frame = +2

Query  5    VFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDE  184
            VFG+KY DKEL  KGFK  + EA+K+    N+GD+ P +  LD+QGL RR K+V K+FD 
Sbjct  189  VFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFIPFIAPLDLQGLIRRAKSVHKVFDR  248

Query  185  FLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASIDT  364
            FLE+II++H E+ +     +T DFVD MLEIM+S ++  Q  R  +K++MLD+L A +DT
Sbjct  249  FLERIIDEHLESKNN---NSTKDFVDVMLEIMESQQTDYQIDRSTIKAIMLDLLFAGMDT  305

Query  365  SSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPV  544
            +++ I W I+EL R PEIMKKV+ E+E  VGL RMV+ES+L H KYLE+V+KE  R+HP 
Sbjct  306  TTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMVQESELSHLKYLEMVVKEVFRLHPP  365

Query  545  VPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYRG  724
             PLLIPH   +DC V+ FHIPK S V VN WAIGRDP  W+D  +FFPERF  S V+ +G
Sbjct  366  APLLIPHQPLKDCIVNNFHIPKMSRVIVNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKG  425

Query  725  QDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLN  904
              FE +PFGSGRR C G+Q+G+  V  V+A LLHCFDW LPNGMLP DL+ TEEFG+S  
Sbjct  426  NHFELIPFGSGRRGCVGIQMGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCP  485

Query  905  RAEHLMAIPTYRL  943
             A  +M  P YRL
Sbjct  486  LAHDVMVTPIYRL  498



>ref|XP_009372715.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 241/315 (77%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G    + E +K+   PN GD+FP +  LD+QGLT++MKAV K+FD
Sbjct  184  MVFGKKYKDEEFGGRGIVYVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++     A+ T DF D ML  M S ES  +  R ++K++M D+L+AS D
Sbjct  244  DFYEKIIDEHLQSMD---AERTKDFTDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ + W +SEL R P++MKKV++EI++ VGL+RMVEESD E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PHAA EDC VDG+HIPK S V VNVWAIGRDP  W D EKF PERF  S+V+ R
Sbjct  361  VLPLLLPHAAIEDCTVDGYHIPKKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFGSGRR C GMQLGITVV  V+AQL+HCFDW LP+ MLP +L+M EEFGL++
Sbjct  421  GHHFQILPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMAEEFGLAV  480

Query  902  NRAEHLMAIPTYRLH  946
            +RA++L+AIP YRL 
Sbjct  481  SRAKNLLAIPLYRLQ  495



>ref|XP_004153472.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 ref|XP_004162329.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 228/316 (72%), Gaps = 5/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E GE+GFKA I E +++   PNL DY P +   D+QGL RR   V K FD
Sbjct  184  MAFGKKYRDEEFGERGFKAVIQEGMQLVIAPNLADYIPFVAPFDIQGLNRRATFVLKEFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP--VQFTRQHVKSVMLDILIAS  355
             F E+II +H E+    + +   DF+D +L+IM S + P   Q  R ++K++ LD+L A+
Sbjct  244  GFFERIIEEHIESKDGNRNK---DFMDHLLDIMMSSQDPDGYQIDRSNIKAIALDVLSAA  300

Query  356  IDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRM  535
            +DTS++ I+W ++EL + P+ MK+++ E+E  VGL+RMVEES LEH +YL +VIKE LR+
Sbjct  301  MDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLQYLGMVIKEVLRL  360

Query  536  HPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVE  715
            HP  PLL+PH + EDC VDGFHIPK S + VN W+IG+DP VW DP+KFFPERF  S  +
Sbjct  361  HPPAPLLVPHESLEDCTVDGFHIPKKSRIFVNAWSIGQDPNVWIDPQKFFPERFIHSLAD  420

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF  +PFGSGRRSCPG+ LG+ +V LVVA L+HCFDW LPN ML  DL+M EEFGL
Sbjct  421  VKGRDFHLIPFGSGRRSCPGIHLGLLIVSLVVANLVHCFDWELPNCMLATDLDMEEEFGL  480

Query  896  SLNRAEHLMAIPTYRL  943
            +  RA+ LM IPTYRL
Sbjct  481  TCPRAQELMLIPTYRL  496



>ref|XP_007221131.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
 gb|EMJ22330.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
Length=494

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 229/315 (73%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GK Y D+E   +G ++ I E +++    NLGDY P +   D+QG T++MK+V K  D
Sbjct  182  MVLGKMYRDEEFDARGIRSVIKEGIQLIVAANLGDYIPFIAPFDLQGFTKQMKSVNKALD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EK+I++H ++    + + T DFVD M+  M S +S  +  R H+K+++ D+L+ SID
Sbjct  242  TFFEKVIDEHIQSN---EGERTKDFVDVMVAFMGSEQSEYRIERPHIKAIIFDMLVGSID  298

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T S  +EW +SEL R P+ MKKV++E+E  VGL RMVEESDL    YL +V+KE++R+HP
Sbjct  299  TLSVTVEWALSELMRNPKAMKKVQKELEDVVGLGRMVEESDLGKLDYLSMVVKETMRLHP  358

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPHAA EDC V+G+HIPK S V +N WAIGRDP  W D E+F PERF+ S V+ R
Sbjct  359  VGPLLIPHAATEDCTVNGYHIPKKSHVIINAWAIGRDPSAWIDAEEFIPERFDGSDVDVR  418

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ +PFGSGRR CPG+QL + VV+L++AQL+HCFDW LPN MLP++L+MTE FG+++
Sbjct  419  GNHFQLIPFGSGRRRCPGIQLALIVVQLMLAQLVHCFDWELPNDMLPEELDMTEVFGITV  478

Query  902  NRAEHLMAIPTYRLH  946
             RA+ L+AIP+YRLH
Sbjct  479  ARAKRLIAIPSYRLH  493



>ref|XP_009372727.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 241/310 (78%), Gaps = 3/310 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G  + + E +K+   PN GD+FP +  LD+QGLT++MKAV K+FD
Sbjct  184  MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++     A+ T DF+D ML  M S ES  +  R ++K++M D+L+AS D
Sbjct  244  DFYEKIIDEHLQSKD---AERTKDFIDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ + W +SEL R P++MKKV++EI++ VGL+RMVEESD E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PHAA EDC VDG+HIPK S V VNVWAIGRDP  W D EKF PERF  S+V+ R
Sbjct  361  VLPLLLPHAAIEDCTVDGYHIPKKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFGSGRR C GMQLGITVV  V+AQL+HCFDW LP+ MLP +L+MTEEFGL++
Sbjct  421  GHHFQILPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAV  480

Query  902  NRAEHLMAIP  931
            +RA++L+AIP
Sbjct  481  SRAKNLLAIP  490



>ref|XP_009372726.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   370 bits (951),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 240/310 (77%), Gaps = 3/310 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G  + + E +K+   PN GD+FP +  LD+QGLT++MKAV K+FD
Sbjct  184  MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++     A+ T DF D ML  M S ES  +  R ++K++M D+L+AS D
Sbjct  244  DFYEKIIDEHLQSMD---AERTKDFTDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ + W +SEL R P++MKKV++EI++ VGL+RMVEESD E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PHAA EDC VDG+HIPK S V VNVWAIGRDP  W D EKF PERF  S+V+ R
Sbjct  361  VLPLLLPHAAIEDCTVDGYHIPKKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFGSGRR C GMQLGITVV  V+AQL+HCFDW LP+ MLP +L+MTEEFGL++
Sbjct  421  GHHFQILPFGSGRRRCVGMQLGITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAV  480

Query  902  NRAEHLMAIP  931
            +RA++L+AIP
Sbjct  481  SRAKNLLAIP  490



>ref|XP_007159749.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31743.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=483

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 233/316 (74%), Gaps = 15/316 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D++L EKGFKA + E + ++A PN+GDY P +  LD+QGL +RMK VGK+FD
Sbjct  180  MVLGKKYMDRDLDEKGFKAVMQEGMHLSATPNMGDYIPYIAALDLQGLNKRMKVVGKIFD  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H +  S+ +   T DFVD ML  + + ES  +  R ++K++MLD+L  S+D
Sbjct  240  DFFEKIIDEHMQ--SEKEENKTKDFVDVMLGFVGTEESEYRIERPNIKAIMLDMLAGSMD  297

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWT+SEL + P +MKK++ E+E+ VG+++ VEESDLE  +YL++VIKESLR+HP
Sbjct  298  TSATAIEWTLSELLKNPRVMKKLQVELENVVGMEKKVEESDLEKLEYLDMVIKESLRLHP  357

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIPH + EDC VD                I RDP  W + EKF+PERF  S+++ R
Sbjct  358  VAPLLIPHQSTEDCMVDSE-------------CIMRDPDAWIEAEKFWPERFEGSNIDVR  404

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G++FE +PFGSGRR CPG+QLG+TV+R  VAQL+HCFDW LPN M+P +L+M +EFGL++
Sbjct  405  GREFELIPFGSGRRGCPGIQLGLTVIRHTVAQLVHCFDWKLPNDMMPAELDMADEFGLTM  464

Query  902  NRAEHLMAIPTYRLHI  949
             RA HL+AIP+YRL +
Sbjct  465  PRANHLLAIPSYRLSL  480



>ref|XP_009372725.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 239/310 (77%), Gaps = 3/310 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY D+E G +G  + + E +K+   PNLGD+FP +  LD+QGLT++MKAV K FD
Sbjct  184  MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNLGDFFPCIAPLDLQGLTKKMKAVNKEFD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            +F EKII++H ++     A+ T DF+D ML  M S ES  +  R ++K++M D+L+AS D
Sbjct  244  DFYEKIIDEHLQSKD---AERTKDFIDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TSS+ + W +S L R P++MKKV++EI++ VGL+RMVEESD E  +YL++V+KE++R+HP
Sbjct  301  TSSTTVLWALSGLMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PHAA EDC VDG+HIPK S V VNVWAIGRDP VW D EKF PERF  S+V+ R
Sbjct  361  VLPLLLPHAAIEDCTVDGYHIPKKSRVIVNVWAIGRDPSVWEDAEKFVPERFEDSNVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G  F+ LPFGSGRR C GMQLGITVV  V+AQL+H FDW LP+ MLP +L+MT EFGL++
Sbjct  421  GHHFQILPFGSGRRRCVGMQLGITVVHFVLAQLVHWFDWELPDNMLPNELDMTAEFGLAV  480

Query  902  NRAEHLMAIP  931
            +RA++L+AIP
Sbjct  481  SRAKNLLAIP  490



>ref|XP_004143566.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=506

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 236/318 (74%), Gaps = 5/318 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D+EL ++GFKA + E +++ A PNLGD+ P + + D+QGL RRM  V K+FD
Sbjct  192  MVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFIPFIERFDLQGLNRRMINVSKVFD  251

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFT--RQHVKSVMLDILIAS  355
             F E+II++H ++  + K   T DF+D ML++M +     ++   R +VK+++LD+L A+
Sbjct  252  GFFERIIDEHLKSMGEKK---TKDFLDVMLDLMNTECLSYEYRIDRSNVKAIILDMLGAA  308

Query  356  IDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRM  535
            +DTS++VI W + EL R P++MKKVK+E+E+ VGLD +VEES L H +YL++VIKE LR+
Sbjct  309  MDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDTIVEESHLIHLQYLDMVIKEILRL  368

Query  536  HPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVE  715
            +P VPLL+PH + +DC VDGF IP+ S V VN WAIGRDP  W  P KF PERF  S ++
Sbjct  369  YPPVPLLVPHESLQDCVVDGFFIPRKSRVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLD  428

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF+ +PFG+GRR CPG+ LG+TVVRLV+AQLLHCFDW L  GM   +L+MTE FGL
Sbjct  429  VKGRDFQLIPFGAGRRGCPGIHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGL  488

Query  896  SLNRAEHLMAIPTYRLHI  949
            +  RA+ L+ IP YRLHI
Sbjct  489  TCPRAQDLILIPVYRLHI  506



>ref|XP_004162326.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=507

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 236/318 (74%), Gaps = 5/318 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D+EL ++GFKA + E +++ A PNLGD+ P + + D+QGL RRM  V K+FD
Sbjct  193  MVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFIPFIERFDLQGLNRRMINVSKVFD  252

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFT--RQHVKSVMLDILIAS  355
             F E+II++H ++  + K   T DF+D ML++M +     ++   R +VK+++LD+L A+
Sbjct  253  GFFERIIDEHLKSMGEKK---TKDFLDVMLDLMNTECLSYEYRIDRSNVKAIILDMLGAA  309

Query  356  IDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRM  535
            +DTS++VI W + EL R P++MKKVK+E+E+ VGLD +VEES L H +YL++VIKE LR+
Sbjct  310  MDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDTIVEESHLIHLQYLDMVIKEILRL  369

Query  536  HPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVE  715
            +P VPLL+PH + +DC VDGF IP+ S V VN WAIGRDP  W  P KF PERF  S ++
Sbjct  370  YPPVPLLVPHESLQDCVVDGFFIPRKSRVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLD  429

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             +G+DF+ +PFG+GRR CPG+ LG+TVVRLV+AQLLHCFDW L  GM   +L+MTE FGL
Sbjct  430  VKGRDFQLIPFGAGRRGCPGIHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGL  489

Query  896  SLNRAEHLMAIPTYRLHI  949
            +  RA+ L+ IP YRLHI
Sbjct  490  TCPRAQDLILIPVYRLHI  507



>ref|XP_008460602.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=528

 Score =   364 bits (934),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 230/317 (73%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    MVFGKKY-DDKEL--GEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGK  172
            MVFGKKY +D+E+   EK F  A+ E V++ A PNL D+ P +   D QG+ RR K++  
Sbjct  211  MVFGKKYVEDQEMIMDEKSFHDAVKEVVQLVATPNLSDFIPCVAWFDFQGINRRAKSLRN  270

Query  173  LFDEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIA  352
            +FD FLE+II +H +   K + +   DFVD +L +M S  +        +K+++L+++I 
Sbjct  271  MFDGFLERIIEEHLDDQFKNENKNQ-DFVDVLLGLMGSQNNEYNIDPSTIKALILEMVIT  329

Query  353  SIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLR  532
            ++DT+++ I+W I EL R P IMKK+++E++  VGL RMV ESDLEH +YL +VIKE LR
Sbjct  330  AMDTTATNIDWAIVELIRHPHIMKKMQQELDKVVGLQRMVLESDLEHLQYLNMVIKEVLR  389

Query  533  MHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSV  712
            +HP VPLL+PH + +DC  +GFHIPK S + VN WAIGRDP VW+DP+KFFPERF  S V
Sbjct  390  LHPPVPLLVPHESLQDCTTNGFHIPKQSRIIVNAWAIGRDPTVWNDPQKFFPERFIDSEV  449

Query  713  EYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFG  892
            + +G+DFE +PFGSGRR CPGM LG+T+VRL++AQL+H F W LPNG+LP  L+MTEEFG
Sbjct  450  DLKGKDFELIPFGSGRRCCPGMHLGLTMVRLLLAQLVHAFYWELPNGILPNQLDMTEEFG  509

Query  893  LSLNRAEHLMAIPTYRL  943
            L+  RA+HLM  P YRL
Sbjct  510  LTCPRAQHLMVTPIYRL  526



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 229/321 (71%), Gaps = 10/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K  D
Sbjct  188  MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTVD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDIL  346
            + LEKII DHE  + + + +   DFVD +L  +    +P         R + K+++LD++
Sbjct  244  QLLEKIIQDHELVSRREQGKHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAILLDMI  303

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KES
Sbjct  304  AGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKES  363

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HPV PLL+PH + ED  VDG+HIPK S + +N+W IGRDP VWSD  E+F+PERF  
Sbjct  364  LRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMN  423

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG DF+ +PFGSGRR CP MQLG+T VRL +  LLHCF+W LP+GMLPKDL+MTE
Sbjct  424  SNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLHCFNWELPSGMLPKDLDMTE  483

Query  884  EFGLSLNRAEHLMAIPTYRLH  946
            +FGLSL++A+HL+A+PT RL+
Sbjct  484  KFGLSLSKAKHLLAMPTCRLY  504



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 226/321 (70%), Gaps = 10/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LDVQGLT+RMK V K  D
Sbjct  188  MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDVQGLTKRMKRVSKTVD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDIL  346
            + LEKII DHE+ +   +     DFVD +L  +     P         R + K+++LD++
Sbjct  244  QLLEKIIQDHEQGSRSEQGNHHKDFVDVLLSSIHQPLKPNDEEVYMLERTNAKAILLDMI  303

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KES
Sbjct  304  AGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKES  363

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HPV PLL+PH + ED  VDG+HIPK S + +N+W IGRDP VWSD  E+F+PERF  
Sbjct  364  LRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYPERFMN  423

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG DF+ +PFGSGRR CP MQLG+T VR  +  LLHCF+W LP+GMLPKDL+MTE
Sbjct  424  SNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRFALGNLLHCFNWELPSGMLPKDLDMTE  483

Query  884  EFGLSLNRAEHLMAIPTYRLH  946
            +FGLSL++A+HL+A+PT RL+
Sbjct  484  KFGLSLSKAKHLLAMPTCRLY  504



>gb|KEH15895.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=323

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 223/314 (71%), Gaps = 30/314 (10%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +VFGKKY DK+L EKGFKA++                             RMKA+GK+FD
Sbjct  40   IVFGKKYSDKDLNEKGFKASM-----------------------------RMKAIGKIFD  70

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EFLEKII++H ++ +K   +T  DFVD ML  + + ES  +  R ++K++++D+LI + D
Sbjct  71   EFLEKIIDEHIQSENKDDNKTK-DFVDVMLGFVGTEESDYRIERSNIKAIIMDMLIGATD  129

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEWTISEL + P +MKKV++E+E  VG+ R VEESDLE  +YL +VIKESLR HP
Sbjct  130  TSATAIEWTISELLKNPRVMKKVQKELEIVVGMKRKVEESDLEKLEYLNMVIKESLRFHP  189

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            VVPL +PH + EDC V+ F IPK S + VN WAI RDP  W+DPEKF+PERF  ++++  
Sbjct  190  VVPLSVPHQSMEDCTVEEFFIPKNSRIMVNAWAIMRDPNSWTDPEKFWPERFEGNNIDVG  249

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            GQ F  +PFGSGRR CPG+QLG+T+VRL VAQL+HCFD+ LPN MLP DL+MTE FG+++
Sbjct  250  GQHFHLIPFGSGRRGCPGLQLGLTMVRLAVAQLVHCFDFKLPNDMLPSDLDMTESFGVTM  309

Query  902  NRAEHLMAIPTYRL  943
             RA HL+AIP YRL
Sbjct  310  PRANHLIAIPVYRL  323



>ref|XP_004153471.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
 ref|XP_004162314.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=497

 Score =   357 bits (916),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 230/317 (73%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M FGKKY D+E+ E+GFKA I E  ++ A PNLGD+FP + + DVQ L  RM+ V K+ D
Sbjct  184  MAFGKKYGDEEIDERGFKATIQEGSQLAATPNLGDFFPFIARFDVQRLNNRMQCVHKVLD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMK-SGESPVQFTRQHVKSVMLDILIASI  358
             FLE+I+N+H EA    K   T D VD MLE+M    E+  Q  R  +K++MLD+L A +
Sbjct  244  GFLERIVNEHLEAKGDKK---TKDLVDVMLELMNFQEETDYQIDRSAIKAIMLDMLSAGM  300

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS++VI W +SEL + P IMKK++EE+E+ +GLD++VEESDLE  +YL++V+KE  R++
Sbjct  301  DTSATVIGWAMSELIKHPHIMKKLQEELENEIGLDKIVEESDLERLEYLKMVVKEIFRLY  360

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            P  PLL+PH + +DC VDGFHIPK S + +NVWAIGRD   W DP KF PERF  S V+ 
Sbjct  361  PPAPLLLPHESLQDCIVDGFHIPKKSRIIINVWAIGRDRNSWIDPHKFDPERFIDSQVDV  420

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            +G+DF+ +PFGSGRR CPGMQLG+T+V+ V+AQL+HCFDW L NGM    L+MTEEFGL+
Sbjct  421  KGRDFQLIPFGSGRRGCPGMQLGLTLVQFVLAQLVHCFDWMLSNGMPASQLDMTEEFGLT  480

Query  899  LNRAEHLMAIPTYRLHI  949
              R   L+ IP YRL I
Sbjct  481  CPRLHDLIVIPRYRLRI  497



>ref|XP_004143494.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 241/317 (76%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D+EL ++GFKA I E +++ A PNLGD  P +   D+QGLTRRMK + K+FD
Sbjct  188  MVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLIPFIAMFDLQGLTRRMKNINKVFD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGES-PVQFTRQHVKSVMLDILIASI  358
             F E+II++H ++  + K   T DF+D ML++MKS ++   +  R  VK+++LD+L A++
Sbjct  248  RFFERIIDEHLKSMGEKK---TKDFLDVMLDLMKSEDTHEYRIDRSSVKAIILDVLGAAM  304

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS++VI W ++EL R P++MKKV++E+E+ VGLDRMVEE DL H +YL++VIKE LR++
Sbjct  305  DTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRMVEELDLIHLEYLDMVIKEILRLY  364

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            P +PLL+PH + +DC V+ F IPK S V VN WAIGR+P  W  P KF PERF  S ++ 
Sbjct  365  PPLPLLVPHESLQDCIVEDFFIPKNSRVIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDV  424

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ +PFG+GRR CPG+QLG+TV+RLV+AQLLHCFDW LPNG    +L+MTEEFGL+
Sbjct  425  RGRDFQLIPFGAGRRGCPGIQLGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLT  484

Query  899  LNRAEHLMAIPTYRLHI  949
              RA+ L+ IP YRLHI
Sbjct  485  CPRAQDLIVIPIYRLHI  501



>ref|XP_004299223.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 233/322 (72%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DDK       KA + E   +    N+ D+ P L   D+QGLT+R+K V K  D
Sbjct  186  MVLGCKRDDK----FDLKAFVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSKTAD  241

Query  182  EFLEKIINDHEEA--TSKGKAQTTMDFVDTML----EIMKSGESPVQFT-RQHVKSVMLD  340
            + L+KIINDHE+A  T  GK     DFVD +L    +++   +  V F  R++VK+++LD
Sbjct  242  QLLDKIINDHEQAAETKGGKQGQHEDFVDVLLSFTNQLLNPNDEQVHFLDRENVKAILLD  301

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ A+ DTS++ I W+++EL R P IMK+++EE+++ VG+DRMVEESDL    YL +V+K
Sbjct  302  MITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQTVVGMDRMVEESDLPKLDYLNLVVK  361

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            ES R+HPV PLL+PH + +D  +DG+ IPK S + VN W+I RDP VWS+  E+F+PERF
Sbjct  362  ESFRLHPVAPLLVPHESIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSENVEEFYPERF  421

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S+++ RG D++ +PFG+GRR CPGMQLG+T VRLV+AQL+HCF+W LPNGMLP+DLNM
Sbjct  422  TNSNIDLRGHDYQLIPFGTGRRGCPGMQLGLTTVRLVLAQLVHCFNWELPNGMLPQDLNM  481

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL+A PTYRL
Sbjct  482  TEKFGLSLSKAKHLLAKPTYRL  503



>ref|XP_004162312.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 241/317 (76%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+K+ D+EL ++GFKA I E +++ A PNLGD  P +   D+QGLTRRMK + K+FD
Sbjct  188  MVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLIPFIAMFDLQGLTRRMKNINKVFD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGES-PVQFTRQHVKSVMLDILIASI  358
             F E+II++H ++  + +   T DF+D ML++MKS ++   +  R  VK+++LD+L A++
Sbjct  248  RFFERIIDEHLKSMGEKR---TKDFLDVMLDLMKSEDTHEYRIDRSSVKAIILDVLGAAM  304

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS++VI W ++EL R P++MKKV++E+E+ VGLDRMVEE DL H +YL++VIKE LR++
Sbjct  305  DTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRMVEELDLIHLEYLDMVIKEILRLY  364

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEY  718
            P +PLL+PH + +DC V+ F IPK S V VN WAIGR+P  W  P KF PERF  S ++ 
Sbjct  365  PPLPLLVPHESLQDCIVEDFFIPKNSRVIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDV  424

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG+DF+ +PFG+GRR CPG+QLG+TV+RLV+AQLLHCFDW LPNG    +L+MTEEFGL+
Sbjct  425  RGRDFQLIPFGAGRRGCPGIQLGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLT  484

Query  899  LNRAEHLMAIPTYRLHI  949
              RA+ L+ IP YRLHI
Sbjct  485  CPRAQDLIVIPIYRLHI  501



>ref|XP_006365796.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=482

 Score =   354 bits (909),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 216/286 (76%), Gaps = 3/286 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFGKKY ++E  E+GFK   +EA  + A PN+ ++FP L   D+QG   RMK + K+FD
Sbjct  187  MVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEFFPFLSVFDLQGFIARMKDLAKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            EF EK+I++H ++  + +A+   D VDTM+ IM+SGE+  +  R+ VK+V+LD+L+AS D
Sbjct  247  EFFEKVIDEHVQSKEQNQAK---DMVDTMMTIMQSGEAEFKIDRRDVKAVLLDLLLASTD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
              S  I+W +SEL R P++MKK++ E+E  VG++RMVEESDLE  +YL++VI+E LR+HP
Sbjct  304  NVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRMVEESDLERLEYLDMVIREGLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
               LL PH + EDC VDGF IPKGS + VNVWAIGRDP+ W DPEKF PERF  S+++ R
Sbjct  364  PSTLLTPHESIEDCIVDGFDIPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLR  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGML  859
            G DF+ LPFGSGRRSCPG+QLG+T+VRLV+AQL+HCFDW LPN  L
Sbjct  424  GHDFQLLPFGSGRRSCPGLQLGLTIVRLVLAQLVHCFDWELPNVFL  469



>ref|XP_008374738.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=529

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 232/322 (72%), Gaps = 11/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K+ D
Sbjct  209  MVLGRKNDDMF----DLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKIVD  264

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDI  343
            + LEKII DHE+ + S+ +     DFVD +L  +    +P         R +VK+++LD+
Sbjct  265  QLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNNEEVYMLERTNVKAILLDM  324

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++ ++DTS++ I WT++EL R P++MK+++EE++S + +DRMVEESDL    YL  V+K+
Sbjct  325  IVGALDTSTTAIVWTLAELLRHPKVMKRLQEELKSVIRMDRMVEESDLPKLDYLSTVVKD  384

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            SLR+HP+ PLL+PH + ED  VDG+HIPK S V +N+W IGRDP VWSD  E+F+ ERF 
Sbjct  385  SLRLHPIAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTIGRDPSVWSDNVEEFYNERFM  444

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             ++V+ RG DF+ +PFGSGRR CP MQLG+T VRLV+  LLHCF+W LP+GMLPKDL+MT
Sbjct  445  NNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLVLGNLLHCFNWELPSGMLPKDLDMT  504

Query  881  EEFGLSLNRAEHLMAIPTYRLH  946
            E+FGLSL++A+HL+A+PT RL+
Sbjct  505  EKFGLSLSKAKHLLAMPTCRLY  526



>ref|XP_004169555.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=429

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 232/318 (73%), Gaps = 8/318 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKK+ DKEL      AAI E   ++  PNLGD+FP +  LD+QGL RR KAV K+ D
Sbjct  118  MLFGKKFVDKEL-----TAAIREGTSLSGAPNLGDFFPFIAFLDLQGLGRRAKAVNKVVD  172

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FL+ II +  E   K K +++  FVD ML++++S E   Q  R ++K+V+ D++I  +D
Sbjct  173  GFLDMIIEERLEFKDKNKTESSELFVDVMLDLIRSEEMEHQIDRSNIKAVIFDLMIGGVD  232

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            +SS+ I W +SE+ + P++MKK++EE++  VGL++MVEES L   KYL++ IKESLR+HP
Sbjct  233  SSSTTIIWALSEIIKNPQVMKKIQEELKEVVGLNKMVEESHLNQLKYLDMTIKESLRIHP  292

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+P LIP  + +DC V+G+HIPK + + +N WAIG+DP  W +P+KF P+RF  + +++ 
Sbjct  293  VIP-LIPRKSIQDCNVNGYHIPKNTDIIINDWAIGQDPCYWIEPQKFNPDRFVDTQIDFI  351

Query  722  G--QDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
            G   +FE +PFGSGRR CPGMQLG+ +VR++VAQL+HCFDW LPNG+LP +L+M+E+FGL
Sbjct  352  GNKNNFEMIPFGSGRRGCPGMQLGLVLVRMIVAQLVHCFDWELPNGVLPSELDMSEDFGL  411

Query  896  SLNRAEHLMAIPTYRLHI  949
            S  RA++L  +P YR+ I
Sbjct  412  SCPRAQNLRVVPVYRVCI  429



>ref|XP_008385982.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 239/315 (76%), Gaps = 3/315 (1%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +VFGKKY D++  E+GF A + E+++I A PNL D+ P L   D+QGLT++MK++ K F+
Sbjct  187  LVFGKKYKDEDFDERGFTAVLKESIQIVAAPNLNDHIPFLRPFDLQGLTKKMKSINKKFN  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F EKII+DH ++  +   + T DFVD +L  M S ES  +  R HVK+VMLD+  A++D
Sbjct  247  TFFEKIIDDHLQSKDE---ERTKDFVDVVLGRMGSEESDYRIERVHVKAVMLDMFAAALD  303

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            T  S I W +SEL R P++MKK+++E+E+ VGL+RMVEESDLE  +YL+IV+KE+LR+HP
Sbjct  304  TPPSAILWALSELLRHPQVMKKLQKELENVVGLNRMVEESDLEKLEYLDIVVKETLRLHP  363

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V+PLL+PH + EDC VDG+HIPK S + VN WAIGRDP  W D EKF PERF  S+++ +
Sbjct  364  VLPLLLPHLSIEDCTVDGYHIPKNSRLIVNAWAIGRDPSAWEDAEKFVPERFEGSNIDVK  423

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+ F+ +PFGSGRR C GMQLG+TVV+ V+AQ++HCFDW LP+ MLP +L+MTE FGL++
Sbjct  424  GKHFQLIPFGSGRRRCAGMQLGLTVVQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLAV  483

Query  902  NRAEHLMAIPTYRLH  946
            +R + L+ IP+YRL 
Sbjct  484  SRTKDLLLIPSYRLQ  498



>ref|XP_008374739.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=508

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 229/322 (71%), Gaps = 11/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K  D
Sbjct  188  MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKXVD  243

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDI  343
            + LEKII DHE+ + S+ +     DFVD +L  +    +P         R + K+++LD+
Sbjct  244  QLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNBEEVYMLERTNXKAILLDM  303

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +  + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KE
Sbjct  304  IAGAXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  363

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            SLR+ PV PLL+PH + ED  VDG+HIPK S V +N+W IGRDP VWSD  E+F+PERF 
Sbjct  364  SLRLXPVAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTIGRDPSVWSDNVEEFYPERFM  423

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             ++V+ RG DF+ +PFGSGRR C  MQLG+T VRLV+  LLHCF+W LP+GMLPKDL+MT
Sbjct  424  NNNVDLRGHDFQLIPFGSGRRGCXAMQLGLTTVRLVLGNLLHCFNWELPSGMLPKDLDMT  483

Query  881  EEFGLSLNRAEHLMAIPTYRLH  946
            E+FGLSL++A+HL+A+PT RL+
Sbjct  484  EKFGLSLSKAKHLLAMPTCRLY  505



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   352 bits (904),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 227/322 (70%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K +D        K  I E + ++   N+GDY P L  LD+QGLT+RMK + K  D
Sbjct  189  MVLGRKNNDM----FDLKGIIEEVMFLSGAFNIGDYVPFLIPLDLQGLTKRMKRISKTVD  244

Query  182  EFLEKIINDHEEATSKGKAQTTM--DFVDTMLEIMKSGESP-----VQFTRQHVKSVMLD  340
            +  EKII DHE+ +   + Q     DFVD +L ++    +P       F R + K+++LD
Sbjct  245  QLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAILLD  304

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++  S DTS+  I WT++EL R PE+MK++++E++S VG+DRMVEESDL    YL +V+K
Sbjct  305  MISGSFDTSAMAIVWTLAELLRHPEVMKRLQKELQSVVGMDRMVEESDLPKLDYLSMVVK  364

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            ESLR+HPV PLLIPH + ED  VDG+HIPK S V +N+W IGRDP VWSD  E+F+PERF
Sbjct  365  ESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERF  424

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S+V+ +G DF+ +PFGSGRR CP MQLG+T VRL +  L+HCF+W LP GMLPKDL+M
Sbjct  425  MNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDM  484

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL+A+PT+ L
Sbjct  485  TEKFGLSLSKAKHLLAMPTHHL  506



>gb|KDP20096.1| hypothetical protein JCGZ_05865 [Jatropha curcas]
Length=510

 Score =   352 bits (903),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 226/320 (71%), Gaps = 11/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+  ++ EL     KA + EA+ +    N+ DY P LG +D+QGLT+RMKA  K  D
Sbjct  194  MVFGE-VNNHELD---LKALVKEALLLAGAFNIADYIPFLGPIDLQGLTKRMKAFSKAMD  249

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS------GESPVQFTRQHVKSVMLDI  343
            + LE+II++HE+     K Q + DF+D +L +M          +     R H+K++ +D+
Sbjct  250  KVLERIIDEHEKEAYWEKKQKS-DFIDVLLSLMNQPMVTSHDNALSTIDRTHIKAISIDM  308

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +I S DTS++ IEWT+SEL R P  MK +++E++S VG+D MVEE  L    YL++VIKE
Sbjct  309  IIGSFDTSATTIEWTLSELLRHPHAMKCLQDELQSVVGMDNMVEEKHLSKLPYLDMVIKE  368

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNK  703
            SLR+HP+ PLL+P  A ED  VDG++IPK S V VN WAIGRDP  WSD EKF PERF  
Sbjct  369  SLRLHPIAPLLVPREAMEDVMVDGYYIPKKSRVIVNAWAIGRDPDAWSDTEKFLPERFID  428

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
             +++ RGQDF+ +PFGSGRR CPG+QLG+T++++++AQL+HCFDW LPNG+LP +L+M E
Sbjct  429  MNIDLRGQDFQLIPFGSGRRGCPGIQLGLTIIKIIIAQLVHCFDWELPNGLLPGELDMNE  488

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGLSL RA HL+ +P YRL
Sbjct  489  KFGLSLPRANHLLVVPKYRL  508



>ref|XP_008346791.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X2 [Malus domestica]
Length=399

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 227/322 (70%), Gaps = 11/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K  D
Sbjct  79   MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKXVD  134

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDI  343
            + LEKII DHE+ + S+ +     DFVD +L  +    +P         R + K+++LD+
Sbjct  135  QLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAILLDM  194

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +  + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KE
Sbjct  195  IAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  254

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            SLR++PV PLL+PH + ED  VDG+HIPK S V  N+W IGRDP VWSD  E+F+PE F 
Sbjct  255  SLRLNPVAPLLVPHQSMEDITVDGYHIPKKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFM  314

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             ++V+ RG DF+ +PFGSGRR CP MQLG+T VR V+  LLHCF+W LP+GMLPKDL+MT
Sbjct  315  NNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRXVLGNLLHCFNWELPSGMLPKDLDMT  374

Query  881  EEFGLSLNRAEHLMAIPTYRLH  946
            E+FGLSL++A+HL+A+ T RL+
Sbjct  375  EKFGLSLSKAKHLLAMXTCRLY  396



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 219/320 (68%), Gaps = 9/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K  D
Sbjct  188  MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTVD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDIL  346
            +  EKII DHE+ +   +     DFVD +L  +     P         R + K+ +LD++
Sbjct  244  QLFEKIIQDHEQVSRSEQGNHHKDFVDVLLSSIHQTLKPNDEEVYMLERTNAKATLLDMI  303

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KES
Sbjct  304  AGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKES  363

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKS  706
             R+HPV PLL+PH + ED  VDG+H PK S + +N+W IGRDPK W + E+F+PERF   
Sbjct  364  FRLHPVAPLLVPHQSMEDITVDGYHTPKKSRIFINIWTIGRDPKSWDNAEEFYPERFMNR  423

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
            +V+ RG DF+ +PFGSGRR CP MQLG+T VRL +  LLHC +W LP+GMLPKDL+MTE+
Sbjct  424  NVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLHCSNWELPSGMLPKDLDMTEK  483

Query  887  FGLSLNRAEHLMAIPTYRLH  946
            FGLSL++A+HL+A PT RL+
Sbjct  484  FGLSLSKAKHLLATPTCRLY  503



>ref|XP_008346790.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X1 [Malus domestica]
Length=399

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 227/322 (70%), Gaps = 11/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K DD        K  I EA+ +T   N+ DY P L  LD+QGLT+RMK V K  D
Sbjct  79   MVLGRKNDDM----FDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKXVD  134

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDI  343
            + LEKII DHE+ + S+ +     DFVD +L  +    +P         R + K+++LD+
Sbjct  135  QLLEKIIKDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAILLDM  194

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +  + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    YL +V+KE
Sbjct  195  IAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  254

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            SLR++PV PLL+PH + ED  VDG+HIPK S V  N+W IGRDP VWSD  E+F+PE F 
Sbjct  255  SLRLNPVAPLLVPHQSMEDITVDGYHIPKKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFM  314

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             ++V+ RG DF+ +PFGSGRR CP MQLG+T VR V+  LLHCF+W LP+GMLPKDL+MT
Sbjct  315  NNNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRXVLGNLLHCFNWELPSGMLPKDLDMT  374

Query  881  EEFGLSLNRAEHLMAIPTYRLH  946
            E+FGLSL++A+HL+A+ T RL+
Sbjct  375  EKFGLSLSKAKHLLAMXTCRLY  396



>ref|XP_008360900.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=504

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 225/325 (69%), Gaps = 14/325 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I E + +T   N+GDY P L   D+QGL +RMK + K  D
Sbjct  183  MVLGSKNDDTF----DVKGIIEEIMLLTGAVNIGDYVPFLSPFDIQGLNKRMKTLSKTID  238

Query  182  EFLEKIINDHEEATS----KGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVM  334
            + LEKII +HE+ +     +G+ Q   DFV+ +L +M    +P         R +VK+++
Sbjct  239  QLLEKIIGEHEQVSKSKQLQGRPQNHKDFVEMLLSLMNQPLNPNDEQVYVVDRTNVKAIL  298

Query  335  LDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIV  514
            LD++  + DTS++ I W ++EL R P +MK +++E+++ +G+DR VEESDL    YL  V
Sbjct  299  LDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLPKLAYLNKV  358

Query  515  IKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPE  691
            IKES R+HPV PLLIPHA+ ED  VDG+HIPK ST+ VN+W IGRDP VWSD  E+F+PE
Sbjct  359  IKESFRLHPVAPLLIPHASMEDITVDGYHIPKKSTIFVNIWTIGRDPSVWSDNVEEFYPE  418

Query  692  RFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDL  871
            RFN S V+ +G DF+ LPFGSGRR CP MQLG+T VRL +A L+HCF+++LP+G+LP +L
Sbjct  419  RFNDSDVDLKGHDFQLLPFGSGRRGCPAMQLGLTTVRLALANLVHCFNFDLPSGLLPNEL  478

Query  872  NMTEEFGLSLNRAEHLMAIPTYRLH  946
            +MTE FGLSL++ +HL+ +PTYRLH
Sbjct  479  DMTETFGLSLSKTKHLLVVPTYRLH  503



>emb|CBI15435.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 230/320 (72%), Gaps = 10/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+    K+      KA + E + +    N+ DY P LG LD+QGL RRMKA+    D
Sbjct  40   MLFGRC---KDYQRADLKALVQETLILVGAFNIADYVPFLGALDLQGLKRRMKAISGAVD  96

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
              LEK+I++H++  S+ +     DFVD ML +M        E      ++++K ++ DI+
Sbjct  97   HILEKVIDEHKQDASENQGNHK-DFVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDII  155

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            I +IDTS++ IEW +SELFR P +M++++EE+E+ +G++RMVEE DL +  YL++V+KE 
Sbjct  156  IGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMERMVEEVDLANLVYLDMVLKEG  215

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HP  PLL+PH + ED  ++G++IPK S + +N WAIGRDP +WS+  E FFPERF  
Sbjct  216  LRLHPAGPLLLPHESIEDITLNGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFIG  275

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+++++G+DF+F+PFGSGRR CPGMQLG+  VRLV+AQL+HCFDW LPNGMLP +L+M+E
Sbjct  276  SNIDFQGKDFQFIPFGSGRRKCPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSE  335

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            EFGL+L RA HL A+PTYRL
Sbjct  336  EFGLALPRATHLHALPTYRL  355



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 230/322 (71%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+K  + E+ +   K  I E + ++   N+ DY P L  LD+QGLT+RMK + K  D
Sbjct  189  MVLGRK--NNEMFD--LKGIIEEVMFLSGAFNISDYVPFLIPLDLQGLTKRMKRISKTVD  244

Query  182  EFLEKIINDHEEATSKGKAQTT--MDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLD  340
            +  EKII DHE+ +   + Q     DFVD +L ++    +P       F R + K+++LD
Sbjct  245  QLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAILLD  304

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++  S DTS++ I WT++EL R PE+MK++++E++S VG+DRMVEESDL    YL +V+K
Sbjct  305  MISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGVDRMVEESDLPKLDYLSMVVK  364

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            E+LR+HPV PLLIPH + ED  VDG+HIPK S V +N+W IGRDP VWSD  E+F+PERF
Sbjct  365  ETLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERF  424

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S+V+ +G DF+ +PFGSGRR CP MQLG+T VRL +  L+HCF+W LP GMLPKDL+M
Sbjct  425  MNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDM  484

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL+A+PT+RL
Sbjct  485  TEKFGLSLSKAKHLLAMPTHRL  506



>ref|XP_009337234.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=504

 Score =   350 bits (897),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 225/325 (69%), Gaps = 14/325 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I E + +T   N+GDY P L   D+QGL +RMK + K  D
Sbjct  183  MVLGSKNDDTF----DVKGIIEEVMLLTGAVNIGDYVPFLSPFDIQGLNKRMKRLSKTID  238

Query  182  EFLEKIINDHEEATS----KGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVM  334
            + LEKII +HE+ +     +G+ Q   DFV+ +L +M    +P         R +VK+++
Sbjct  239  QLLEKIIGEHEQVSKSEQLQGRPQNHKDFVEMLLSLMNQPLNPNDEQVYVVDRTNVKAIL  298

Query  335  LDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIV  514
            LD++  + DTS++ I W ++EL R P +MK +++E+++ +G+DR VEESDL    YL  V
Sbjct  299  LDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLPKLAYLNKV  358

Query  515  IKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPE  691
            +KES R+HPV PLLIPHA+ ED  VDG+HIPK ST+ VN+W IGRDP VWSD  E+F+PE
Sbjct  359  VKESFRLHPVAPLLIPHASMEDITVDGYHIPKKSTIFVNIWTIGRDPSVWSDNVEEFYPE  418

Query  692  RFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDL  871
            RFN S V+ +G DF+ LPFGSGRR CP MQLG+T VRL +A L+HCF+++LP+G+LP +L
Sbjct  419  RFNDSDVDLKGHDFQLLPFGSGRRGCPAMQLGLTTVRLALANLVHCFNFDLPSGLLPNEL  478

Query  872  NMTEEFGLSLNRAEHLMAIPTYRLH  946
            +MTE FGLSL++ +HL+ +PTYRLH
Sbjct  479  DMTETFGLSLSKTKHLLVVPTYRLH  503



>ref|XP_007036492.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY20993.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=512

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 231/321 (72%), Gaps = 12/321 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DDK       K  IHE +++    NL D+ P L  LD+QGL +R ++V K  D
Sbjct  192  MILGRCKDDK----FDLKPLIHEGIRLLGTFNLADFVPFLAPLDLQGLRQRFESVRKACD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ------FTRQHVKSVMLDI  343
            +FLE+II++HE+  +KG+ +   DFVD ML  +    +P          R ++K+++LD+
Sbjct  248  KFLEEIIDEHEK-LNKGQQKQHRDFVDFMLSYLNQPMNPNDEEQTYIIDRTNIKAIILDM  306

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + A+++TS+ VIEW ++E+ R P +  ++++E+E+ VG++RMVEE+DL +  YL++VIKE
Sbjct  307  IAAALETSAVVIEWALAEIIRHPRVKSRLQKELEAVVGMNRMVEEADLANLTYLDMVIKE  366

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            SLR+HPV PLLIPH + ED  ++G+HIPK S + +N+WAIGRDP VWSD  E F PERF 
Sbjct  367  SLRLHPVAPLLIPHESMEDVTINGYHIPKKSRILINIWAIGRDPNVWSDNVEDFLPERFV  426

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+V+ RG DF+ +PFGSGRR CPG+QLG+T VRL +AQL+HCF+W LPNGMLP DL+M+
Sbjct  427  GSNVDLRGHDFQLIPFGSGRRGCPGLQLGLTTVRLALAQLVHCFEWELPNGMLPNDLSMS  486

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLS  RAEHL+A P YRL
Sbjct  487  EKFGLSAPRAEHLLARPVYRL  507



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 230/320 (72%), Gaps = 10/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+    K+      KA + E + +    N+ DY P LG LD+QGL RRMKA+    D
Sbjct  187  MLFGRC---KDYQRADLKALVQETLILVGAFNIADYVPFLGALDLQGLKRRMKAISGAVD  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
              LEK+I++H++  S+ +     DFVD ML +M        E      ++++K ++ DI+
Sbjct  244  HILEKVIDEHKQDASENQGNHK-DFVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDII  302

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            I +IDTS++ IEW +SELFR P +M++++EE+E+ +G++RMVEE DL +  YL++V+KE 
Sbjct  303  IGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMERMVEEVDLANLVYLDMVLKEG  362

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HP  PLL+PH + ED  ++G++IPK S + +N WAIGRDP +WS+  E FFPERF  
Sbjct  363  LRLHPAGPLLLPHESIEDITLNGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFIG  422

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+++++G+DF+F+PFGSGRR CPGMQLG+  VRLV+AQL+HCFDW LPNGMLP +L+M+E
Sbjct  423  SNIDFQGKDFQFIPFGSGRRKCPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSE  482

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            EFGL+L RA HL A+PTYRL
Sbjct  483  EFGLALPRATHLHALPTYRL  502



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 227/322 (70%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G++ +D        K  I E + +T   N+ DY P L  LD+QGLT+RMK + K  D
Sbjct  202  MVLGRRNNDMF----DLKGIIEETMFLTGAFNISDYVPFLIPLDLQGLTKRMKRISKTVD  257

Query  182  EFLEKIINDHEEATSKGKAQTT--MDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLD  340
            +  E+II +HE+ +   +       DFVD +L ++    +P       F R + K+++LD
Sbjct  258  QLFERIIQEHEQVSRSEQVHGNHHKDFVDVLLSLIHQPLNPNDKEVYMFERTNAKAILLD  317

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++  S DTS++ I WT++EL R P++MK++++E++S VG+DRMVEESDL    YL +V+K
Sbjct  318  MISGSFDTSATAIVWTLAELLRHPKVMKRLQKELQSVVGMDRMVEESDLPKLDYLSMVVK  377

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            ESLR+HPV PLLIPH + ED  VDG+HIPK S + +N+W IGRDP VWSD  E+F+PERF
Sbjct  378  ESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSIIFINIWTIGRDPNVWSDNVEEFYPERF  437

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S+V+ +G DF+ +PFGSGRR CP MQLG+T VRL +  L+HCF+W LP GMLPKDL+M
Sbjct  438  MNSNVDLQGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDM  497

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLS+++A+HL+A+PT+RL
Sbjct  498  TEKFGLSMSKAKHLLAMPTHRL  519



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 225/322 (70%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I EA+ ++   N+GDY P L  LD+QGL +RMK + K  D
Sbjct  187  MVLGSKNDDM----FDLKGTIQEALFLSGAFNIGDYVPFLSPLDLQGLAKRMKRISKTID  242

Query  182  EFLEKIINDHEEATSKGKAQ--TTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLD  340
            +  EKII +HE+ +  G+ Q  +  DFVD +L ++    +P         R +VK+++LD
Sbjct  243  QLFEKIIGEHEQVSKSGQVQGHSHKDFVDVLLSLIHQPLNPNDEKVYMMERTNVKAILLD  302

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++  + DTS++ I WT++EL R P +MK ++EE++S +G+DRMVEESDL    YL +V+K
Sbjct  303  MISGAFDTSATTIVWTLAELLRHPRVMKHLQEELQSVIGMDRMVEESDLPKLCYLSMVVK  362

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERF  697
            ESLR+HPV PLLIPH + ED  V+GF IPK S + +N WAIGRDPKVWS + E+F+ ERF
Sbjct  363  ESLRLHPVAPLLIPHESMEDITVEGFDIPKKSRIFINTWAIGRDPKVWSENVEEFYTERF  422

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
               +++ RG DF+ LPFGSGRR CP MQLG+T V L +A L+HCF+W LP+G+ PKDL+M
Sbjct  423  IDGNIDLRGHDFQLLPFGSGRRGCPAMQLGLTTVCLALANLVHCFNWELPSGLKPKDLDM  482

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL A+PTYRL
Sbjct  483  TEKFGLSLSKAKHLFAMPTYRL  504



>ref|XP_003630097.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=457

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 219/314 (70%), Gaps = 24/314 (8%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D +L EKGFKA + E + ++A PN+     +                     
Sbjct  163  MVLGKKYTDDDLDEKGFKAVMLETMHLSATPNIEKSLMI---------------------  201

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F +KII++H +  S  K   T DFVD ML  + + ES  +  R  +K++MLD+L  S+D
Sbjct  202  -FFDKIIDEHIQ--SDNKDDKTKDFVDVMLGFVGTEESEYRIERNDIKAIMLDMLGGSMD  258

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW ISEL + P +MK V++E+E+ VG+ R VEESDL+  KYLE+VIKESLR+HP
Sbjct  259  TSATAIEWAISELLKNPRVMKNVQKELETVVGMKRKVEESDLDKLKYLEMVIKESLRLHP  318

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIP+ + EDC V+   IPK S V VN W+I RDP  W+DPEKF+PERF  ++++ +
Sbjct  319  VAPLLIPYQSLEDCMVEDLFIPKKSRVIVNAWSIMRDPNAWTDPEKFWPERFEGNNIDVK  378

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR CPG+QLG+TV+RLVVAQL+HCFDW LPN MLP DL+MTE+FGL++
Sbjct  379  GRDFQLIPFGSGRRGCPGLQLGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTM  438

Query  902  NRAEHLMAIPTYRL  943
             RA +L+AIP YRL
Sbjct  439  PRANNLIAIPAYRL  452



>gb|KGN49699.1| hypothetical protein Csa_5G076690 [Cucumis sativus]
Length=305

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 214/305 (70%), Gaps = 2/305 (1%)
 Frame = +2

Query  35   LGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHE  214
            + EK F  A+ E V++ A PNL D+ P +   D+QG+  R K +  +FD FLEKII +H 
Sbjct  3    MDEKSFHDAVKEVVQLVATPNLCDFIPCVAWFDLQGINGRAKHLCNMFDGFLEKIIEEHL  62

Query  215  EATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTIS  394
            +      A    DFVD +L +M S  +  +  R  +K+++L+++I ++DT+++ I+W I 
Sbjct  63   DQFKI--ANKNQDFVDVLLGLMGSQNNEYKIDRSTIKALILEMVITAMDTTATSIDWAIV  120

Query  395  ELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAR  574
            EL R P IM K+++E++  VGL RMV ESDLEH +YL +VIKE LR+HP VPLL+PH + 
Sbjct  121  ELIRHPHIMNKMQQELDKVVGLQRMVLESDLEHLQYLNMVIKEILRLHPPVPLLVPHESL  180

Query  575  EDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYRGQDFEFLPFGS  754
            +DC ++G HIPK S + VN WAIG+DP +W+DP+ FFPERF  S V+ +G+DFE +PFGS
Sbjct  181  QDCTINGLHIPKQSRIIVNAWAIGQDPTIWNDPQNFFPERFIDSEVDLKGKDFELIPFGS  240

Query  755  GRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPT  934
            GRR CPGM LG+TVVRL++AQL+H F W LPN +LP  L++ EEFGL+  RA+ LM  P 
Sbjct  241  GRRGCPGMHLGLTVVRLLLAQLVHAFHWELPNDILPNQLDVREEFGLTCPRAQQLMVTPI  300

Query  935  YRLHI  949
            YRL I
Sbjct  301  YRLKI  305



>ref|XP_008441066.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=499

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 230/314 (73%), Gaps = 6/314 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+KY+D ELGEKGFK  I EA ++ A PNLGD+ PL+ + DVQG   R KAVGK+FD
Sbjct  187  MVLGRKYEDNELGEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE I+ +H       K +   DFVD +L++M S E   Q  R ++K+++LD +IA++D
Sbjct  247  GFLESIVEEHVVFEKDNKDK---DFVDVLLDLMGSRE--YQIDRSNIKAIILDFVIAAVD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            ++++ I W +SEL + P IMKK++EE+E  VGL+RMVEESDL + KYLE+V+KESLRMHP
Sbjct  302  STTTTINWMLSELIKHPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVMKESLRMHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             VPL IP    +DC ++G+HIPK S + +N WAIGRDP  W DP KF PERF +S V+ R
Sbjct  362  PVPL-IPRECIQDCNINGYHIPKKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVR  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR C G+QL + VVRLVVAQLLHCFD  LP+GM P +L+MTE  GL+ 
Sbjct  421  GRDFELIPFGSGRRGCVGIQLALVVVRLVVAQLLHCFDLKLPDGMSPLELDMTEILGLTC  480

Query  902  NRAEHLMAIPTYRL  943
             RA++L  IP +RL
Sbjct  481  PRAQNLRVIPIFRL  494



>ref|XP_004301061.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 229/322 (71%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD+       KA + E   +    N+ D+ P L   D+QGLT+R+K V +  D
Sbjct  186  MVLGCKRDDR----FDLKAIVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSRTVD  241

Query  182  EFLEKIINDHEEA--TSKGKAQTTMDFVDTMLEIMKSGESP----VQFT-RQHVKSVMLD  340
            + L+KII+DHE+A  T  GK     DFVD +L   K   +P    V F  R++VK+++LD
Sbjct  242  QLLDKIIDDHEQAAETEGGKQGQHEDFVDVLLSFTKQPLNPNDEQVHFLDRENVKAILLD  301

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ A+ DTS++ I W+++EL R P IMK+++EE++  VG+DR VEESDL    YL +V+K
Sbjct  302  MITAAFDTSATTIIWSLAELMRHPRIMKQLQEELQIVVGMDRGVEESDLPKLDYLNLVVK  361

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            ES R+HPV PLL+PH + +D  +DG+ IPK S + VN W+I RDP VWS+  E+F PERF
Sbjct  362  ESFRLHPVAPLLLPHESIKDITIDGYDIPKKSRLIVNFWSIARDPNVWSENVEEFCPERF  421

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S+++ +G D++ +PFG+GRR CPGMQLG+T VRLV+AQL+HCF+W LPNGMLP+DL+M
Sbjct  422  TNSNIDLQGHDYQLIPFGTGRRGCPGMQLGLTTVRLVLAQLMHCFNWELPNGMLPQDLDM  481

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL+A PTYRL
Sbjct  482  TEKFGLSLSKAKHLLAKPTYRL  503



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 223/322 (69%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I EA+ ++   N+GDY P L  LD+QGL +RMK + K  D
Sbjct  191  MVLGSKNDDM----FDLKGTIEEALFLSGAFNIGDYMPFLSPLDLQGLAKRMKRISKTID  246

Query  182  EFLEKIINDHEEATSKGKAQ--TTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLD  340
            +  EKII +HE+ +  G+ Q  +  DFVD +L ++    +P         R +VK+++LD
Sbjct  247  QLFEKIIGEHEQVSKSGQVQDHSHKDFVDVLLSLIHQPLNPNDEQVYMMERTNVKAILLD  306

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++  + DTS++ I WT++EL R P +MK ++ EI+S +G DRMVEESDL    YL +V+K
Sbjct  307  MISGAFDTSATAIVWTLAELLRHPRVMKHLQGEIQSVIGTDRMVEESDLPKLGYLSMVVK  366

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERF  697
            ESLR+HPV P LIPH + ED  V+GF +PK S + +N WAIGRDPKVWS+  E+F+PERF
Sbjct  367  ESLRLHPVAPFLIPHESMEDITVEGFDVPKKSRIFINTWAIGRDPKVWSENVEEFYPERF  426

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
               +++ RG DF+ LPFGSGRR CP MQLG+  VRL +A L+HCF+W LP+G+ P+DL+M
Sbjct  427  IDGNIDLRGHDFQLLPFGSGRRGCPAMQLGLITVRLALANLVHCFNWELPSGLKPEDLDM  486

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TE+FGLSL++A+HL A+PTYRL
Sbjct  487  TEKFGLSLSKAKHLFAMPTYRL  508



>gb|KHN20714.1| Cytochrome P450 71D10 [Glycine soja]
Length=510

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 225/321 (70%), Gaps = 11/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG   DD+       K   HE V +    N+ DY P L   D+Q L RR+K V K FD
Sbjct  187  MIFGCSKDDR----FDVKNLAHEIVNLAGTFNVADYMPWLRVFDLQELVRRLKKVSKSFD  242

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
            E LE+II DHE+++ +K K+Q   DFVD  L +M     P         R ++K++M+ +
Sbjct  243  EVLEQIIKDHEQSSDNKQKSQRQKDFVDIFLALMHQPLDPQDEHGHVLDRTNMKAIMMTM  302

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A+IDTS++ IEW +SEL + P +MKK+++E+ES VG++R VEESD+E   YL++V+KE
Sbjct  303  IVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDMEKLPYLDLVVKE  362

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFN  700
            +LR++PV PLL+P   RE+  +DG+ I + S + VN WAIGRDPKVWSD  E F+PERF 
Sbjct  363  TLRLYPVAPLLVPRECREEITIDGYCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFA  422

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+V+ RG DF  LPFGSGRR CPG+ LG+T V++V+AQL+HCF+W LP GM P DL+MT
Sbjct  423  NSNVDMRGYDFRLLPFGSGRRGCPGIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMT  482

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ R+ HL+A+PTYRL
Sbjct  483  EKFGLTIPRSNHLLAVPTYRL  503



>ref|XP_002275714.2| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 220/322 (68%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+  D    G    K  + E  ++    NLGDYFP LG LD+QGL +R KA+ K  D
Sbjct  187  MVFGRNKD----GMIDLKTLVREGTRLAGTFNLGDYFPFLGPLDLQGLVQRFKAINKAAD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
            E LEKII+        GK     +F+D ML +M +      ES     R +VK+++LD+L
Sbjct  243  EVLEKIID--RRIQDGGKDHNHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAILLDML  300

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+SS+ IEW  SEL R P +M++++ E+++ V +DRMV+ESDLE+  YL +V+KE 
Sbjct  301  VGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRMVDESDLENLVYLNMVVKEV  360

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HP+ P L+PHA+ ED  ++G  IPK ST+ +N WAIGRDP  WSD  ++F PERF  
Sbjct  361  LRLHPIGPFLVPHASTEDITIEGHFIPKRSTILINTWAIGRDPNFWSDNVDEFLPERFIN  420

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+++ +G+DFE +PFGSGRR CPG+QLG+  VRLV+AQLLHCF+W LPN M   DL+M+E
Sbjct  421  SNIDLQGRDFELIPFGSGRRGCPGIQLGLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSE  480

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
            +FGL++ R  HL AIPTYRL I
Sbjct  481  KFGLTMPRVNHLYAIPTYRLLI  502



>ref|XP_003627829.1| Cytochrome P450, partial [Medicago truncatula]
Length=591

 Score =   343 bits (879),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/314 (53%), Positives = 219/314 (70%), Gaps = 24/314 (8%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV GKKY D +L EKGFKA + E + ++A PN                      + K   
Sbjct  206  MVLGKKYTDDDLDEKGFKAVMLETMHLSATPN----------------------IEKSLM  243

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             F +KII++H +  S  K   T DFVD ML  + + ES  +  R  +K++MLD+L  S+D
Sbjct  244  IFFDKIIDEHIQ--SDNKDDKTKDFVDVMLGFVGTEESEYRIERNDIKAIMLDMLGGSMD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS++ IEW ISEL + P +MK V++E+E+ VG+ R VEESDL+  KYLE+VIKESLR+HP
Sbjct  302  TSATAIEWAISELLKNPRVMKNVQKELETVVGMKRKVEESDLDKLKYLEMVIKESLRLHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
            V PLLIP+ + EDC V+   IPK S V VN W+I RDP  W+DPEKF+PERF  ++++ +
Sbjct  362  VAPLLIPYQSLEDCMVEDLFIPKKSRVIVNAWSIMRDPNAWTDPEKFWPERFEGNNIDVK  421

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DF+ +PFGSGRR CPG+QLG+TV+RLVVAQL+HCFDW LPN MLP DL+MTE+FGL++
Sbjct  422  GRDFQLIPFGSGRRGCPGLQLGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTM  481

Query  902  NRAEHLMAIPTYRL  943
             RA +L+AIP YRL
Sbjct  482  PRANNLIAIPAYRL  495



>ref|XP_004162328.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=499

 Score =   339 bits (869),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 228/314 (73%), Gaps = 6/314 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+KY+D EL EKGFK  I EA ++ A PNLGD+ PL+ + DVQG   R KAVGK+FD
Sbjct  187  MVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+I+   EE     +     DFVD +L++M S E   Q  R ++K+++LD LIA++D
Sbjct  247  GFLERIV---EERVVFQRDNKDKDFVDVLLDLMGSRE--YQIDRSNIKAIILDFLIAAVD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            ++++ I W +SEL + P IMKK++EE+E  VGL+RMVEESDL + KYLE+VIKESLRMHP
Sbjct  302  STTTTINWMLSELIKNPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVIKESLRMHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             VPL IP    +DC ++G+HIP+ S + +N WAIGRDP  W DP KF PERF +S V+ +
Sbjct  362  PVPL-IPRECIQDCNINGYHIPEKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVK  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR C G+QL + VVRLVVAQL+HCFD  LPNGM P +L+MTE  GL  
Sbjct  421  GRDFELIPFGSGRRGCVGIQLALVVVRLVVAQLVHCFDLKLPNGMSPLELDMTEILGLIC  480

Query  902  NRAEHLMAIPTYRL  943
             RA++L  +P +RL
Sbjct  481  PRAQNLKVVPIFRL  494



>dbj|BAD15331.1| cytochrome P450 [Panax ginseng]
Length=500

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 224/320 (70%), Gaps = 12/320 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            ++ G+  DD+       K  ++EA+ +    N+ D+ P LG LD+QGLTR+ K  GK  D
Sbjct  187  LLLGRTKDDR----YDLKGIMNEALTLAGRFNIADFVPFLGPLDIQGLTRQFKDTGKRLD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
            + LE II++HE+ +S G A    DF+D ML +         E      R  +K++M+DI+
Sbjct  243  KILEFIIDEHEQNSSNGNASG--DFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDII  300

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             A+IDTS + IEW ++EL + P  MKK +EEI++ VG+DRMVEE+DL + +Y+ +V+KE 
Sbjct  301  SAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLPNLEYVYMVVKEG  360

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNK  703
            LR+HPV PLL PH + ED  ++G+ IPK S V VN WA+GRDP VWS D ++F PERF  
Sbjct  361  LRLHPVAPLLGPHESMEDITINGYFIPKQSRVIVNSWALGRDPNVWSEDADEFLPERFEG  420

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+++ RG+DF+ LPFGSGRR CPGMQLG+  V+LVVA+L+HCFDWNLPNG+ P +L+MTE
Sbjct  421  SNIDVRGRDFQLLPFGSGRRGCPGMQLGLITVQLVVARLVHCFDWNLPNGITPDNLDMTE  480

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL+  R +HL+A+P YRL
Sbjct  481  KFGLTTPRVKHLLAVPKYRL  500



>ref|XP_004143569.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=499

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 228/314 (73%), Gaps = 6/314 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+KY+D EL EKGFK  I EA ++ A PNLGD+ PL+ + DVQG   R KAVGK+FD
Sbjct  187  MVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIFD  246

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FLE+I+ +H       K +   DFVD +L++M S E   Q  R ++K+++LD LIA++D
Sbjct  247  GFLERIVEEHVVFQRDNKDK---DFVDVLLDLMGSRE--YQIDRSNIKAIILDFLIAAVD  301

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            ++++ I W +SEL + P IMKK++EE+E  VGL+RMVEESDL + KYLE+VIKESLRMHP
Sbjct  302  STTTTINWMLSELIKNPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVIKESLRMHP  361

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             VPL IP    +DC ++G+HIP+ S + +N WAIGRDP  W DP KF PERF +S V+ +
Sbjct  362  PVPL-IPRECIQDCNINGYHIPEKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVK  420

Query  722  GQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSL  901
            G+DFE +PFGSGRR C G+QL + VVRLVVAQL+HCFD   PNGM P +L+MTE  GL  
Sbjct  421  GRDFELIPFGSGRRGCVGIQLALVVVRLVVAQLVHCFDLKPPNGMSPLELDMTEILGLIC  480

Query  902  NRAEHLMAIPTYRL  943
             RA++L  +P +RL
Sbjct  481  PRAQNLKVVPIFRL  494



>ref|XP_004291274.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   337 bits (865),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 229/323 (71%), Gaps = 13/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K D++       KA + E V +    N+ D+ P L   D+QGLT+R+K V ++ D
Sbjct  186  MVLGCKRDNR----FDLKAIVEEVVFLIGAFNISDFIPSLSAFDIQGLTKRLKKVSRMVD  241

Query  182  EFLEKIINDHE---EATSKGKAQTTMDFVDTMLEI----MKSGESPVQFT-RQHVKSVML  337
            + L+KII+DHE   E  S GK     +FVD +L      +   +  V F  R++ K+++L
Sbjct  242  QLLDKIIDDHEQDAETKSGGKQGQHENFVDVLLSFTNQSLNLNDEQVHFLDRENAKAILL  301

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            +++  + DTS++ I W+++EL R P IMK+++EE+++ VG+DRMVEESDL    YL +V+
Sbjct  302  EMITGAFDTSTTTIIWSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLPKLDYLNLVV  361

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPER  694
            KES R+HPV PLL+P  + +D  +DG+ IPK   + VN+W+IGRDP VWS+  E+F PER
Sbjct  362  KESFRLHPVAPLLVPRESIKDITIDGYDIPKKLRLIVNLWSIGRDPNVWSENVEEFCPER  421

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+++ RG D++ +PFG+GRR CPGMQLG+T VRLV+AQL+HCF+W LPNGMLP+DL+
Sbjct  422  FTNSNIDLRGHDYQLIPFGTGRRGCPGMQLGLTTVRLVLAQLVHCFNWELPNGMLPQDLD  481

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE+FGLS+++A+HL+A PTYRL
Sbjct  482  MTEQFGLSMSKAKHLLAKPTYRL  504



>sp|H2DH18.1|C7A12_PANGI RecName: Full=Cytochrome P450 CYP736A12 [Panax ginseng]
 gb|AEY75215.1| cytochrome P450 CYP736A12 [Panax ginseng]
Length=500

 Score =   337 bits (865),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 223/320 (70%), Gaps = 12/320 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            ++ G+  DD+       K  ++EA+ +    N+ D+ P LG LD+QGLTR+ K  GK  D
Sbjct  187  LLLGRTKDDR----YDLKGIMNEALTLAGRFNIADFVPFLGPLDIQGLTRQFKDTGKRLD  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
            + LE II++HE+ +S G A    DF+D ML +         E      R  +K++M+DI+
Sbjct  243  KILEFIIDEHEQNSSNGNASG--DFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDII  300

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             A+IDTS + IEW ++EL + P  MKK +EEI++ VG+DRMVEE+DL + +Y+ +V+KE 
Sbjct  301  SAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLPNLEYVYMVVKEG  360

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNK  703
            LR+HPV PLL PH + ED  ++G+ IPK S V VN WA+GRDP VWS + E+F PERF  
Sbjct  361  LRLHPVAPLLGPHESMEDITINGYFIPKQSRVIVNSWALGRDPNVWSENAEEFLPERFEG  420

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG+DF+ LPFGSGRR CPGMQLG+  V+LVVA+L+HCFDWNLPNG  P +L+MTE
Sbjct  421  SNVDVRGRDFQLLPFGSGRRGCPGMQLGLITVQLVVARLVHCFDWNLPNGTTPDNLDMTE  480

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL+  R +HL+A+P YRL
Sbjct  481  KFGLTTPRVKHLLAVPKYRL  500



>ref|XP_008449122.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=432

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 225/319 (71%), Gaps = 9/319 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FGKK+ DKEL       AI E   ++ +PNLGD+ P +  LD+QGL RR KA+ K+ D
Sbjct  120  MLFGKKFVDKEL-----TVAIREGTFLSGVPNLGDFIPFIAFLDLQGLCRRAKAINKVVD  174

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
             FL+ II +  E   + K      FVD ML++ +S E   Q  R +VK+V+ D++I  +D
Sbjct  175  GFLDMIIEERPEFKDQNKTDKGGFFVDVMLDLTRSQEIEHQIDRSNVKAVLFDLMIGGVD  234

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            +SS+ I W +SE+ + P++MKK++EE++  VGL++MVEES L   KYL++ IKE+LR+HP
Sbjct  235  SSSTTIIWALSEIIKHPQVMKKIQEELQQVVGLNKMVEESHLNQLKYLDMTIKETLRIHP  294

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSSVEYR  721
             +P LIP  + +DC V+G+HIPK + + +N WAIG+DP  W++P+KF P+RF  S +++ 
Sbjct  295  PIP-LIPRKSIQDCNVNGYHIPKNTDIMINDWAIGQDPSYWTEPQKFNPDRFVDSQIDFI  353

Query  722  G--QDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE-FG  892
            G   +FE LPFG GRR CPGMQLG+ +VRL+VAQL+HCFDW LPNG+LP +L+M+EE FG
Sbjct  354  GNNNNFEMLPFGFGRRGCPGMQLGLVMVRLIVAQLVHCFDWELPNGVLPSELDMSEESFG  413

Query  893  LSLNRAEHLMAIPTYRLHI  949
            L+  RA++L  +P  R+ I
Sbjct  414  LTCPRAQNLRVVPICRVCI  432



>ref|XP_009337244.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 218/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I E + + A  N+GDY P L  LD+QGLT+R K + K+ D
Sbjct  202  MVLGSKSDDMF----DIKTIIREVMSVLAFFNIGDYVPFLRPLDIQGLTKRNKRISKIVD  257

Query  182  EFLEKIINDHEEATSKGKAQTTM---DFVDTMLEIMKSGESP-----VQFTRQHVKSVML  337
            +  EKII +HE+ +   +AQ      DFVD M+ ++    +P      +  R  VK+++L
Sbjct  258  QLFEKIIWEHEQVSKSERAQGHHHHKDFVDVMVSLIHQPLNPNDEQGYRIERTDVKAILL  317

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D++  S DTS++ I W ++EL R P +MK ++EE++  +G DRMVEESDL    YL  VI
Sbjct  318  DMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTDRMVEESDLRKLSYLNAVI  377

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPER  694
            KES R+HP+ P L+P  + +D  VDG++IPK S + +N WAIGRDP VWSD   KF+PER
Sbjct  378  KESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAIGRDPNVWSDNVGKFYPER  437

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+V+ RG DF+ LPFGSGRR CPG+QLG+T VRLV+A ++HCF+W+LP+G+LP+DL+
Sbjct  438  FINSNVDLRGHDFQLLPFGSGRRGCPGVQLGLTTVRLVLANIVHCFNWDLPSGLLPQDLD  497

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE FG    +A+HL+A PTYRL
Sbjct  498  MTETFGSVPTKAQHLLATPTYRL  520



>ref|XP_009337218.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 216/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I E + + A  N+GDY P L  LD+QGLT+R K + K+ D
Sbjct  202  MVLGSKSDDMF----DIKTIIREVMSVLAFFNIGDYVPFLRPLDIQGLTKRNKRISKMVD  257

Query  182  EFLEKIINDHEEATSKGKAQTTM---DFVDTMLEIMKSGESP-----VQFTRQHVKSVML  337
            +  EKII +HE+ +   + Q      DFVD +L ++    +P      +  R  VK+++L
Sbjct  258  QLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVLLSLIHQPLNPNDEQGYRIERTDVKAILL  317

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D++  S DTS++ I W ++EL R P +MK ++EE++  +G DRMVEESDL    YL  VI
Sbjct  318  DMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTDRMVEESDLRKLSYLNAVI  377

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPER  694
            KES R+HP+ P L+P  + +D  VDG++IPK S + +N WAIGRDP VWSD   KF+PER
Sbjct  378  KESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAIGRDPNVWSDNVGKFYPER  437

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+V+ RG DF+ LPFGSGRR CPGMQLG+T VRL +A ++HCF+W+LP+G+LP+DL+
Sbjct  438  FINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLD  497

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE FG    +A+HL A+PTYRL
Sbjct  498  MTETFGSVPTKAQHLFAMPTYRL  520



>gb|KHF97324.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG09556.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 222/321 (69%), Gaps = 11/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            ++FG+  DDK      FK  ++EA+ +  + NL DY P L  LD+QG TRR+K V     
Sbjct  201  VLFGRSMDDK----IDFKPLVNEAMHLAGVFNLSDYVPFLAPLDLQGYTRRLKKVSSGLH  256

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG------ESPVQFTRQHVKSVMLDI  343
            EF +K+I+++++  +    +   +F   M+ ++ +       + P    R+++K++M+D+
Sbjct  257  EFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQPYIVGRENIKAIMVDM  316

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + AS DT+++ IEWT SEL R P +M  +++E+ES VG +RMVEESDL    YL++VIKE
Sbjct  317  VAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLPKLAYLDMVIKE  376

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVW-SDPEKFFPERFN  700
            S R+HPV PLL+PH + ED  ++G+ IPK S + VN W++GR+PK+W S+ E+FFPERF 
Sbjct  377  SFRLHPVAPLLVPHESTEDVTINGYFIPKKSRLLVNTWSMGRNPKIWSSNAEEFFPERFK  436

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               ++ RG DFE +PFG+GRR CPGMQL +  +RL++AQ  HCFDW LP+GMLP +L+MT
Sbjct  437  DRKIDLRGHDFELIPFGTGRRGCPGMQLALISMRLILAQSAHCFDWELPDGMLPNELDMT  496

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL+L RA HL+A PTYRL
Sbjct  497  EKFGLTLPRANHLLAKPTYRL  517



>ref|XP_003528941.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=981

 Score =   343 bits (880),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 226/321 (70%), Gaps = 11/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG   DD+       K   HE V +    N+ DY P L   D+QGL RR+K V K FD
Sbjct  187  MIFGCSKDDR----FDVKNLAHEIVNLAGTFNVADYMPWLRVFDLQGLVRRLKKVSKSFD  242

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
            E LE+II DHE+++ +K K+Q   DFVD  L +M     P         R ++K++M+ +
Sbjct  243  EVLEQIIKDHEQSSDNKQKSQRLKDFVDIFLALMHQPLDPQDEHGHVLDRTNMKAIMMTM  302

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A+IDTS++ IEW +SEL + P +MKK+++E+ES VG++R VEESD+E   YL++V+KE
Sbjct  303  IVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDMEKLPYLDLVVKE  362

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFN  700
            +LR++PV PLL+P   RE+  +DG+ I + S + VN WAIGRDPKVWSD  E F+PERF 
Sbjct  363  TLRLYPVAPLLVPRECREEITIDGYCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFA  422

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+V+ RG DF  LPFGSGRR CPG+ LG+T V++V+AQL+HCF+W LP GM P DL+MT
Sbjct  423  NSNVDMRGYDFRLLPFGSGRRGCPGIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMT  482

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ R+ HL+A+PTYRL
Sbjct  483  EKFGLTIPRSNHLLAVPTYRL  503


 Score =   307 bits (787),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 220/321 (69%), Gaps = 14/321 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+  DD+       K  + E + ++   NL DY P L   D+QGLTRR K + K  D
Sbjct  661  MVLGRNKDDR----FDLKGILVETMSVSGAFNLADYVPWLRLFDLQGLTRRSKKISKSLD  716

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
            + L+++I +H+ A  ++G  +   DF+D +L +      P         ++ +K ++ D+
Sbjct  717  KMLDEMIEEHQLAPPAQGHLK---DFIDILLSLKDQPIHPHDKHAPIIDKRSIKGIVFDM  773

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +I + +TSS+VIEW ISEL R P +M+ ++ E++  VG+++MV+E+DL    YL++V+KE
Sbjct  774  IIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGINKMVDENDLAKLSYLDMVVKE  833

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR+HPVVPLL PH + ED  ++G++I K S V +N WAIGRDPKVWS + E F+PERF 
Sbjct  834  TLRLHPVVPLLAPHESMEDIVIEGYYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFM  893

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+++++GQDF+ +PFGSGRRSCPG+ +G+T+V+LV+ QL+HCF W LP G+ P +L+M 
Sbjct  894  NSNIDFKGQDFQLIPFGSGRRSCPGIVMGLTIVKLVLTQLVHCFKWELPCGIGPDELDMN  953

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+ GLS+ RA HL+ IPTYRL
Sbjct  954  EKSGLSMPRARHLLVIPTYRL  974



>ref|XP_007152786.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
 gb|ESW24780.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
Length=511

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/320 (49%), Positives = 222/320 (69%), Gaps = 11/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+F    DD+       K  + E + +    N+ DY P L   D+QGL RR+K V K FD
Sbjct  190  MIFDCSKDDRF----DVKNLVREVLDLAGTFNVADYLPWLRMFDLQGLVRRLKKVSKSFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDIL  346
              LE+II DHE+ + K + +   DFVD  L +M     P         R H+K+V++ ++
Sbjct  246  VVLEQIIRDHEQYSDK-EEKGQKDFVDIFLALMHQPLDPHDEHGPVVERTHIKAVVMTMI  304

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            IA IDTSS+ +EW +SEL + P +MKK+++E+ES VG+ R VEE+D+E   YL++V+KE+
Sbjct  305  IAGIDTSSTSVEWAMSELLKHPRVMKKLQDELESVVGMKRKVEETDMEKLLYLDLVVKET  364

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++PVVPLL+P   RED  +DG+ I K S V VN WA+GRDPKVWSD  E F+PERF  
Sbjct  365  LRLYPVVPLLVPRECREDVTIDGYFIKKNSRVIVNAWAVGRDPKVWSDNAEMFYPERFTN  424

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++V+ +G DF  +PFGSGRR CPG+ LG+T V++V++QL+HCF+W LP+GM P +L+MTE
Sbjct  425  NNVDIKGFDFRLIPFGSGRRGCPGIHLGLTTVKIVLSQLVHCFNWELPSGMSPDELDMTE  484

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL++ R++HL+A+PTYRL
Sbjct  485  KFGLTMPRSKHLLAVPTYRL  504



>gb|KHG07950.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   329 bits (844),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 222/321 (69%), Gaps = 11/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            ++FG+  DDK      FK  ++EA+ +  + NL DY P L  LD+QG TRR+K V     
Sbjct  201  VLFGRSMDDK----IDFKPLVNEAMHLAGVFNLSDYVPFLAPLDLQGYTRRLKKVSSGLH  256

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG------ESPVQFTRQHVKSVMLDI  343
            EF +K+I+++++  +    +   +F   M+ ++ +       + P    R+++K++M+D+
Sbjct  257  EFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQPYIVGRENIKAIMVDM  316

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + AS DT+++ IEWT SEL R P +M  +++E+ES VG +RMVEESDL    YL++VIKE
Sbjct  317  VAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLPKLAYLDMVIKE  376

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVW-SDPEKFFPERFN  700
            S R+HPV PLL+PH + ED  ++G+ IPK S + VN W++GR+PK+W S+ E+FFPERF 
Sbjct  377  SFRLHPVAPLLVPHESTEDVTINGYFIPKKSRLLVNTWSMGRNPKIWSSNAEEFFPERFK  436

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               ++ RG DFE +PFG+GRR CPGMQL +  +RL++AQL HCFDW LP+GMLP +L+M+
Sbjct  437  DRKIDLRGHDFELIPFGTGRRGCPGMQLVLISMRLILAQLAHCFDWELPDGMLPNELDMS  496

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLSL RA HL+A  TYRL
Sbjct  497  EKFGLSLPRANHLLAKSTYRL  517



>ref|XP_008385728.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=356

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 203/276 (74%), Gaps = 8/276 (3%)
 Frame = +2

Query  140  GLTRRMKAVGKLFDEFLEKIINDHEEATSKGKAQTT--MDFVDTMLEIMKSGESP-----  298
            GLT+RMK + K  D+  EKII DHE+ +   + Q     DFVD +L ++    +P     
Sbjct  81   GLTKRMKRISKTVDQLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEV  140

Query  299  VQFTRQHVKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEE  478
              F R + K+++LD++  S DTS++ I WT++EL R PE+MK++++E++S VG+DRMVEE
Sbjct  141  YMFERTNAKAILLDMISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGMDRMVEE  200

Query  479  SDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPK  658
            SDL    YL +V+KES R+HPV PLLIPH + ED  VDG+HIPK S V +N+W IGRDP 
Sbjct  201  SDLPKLDYLSMVVKESFRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTIGRDPN  260

Query  659  VWSDP-EKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFD  835
            VWSD  E+F+PERF  S+V+ +G DF+ +PFGSGRR CP MQLG+T VRL +  L+ CF+
Sbjct  261  VWSDNVEEFYPERFMNSNVDLQGXDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLVXCFN  320

Query  836  WNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRL  943
            W LP GMLPKDL+MTE+FGLSL++A+HL+A+PT+RL
Sbjct  321  WELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHRL  356



>gb|KCW83844.1| hypothetical protein EUGRSUZ_B00712 [Eucalyptus grandis]
Length=436

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 217/319 (68%), Gaps = 9/319 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  D    GE   K  I E  ++  + NL DY P L  LD+QG +R+ KAV +  D
Sbjct  120  MILGRSTD----GEHDLKGIIQENARVAGVFNLADYVPFLRPLDLQGSSRQFKAVRRSVD  175

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ----FTRQHVKSVMLDILI  349
            + LEKII+DH + T+   ++   DF+D +L +M     P +      R ++K+++LD++ 
Sbjct  176  KLLEKIIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREEKYIIDRTNIKAIILDMIS  235

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
             S +T+S+ I+W  SEL R P+ M  ++EE+E+ VGL RMVEESDL    YL++V+KES+
Sbjct  236  GSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLPKLNYLDMVVKESM  295

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKS  706
            R+HPVVPLL+P  + ED  ++   IPK S + VN+WAIGRDP VWS + EKF PERF  +
Sbjct  296  RLHPVVPLLVPRESMEDAVINECFIPKKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDN  355

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
             ++ +G  FE LPFGSGRR CPG+QLG+  V+LV+AQL+HCF W +P  M+P D++M+E 
Sbjct  356  GIDVKGHHFELLPFGSGRRGCPGIQLGLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSER  415

Query  887  FGLSLNRAEHLMAIPTYRL  943
            FGLS+ RA HL+A+PTYRL
Sbjct  416  FGLSVPRANHLLAVPTYRL  434



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 217/323 (67%), Gaps = 13/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I + + + AL N+GDY P L  LD+QGLT+R K + K+ D
Sbjct  202  MVLGSKSDDM----FDIKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRISKIVD  257

Query  182  EFLEKIINDHEEATSKGKAQTTM---DFVDTMLEIMKSGESP-----VQFTRQHVKSVML  337
            +  EKII +HE+ +   + Q      DFVD +L ++    +P      +  R  VK+++L
Sbjct  258  QLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVVLSLIHQPLNPNDEQGYRIERTDVKAILL  317

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D++  S DTS++ I W ++EL R P ++K ++EE++  +G DRMVEESDL    YL  VI
Sbjct  318  DMITGSFDTSATAIVWNLAELLRHPRVLKHLQEELQRVIGTDRMVEESDLRMLSYLNAVI  377

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPER  694
            KES R+HP+ P L+P  + +D  VDG++IPK S + +N WAIGRDP VWSD   +F+PER
Sbjct  378  KESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAIGRDPNVWSDNVGEFYPER  437

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+V+ RG DF+ LPFGSGRR CPGMQLG+T VRL +A ++HCF+W+LP+G+LP+DL+
Sbjct  438  FINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLD  497

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE FG    +A+ L+A+PTYRL
Sbjct  498  MTETFGSVPTKAQPLLAMPTYRL  520



>ref|XP_010094782.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB56947.1| Cytochrome P450 71A1 [Morus notabilis]
Length=507

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 214/321 (67%), Gaps = 12/321 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G   +D+       K  +HEA+ ++   NL DY P L  LD+QG TRRMK   +  D
Sbjct  187  MILGISLEDR----NHLKELVHEAMFLSGAFNLSDYVPYLAPLDLQGYTRRMKKNSEAID  242

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQF------TRQHVKSVMLDI  343
              LE+II +HE  TS+ K     DFVD +L ++    +P          R ++K+++LD+
Sbjct  243  RVLEEIITEHERGTSE-KGHRQKDFVDVLLSLVNQPMNPQDLEHLYIIDRTNIKAILLDM  301

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + AS DTS+++IEWT SEL + P +M  ++ E+E  VG+D+MVEE DLE   YL++V+KE
Sbjct  302  VAASFDTSAALIEWTFSELLKHPRVMNNLQRELERVVGMDKMVEEQDLEKLDYLDMVVKE  361

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            S R+HPV PLL+P  + ED  ++G+ IPK S + VN W IGRDP VWS+  E+F PERF 
Sbjct  362  SFRLHPVAPLLVPRESMEDITIEGYFIPKKSRIIVNAWTIGRDPNVWSENVEEFLPERFV  421

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
              +++ RG DF  LPFGSGRR CPG+ LG+  +RLV+AQL+HCF W LPNG+  KD++M+
Sbjct  422  DKNIDLRGHDFRLLPFGSGRRGCPGVHLGLVNIRLVLAQLVHCFSWELPNGVETKDVDMS  481

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLS+ RA  L+A PTYRL
Sbjct  482  EKFGLSMGRANQLLAKPTYRL  502



>ref|XP_010045641.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=506

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 217/319 (68%), Gaps = 9/319 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  D    GE   K  I E  ++  + NL DY P L  LD+QG +R+ KAV +  D
Sbjct  190  MILGRSTD----GEHDLKGIIQENARVAGVFNLADYVPFLRPLDLQGSSRQFKAVRRSVD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ----FTRQHVKSVMLDILI  349
            + LEKII+DH + T+   ++   DF+D +L +M     P +      R ++K+++LD++ 
Sbjct  246  KLLEKIIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREEKYIIDRTNIKAIILDMIS  305

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
             S +T+S+ I+W  SEL R P+ M  ++EE+E+ VGL RMVEESDL    YL++V+KES+
Sbjct  306  GSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLPKLNYLDMVVKESM  365

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKS  706
            R+HPVVPLL+P  + ED  ++   IPK S + VN+WAIGRDP VWS + EKF PERF  +
Sbjct  366  RLHPVVPLLVPRESMEDAVINECFIPKKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDN  425

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
             ++ +G  FE LPFGSGRR CPG+QLG+  V+LV+AQL+HCF W +P  M+P D++M+E 
Sbjct  426  GIDVKGHHFELLPFGSGRRGCPGIQLGLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSER  485

Query  887  FGLSLNRAEHLMAIPTYRL  943
            FGLS+ RA HL+A+PTYRL
Sbjct  486  FGLSVPRANHLLAVPTYRL  504



>ref|XP_003615678.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98636.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 223/322 (69%), Gaps = 14/322 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            ++FG+ KY+  +L     K+ + E + +    NL DY P LG  D+QGLT+  K V K  
Sbjct  191  LMFGRSKYEQFDL-----KSLVQEGLALIGAFNLADYVPWLGIFDLQGLTKSCKKVSKAL  245

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE I+ +HE+A +  K Q   DFVD +L IM       GE  +   R ++K+++LD+
Sbjct  246  DEVLEVILTEHEQAANVNKTQK--DFVDILLSIMHQTIDIEGEQNLVIDRTNIKAILLDM  303

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A+IDTS++ IEW +SEL R P +MKK+++EI++ VG  RMV E DL+   YL++V+ E
Sbjct  304  IVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRMVNEKDLKKLNYLDMVVDE  363

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEK-FFPERFN  700
            +LR++PV PLL+P  +RE   +DG+ I + + + VN WAIGRDP VWS+  K F+PERF 
Sbjct  364  TLRLYPVAPLLVPRESRESTTIDGYFIKEKTRLIVNAWAIGRDPNVWSENAKEFYPERFV  423

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
            +  + Y GQ+FE +PFGSGRR CPG+QLG+  V+LV+AQ +HCF+W LP+ + P +LNM 
Sbjct  424  EKKMNYLGQEFESIPFGSGRRRCPGIQLGLITVKLVIAQFIHCFNWELPHNISPSNLNME  483

Query  881  EEFGLSLNRAEHLMAIPTYRLH  946
            E+FGL++ RA+HL AIP+YRL+
Sbjct  484  EKFGLTIPRAQHLHAIPSYRLN  505



>ref|XP_008385725.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=510

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 213/323 (66%), Gaps = 13/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD        K  I + + + AL N+GDY P L  LD+QGLT+R K + K+ D
Sbjct  189  MVLGSKSDDM----FDJKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRISKIVD  244

Query  182  EFLEKIINDHEEATSKGKAQTTM---DFVDTMLEIMKSGESP-----VQFTRQHVKSVML  337
            +  EKII +HE+ +   + Q      DFVD  L ++    +P         R  VK+++L
Sbjct  245  QLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVXLSLIHQPLNPNDEQGYXIERTDVKAILL  304

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D++  S DTS++ I W ++EL R P + K ++EE++  +G DRMVEESDL    YL  VI
Sbjct  305  DMITGSFDTSATAIVWNLAELLRHPRVXKXLQEELQRVIGTDRMVEESDLRXLSYLNAVI  364

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPE-KFFPER  694
            KES R+HP+ P L+P  + +D  VDG++IPK S + +N WAIGRDP VWSD    F+PER
Sbjct  365  KESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAIGRDPNVWSDNXGXFYPER  424

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+V+ RG DF+ LPFGSGRR CPGMQLG+T VRL +A ++HCF+W+LP+G+LP+DL+
Sbjct  425  FINSNVDLRGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANIVHCFNWDLPSGLLPQDLD  484

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE FG    +A+ L+A+PTYRL
Sbjct  485  MTETFGSVPTKAQPLLAMPTYRL  507



>ref|XP_007152783.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 ref|XP_007152784.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24777.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24778.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
Length=511

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 221/320 (69%), Gaps = 11/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG   DD+       K  + E + +    N+ DY P L   D+QGL RR+K V K FD
Sbjct  190  MIFGCSKDDR----FDVKNLVRELLDLVGTFNVADYLPWLRMFDLQGLVRRLKKVSKSFD  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDIL  346
              LE+II DHE+ + K + +   DFVD +L ++     P         R H+K+V++ ++
Sbjct  246  VVLEQIIRDHEQYSDK-EDKGQKDFVDILLALIHQPMDPHDEHGPVVERTHIKAVVMTMI  304

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            I  I+TSS  +EW +SEL + P +MKKV++E+ES VG+ R VEE+D+E   YL++V+KE+
Sbjct  305  ITGINTSSITVEWAMSELLKHPRVMKKVQDELESVVGMKRKVEETDMEKLPYLDLVVKET  364

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++PVVPLL+P   RED  +DG+ I K S + VN WA+GRDPKVWSD  E F+PERF  
Sbjct  365  LRLYPVVPLLVPRECREDVTIDGYFIKKNSRLIVNAWALGRDPKVWSDNAEMFYPERFTN  424

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++V+ +G DF  +PFGSGRR CPG+ LG+  V++V+AQL+HCF+W LP+GM P +L+MTE
Sbjct  425  NNVDIKGFDFRLIPFGSGRRGCPGIHLGLATVKIVLAQLVHCFNWELPSGMSPDELDMTE  484

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL++ R++HL+A+PTYRL
Sbjct  485  KFGLTMPRSKHLLAVPTYRL  504



>ref|XP_002511968.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF50637.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=501

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/322 (46%), Positives = 228/322 (71%), Gaps = 13/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG   ++   G+   K+ + E +++    N+GD+ P LG  D+QG+ +R KA  + FD
Sbjct  183  MVFGVSTNN---GDFRLKSVVEETLRLVGAFNIGDFVPFLGAFDLQGVKKRSKACNEAFD  239

Query  182  EFLEKIINDHE-EATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDI  343
            + +EKII++HE EA  + K Q   DFVD +L ++         +  +  R ++K++++DI
Sbjct  240  KIMEKIIDEHEKEAHWENKQQR--DFVDALLSVVNQSMISHDGAESEIDRSNIKAILIDI  297

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A++DTS++ IEWT++EL R P+ MK +++E+++ VGLD+MVEE DL    YL++VIKE
Sbjct  298  IVAAVDTSATAIEWTLAELIRHPQAMKTLQDELQNVVGLDKMVEEKDLSKLTYLDMVIKE  357

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            S R+HPV PLL+PH + ++  +DG+HIPK S + VN+WAIGRD  VWSD  ++F PERF 
Sbjct  358  SSRLHPVAPLLVPHESIDEITIDGYHIPKRSRILVNIWAIGRDSNVWSDNVDEFLPERFI  417

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNG-MLPKDLNM  877
             ++V+  G DF  +PFGSGRR CPG+ LG+T VR+ +AQL+HCF+W LP+G + P +L+M
Sbjct  418  GTNVDLHGHDFRLIPFGSGRRGCPGIHLGLTTVRMAIAQLVHCFNWKLPDGDVSPSELDM  477

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            +E+FGL+++RA HL  +P YRL
Sbjct  478  SEQFGLTVSRASHLFLVPEYRL  499



>ref|XP_010045642.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW83846.1| hypothetical protein EUGRSUZ_B00716 [Eucalyptus grandis]
Length=508

 Score =   325 bits (832),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 213/319 (67%), Gaps = 9/319 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  D    GE   K  I EA ++    NL D+ P L  LD+QG TRR KAV +  D
Sbjct  192  MILGRSTD----GEHDLKGIIQEAARVAGAFNLADFVPFLRPLDLQGSTRRFKAVRRSVD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ----FTRQHVKSVMLDILI  349
            + LEKII+DH    +   ++   DF+D +L +M     P +      R ++K+++LD++ 
Sbjct  248  KLLEKIIDDHVRDAAYYDSEHQEDFIDILLSMMNQPIDPREEKYIIDRTNIKAIILDMIS  307

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
             S +TSS+ I+W  SEL R P+ M +++EE+E+ VGL RMVEESDL    YL++V KES+
Sbjct  308  GSFETSSTSIDWAFSELMRNPQAMARLQEELETVVGLTRMVEESDLSKLNYLDMVAKESM  367

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKS  706
            R+HPV+PLL+P  + ED  ++   IPK S + VN+WAIGRDP VWS + E+F PERF  +
Sbjct  368  RLHPVIPLLVPRESMEDAIINERFIPKKSQIIVNIWAIGRDPSVWSENAEEFVPERFADN  427

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
             ++ +G  FE LPFGSGRR CPG+QLG+  V+ V+AQL HCF W LP GM+P D++M+E 
Sbjct  428  GIDVKGHHFELLPFGSGRRGCPGIQLGLIQVKFVLAQLAHCFKWELPKGMVPSDIDMSER  487

Query  887  FGLSLNRAEHLMAIPTYRL  943
            FGLS+ RA HL A+PTYRL
Sbjct  488  FGLSVPRANHLFAVPTYRL  506



>gb|KCW79058.1| hypothetical protein EUGRSUZ_C00484 [Eucalyptus grandis]
Length=502

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 219/322 (68%), Gaps = 15/322 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G    DK       K  IHE + +    NL DY PLLG LD+QG+TRR KAV +  D
Sbjct  186  MILGCSTRDK----FNLKPVIHEGLNLVGAFNLADYVPLLGALDLQGITRRAKAVNRAVD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM------KSGESPVQ-FTRQHVKSVMLD  340
            + LE II +HEE T+ GK +   DF+DT+L  M         + PV    R ++K++ LD
Sbjct  242  KVLEDIIREHEEDTT-GKYEG--DFIDTLLAGMGHPINGSPQDEPVHVLDRTNIKALALD  298

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ AS ++SS+ IEW +SEL R P  MK+++ E+E+ VGL R VEE+DL    Y+++V+K
Sbjct  299  MIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  358

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERF  697
            ES R++P  PLLIPH + E  E+ G++IPKG+ V VN WA+GRD   W+ DPE+F PERF
Sbjct  359  ESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDAGTWAEDPEEFRPERF  418

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
                V+ +G+DF+ +PFGSGRR CPGM LG+  VRLV+AQL+HCFDW LP G  PK+L+M
Sbjct  419  ADGGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELPAGTSPKELDM  478

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            +E+FGL++ RA+HL+  P+YRL
Sbjct  479  SEDFGLAMPRAKHLILRPSYRL  500



>ref|XP_010663583.1| PREDICTED: cytochrome P450 CYP736A12 isoform X2 [Vitis vinifera]
Length=472

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 215/322 (67%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG  +D  E+ +   K  I EA  +    N+ DY P LG  D+QGLTRR +A  +  D
Sbjct  157  MVFG--HDKDEMID--LKTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAID  212

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDIL  346
            E LEKII+ H +    G     M+F+D ML +M        E      R +VK+++LDIL
Sbjct  213  EVLEKIIDKHTKDARDGVNH--MNFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDIL  270

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+S   ++W ++EL R P +MKKV+EE+++ VG+ R VEESDL+   Y+ +V+KE+
Sbjct  271  VGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLKSLIYMNMVLKEA  330

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR+HPV P LIP  + E   ++  +IPK + + +N WAIGRDP  WS+  E+FFPERF  
Sbjct  331  LRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPNAWSNNAEEFFPERFID  390

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++++  G DFE +PFGSGRR CPG+QLG+  V+L++AQL+HCFDW LPN M P DLNM E
Sbjct  391  NNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELPNDMSPSDLNMRE  450

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
            +FGL++ RA HL+A PTYRLHI
Sbjct  451  KFGLTMPRANHLIAKPTYRLHI  472



>ref|XP_002275691.1| PREDICTED: cytochrome P450 CYP736A12 isoform X1 [Vitis vinifera]
Length=501

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 215/322 (67%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG  +D  E+ +   K  I EA  +    N+ DY P LG  D+QGLTRR +A  +  D
Sbjct  186  MVFG--HDKDEMID--LKTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAID  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDIL  346
            E LEKII+ H +    G     M+F+D ML +M        E      R +VK+++LDIL
Sbjct  242  EVLEKIIDKHTKDARDGVNH--MNFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDIL  299

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+S   ++W ++EL R P +MKKV+EE+++ VG+ R VEESDL+   Y+ +V+KE+
Sbjct  300  VGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLKSLIYMNMVLKEA  359

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR+HPV P LIP  + E   ++  +IPK + + +N WAIGRDP  WS+  E+FFPERF  
Sbjct  360  LRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPNAWSNNAEEFFPERFID  419

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++++  G DFE +PFGSGRR CPG+QLG+  V+L++AQL+HCFDW LPN M P DLNM E
Sbjct  420  NNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELPNDMSPSDLNMRE  479

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
            +FGL++ RA HL+A PTYRLHI
Sbjct  480  KFGLTMPRANHLIAKPTYRLHI  501



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 213/316 (67%), Gaps = 6/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K   H+ + +  L N+ DY P  G  D+QGL R+ K   K FD
Sbjct  188  MILGRSRDDRF----DLKGLTHDYLHLLGLFNVADYVPWAGVFDLQGLKRQFKQTSKAFD  243

Query  182  EFLEKIINDHEEATSKGKAQT-TMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            +  E+II DHE  +   K    + DFVD +L +M          R ++K+++LD++  + 
Sbjct  244  QVFEEIIKDHEHPSDNNKENVHSKDFVDILLSLMHQPSEHHVIDRINIKAILLDMIAGAY  303

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DTS+  +EW +SEL R P +MKK+++E+   VG DR VEESDL    YL +V+KE+LR++
Sbjct  304  DTSAIGVEWAMSELLRHPRVMKKLQDELNIVVGTDRPVEESDLAKLPYLNMVVKETLRLY  363

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKSSVE  715
            PV PLL+P  + ED  ++G++I K S + +N WAIGRDPKVWSD  E F+PERF  S+++
Sbjct  364  PVGPLLVPRESLEDITINGYYIKKKSRILINAWAIGRDPKVWSDNVEMFYPERFLNSNID  423

Query  716  YRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGL  895
             RGQ+F+ +PFGSGRR CPG+QLGIT   LV+AQL+HCF+W LP GM P D++MTE FGL
Sbjct  424  MRGQNFQLIPFGSGRRGCPGIQLGITTFSLVLAQLVHCFNWELPFGMSPDDIDMTENFGL  483

Query  896  SLNRAEHLMAIPTYRL  943
            SL R++HL+A+PT+RL
Sbjct  484  SLPRSKHLLAVPTHRL  499



>ref|XP_010047217.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   323 bits (827),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 219/322 (68%), Gaps = 15/322 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G    DK       K  IHE + +    NL DY PLLG LD+QG+TRR KAV +  D
Sbjct  215  MILGCSTRDK----FNLKPVIHEGLNLVGAFNLADYVPLLGALDLQGITRRAKAVNRAVD  270

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM------KSGESPVQ-FTRQHVKSVMLD  340
            + LE II +HEE T+ GK +   DF+DT+L  M         + PV    R ++K++ LD
Sbjct  271  KVLEDIIREHEEDTT-GKYEG--DFIDTLLAGMGHPINGSPQDEPVHVLDRTNIKALALD  327

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ AS ++SS+ IEW +SEL R P  MK+++ E+E+ VGL R VEE+DL    Y+++V+K
Sbjct  328  MIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  387

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERF  697
            ES R++P  PLLIPH + E  E+ G++IPKG+ V VN WA+GRD   W+ DPE+F PERF
Sbjct  388  ESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDAGTWAEDPEEFRPERF  447

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
                V+ +G+DF+ +PFGSGRR CPGM LG+  VRLV+AQL+HCFDW LP G  PK+L+M
Sbjct  448  ADGGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELPAGTSPKELDM  507

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            +E+FGL++ RA+HL+  P+YRL
Sbjct  508  SEDFGLAMPRAKHLILRPSYRL  529



>gb|KHN32024.1| Cytochrome P450 71A1 [Glycine soja]
Length=459

 Score =   320 bits (821),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 216/322 (67%), Gaps = 10/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K    E +++T + N+ DY P  G LD+QGL  +MK + K FD
Sbjct  140  MILGRSKDDRF----DLKGLAREVLRLTGVFNIADYVPWTGFLDLQGLKGKMKKMSKAFD  195

Query  182  EFLEKIINDHEEATSKGKAQT-TMDFVDTMLEIMKSG----ESPVQFTRQHVKSVMLDIL  346
            E  E+II DHE+ ++  K    + DFVD +L  M       E      R ++K+++LD++
Sbjct  196  EVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQEQKYVIGRTNIKAIILDMI  255

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              S DTS+  +EW +SEL R P  MKK++EE+ + VG +++VEESDL    YL +V+KE+
Sbjct  256  AGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKLVEESDLSKLPYLNMVVKET  315

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++P  PLL+P  + ED  ++G+HI K + + VN WAIGRDPKVWSD  + F PERF  
Sbjct  316  LRLYPAGPLLVPRESLEDITINGYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVN  375

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG DF+ LPFGSGRR CPG+QLG+T   LV+AQL+HCF+W LP G+ P DL+M+E
Sbjct  376  SNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSE  435

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
             FGLSL R++ L+AIPTYRL I
Sbjct  436  RFGLSLPRSKPLLAIPTYRLFI  457



>ref|XP_010036875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW48537.1| hypothetical protein EUGRSUZ_K02212 [Eucalyptus grandis]
Length=504

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 217/310 (70%), Gaps = 11/310 (4%)
 Frame = +2

Query  38   GEKGF--KAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDH  211
            GE  F  K  IHE + +    NL DY PLLG  D+QGL RR K V +  D+ LE +I +H
Sbjct  196  GEDEFDLKKLIHEVLSLAGSFNLADYVPLLGPFDLQGLARRAKVVHQAIDKVLEGVIKEH  255

Query  212  EEATSKGKAQTTMDFVDTMLEIMK-----SGESPVQFTRQHVKSVMLDILIASIDTSSSV  376
            ++ T+ GK +   DF+DT+L + +     S + P    R +VK+++LD++  S ++SS++
Sbjct  256  QQDTT-GKYKG--DFLDTILSVTQHPMTDSQDKPDMLDRTNVKAIVLDLISGSYESSSTI  312

Query  377  IEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLL  556
            I+W  SEL R P +MKK+++E+ + VG++RMVEESDL    YL++VIKE+ R++P  PLL
Sbjct  313  IDWAFSELMRSPHVMKKLQQELRAIVGMNRMVEESDLPKLNYLDMVIKETFRLYPPGPLL  372

Query  557  IPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKSSVEYRGQDF  733
            IPH + ED E+DG +IPK + V VN WA+GRD   W D  E+F PERF  SSV+ +G+DF
Sbjct  373  IPHESTEDIEIDGHYIPKRTRVIVNAWALGRDIDAWGDDVEEFKPERFANSSVDVKGRDF  432

Query  734  EFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAE  913
            + +PFGSGRRSCPGM L +   RL +AQ++HCFDW LP+GM P DL+MTEE GLSL++A+
Sbjct  433  QLIPFGSGRRSCPGMNLALINTRLFLAQMVHCFDWELPDGMSPSDLDMTEEVGLSLSKAK  492

Query  914  HLMAIPTYRL  943
            HL  +PTYRL
Sbjct  493  HLSLVPTYRL  502



>ref|XP_007036496.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY20997.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=514

 Score =   322 bits (824),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 220/323 (68%), Gaps = 10/323 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+   + E      K  I E  ++    NL D+ P L  LD+QGL ++ K + K+ D
Sbjct  188  MIFGRP-SNSEDDNINLKLLIKEISRLAGAFNLSDFVPCLAPLDLQGLAQKQKRISKILD  246

Query  182  EFLEKIINDHEEATSKG--KAQTTMDFVDTMLEIMKSGESP------VQFTRQHVKSVML  337
            +FLEKII++HE+A      + +   +FV  M+ ++    +P          R ++K++ML
Sbjct  247  KFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKPMNPHDEEQEYIIDRTNIKAIML  306

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            +++ A +++S++ IEW +SEL + P +M  +++E+E+ VG  RMVEESDL    YL++V+
Sbjct  307  EMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLPQLTYLDVVV  366

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPER  694
            KESLR+HPV PLLIPH + ED  +DG+ IPK S + VN W++GRDP VWS + E+FFPER
Sbjct  367  KESLRLHPVGPLLIPHESMEDITIDGYFIPKKSRIIVNAWSMGRDPDVWSNNAEEFFPER  426

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+++ RGQDF+ +PFGSGRR CPGMQLG+  +RLV+AQ +HCFDW LP+GMLP  L+
Sbjct  427  FIDSNIDLRGQDFQLIPFGSGRRGCPGMQLGLITIRLVLAQFVHCFDWELPDGMLPVQLD  486

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            M+E FGLS++RA  L+   TYRL
Sbjct  487  MSENFGLSMSRANPLLVKATYRL  509



>emb|CAN69565.1| hypothetical protein VITISV_033534 [Vitis vinifera]
Length=501

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 214/322 (66%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG  +D  E+ +   K  I EA  +    N+ DY P LG  D+QGLTRR +A  +  D
Sbjct  186  MVFG--HDKDEMID--LKTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAID  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDIL  346
            E LEKII+ H +    G     M+F+D ML +M        E      R +VK+++ DIL
Sbjct  242  EVLEKIIDKHTKDARDGVNH--MNFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIIFDIL  299

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+S   ++W ++EL R P +MKKV+EE+++ VG+ R VEESDL+   Y+ +V+KE+
Sbjct  300  VGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLKSLIYMNMVLKEA  359

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR+HPV P LIP  + E   ++  +IPK + + +N WAIGRDP  WS+  E+FFPERF  
Sbjct  360  LRLHPVGPFLIPRESVEHSTINEHYIPKKARILINTWAIGRDPBAWSNNAEEFFPERFID  419

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++++  G DFE +PFGSGRR CPG+QLG+  V+L++AQL+HCFDW LPN M P DLNM E
Sbjct  420  NNIDLYGHDFELIPFGSGRRRCPGIQLGLITVQLILAQLVHCFDWELPNDMSPSDLNMRE  479

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
            +FGL++ RA HL+A PTYRLHI
Sbjct  480  KFGLTMPRANHLIAKPTYRLHI  501



>ref|XP_007036495.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20996.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=535

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 220/323 (68%), Gaps = 10/323 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+   + E      K  I E  ++    NL D+ P L  LD+QGL ++ K + K+ D
Sbjct  209  MIFGRP-SNSEDDNINLKLLIKEISRLAGAFNLSDFVPCLAPLDLQGLAQKQKRISKILD  267

Query  182  EFLEKIINDHEEATSKG--KAQTTMDFVDTMLEIMKSGESP------VQFTRQHVKSVML  337
            +FLEKII++HE+A      + +   +FV  M+ ++    +P          R ++K++ML
Sbjct  268  KFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKPMNPHDEEQEYIIDRTNIKAIML  327

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            +++ A +++S++ IEW +SEL + P +M  +++E+E+ VG  RMVEESDL    YL++V+
Sbjct  328  EMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLPQLTYLDVVV  387

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPER  694
            KESLR+HPV PLLIPH + ED  +DG+ IPK S + VN W++GRDP VWS + E+FFPER
Sbjct  388  KESLRLHPVGPLLIPHESMEDITIDGYFIPKKSRIIVNAWSMGRDPDVWSNNAEEFFPER  447

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F  S+++ RGQDF+ +PFGSGRR CPGMQLG+  +RLV+AQ +HCFDW LP+GMLP  L+
Sbjct  448  FIDSNIDLRGQDFQLIPFGSGRRGCPGMQLGLITIRLVLAQFVHCFDWELPDGMLPVQLD  507

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            M+E FGLS++RA  L+   TYRL
Sbjct  508  MSENFGLSMSRANPLLVKATYRL  530



>ref|XP_010094781.1| Cytochrome P450 71D8 [Morus notabilis]
 gb|EXB56946.1| Cytochrome P450 71D8 [Morus notabilis]
Length=508

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 219/322 (68%), Gaps = 12/322 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            +V G+   D+       K  + E +++T   NL DY P L  LD+QG TR++K V K  D
Sbjct  185  IVLGRNVGDERYD---LKRLVEEIMRLTGAFNLADYVPYLAPLDLQGYTRQLKKVNKEMD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ------FTRQHVKSVMLDI  343
            + LE+II +HEE   + K     DF+D +L +M    +P          R ++K++++D+
Sbjct  242  KVLEEIIAEHEE-VGRYKQGHHDDFIDVLLSLMNQPMNPQDRENVFIIDRTNIKAILVDL  300

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            L A++DTSS+ +EWT+SEL + P +MK  + E+ES +G++R VEE D+E   YL++V+KE
Sbjct  301  LTAALDTSSASVEWTLSELIKNPRVMKNAQRELESVIGMERTVEEKDVEKLDYLDMVVKE  360

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            S R+HPV+PLL+P  + ++  + G+HIP  S V VNVWAIGRDP VWS+  E+F+PERF 
Sbjct  361  SFRLHPVIPLLLPRESLKEITIKGYHIPNKSRVIVNVWAIGRDPNVWSENVEEFYPERFG  420

Query  701  KS-SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
            +S  +++RG+DF  LPFGSGRR CPGMQLG+T +  VVAQL+HCF W +P+GM P +++M
Sbjct  421  ESDDIDFRGRDFRLLPFGSGRRGCPGMQLGLTTIHFVVAQLVHCFSWEVPSGMNPAEIDM  480

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
             E+FGLS+ RA HL+  P YRL
Sbjct  481  IEKFGLSVVRANHLLLKPIYRL  502



>ref|XP_010663579.1| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 219/320 (68%), Gaps = 11/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG   D         K  I EA ++    NL DY P LG LD+QGLT+ ++   +  D
Sbjct  186  MVFGHNKDRI----FDLKTLIREATRLAGTFNLADYVPFLGPLDLQGLTQLLRTNNEAID  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGES----PV-QFTRQHVKSVMLDIL  346
            E L+KII+ H +  SK +    M+F+D +L +M    +    P+    RQ+ K+++LDIL
Sbjct  242  EVLDKIIDKHIQDVSKDEVNH-MNFIDVVLSLMNKSNNFEDDPLYAIDRQNAKAIILDIL  300

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+S + IEW ISEL R P +M++++EE+++ VG+ RMVEESDLE+  YL +V+KE+
Sbjct  301  VGGIDSSITSIEWVISELLRHPRVMRRLQEELKNVVGMCRMVEESDLENLGYLNMVVKET  360

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HP+ P L+P  + ED  ++G +IPK S + +N W IGRDP VWS+  E+FFPERF +
Sbjct  361  LRLHPIGPFLVPRESIEDIVINGHYIPKKSRILINTWTIGRDPNVWSNNVEEFFPERFVE  420

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            ++++ +G DFE  PFGSGRR CPG+QLG+  V+LVV+QL+HCF+W LPN   P +LNM E
Sbjct  421  NNIDLQGHDFELTPFGSGRRGCPGIQLGLITVQLVVSQLVHCFNWKLPNDTPPSELNMKE  480

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL++ R +HL+A PTYRL
Sbjct  481  KFGLTMPRVDHLLATPTYRL  500



>ref|XP_002514610.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47716.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 219/325 (67%), Gaps = 19/325 (6%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG++ +D    E   +  I E++++    N+ DY P +G LD+QGLTRRM+A  K  D
Sbjct  197  MIFGQRSND----EFDLRPLIKESLELIGAINIADYVPYIGVLDLQGLTRRMRAYRKGMD  252

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG------ESPVQFT--RQHVKSVML  337
            + LEKII+ HE+   + K +   DF+D ML +M           P  +   R  +K+++ 
Sbjct  253  KVLEKIIDSHEK-DGRWKTKEQKDFIDVMLSVMNRSSPMIPPNDPQSYVIDRTCIKAIIQ  311

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            DI++   +TS+S IEWT SEL R P +MK +++E+E+ VGLDRMVEE DL +  YL++++
Sbjct  312  DIIVGGFETSTSSIEWTFSELLRHPRVMKCLQKELETVVGLDRMVEERDLPNLTYLDMIV  371

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPE-KFFPER  694
            KESLR++P +P LIP    ED  V+G+HIP  S + VN WAIGRD  VWSD   +F+PER
Sbjct  372  KESLRLYPTLP-LIPRKCVEDITVNGYHIPSNSRILVNAWAIGRDTNVWSDNALEFYPER  430

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F    V+ RG  F+ +PFGSGRRSCPGM LG+  +RLV+AQL HCF+W+LP+G    DL+
Sbjct  431  FKDECVDLRGLHFQLIPFGSGRRSCPGMSLGLRNIRLVIAQLAHCFNWDLPSG----DLD  486

Query  875  MTEEFGLSLNRAEHLMAIPTYRLHI  949
            MTE++GL+L RA H  A+PTYRLH+
Sbjct  487  MTEKYGLTLPRANHFSALPTYRLHV  511



>ref|XP_007152790.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
 gb|ESW24784.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
Length=507

 Score =   318 bits (816),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 207/318 (65%), Gaps = 8/318 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K  I E + +    NL DY P LG  D QG+T+R+K   KLFD
Sbjct  192  MMLGRVKDDR----LDLKKLIQEVMNLVGAFNLADYMPWLGFFDPQGITKRLKKASKLFD  247

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ----FTRQHVKSVMLDILI  349
            E LE+II DHE  +     +  MDFV+ ++ +M              R +VK+++LDI+ 
Sbjct  248  EVLEQIIQDHERNSYDKDNKRNMDFVEILVSLMHQSNDVHNNENIIDRTNVKAIILDIIT  307

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
            A++DTS + IEW +SEL R P +MK+++ E+E  VG++R VEE+DLE+  YL +V+KE+L
Sbjct  308  AALDTSYTTIEWAMSELLRHPSVMKRLQHELEHVVGMNRHVEENDLENLSYLNMVVKETL  367

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSS  709
            R+HPV PLL+P   RED  +DG+ I K S + VN WAIGRDPKVW++   F P RF   +
Sbjct  368  RLHPVAPLLVPRECREDVIIDGYFIKKKSRIIVNAWAIGRDPKVWNNAAIFNPTRFENDN  427

Query  710  VEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEF  889
            ++ RG+DF  LPFGSGRR CPG+ LG+T   L++AQL+HCFDW LP GM   +L+M E F
Sbjct  428  IDIRGKDFRILPFGSGRRGCPGIHLGLTTFSLILAQLVHCFDWVLPLGMSCDELDMQEIF  487

Query  890  GLSLNRAEHLMAIPTYRL  943
            GL+  R +HL+  P YRL
Sbjct  488  GLTTPRKKHLLVRPVYRL  505



>ref|XP_004301062.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 223/323 (69%), Gaps = 14/323 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD+       KA + E   +    N+ D+ P L   D+Q + +R+K V K  D
Sbjct  191  MVLGCKRDDR----FDLKAIVEEIFFLVGAFNISDFIPSLSAFDIQRI-KRLKKVSKTAD  245

Query  182  EFLEKIINDHEEATSK---GKAQTTMDFVDTMLEIMKSGESP----VQFT-RQHVKSVML  337
            +  +KII+DHE+A      GK     DFVD +L   K   +P    V F  R++VK+++L
Sbjct  246  QLWDKIIDDHEQAAETKGGGKQGQHEDFVDVLLSFTKQLLNPNDEQVHFLDRENVKAILL  305

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D++ A+ DTS++ I W+++EL R P IMK+++EE+++ VG+DRMVEESDL +  YL++V+
Sbjct  306  DMITAAFDTSATTIIWSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLPNLDYLDLVV  365

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPER  694
            KES R+HPV PLL PH + +D  +DG+ +PK S + VN W+I RDP VWS+  E+F PER
Sbjct  366  KESFRLHPVAPLLDPHESIKDITIDGYDVPKKSRLIVNFWSIARDPNVWSENVEEFCPER  425

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
            F   +V  +G  ++ +PFG+GRR CPGMQLG+T VR+V+AQL+HCF+W LPNGMLP DL+
Sbjct  426  FTNINVYRQGHHYQLIPFGTGRRGCPGMQLGLTTVRIVLAQLVHCFNWELPNGMLPLDLD  485

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            MTE+FGLS++ A+HL+A PT+RL
Sbjct  486  MTEKFGLSMSMAKHLLAKPTFRL  508



>ref|XP_010111002.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXC29388.1| Cytochrome P450 71D10 [Morus notabilis]
Length=473

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 209/303 (69%), Gaps = 9/303 (3%)
 Frame = +2

Query  56   AAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSKGK  235
            AA  E V ++    + DY P L  LD+QG TRRMK V K  D+ LEKII  HE+  S+ +
Sbjct  170  AAARELVDVSR--KIADYVPYLAPLDLQGYTRRMKKVSKGIDKVLEKIIMAHEQGASE-E  226

Query  236  AQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDILIASIDTSSSVIEWTISEL  400
                 DFVD +L ++    +P         R ++K+++LD+++A+ DTS++ IEWT+SE+
Sbjct  227  GHHHKDFVDVLLSLVNQPMNPQDQHVYIIDRTNIKAILLDMVVAAFDTSATSIEWTLSEV  286

Query  401  FRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAARED  580
             + P + + ++EE+E   G+D+MVEE DLE   YL++V+KES R+HPV PLL+P  + ED
Sbjct  287  LKNPRVTQNLQEEVERVTGMDKMVEERDLEKLDYLDMVVKESFRLHPVAPLLVPRESMED  346

Query  581  CEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKSSVEYRGQDFEFLPFGSG  757
              V+G+ IPK S + VN W IGRDP VWS+  E+FFPERF  S ++ RG DF  LPFGSG
Sbjct  347  ITVEGYFIPKNSRIIVNTWTIGRDPNVWSENVEEFFPERFINSKIDLRGYDFRLLPFGSG  406

Query  758  RRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTY  937
            RR CPG  LGI  ++LV+AQL+HCF W+LP+G+  KD++M+E+FGLS+ R  HL+A PTY
Sbjct  407  RRGCPGAHLGIVTIQLVLAQLVHCFSWDLPSGVETKDIDMSEKFGLSMGRENHLLAKPTY  466

Query  938  RLH  946
            RL+
Sbjct  467  RLN  469



>ref|XP_007036499.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY21000.1| Cytochrome P450, putative [Theobroma cacao]
Length=511

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 215/321 (67%), Gaps = 12/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            MV G  KYD   L E      + E   +    NL DY P LG LD+QGL  R+KA     
Sbjct  191  MVIGHMKYDQFNLKE-----LVQEVTSLAGAFNLADYVPFLGALDLQGLRPRIKAASGAL  245

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQHVKSVMLDI  343
            D+ LE II++HE      + +   DFVD ML ++    +P         R  +K++++D+
Sbjct  246  DKALENIIDEHELKNIHEQQKQQRDFVDLMLTMLNQPMNPHDDPMYIVDRTTIKAIIVDL  305

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +   +DT+++ IEW ++EL R P  M+ ++ E++S VG+ R VEE DL    YL++V+KE
Sbjct  306  ITGGLDTTTTTIEWAVTELIRNPRAMQHLQRELQSFVGIYRTVEEIDLPKLTYLDMVVKE  365

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFN  700
            +LR+HPV PLL+PH + ED  +DG++IPK S + VNVWAIGRDP VWS+  E+FFPERF 
Sbjct  366  TLRLHPVAPLLVPHESMEDTTIDGYYIPKKSRILVNVWAIGRDPDVWSNNVEEFFPERFI  425

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+++ RG DFE +PFG+GRR CPGM+LG+T V+ V+AQL+HCFDW LP+GMLP++L+ +
Sbjct  426  DSNIDLRGHDFELIPFGAGRRMCPGMKLGLTTVKFVLAQLVHCFDWELPDGMLPEELDTS  485

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLSL R+ HL A P YRL
Sbjct  486  EKFGLSLPRSSHLYAKPIYRL  506



>gb|AES98630.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=622

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 216/321 (67%), Gaps = 13/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KYD  +L     K  + + + +    NL DY P LG  D+QGLTR  K  GK  
Sbjct  301  MILGRSKYDQFDL-----KRVVQDVLALVGAFNLADYVPWLGVFDLQGLTRACKETGKAI  355

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE I+ +HE+ T+  K +   DFVD +L  M        E      R ++K+++LD+
Sbjct  356  DEVLEVILTEHEQTTNVDKNRHE-DFVDILLTFMHQTIDLENEENHFIDRTNIKAILLDL  414

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
             +A+IDTS++VIEW +SEL R P +MK +++EI++ VG +RM+EE DLE+  YLE+V+ E
Sbjct  415  TVAAIDTSATVIEWALSELLRHPRVMKILQDEIQNEVGNERMIEEKDLENLSYLEMVVHE  474

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR++PV PLL+P   RE   +DG+ I + + V VN WAIGRD  VWS + E+F+PERF 
Sbjct  475  TLRLYPVAPLLLPRECRESVTIDGYFIKEKTRVIVNAWAIGRDSNVWSENAEEFYPERFI  534

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               + Y+GQ+FE LPFGSGRR CPG+Q G+  V+LV+AQL+HCFDW LP  + P +LNM 
Sbjct  535  GKKMNYQGQEFESLPFGSGRRRCPGIQSGLVTVKLVIAQLVHCFDWELPYNISPSNLNME  594

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ RA+HL  IPTYRL
Sbjct  595  EKFGLTIPRAQHLHVIPTYRL  615



>ref|XP_003615666.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98624.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AFK39835.1| unknown [Medicago truncatula]
Length=511

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 218/321 (68%), Gaps = 13/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+FG+ KY+  ++ +      + EA+ +    NL DY P LG  D+QGLTR  K   K  
Sbjct  191  MMFGRSKYEQFDMNK-----LVLEAMALMGAFNLADYVPWLGVFDLQGLTRACKKTSKAL  245

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE II +HE+ T+  K +   DFVD +L IM       GE  +   R ++K+++LD+
Sbjct  246  DEVLEMIITEHEQTTNTDKTRNE-DFVDILLSIMHQTIDVEGEQNLVIDRTNIKAILLDM  304

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + AS+ TS++ IEW +SEL R   +MK +++EI++ VG  RMVEE DL+ F YL++V+ E
Sbjct  305  IAASVHTSATTIEWALSELLRHSRVMKILQDEIQNEVGNKRMVEEKDLKKFNYLDMVVDE  364

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR++PV PLLIP   RE   +DG+ I K + V VN WAIGRD  VWS + ++F+PERF 
Sbjct  365  TLRLYPVGPLLIPRECRESITIDGYFITKKTRVIVNAWAIGRDCNVWSENADEFYPERFI  424

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               + Y+G +FE +PFGSGRR CPG+QLG+ +V+LV+AQ +HCF+W LP+ + P +LNM 
Sbjct  425  DKKMNYQGHEFESIPFGSGRRRCPGIQLGLIIVKLVIAQFVHCFNWELPHNISPSNLNME  484

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLS+ RA+HL AIP+YRL
Sbjct  485  EKFGLSIPRAQHLQAIPSYRL  505



>gb|AES98625.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 219/321 (68%), Gaps = 15/321 (5%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KY+  +L     K  I + + +    NL DY P LG  D+QGLT+  K   K  
Sbjct  190  MILGRGKYEQFDL-----KKMIKDGLTLMGAFNLADYVPWLGIFDLQGLTQACKKTSKAL  244

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE II +HE+ T+    +   DFVDT+L IM       G   +   R  +K+++LD+
Sbjct  245  DEVLEMIITEHEQTTNTDDPK---DFVDTVLSIMHQTIDVEGGQDLVIDRTIIKAILLDM  301

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + ASIDTSS+VIEW +SEL R P +MK +++EI++ VG  RMVEE DL++F YL++V+ E
Sbjct  302  IGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRMVEEKDLKNFNYLDMVVDE  361

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR++PV PLLIP   RE+  +D + I + + V VN WAIGRDP VWS + E+F+PERF 
Sbjct  362  TLRLYPVAPLLIPRECRENITIDDYSIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFI  421

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
            +  + Y GQ+FE +PFGSGRR CPG+QLG+  V+LV+AQ +HCF+W LP+ + P +LNM 
Sbjct  422  EKKMNYLGQEFESIPFGSGRRRCPGIQLGMITVKLVIAQFVHCFNWELPHNISPSNLNME  481

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ RA+HL AIP+YRL
Sbjct  482  EKFGLTIPRAQHLHAIPSYRL  502



>ref|XP_010541895.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=512

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 216/321 (67%), Gaps = 8/321 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            ++ G+  +D +  +   K  + E V +T   N+ DY PLL  LD+QGL RRM+ + K  D
Sbjct  193  LILGRGKNDDD--DVKLKELVEEIVSLTGAFNISDYLPLLAPLDLQGLARRMRHLSKSMD  250

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM-----KSGESPVQFTRQHVKSVMLDIL  346
              LE II +HE+     K++   DFVD +L ++     +  E      R HVKS++LD++
Sbjct  251  IILENIIEEHEQQNRDHKSKDHKDFVDVLLSLLNQPMNEQDEHSEIIGRTHVKSILLDMV  310

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             A+++TS++ IEW  SE+ +   IMKK+++E+++ VG+DRMV E+DL    YL++VIKE 
Sbjct  311  AAALETSATAIEWIFSEILKNTRIMKKLQDELKNIVGMDRMVNETDLSKLTYLDMVIKEG  370

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
             R+HPV PLLIPH + ED  +DGF+IPK S V VNVW+IGRD  VW D  E+F PERF  
Sbjct  371  FRLHPVAPLLIPHESVEDVVLDGFYIPKKSRVLVNVWSIGRDRDVWGDNNEEFNPERFEN  430

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
              ++  G DF  +PFGSGRR CPGMQ+G+  +RLV+AQL+HCFDW LP GM+ ++L+M E
Sbjct  431  DDIDINGLDFRLIPFGSGRRRCPGMQMGLLNLRLVIAQLVHCFDWVLPVGMVREELDMNE  490

Query  884  EFGLSLNRAEHLMAIPTYRLH  946
            +FGL++ RA ++ A P YRL+
Sbjct  491  KFGLTVGRANNVFATPIYRLN  511



>ref|XP_004490599.1| PREDICTED: uncharacterized protein LOC101502297 [Cicer arietinum]
Length=983

 Score =   328 bits (840),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 220/321 (69%), Gaps = 13/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KY+  +L     K  I EA+ +    N+ DY P L   D+QGLTR  K + K  
Sbjct  191  MILGRSKYEQFDL-----KGLIQEAMVLFGSFNVADYVPWLSAFDIQGLTRACKKMSKSL  245

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM-----KSGESPVQFTRQHVKSVMLDI  343
            DE LE II +HEE+T+  K +   DF+D +L IM     K  E      R ++K+++LD+
Sbjct  246  DEVLEVIITEHEESTNVEKTRHE-DFIDILLSIMHHNIDKENEQSHAIDRTNIKAILLDV  304

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++ +IDTS++VI WT SEL R P++MK ++ EIE  VG  RMVEE DL+ FKYL++VI E
Sbjct  305  ILGAIDTSANVIGWTFSELLRHPKVMKNLQNEIEKEVGNKRMVEEKDLKKFKYLDMVIDE  364

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            SLR++PV PLL+P   RE   +DG+ I + + + VN WAIGRDP VWS + E+F+PERF 
Sbjct  365  SLRLYPVGPLLLPRECRESVTIDGYFIKEKTRLIVNAWAIGRDPNVWSENAEEFYPERFV  424

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
              ++ Y+GQDFE +PFGSGRR CPG+ LG+  VR V+AQL+HCF+W LP+ + P +LNM 
Sbjct  425  DKTMNYQGQDFECIPFGSGRRRCPGIHLGLVTVRFVIAQLVHCFNWELPSNITPSNLNME  484

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLS+ RA+HL AIP+YRL
Sbjct  485  EKFGLSIPRAQHLHAIPSYRL  505


 Score =   322 bits (825),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 209/307 (68%), Gaps = 13/307 (4%)
 Frame = +2

Query  50   FKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSK  229
             K  + EA+ +    N+ DY P LG  D+QGLTR  K V K  DE LE II +HE+AT  
Sbjct  674  LKKLVQEALALIGSFNMADYVPWLGAFDLQGLTRAFKRVSKSLDEVLEVIITEHEQATKI  733

Query  230  GKAQTTMDFVDTMLEIMKSGESPVQFTRQH--------VKSVMLDILIASIDTSSSVIEW  385
             K     DFV+ +L IM     P+ F  +H        +K+ +LD+++A IDTSS+VIEW
Sbjct  734  DKTHRE-DFVNILLSIM---HQPIDFENEHNHIIDRTNIKAFLLDMIVAGIDTSSTVIEW  789

Query  386  TISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPH  565
             +SEL R P +MK +++EI + VG  RMVEE+DL    YL++V+ E+LR++PV PLL+P 
Sbjct  790  ALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMVVNETLRLYPVGPLLLPR  849

Query  566  AAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKSSVEYRGQDFEFL  742
              RE   +DG+ I K + V +N WAIGRDP VWS + ++F+PERF    + Y+GQ+F+ +
Sbjct  850  ECRESITIDGYFIKKKTRVMINAWAIGRDPNVWSENADEFYPERFIDKKMNYQGQEFDSI  909

Query  743  PFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLM  922
            PFGSGRR CPG+QLG+  V+LV+AQL+HCF+W LP  M P +LNM E+FGL++ RA+HL 
Sbjct  910  PFGSGRRRCPGIQLGLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLY  969

Query  923  AIPTYRL  943
            AIP+YRL
Sbjct  970  AIPSYRL  976



>ref|XP_009631573.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=227

 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 183/227 (81%), Gaps = 1/227 (0%)
 Frame = +2

Query  266  MLEIMKSGESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIE  445
            M+EIM+SGE+  QF  +H+K+++LD+LIA++DTS++ +EW ++EL R  + MKK++ E+E
Sbjct  1    MMEIMQSGEAEFQFDCRHIKAILLDMLIAAMDTSATSVEWILTELLRHTQAMKKLQRELE  60

Query  446  SHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVT  625
              VG+DRMVEESDLE+ KYL++V+KE LR+H +V L++ H A EDC VDGFHI KGS + 
Sbjct  61   EVVGMDRMVEESDLENLKYLDMVVKEGLRLHSIV-LVMHHEAMEDCVVDGFHIQKGSRIM  119

Query  626  VNVWAIGRDPKVWSDPEKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRL  805
            +N +AI RDP VW +PEKF PERF  SSV+ RG  F+ LPF SGRRSCPGMQLGIT+VRL
Sbjct  120  INCYAIQRDPNVWPEPEKFLPERFVGSSVDIRGCHFQLLPFSSGRRSCPGMQLGITIVRL  179

Query  806  VVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRLH  946
            VVAQL+HCFDW +PNGM P DL++ EEFG+ L + + LMAIPTYRL+
Sbjct  180  VVAQLVHCFDWEIPNGMQPLDLDVDEEFGIVLCKEKPLMAIPTYRLN  226



>ref|XP_003615665.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003615670.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98623.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98628.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 217/321 (68%), Gaps = 13/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KY+  +L     K  + E + +    NL DY   LG  D+QG TR  K  GK  
Sbjct  189  MILGRGKYEQFDL-----KKLVQEGMAMLGAFNLADYVSWLGPFDLQGFTRTCKKTGKAL  243

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
            DE LE II +HE++T+  K +   DF+D +L I+     P         R ++K+++LD+
Sbjct  244  DEVLEMIITEHEQSTNVDKVRHE-DFIDILLSIVHQTVDPENEQSGVIDRTNIKAILLDM  302

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A IDT+++ IEW +SELFR P +MKK+++EI++ VG  RMVEE+DL+   YL++V+ E
Sbjct  303  IVAGIDTATTTIEWALSELFRHPRVMKKLQDEIQNEVGNKRMVEENDLKKLNYLDMVVDE  362

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVW-SDPEKFFPERFN  700
            +LR++PV PLL+P   RE   +DG+ I + + V VN WAIGRD  +W  + ++F+PERF+
Sbjct  363  TLRLYPVGPLLLPRECRESITIDGYFIKEKTRVIVNAWAIGRDSNIWLENADEFYPERFS  422

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               + Y+GQ FE +PFGSGRR CPG+QLG+  VR VVAQL+HCF+W LP+ + P +LNM 
Sbjct  423  DKKMNYQGQQFESIPFGSGRRRCPGIQLGLVTVRFVVAQLVHCFNWELPHNISPSNLNME  482

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FG+++ RA+HL AIP+YRL
Sbjct  483  EKFGVTIPRAQHLHAIPSYRL  503



>gb|KCW48536.1| hypothetical protein EUGRSUZ_K02211 [Eucalyptus grandis]
Length=502

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 220/322 (68%), Gaps = 15/322 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G    DK       K  IHEA+ +    NL DY PLLG LD+QG+TRR KAV ++ D
Sbjct  186  MILGCSTRDK----FNLKPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAVNRVVD  241

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM------KSGESPVQ-FTRQHVKSVMLD  340
            + LE II +HEE T+ GK +   DF+D +L  M         + PV    R ++K++ LD
Sbjct  242  KVLEDIIREHEEDTT-GKYEG--DFIDALLAGMGHPINGSPQDEPVHVLGRTNIKALALD  298

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ AS ++SS+ IEW +SEL R P  +K+++ E+E+ VGL R VEE+DL    Y+++V+K
Sbjct  299  MIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  358

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERF  697
            ES R++P  PLLIPH + E  E+ G++IPKG+ V VN WA+GRD   W+ DPE+F PERF
Sbjct  359  ESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDADTWAEDPEEFRPERF  418

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S V+ +G+DF+ +PFGSGRR CPGM LG+  VRLV+AQL+HCFDW LP G  P +L+M
Sbjct  419  ANSGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELPAGTSPSELDM  478

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            +E+FGLS+ RA+HL+  P+YRL
Sbjct  479  SEDFGLSMPRAKHLILRPSYRL  500



>ref|XP_003615672.1| Cytochrome P450 [Medicago truncatula]
Length=716

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 216/321 (67%), Gaps = 13/321 (4%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KYD  +L     K  + + + +    NL DY P LG  D+QGLTR  K  GK  
Sbjct  395  MILGRSKYDQFDL-----KRVVQDVLALVGAFNLADYVPWLGVFDLQGLTRACKETGKAI  449

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE I+ +HE+ T+  K +   DFVD +L  M        E      R ++K+++LD+
Sbjct  450  DEVLEVILTEHEQTTNVDKNRHE-DFVDILLTFMHQTIDLENEENHFIDRTNIKAILLDL  508

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
             +A+IDTS++VIEW +SEL R P +MK +++EI++ VG +RM+EE DLE+  YLE+V+ E
Sbjct  509  TVAAIDTSATVIEWALSELLRHPRVMKILQDEIQNEVGNERMIEEKDLENLSYLEMVVHE  568

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR++PV PLL+P   RE   +DG+ I + + V VN WAIGRD  VWS + E+F+PERF 
Sbjct  569  TLRLYPVAPLLLPRECRESVTIDGYFIKEKTRVIVNAWAIGRDSNVWSENAEEFYPERFI  628

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               + Y+GQ+FE LPFGSGRR CPG+Q G+  V+LV+AQL+HCFDW LP  + P +LNM 
Sbjct  629  GKKMNYQGQEFESLPFGSGRRRCPGIQSGLVTVKLVIAQLVHCFDWELPYNISPSNLNME  688

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ RA+HL  IPTYRL
Sbjct  689  EKFGLTIPRAQHLHVIPTYRL  709



>ref|XP_006350392.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=507

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 204/300 (68%), Gaps = 2/300 (1%)
 Frame = +2

Query  50   FKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEE-ATS  226
             K  + E V+++   N+ DY P L   D+QGL +++K  GK   E  + IIN+HE+ A +
Sbjct  206  LKNIVKEMVRLSGTFNVADYVPFLEPFDIQGLNKQLKETGKRVQEIFDTIINEHEQDANN  265

Query  227  KGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTISELFR  406
                    D VD ML    +  S     R  +K+++ D+++ +IDTS + IEW  +E+ +
Sbjct  266  YTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAILSDMIVGAIDTSHTWIEWVFAEIIK  325

Query  407  QPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCE  586
             P +M K+++E+ S VGLDRMVEE DL   +YLE+V+KE+ R+HPV PLL+P  + ED  
Sbjct  326  HPTVMNKLQDELTSIVGLDRMVEEDDLPKLEYLELVLKETFRLHPVAPLLVPRESIEDVV  385

Query  587  VDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKSSVEYRGQDFEFLPFGSGRR  763
            ++  +IPKGS V +N WA+G DPK+WSD  EKF PERF   ++  RG DF  LPFG GRR
Sbjct  386  INECYIPKGSRVMINCWALGHDPKIWSDNVEKFIPERFIGKNINLRGHDFHLLPFGYGRR  445

Query  764  SCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRL  943
            SCPG+ LG+  V+L+VAQL+HCF+W+LP+G+LP DL+MTE+FGL+  RA++L+ IPTYRL
Sbjct  446  SCPGINLGLITVKLIVAQLVHCFNWDLPDGILPDDLDMTEKFGLAAPRAQNLLVIPTYRL  505



>ref|XP_007152787.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
 gb|ESW24781.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
Length=499

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 208/318 (65%), Gaps = 8/318 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+  DDK       K  I EA+ +    NL DY P LG  D QG+T+R+K   K  D
Sbjct  184  MVLGRVKDDK----LELKRLIQEALNLVGAFNLADYMPWLGLFDFQGITKRLKKTSKSID  239

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ----FTRQHVKSVMLDILI  349
            E LE+II DHE  + + + +  +DFV+ +L +M   +          R ++K+++LD++ 
Sbjct  240  ERLEQIIQDHENNSYEKEKKYNIDFVEILLSLMHQPDDVHNHQNVIDRTNIKAIILDMIA  299

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
             +++TSS+ +EW +SEL R P +MK+++ E+E  VG+++ VEE+DL+   YL +V+KE+L
Sbjct  300  GALETSSTTLEWAMSELLRHPSVMKRLQHELEHVVGMNKHVEENDLQKLSYLNMVVKETL  359

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKSS  709
            R+HPV PLL+P   RED  +DG+ I K S + VN WAIGRDP VW + E F P RF   +
Sbjct  360  RLHPVGPLLVPRECREDVIIDGYLIKKKSRIIVNAWAIGRDPNVWDNAEIFDPTRFENDN  419

Query  710  VEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEF  889
            V+ RG+DF  LPFGSGRR CPG+ LG+T V LV+AQL+HCFDW LP GM   +L+M E F
Sbjct  420  VDIRGKDFRILPFGSGRRGCPGIHLGLTTVSLVLAQLVHCFDWMLPLGMSCDELDMQEIF  479

Query  890  GLSLNRAEHLMAIPTYRL  943
            GLS+ R  HL+  P YRL
Sbjct  480  GLSIPRKNHLLTRPVYRL  497



>gb|KDO35964.1| hypothetical protein CISIN_1g036473mg, partial [Citrus sinensis]
Length=204

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  338  DILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVI  517
            D+L  ++DTS +V+EW +SEL + P +MKK++ E+E+ VGL RMVEESDLE+ +YL++V+
Sbjct  1    DMLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLENLEYLDMVV  60

Query  518  KESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERF  697
            KE+LR+HPV PL+ PH + EDC V+GFHIPK S V VN WAIGRDPK W+DPEKFFPERF
Sbjct  61   KETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERF  120

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              SSV+ RG+DF+ LPFGSGRR+CPGMQL +TVV+ V AQL+HCFDW LP GMLP +L+M
Sbjct  121  VGSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDM  180

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            TEEFGL   RA+HL+A+P+YRL
Sbjct  181  TEEFGLVTYRAKHLLAVPSYRL  202



>ref|XP_010036876.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 220/322 (68%), Gaps = 15/322 (5%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G    DK       K  IHEA+ +    NL DY PLLG LD+QG+TRR KAV ++ D
Sbjct  215  MILGCSTRDK----FNLKPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAVNRVVD  270

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIM------KSGESPVQ-FTRQHVKSVMLD  340
            + LE II +HEE T+ GK +   DF+D +L  M         + PV    R ++K++ LD
Sbjct  271  KVLEDIIREHEEDTT-GKYEG--DFIDALLAGMGHPINGSPQDEPVHVLGRTNIKALALD  327

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            ++ AS ++SS+ IEW +SEL R P  +K+++ E+E+ VGL R VEE+DL    Y+++V+K
Sbjct  328  MIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTVEEADLPKLNYMDMVVK  387

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERF  697
            ES R++P  PLLIPH + E  E+ G++IPKG+ V VN WA+GRD   W+ DPE+F PERF
Sbjct  388  ESFRLYPPGPLLIPHESTEGIEMGGYYIPKGTRVIVNAWALGRDADTWAEDPEEFRPERF  447

Query  698  NKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNM  877
              S V+ +G+DF+ +PFGSGRR CPGM LG+  VRLV+AQL+HCFDW LP G  P +L+M
Sbjct  448  ANSGVDVKGRDFQLIPFGSGRRGCPGMHLGLVNVRLVLAQLVHCFDWELPAGTSPSELDM  507

Query  878  TEEFGLSLNRAEHLMAIPTYRL  943
            +E+FGLS+ RA+HL+  P+YRL
Sbjct  508  SEDFGLSMPRAKHLILRPSYRL  529



>gb|ACN40174.1| unknown [Picea sitchensis]
Length=528

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 209/318 (66%), Gaps = 12/318 (4%)
 Frame = +2

Query  2    MVFGKKYDDKE-LGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M FG+KY D+E    +GF+  I E   +    ++GD+ P LG +D+QGL RR KA+ +  
Sbjct  205  MAFGRKYSDEEAYDNRGFEEMIKEFGFLLGAFDIGDFIPYLGWMDLQGLGRRQKAISRTA  264

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D F EK+I +H    ++   + T DFVD +L +     S     R ++K++++D+L A  
Sbjct  265  DAFYEKLIEEH---LAQKDVRETRDFVDVLLAL-----SEHNIRRDNIKAILIDMLHAGS  316

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            D  S+ +EW +SEL R+P +M K +EE+E  VGL+R V ESDL H  YL+ V+KE+LR++
Sbjct  317  DAPSTALEWAMSELLRRPLVMTKAQEELEKVVGLNRKVRESDLPHLPYLQAVVKETLRLY  376

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNK---SS  709
            P  PLL PH + E C V  + IP  + V VN WAIGRDPK W D E+F PERF +   S 
Sbjct  377  PSAPLLAPHESMESCTVCDYEIPARTRVIVNAWAIGRDPKSWEDAEEFKPERFTESPSSC  436

Query  710  VEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEF  889
            V+ RGQDFE +PFGSGRR CPGMQLG+ +V  V+AQLLHC DW LP  +  +DL+MTE F
Sbjct  437  VDVRGQDFELIPFGSGRRGCPGMQLGMVIVEFVLAQLLHCLDWRLPAEIQGRDLDMTENF  496

Query  890  GLSLNRAEHLMAIPTYRL  943
            GL++ RA  L+AIPT RL
Sbjct  497  GLAIPRAVPLLAIPTPRL  514



>ref|XP_009617817.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 209/316 (66%), Gaps = 5/316 (2%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG   D +       K  + E V++    N+ DY P L   D+QGL +++K  GK   
Sbjct  189  MLFG---DFRNSDRFDLKNIVQEMVRLAGAFNIADYVPFLEPFDIQGLNKQLKETGKAVQ  245

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASID  361
            + L+ IIN+HE+    G  + + D VD ML      +S     R  +K+++ D+++ +ID
Sbjct  246  KVLDTIINEHEQDARDGTRKGSKDLVDVMLSHQNCPKS-YSIDRATMKAILSDMIVGAID  304

Query  362  TSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHP  541
            TS + IEW  +E+ +   +M K++EE+ S VGLDRMVEE DL   +YLE+V+KE+ R+HP
Sbjct  305  TSHTWIEWVFAEIVKHSRVMNKLQEELISVVGLDRMVEEQDLPKLEYLELVLKETFRLHP  364

Query  542  VVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKSSVEY  718
            V  LL+P  + ED  ++G++IPK S V  N WA+G DPK+WSD  E+F PERF   +++ 
Sbjct  365  VATLLVPRESMEDVVINGYYIPKRSRVMTNCWALGHDPKIWSDNVEEFVPERFIGKNIDL  424

Query  719  RGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLS  898
            RG  F  LPFG GRRSCPGM LG+  V+L+VAQL+HCF+W+LP GMLP DL+MTE+FGL+
Sbjct  425  RGHAFHLLPFGYGRRSCPGMNLGLITVKLIVAQLVHCFNWDLPEGMLPGDLDMTEKFGLA  484

Query  899  LNRAEHLMAIPTYRLH  946
              RA++L+ IPTYRLH
Sbjct  485  APRAQNLLVIPTYRLH  500



>gb|EYU31077.1| hypothetical protein MIMGU_mgv1a024906mg [Erythranthe guttata]
Length=230

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 188/234 (80%), Gaps = 5/234 (2%)
 Frame = +2

Query  248  MDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKK  427
            MDFVDT++ IM+SGE+  +F R++VK+V+LD+L+A +DTS++ +EWT+SE+   P + KK
Sbjct  1    MDFVDTLMSIMESGEAGFEFDRRNVKAVLLDLLVAGLDTSATAMEWTLSEVINHPSVTKK  60

Query  428  VKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIP  607
            ++ EIE  VG +++V+ES L H KYL+ V++ESLR+HPV PLLI H + EDCEV+G HIP
Sbjct  61   LQIEIEETVGKNQLVDESHLPHLKYLDYVVRESLRLHPVGPLLI-HESMEDCEVNGLHIP  119

Query  608  KGSTVTVNVWAIGRDPKVWSDPEKFFPERFNKS-SVEYRGQDFEFLPFGSGRRSCPGMQL  784
            K + V VNVWAIGRDP VW+DPE+F+P+RF +S +V+ RG+DF+ +PFGSGRR CPGMQL
Sbjct  120  KKARVLVNVWAIGRDPNVWADPERFWPDRFVESPNVDLRGRDFQLIPFGSGRRGCPGMQL  179

Query  785  GITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRLH  946
             +T+V+LVVAQL+HCFDW +P G    D++M EEFGL   RA+HLM  PTYRL+
Sbjct  180  ALTIVQLVVAQLVHCFDWEIPGG---GDVDMAEEFGLVTGRAKHLMVRPTYRLN  230



>ref|XP_004490596.1| PREDICTED: uncharacterized protein LOC101501242 [Cicer arietinum]
Length=965

 Score =   322 bits (824),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 210/307 (68%), Gaps = 13/307 (4%)
 Frame = +2

Query  50   FKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSK  229
             K  I EA+ +    N+ DY P LG  D+QGLTR  K V K  DE LE II +HE+AT  
Sbjct  656  LKKLIQEALALIGSFNMADYVPWLGAFDLQGLTRACKRVSKSLDEVLEVIITEHEQATKI  715

Query  230  GKAQTTMDFVDTMLEIMKSGESPVQFTRQH--------VKSVMLDILIASIDTSSSVIEW  385
             K     DFV+ +L IM     P++F  +H        +K+++LD+++A IDTSS+VIEW
Sbjct  716  DKTHRE-DFVNILLSIM---HQPIEFENEHNLIIDRTNIKAILLDMIVAGIDTSSTVIEW  771

Query  386  TISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPH  565
             +SEL R P +MK +++EI + VG  RMVEE+DL    YL++V+ E+LR++PV PLLIP 
Sbjct  772  ALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMVVNETLRLYPVGPLLIPR  831

Query  566  AAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKSSVEYRGQDFEFL  742
              RE   +DG+ I K + V +N WAIGRD  VWS + ++F+PERF    + Y+GQ+F+ +
Sbjct  832  ECRESRTIDGYFIKKKTRVMINAWAIGRDLNVWSENADEFYPERFIDKKMNYQGQEFDSI  891

Query  743  PFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLM  922
            PFGSGRR CPG+QLG+  V+LV+AQL+HCF+W LP  M P +LNM E+FGL++ RA+HL 
Sbjct  892  PFGSGRRRCPGIQLGLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLY  951

Query  923  AIPTYRL  943
            AIP+YRL
Sbjct  952  AIPSYRL  958


 Score =   303 bits (776),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 208/323 (64%), Gaps = 37/323 (11%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ GK KY+  +L     K  + EA+ +    N+ DY P LG  D+QGLTR  K V K  
Sbjct  193  MILGKSKYEQFDL-----KKLVQEAMALIGTFNMADYVPWLGAFDLQGLTRAFKRVSKSL  247

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQH--------VKSVM  334
            DE LE II +HE+AT   K     DFV+ +L IM     P++F  +H        +K+++
Sbjct  248  DEVLEVIITEHEQATKIDKTHRE-DFVNILLSIM---HQPIEFENEHNLIIDRTNIKAIL  303

Query  335  LDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIV  514
            LD+++A IDTSS+VIEW +SEL R P +MK +++EI + VG  RMVEE+DL    YL++V
Sbjct  304  LDMIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMV  363

Query  515  IKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPER  694
            + E+LR++PV PLLIP   RE   +DG+ I + + V +NVWAIGRDP VWS         
Sbjct  364  VNETLRLYPVGPLLIPRECRESITIDGYFIKEKTRVMINVWAIGRDPNVWS---------  414

Query  695  FNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLN  874
                      ++F+ +PFGSGRR CPG+QLG+  V+LV+AQL+HCF+W LP  M P +LN
Sbjct  415  ----------ENFDSIPFGSGRRRCPGIQLGLVTVKLVIAQLVHCFNWELPYNMSPSNLN  464

Query  875  MTEEFGLSLNRAEHLMAIPTYRL  943
            M E+FGLS+ RA+HL AIP+YRL
Sbjct  465  MEEKFGLSMPRAQHLYAIPSYRL  487



>ref|XP_010537441.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=509

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 216/321 (67%), Gaps = 9/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G  Y     G    K  + E + +    N+ DY P L   D+QGL RRMK + K  D
Sbjct  189  MILG--YSKNNDGGMKLKEHVEEMMSLAGAFNISDYLPFLAPFDLQGLARRMKELSKSMD  246

Query  182  EFLEKIINDHEEATSKGKAQTT-MDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
              LEKII +HE    + K++    DFVD +L +M    +P+        R HVK++++D+
Sbjct  247  IILEKIIEEHEHQNEEHKSKDHHKDFVDVLLSLMNQSMNPLDKNSDIIGRIHVKAILVDL  306

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A+++TS+ VIEWT SE+ +   +MKK++EE+E+ +G+DR V+ESDL   +YL++V KE
Sbjct  307  VVAAVETSAIVIEWTFSEILKNSRVMKKLQEELETIIGMDRKVQESDLPELEYLDMVTKE  366

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVW-SDPEKFFPERFN  700
              R+HPV P L+PH + ED  VDGF+IP+ S V VNVW+IGRDP VW  + E+F+PERF 
Sbjct  367  GFRLHPVGPFLVPHESMEDVVVDGFYIPRKSRVLVNVWSIGRDPDVWPKNTEEFYPERFE  426

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
               ++ RG DF  +PFGSGRR CPGMQ+G+ +V+LV+A L+HCFDW +P+GML + ++M 
Sbjct  427  NDDIDIRGLDFRLIPFGSGRRRCPGMQIGLPIVKLVLAYLVHCFDWKMPDGMLFEKIDMD  486

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGLS+ RA +++A P YRL
Sbjct  487  EKFGLSVGRANNVIARPIYRL  507



>ref|XP_008374965.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=622

 Score =   313 bits (801),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 197/270 (73%), Gaps = 6/270 (2%)
 Frame = +2

Query  155  MKAVGKLFDEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESP-----VQFTRQH  319
            ++ + K  D+ LEKII DHE+ +   +     DFVD +L  +    +P         R +
Sbjct  350  VEGITKTADQVLEKIIXDHEQVSGSEQGNHHKDFVDVLLSSIHQPLNPNDEEVYMLERTN  409

Query  320  VKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFK  499
             K+++LD++  + DTS++ I WT++EL R P++MK+++EE++S +G+DRMVEESDL    
Sbjct  410  XKAILLDMIAGAXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLD  469

Query  500  YLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-E  676
            YL +V+KESLR+HPV PLL+PH + ED  VDG+HIPK S V +N+W IGRDP VWSD  E
Sbjct  470  YLXMVVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRVFINIWTIGRDPSVWSDNVE  529

Query  677  KFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGM  856
            +F+PERF   +V+ RG DF+ +PFGSGRR CP MQLG+T VRL +  LLHCF+W LP+GM
Sbjct  530  EFYPERFMNXNVDLRGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLLHCFNWELPSGM  589

Query  857  LPKDLNMTEEFGLSLNRAEHLMAIPTYRLH  946
            LPKDL+MTE+F LSL++A+HL+A+PT RL+
Sbjct  590  LPKDLDMTEKFRLSLSKAKHLLAMPTCRLY  619



>ref|XP_003534173.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=978

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 219/322 (68%), Gaps = 10/322 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K    E +++  + N+ DY P  G LD+QGL  ++K + K+FD
Sbjct  658  MILGRSKDDRF----DLKGLAREVLRLAGVFNIADYVPWTGFLDLQGLKGKIKKMSKVFD  713

Query  182  EFLEKIINDHEE-ATSKGKAQTTMDFVDTML----EIMKSGESPVQFTRQHVKSVMLDIL  346
            E  E+II DHE+ + S  K+  + DFVD +L    + M   E      R ++K+++LD++
Sbjct  714  EVFEQIIKDHEDPSASNKKSVHSEDFVDILLSHMHQAMNQQEQKYVTGRTNIKAIILDMI  773

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             AS DTS+  +EW +SEL R P  MKK++EE+ + VG D++VEESDL    YL +V+KE+
Sbjct  774  AASFDTSTVAVEWAMSELLRNPSDMKKLQEELNNVVGEDKLVEESDLSKLPYLNMVVKET  833

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++P  PLL+P  + ED  ++G+HI K + + VN WAIGRDPKVWSD  + F PERF  
Sbjct  834  LRLYPAGPLLLPRESLEDITINGYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVN  893

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG DF+ LPFGSGRR CPG+QLG+T   LV+AQL+HCF+W LP G+ P DL+M+E
Sbjct  894  SNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSE  953

Query  884  EFGLSLNRAEHLMAIPTYRLHI  949
             FGLSL R++ L+AIPTYRL I
Sbjct  954  RFGLSLPRSKPLLAIPTYRLFI  975


 Score =   317 bits (813),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 215/320 (67%), Gaps = 10/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K    E +++T + N+ DY P  G LD+QGL  +MK + K FD
Sbjct  187  MILGRSKDDRF----DLKGLAREVLRLTGVFNIADYVPWTGFLDLQGLKGKMKKMSKAFD  242

Query  182  EFLEKIINDHEEATSKGKAQT-TMDFVDTMLEIMKSG----ESPVQFTRQHVKSVMLDIL  346
            E  E+II DHE+ ++  K    + DFVD +L  M       E      R ++K+++LD++
Sbjct  243  EVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQEQKYVIGRTNIKAIILDMI  302

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
              S DTS+  +EW +SEL R P  MKK++EE+ + VG +++VEESDL    YL +V+KE+
Sbjct  303  AGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKLVEESDLSKLPYLNMVVKET  362

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++P  PLL+P  + ED  ++G+HI K + + VN WAIGRDPKVWSD  + F PERF  
Sbjct  363  LRLYPAGPLLVPRESLEDITINGYHIKKKTRILVNAWAIGRDPKVWSDNADMFCPERFVN  422

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+V+ RG DF+ LPFGSGRR CPG+QLG+T   LV+AQL+HCF+W LP G+ P DL+M+E
Sbjct  423  SNVDIRGHDFQLLPFGSGRRGCPGIQLGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSE  482

Query  884  EFGLSLNRAEHLMAIPTYRL  943
             FGLSL R++ L+AIPTYRL
Sbjct  483  IFGLSLPRSKPLLAIPTYRL  502



>gb|KHG22812.1| Cytochrome P450 [Gossypium arboreum]
Length=493

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 209/319 (66%), Gaps = 18/319 (6%)
 Frame = +2

Query  2    MVFG--KKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKL  175
            M+ G  KKY+     E   K  I E   +    NL D+ P LG  D+QGL  R + +G+ 
Sbjct  188  MILGSVKKYE-----EFNLKELIEELTNLAGAFNLADFVPFLGAFDLQGLKSRTRTLGEK  242

Query  176  FDEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ--FTRQHVKSVMLDILI  349
             DE LE IINDH++       Q   DFV TML  +    +P      R  +K++ +D+++
Sbjct  243  LDEALETIINDHQQ-------QKQDDFVGTMLTELNKQMNPDGDIMDRNSIKAITIDMIV  295

Query  350  ASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESL  529
             S+DTS++ +EW +SEL R P +M K ++E+ES +G  RMVEE+DL   +YL++V++E+L
Sbjct  296  GSLDTSAATLEWALSELIRHPRVMLKFQQELESVIG-KRMVEENDLPKLEYLDMVVRETL  354

Query  530  RMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNKS  706
            R+HPV PLL+P  + ED  +DG +IPK S V VNVWAIGRDP VWS+  E FFPERF  S
Sbjct  355  RLHPVAPLLVPRESMEDIVIDGCYIPKKSRVLVNVWAIGRDPNVWSNNVEDFFPERFINS  414

Query  707  SVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEE  886
            ++E  G DFE +PFGSGRR CPG +LG+  V+L++AQL+HCFDW LP GM P +L+MTE 
Sbjct  415  NIELHGHDFELIPFGSGRRVCPGKKLGLITVKLILAQLVHCFDWELPTGMSPNELDMTEN  474

Query  887  FGLSLNRAEHLMAIPTYRL  943
            FG SL R  +L A P YR+
Sbjct  475  FGSSLPRKTNLCAKPIYRM  493



>ref|XP_006493869.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=203

 Score =   298 bits (763),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  341  ILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIK  520
            +L  ++DTS +V+EW +SEL + P +MKK++ E+E+ VGL RMVEESDLE  +YL++V+K
Sbjct  1    MLAGAMDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVK  60

Query  521  ESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFN  700
            E+LR+HPV PL+ PH + EDC V+GFHIPK S V VN WAIGRDPK W+DPEKFFPERF 
Sbjct  61   ETLRLHPVAPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFI  120

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             SSV+ RG+DF+ LPFGSGRR+CPGMQL +TVV+ V AQL+HCFDW LP GMLP +L+MT
Sbjct  121  GSSVDVRGRDFQLLPFGSGRRACPGMQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMT  180

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            EEFGL   RA+HL+A+P+YRL
Sbjct  181  EEFGLVTYRAKHLLAVPSYRL  201



>ref|XP_004308347.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 213/329 (65%), Gaps = 20/329 (6%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G K DD+       K  + E        NL D+FP L  LD+QGL+RR K   K  D
Sbjct  183  MVLGCKTDDR----FDLKGILKETFLALGAFNLADFFPYLCSLDIQGLSRRFKRNSKRID  238

Query  182  EFLEKIINDHEEATS----KGKAQTTMDFVDTMLEIMKSGESPVQFT-------RQHVKS  328
              LE II DHE+A       G+     DFVD +L +M     P+ F        R ++K+
Sbjct  239  LLLETIIQDHEQANKTEMRSGQRGHDHDFVDMLLSLMNQ---PLNFDGQVHLMDRTNMKA  295

Query  329  VMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEE-SDLEHFKYL  505
            ++ D+++AS  TS+ ++ W  SEL R P +MK +++E++S +G DRMV+E +DL    YL
Sbjct  296  IIFDMIVASTHTSAVMVVWIFSELMRHPRVMKNLQQELDSVIGKDRMVQEVTDLPKLGYL  355

Query  506  EIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKF  682
             +V+KE+ R+HP  PLL PH +  D  V GF I K S + +NVW+IGRDPK+WS+  E+F
Sbjct  356  NMVVKETFRLHPAGPLLFPHESINDTTVQGFKIAKKSRILINVWSIGRDPKLWSENVEEF  415

Query  683  FPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLP  862
            +PERF  S ++ +GQDF+ +PFGSGRR CPGM+LG+T V+LVVA L HCFDW LP G+ P
Sbjct  416  YPERFLDSKIDLQGQDFQLIPFGSGRRGCPGMKLGLTTVQLVVAHLAHCFDWELPGGLQP  475

Query  863  KDLNMTEEFGLSLNRAEHLMAIPTYRLHI  949
            +DL+M+E+F +SL +A H++A PTYRLHI
Sbjct  476  QDLDMSEKFEMSLEKAVHVLAKPTYRLHI  504



>gb|AFK79030.1| cytochrome P450 CYP736A53 [Bupleurum chinense]
Length=498

 Score =   308 bits (789),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 211/320 (66%), Gaps = 12/320 (4%)
 Frame = +2

Query  5    VFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDE  184
            +FG+  DD+       K  + EA  +    N+ D+ P L   D+QGL RR K   K  DE
Sbjct  184  LFGRSKDDR----FDLKGIMTEASFLAGQFNIVDFVPFLRPFDLQGLARRYKQKSKQLDE  239

Query  185  FLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQ------FTRQHVKSVMLDIL  346
             LE II++HE+  +    +   D VD M+ + ++  S           R  +KS+++DI+
Sbjct  240  MLELIIDEHEQNLNDSH-KGNPDVVDEMILLSRNDSSKNHHELAKLLDRPSIKSIVIDII  298

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             ASI+TSS  I+W ++EL + P  MKK +EE+ S VGLDRMVEE DL   +YL +VIKE 
Sbjct  299  TASINTSSISIDWILTELMKHPTAMKKCQEELTSVVGLDRMVEEKDLPKLEYLYMVIKEG  358

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR++P+ PLL PH A+ED  ++G+HI K S + VNVWAIGRDPKVWSD  E+F PERF  
Sbjct  359  LRLYPIAPLLGPHEAKEDIMINGYHIHKKSRIIVNVWAIGRDPKVWSDNAEEFIPERFAD  418

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S ++ RG+DFE LPFGSGRR CPG+QLG+  V+LV+AQLLHCF+W LP G  P+DL+MTE
Sbjct  419  SKIDLRGRDFELLPFGSGRRGCPGIQLGVLNVQLVLAQLLHCFEWELPAGKAPEDLDMTE  478

Query  884  EFGLSLNRAEHLMAIPTYRL  943
             FGL++ R EHL  +P  R+
Sbjct  479  LFGLTIPRIEHLQLVPKIRI  498



>emb|CBI15434.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 210/308 (68%), Gaps = 12/308 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG+  D    G    K  + E  ++    NLGDYFP LG LD+QGL +R KA+ K  D
Sbjct  692  MVFGRNKD----GMIDLKTLVREGTRLAGTFNLGDYFPFLGPLDLQGLVQRFKAINKAAD  747

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDIL  346
            E LEKII+        GK     +F+D ML +M +      ES     R +VK+++LD+L
Sbjct  748  EVLEKIID--RRIQDGGKDHNHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAILLDML  805

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
            +  ID+SS+ IEW  SEL R P +M++++ E+++ V +DRMV+ESDLE+  YL +V+KE 
Sbjct  806  VGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRMVDESDLENLVYLNMVVKEV  865

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDP-EKFFPERFNK  703
            LR+HP+ P L+PHA+ ED  ++G  IPK ST+ +N WAIGRDP  WSD  ++F PERF  
Sbjct  866  LRLHPIGPFLVPHASTEDITIEGHFIPKRSTILINTWAIGRDPNFWSDNVDEFLPERFIN  925

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S+++ +G+DFE +PFGSGRR CPG+QLG+  VRLV+AQLLHCF+W LPN M   DL+M+E
Sbjct  926  SNIDLQGRDFELIPFGSGRRGCPGIQLGLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSE  985

Query  884  EFGLSLNR  907
            +FGL++ R
Sbjct  986  KFGLTMPR  993


 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 140/222 (63%), Gaps = 6/222 (3%)
 Frame = +2

Query  50   FKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSK  229
             K  I E  ++    NL DY P LG LD+QG T+ ++   +  DEFLEKII+ H +  SK
Sbjct  54   LKTLIREFTRLAGTFNLADYVPFLGPLDLQGPTQLLRTNSEAIDEFLEKIIDKHIQDVSK  113

Query  230  GKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDILIASIDTSSSVIEWTIS  394
             +    M+F+D +L +M        ES     R++VK+++LD L    DTS + IEW +S
Sbjct  114  DEVNH-MNFIDVVLSLMNKSNNYEDESLYAIDRKNVKAIILDALAGGTDTSITSIEWILS  172

Query  395  ELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAR  574
            EL R P +M++++EE+++ VG+ RMVEESDLE+  YL +V+KE+LR+HP  PLLIPH + 
Sbjct  173  ELLRHPRVMRQLQEELKNVVGMRRMVEESDLENLDYLNMVVKETLRLHPTTPLLIPHESM  232

Query  575  EDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFN  700
            ED  ++G++IPK   + +N W I RDP VWS+  +     ++
Sbjct  233  EDIVINGYYIPKKLRILINAWTIRRDPNVWSNNHEIIENTYH  274


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 78/143 (55%), Gaps = 11/143 (8%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MVFG  +D  E+ +   K  I EA  +    N+ DY P LG  D+QGLTRR +A  +  D
Sbjct  376  MVFG--HDKDEMID--LKTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAID  431

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDIL  346
            E LEKII+ H +    G     M+F+D ML +M        E      R +VK+++LDIL
Sbjct  432  EVLEKIIDKHTKDARDGVNH--MNFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDIL  489

Query  347  IASIDTSSSVIEWTISELFRQPE  415
            +  ID+S   ++W ++EL R P 
Sbjct  490  VGGIDSSLISVDWALAELLRHPR  512



>gb|ABR16640.1| unknown [Picea sitchensis]
Length=512

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/320 (47%), Positives = 214/320 (67%), Gaps = 9/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKEL-GEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M FG+KY D++L G +G  + I E+  +    N+GDY P L ++D+QGL RR K + K +
Sbjct  196  MAFGRKYSDQDLIGGEGIDSMIKESFLLAGSFNIGDYIPFLARMDLQGLNRRFKNIQKTY  255

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSGESPVQFTRQHVKSVMLDILIASI  358
            D  LEKIIN+H  A+ K K     D VD +L          + TR+++K+V+ DI +A  
Sbjct  256  DYLLEKIINEH--ASHKNKPNAIPDLVDVLLAASAVETMEFKITRENIKAVINDIFLAGT  313

Query  359  DTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKESLRMH  538
            DT+S+ IEW +SE+ R P ++KK+++E+   VG+ RMV ESDL    YL+ V+KE+ R+H
Sbjct  314  DTASTTIEWAMSEVIRNPPVLKKLQDEMGRVVGVGRMVRESDLPSLVYLQAVVKETFRLH  373

Query  539  PVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFNKSS-V  712
            P  PL IPH + EDC V G+ IP+G+ + +NVWAIGR+PK W  D E F PERF +   +
Sbjct  374  PPAPLAIPHISVEDCTVLGYEIPRGTCLLINVWAIGRNPKSWGEDAESFRPERFMEDGFL  433

Query  713  EYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTEEF-  889
            E + + FE++PFG+GRR CPG QLG+ VV   VAQL+HCF+W LPNG   ++L+MTE++ 
Sbjct  434  ESKVEKFEWIPFGAGRRGCPGQQLGMLVVEFAVAQLVHCFNWRLPNG---QELDMTEKYN  490

Query  890  GLSLNRAEHLMAIPTYRLHI  949
            G++L R   L+A+PT RL I
Sbjct  491  GITLPRDHELLAVPTLRLPI  510



>ref|XP_010537439.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=505

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 217/321 (68%), Gaps = 10/321 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+FG+  +D   G++  K  + +   IT   N+ DYFPLL  LD+QG  RR K + K  D
Sbjct  188  MIFGRGKND---GDQKLKDFVEDMSSITGAFNISDYFPLLAPLDLQGFARRTKQLRKSID  244

Query  182  EFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKSG-----ESPVQFTRQHVKSVMLDIL  346
               EKII++HE      K++   DFVD +L ++        ++     R  + +++LD++
Sbjct  245  IIFEKIIHEHEHQKDH-KSKDHKDFVDVLLSLLDQSIDSQDKNSEIIGRSEINAILLDLV  303

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             AS++TS+  I+WT SE+ + P +MKK+++E+E+++G+DRMV+ESDL    YL++VIKE 
Sbjct  304  AASLETSTKAIDWTFSEILKDPRVMKKLQKELETNIGMDRMVQESDLPKLTYLDMVIKEG  363

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR+HPV+PLL PH + ED  +DGF+IPK S V +NVW++GRDP +W D  E+F+PERF  
Sbjct  364  LRLHPVIPLLAPHESMEDVVLDGFYIPKKSRVLINVWSMGRDPDIWGDTTEEFYPERFEN  423

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
              ++ +G DF  +PFGSGRR C GM + +  +R V+AQL+H FDW +P+GM+P+D++M E
Sbjct  424  DDIDMQGLDFRLIPFGSGRRKCLGMHMAMLNLRQVLAQLVHSFDWKMPDGMIPEDIDMDE  483

Query  884  EFGLSLNRAEHLMAIPTYRLH  946
            + GL++ RA ++ A P YRL+
Sbjct  484  KQGLAVGRANNVFARPIYRLN  504



>gb|KHN20715.1| Cytochrome P450 71A1 [Glycine soja]
Length=500

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 219/321 (68%), Gaps = 14/321 (4%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            MV G+  DD+       K  + E + ++   NL DY P L   D+QGLTRR K + K  D
Sbjct  180  MVLGRNKDDR----FDLKGILVETMSVSGAFNLADYVPWLRLFDLQGLTRRSKKISKSLD  235

Query  182  EFLEKIINDHEEAT-SKGKAQTTMDFVDTMLEIMKSGESPVQ-----FTRQHVKSVMLDI  343
            + L+++I +H+ A  ++G  +   DF+D +L +      P         ++ +K ++ D+
Sbjct  236  KMLDEMIEEHQLAPPAQGHLK---DFIDILLSLKDQPIHPHDKHAPIIDKRSIKGIVFDM  292

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            +I + +TSS+VIEW ISEL R P +M+ ++ E++  VG+++MV+E+DL    YL++V+KE
Sbjct  293  IIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGINKMVDENDLAKLSYLDMVVKE  352

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR+HPVVPLL PH + ED  ++G++I K S V +N WAIGRDPKVWS + E F+PERF 
Sbjct  353  TLRLHPVVPLLAPHESMEDIVIEGYYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFM  412

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
             S+++++GQDF+ +PFGSGRRSCPG+ +G+T V+LV+ QL+HCF W LP G+ P +L+M 
Sbjct  413  NSNIDFKGQDFQLIPFGSGRRSCPGIVMGLTTVKLVLTQLVHCFKWELPCGIGPDELDMN  472

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+ GLS+ RA HL+ IPTYRL
Sbjct  473  EKSGLSMPRARHLLVIPTYRL  493



>ref|XP_003615667.1| Cytochrome P450 [Medicago truncatula]
Length=959

 Score =   318 bits (814),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 219/321 (68%), Gaps = 15/321 (5%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KY+  +L     K  I + + +    NL DY P LG  D+QGLT+  K   K  
Sbjct  641  MILGRGKYEQFDL-----KKMIKDGLTLMGAFNLADYVPWLGIFDLQGLTQACKKTSKAL  695

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE II +HE+ T+    +   DFVDT+L IM       G   +   R  +K+++LD+
Sbjct  696  DEVLEMIITEHEQTTNTDDPK---DFVDTVLSIMHQTIDVEGGQDLVIDRTIIKAILLDM  752

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            + ASIDTSS+VIEW +SEL R P +MK +++EI++ VG  RMVEE DL++F YL++V+ E
Sbjct  753  IGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRMVEEKDLKNFNYLDMVVDE  812

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEKFFPERFN  700
            +LR++PV PLLIP   RE+  +D + I + + V VN WAIGRDP VWS + E+F+PERF 
Sbjct  813  TLRLYPVAPLLIPRECRENITIDDYSIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFI  872

Query  701  KSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMT  880
            +  + Y GQ+FE +PFGSGRR CPG+QLG+  V+LV+AQ +HCF+W LP+ + P +LNM 
Sbjct  873  EKKMNYLGQEFESIPFGSGRRRCPGIQLGMITVKLVIAQFVHCFNWELPHNISPSNLNME  932

Query  881  EEFGLSLNRAEHLMAIPTYRL  943
            E+FGL++ RA+HL AIP+YRL
Sbjct  933  EKFGLTIPRAQHLHAIPSYRL  953


 Score =   281 bits (720),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 203/320 (63%), Gaps = 31/320 (10%)
 Frame = +2

Query  2    MVFGK-KYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLF  178
            M+ G+ KY+  +L     K  + E + +    NL DY P LG  D+QGLT+  K V K  
Sbjct  191  MILGRGKYEQFDL-----KKLVQEGLALIGAFNLADYVPWLGIFDLQGLTKSCKKVSKAI  245

Query  179  DEFLEKIINDHEEATSKGKAQTTMDFVDTMLEIMKS-----GESPVQFTRQHVKSVMLDI  343
            DE LE I+ +HE+A +  K     DFVD +L IM       GE  +   R ++K+++LD+
Sbjct  246  DEQLEVILTEHEQAANVNKTHHK-DFVDILLSIMHQTIDVEGEQNLVIDRTNIKAILLDM  304

Query  344  LIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKE  523
            ++A+IDTS++ IEW +SEL R P +MKK+++EI++ VG  R +EE D++   YL++V+ E
Sbjct  305  IVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRKIEEKDMKKLNYLDMVVDE  364

Query  524  SLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSDPEKFFPERFNK  703
            +LR++PV PLL+P  +RE   +DG+ I + + + VN WAIGRDP VWS            
Sbjct  365  TLRLYPVAPLLVPRESRESTIIDGYFIKEKTRLIVNAWAIGRDPNVWS------------  412

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
                   ++FE +PFGS RR CPG+QLG+  ++LV+AQ +HCF+W LP+ +    LNM E
Sbjct  413  -------ENFESIPFGSSRRRCPGIQLGLITIKLVIAQFVHCFNWELPHNISSSSLNMEE  465

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +FGL++ R +HL AIP+YRL
Sbjct  466  KFGLTIPRTQHLHAIPSYRL  485



>gb|KEH27058.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   306 bits (785),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 217/320 (68%), Gaps = 10/320 (3%)
 Frame = +2

Query  2    MVFGKKYDDKELGEKGFKAAIHEAVKITALPNLGDYFPLLGKLDVQGLTRRMKAVGKLFD  181
            M+ G+  DD+       K  +H+A+ +T   NL DY P L   D+QG+ R++K   K +D
Sbjct  191  MILGRSKDDRF----DLKGIVHKAMLLTGKFNLSDYLPWLRPFDLQGIERQIKKTWKQYD  246

Query  182  EFLEKIINDHE-EATSKGKAQTTMDFVDTMLEIMK----SGESPVQFTRQHVKSVMLDIL  346
            E LE+II + E ++  + K     DFVD +L +M     S ++     R ++K++++D++
Sbjct  247  ELLEQIIKERENQSIEEQKGHNNKDFVDILLSLMNQSIDSKDNKYDIDRTNIKAILIDMI  306

Query  347  IASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKYLEIVIKES  526
             A++DT+S VI+W +S+L + P  MKK+++E+E+ VG++R VEE+ L    YL +V+KE+
Sbjct  307  SAALDTTSVVIDWVLSQLLKHPYAMKKLQQELENVVGMNRQVEETHLAKLPYLTMVVKET  366

Query  527  LRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWSD-PEKFFPERFNK  703
            LR+ PV PLL+PH   ED  VDG++I K + + +N W IGRD  VWSD  E F+PERF  
Sbjct  367  LRLCPVGPLLVPHECLEDVVVDGYYIKKKTRILINAWTIGRDTNVWSDNAETFYPERFED  426

Query  704  SSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGMLPKDLNMTE  883
            S V+ RG DF+ +PFG GRRSCPG+Q+G+T V+LVVAQL+HCF+W LP+ M   +L+M+E
Sbjct  427  SDVDIRGHDFQLIPFGFGRRSCPGIQMGLTSVKLVVAQLMHCFNWELPDAMSKDELDMSE  486

Query  884  EFGLSLNRAEHLMAIPTYRL  943
            +F LS+ R + L+A+PTYRL
Sbjct  487  KFELSMPRCQPLLAMPTYRL  506



>gb|KHN32025.1| Cytochrome P450 71A1, partial [Glycine soja]
Length=689

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/287 (51%), Positives = 203/287 (71%), Gaps = 7/287 (2%)
 Frame = +2

Query  104  DYFPLLGKLDVQGLTRRMKAVGKLFDEFLEKIINDHEEATSK-GKAQTTMDFVDTMLEIM  280
            D   L+  L  QG+ RR+K V K FD  LE+II DHE+++ +  K Q   D V+  L +M
Sbjct  1    DIMCLIQSLAHQGIVRRLKKVSKSFDVVLEQIIKDHEQSSDREQKGQRQKDLVNIFLALM  60

Query  281  KSGESPVQ-----FTRQHVKSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIE  445
                 P         R ++K++M+ +++A+IDTS++ IEW +SEL + P +MKK+++E+E
Sbjct  61   HQPLDPQDEHGHVLDRTNIKAIMMTMIVAAIDTSATTIEWAMSELLKHPSVMKKLQDELE  120

Query  446  SHVGLDRMVEESDLEHFKYLEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVT  625
               G++R VEESD+E F YL++V+KE+LR++PV PLLIP   RED  +DG+ I K S + 
Sbjct  121  CVEGMNRKVEESDMEKFPYLDLVVKETLRLYPVAPLLIPRECREDVTIDGYCIKKKSRII  180

Query  626  VNVWAIGRDPKVWSD-PEKFFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVR  802
            VN WAIGRDPKVWSD  E F+PERF  S+V+ RG DF  LPFGSGRR CPG+ L +T V+
Sbjct  181  VNAWAIGRDPKVWSDNAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGCPGIHLDLTTVK  240

Query  803  LVVAQLLHCFDWNLPNGMLPKDLNMTEEFGLSLNRAEHLMAIPTYRL  943
            +V+AQL+HCF+W LP GM P DL+MTE+FGL++ R+ HL+A+PT RL
Sbjct  241  IVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSNHLLAVPTCRL  287


 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 160/208 (77%), Gaps = 1/208 (0%)
 Frame = +2

Query  323  KSVMLDILIASIDTSSSVIEWTISELFRQPEIMKKVKEEIESHVGLDRMVEESDLEHFKY  502
            K ++ D++I S +TSS VIEW ISEL R P +M+ ++ E+++ VG+++MVEE+DL    Y
Sbjct  482  KGIVFDMIIGSSETSSDVIEWAISELVRHPRVMENLQNELKNVVGINKMVEENDLAKLCY  541

Query  503  LEIVIKESLRMHPVVPLLIPHAAREDCEVDGFHIPKGSTVTVNVWAIGRDPKVWS-DPEK  679
            L++V+KE+LR++PVVPLL PH + E   ++G+++ K S V +N WAIGR PKVWS + E 
Sbjct  542  LDMVVKETLRLYPVVPLLAPHESMEAIVIEGYYMKKKSRVIINAWAIGRHPKVWSENAEV  601

Query  680  FFPERFNKSSVEYRGQDFEFLPFGSGRRSCPGMQLGITVVRLVVAQLLHCFDWNLPNGML  859
            F+PERF   +V+++GQDF+ +PFGSGRRSCPGM +G+T+V+LV+AQL++CF W LP G+ 
Sbjct  602  FYPERFMNDNVDFKGQDFQLIPFGSGRRSCPGMVMGLTIVKLVLAQLVYCFHWGLPYGID  661

Query  860  PKDLNMTEEFGLSLNRAEHLMAIPTYRL  943
            P +L+M E+ GLS+ RA HL+ I  +++
Sbjct  662  PDELDMNEKSGLSMPRARHLLVIQWWQV  689



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2472781746720