BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22555_g2_i1 len=1182 path=[4167:0-328 4496:329-366 15394:367-611
10895:612-622 10906:623-650 16981:651-651 2584:652-673 2606:674-710
2643:711-792 2725:793-816 2749:817-1055 2988:1056-1181]

Length=1182
                                                                      Score     E

ref|XP_006350184.1|  PREDICTED: villin-2-like                           611   0.0      
ref|XP_009620592.1|  PREDICTED: villin-3-like                           610   0.0      
ref|XP_004236608.1|  PREDICTED: villin-2                                608   0.0      
ref|XP_009799721.1|  PREDICTED: villin-3-like                           608   0.0      
ref|XP_006351312.1|  PREDICTED: villin-2-like                           605   0.0      
ref|XP_011078908.1|  PREDICTED: villin-3-like                           605   0.0      
ref|XP_010496943.1|  PREDICTED: villin-2-like                           585   0.0      
ref|XP_004249261.1|  PREDICTED: villin-2-like                           604   0.0      
ref|XP_009767117.1|  PREDICTED: villin-2-like                           604   0.0      
ref|XP_009624540.1|  PREDICTED: villin-2                                603   0.0      
emb|CDP14114.1|  unnamed protein product                                603   0.0      
ref|XP_006351385.1|  PREDICTED: villin-2-like                           600   0.0      
ref|XP_006411441.1|  hypothetical protein EUTSA_v10016183mg             600   0.0      
ref|XP_006381007.1|  hypothetical protein POPTR_0006s04870g             591   0.0      
ref|XP_011075326.1|  PREDICTED: villin-2-like                           593   0.0      
ref|XP_002308941.2|  Villin 2 family protein                            593   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP26061.1|  hypothetical protein JCGZ_21094                         594   0.0      
gb|EPS59596.1|  hypothetical protein M569_15209                         578   0.0      
emb|CAN70540.1|  hypothetical protein VITISV_034183                     583   0.0      Vitis vinifera
ref|XP_010505982.1|  PREDICTED: villin-2                                593   0.0      
ref|XP_010653770.1|  PREDICTED: villin-2                                592   0.0      
ref|XP_009133510.1|  PREDICTED: villin-2-like                           591   0.0      
gb|KDO49840.1|  hypothetical protein CISIN_1g002006mg                   590   0.0      
ref|XP_007204293.1|  hypothetical protein PRUPE_ppa000858mg             590   0.0      
ref|XP_007204294.1|  hypothetical protein PRUPE_ppa000858mg             590   0.0      
gb|KDO49841.1|  hypothetical protein CISIN_1g002006mg                   590   0.0      
gb|EYU18732.1|  hypothetical protein MIMGU_mgv1a000936mg                588   0.0      
ref|XP_011048056.1|  PREDICTED: villin-3-like isoform X1                589   0.0      
ref|XP_011048059.1|  PREDICTED: villin-3-like isoform X2                589   0.0      
ref|XP_010508658.1|  PREDICTED: villin-2-like                           587   0.0      
ref|XP_008443130.1|  PREDICTED: villin-3                                587   0.0      
ref|XP_006489971.1|  PREDICTED: villin-3-like isoform X1                586   0.0      
ref|XP_009142774.1|  PREDICTED: villin-2                                586   0.0      
emb|CDX79917.1|  BnaA05g02390D                                          585   0.0      
emb|CDY23826.1|  BnaC04g02110D                                          585   0.0      
ref|NP_565958.1|  villin 2                                              585   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554829.1|  PREDICTED: villin-3 isoform X1                     584   0.0      
ref|XP_010554831.1|  PREDICTED: villin-3 isoform X2                     584   0.0      
ref|XP_006295976.1|  hypothetical protein CARUB_v10025119mg             584   0.0      
ref|XP_010545843.1|  PREDICTED: villin-3-like                           584   0.0      
ref|XP_008222112.1|  PREDICTED: villin-3-like isoform X1                584   0.0      
ref|XP_008222114.1|  PREDICTED: villin-2-like isoform X2                583   0.0      
ref|XP_010672856.1|  PREDICTED: villin-2 isoform X2                     582   0.0      
gb|AAC31606.1|  villin 2                                                582   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672854.1|  PREDICTED: villin-3 isoform X1                     582   0.0      
ref|XP_002881794.1|  hypothetical protein ARALYDRAFT_483257             583   0.0      
ref|XP_002322720.1|  Villin 2 family protein                            582   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006575257.1|  PREDICTED: villin-3-like isoform X5                578   0.0      
ref|XP_007145600.1|  hypothetical protein PHAVU_007G252400g             581   0.0      
ref|XP_004136595.1|  PREDICTED: villin-2-like                           580   0.0      
gb|KCW48056.1|  hypothetical protein EUGRSUZ_K01803                     561   0.0      
ref|XP_008387300.1|  PREDICTED: villin-3-like                           579   0.0      
gb|AES81363.2|  villin                                                  579   0.0      
ref|XP_011033340.1|  PREDICTED: villin-3-like isoform X1                578   0.0      
ref|XP_011033341.1|  PREDICTED: villin-3-like isoform X2                578   0.0      
ref|XP_006575253.1|  PREDICTED: villin-3-like isoform X1                578   0.0      
ref|XP_004493486.1|  PREDICTED: villin-2-like isoform X1                578   0.0      
ref|XP_004493490.1|  PREDICTED: villin-2-like isoform X5                578   0.0      
ref|XP_006575256.1|  PREDICTED: villin-3-like isoform X4                577   0.0      
ref|XP_007162188.1|  hypothetical protein PHAVU_001G131700g             576   0.0      
ref|XP_004513861.1|  PREDICTED: villin-3-like                           575   0.0      
emb|CAB66098.1|  villin 3 fragment                                      561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878148.1|  hypothetical protein ARALYDRAFT_486186             574   0.0      
ref|XP_003521173.1|  PREDICTED: villin-2-like isoform X1                574   0.0      
gb|AAM13051.1|  unknown protein                                         561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427613.1|  PREDICTED: villin-3-like                           572   0.0      
ref|XP_010504669.1|  PREDICTED: villin-3                                571   0.0      
ref|XP_010269772.1|  PREDICTED: villin-2                                570   0.0      
ref|XP_009419900.1|  PREDICTED: villin-3-like                           570   0.0      
ref|XP_007028722.1|  Villin 2 isoform 2                                 569   0.0      
ref|XP_010246733.1|  PREDICTED: villin-2-like                           568   0.0      
ref|XP_010516356.1|  PREDICTED: villin-3-like isoform X1                570   0.0      
ref|XP_010516357.1|  PREDICTED: villin-3-like isoform X2                569   0.0      
ref|XP_007028721.1|  Villin 2 isoform 1                                 570   0.0      
ref|XP_003554172.1|  PREDICTED: villin-3-like isoform X1                569   0.0      
ref|XP_006589014.1|  PREDICTED: villin-3-like isoform X4                567   0.0      
ref|XP_003535925.1|  PREDICTED: villin-3-like isoformX1                 567   0.0      
ref|XP_008367397.1|  PREDICTED: villin-3-like isoform X2                566   0.0      
ref|XP_008367394.1|  PREDICTED: villin-3-like isoform X1                565   0.0      
ref|XP_010036436.1|  PREDICTED: villin-3-like isoform X2                565   0.0      
ref|XP_006421372.1|  hypothetical protein CICLE_v10006928mg             564   0.0      
ref|XP_010036435.1|  PREDICTED: villin-3-like isoform X1                565   0.0      
ref|XP_008790943.1|  PREDICTED: villin-3-like                           564   0.0      
ref|XP_009355490.1|  PREDICTED: villin-3-like                           563   0.0      
ref|NP_567048.1|  villin 3                                              563   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAC31607.1|  villin 3                                                563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304349.1|  PREDICTED: villin-2-like                           563   0.0      
ref|XP_010931980.1|  PREDICTED: villin-2-like                           561   0.0      
ref|XP_006292629.1|  hypothetical protein CARUB_v10018871mg             563   0.0      
tpg|DAA55799.1|  TPA: hypothetical protein ZEAMMB73_503572              551   0.0      
ref|XP_008786911.1|  PREDICTED: villin-2-like isoform X2                561   0.0      
ref|XP_010036453.1|  PREDICTED: villin-3-like isoform X2                562   0.0      
ref|XP_009391537.1|  PREDICTED: villin-2-like                           560   0.0      
ref|XP_009414165.1|  PREDICTED: villin-2-like                           560   0.0      
gb|AAD54660.1|AF088901_1  actin bundling protein ABP135                 560   0.0      Lilium longiflorum [Easter lily]
ref|XP_010036452.1|  PREDICTED: villin-3-like isoform X1                562   0.0      
ref|XP_006402881.1|  hypothetical protein EUTSA_v10005772mg             560   0.0      
ref|XP_003565080.1|  PREDICTED: villin-3-like                           558   0.0      
ref|XP_010922147.1|  PREDICTED: villin-2-like                           558   0.0      
emb|CDX72038.1|  BnaC08g28360D                                          556   0.0      
ref|XP_008802634.1|  PREDICTED: villin-2-like isoform X1                555   0.0      
emb|CDY06107.1|  BnaA09g36730D                                          555   0.0      
ref|XP_010057051.1|  PREDICTED: villin-2-like isoform X2                553   0.0      
ref|XP_004167476.1|  PREDICTED: villin-2-like                           547   0.0      
ref|XP_009116444.1|  PREDICTED: villin-3                                553   0.0      
ref|XP_010938536.1|  PREDICTED: villin-2-like                           553   0.0      
ref|XP_010057040.1|  PREDICTED: villin-3-like isoform X1                553   0.0      
gb|AFW83947.1|  hypothetical protein ZEAMMB73_866328                    553   0.0      
ref|NP_001146280.1|  uncharacterized protein LOC100279855               553   0.0      Zea mays [maize]
ref|XP_002456939.1|  hypothetical protein SORBIDRAFT_03g045970          553   0.0      Sorghum bicolor [broomcorn]
ref|XP_010312403.1|  PREDICTED: villin-2-like                           549   0.0      
ref|XP_008460777.1|  PREDICTED: villin-2-like                           550   0.0      
ref|XP_006650096.1|  PREDICTED: villin-3-like                           550   0.0      
ref|XP_004971280.1|  PREDICTED: villin-2-like                           550   0.0      
emb|CDM86551.1|  unnamed protein product                                550   0.0      
ref|XP_008672462.1|  PREDICTED: uncharacterized protein LOC100273...    550   0.0      
ref|XP_004149401.1|  PREDICTED: villin-2-like                           547   0.0      
ref|XP_010228602.1|  PREDICTED: villin-2-like                           547   0.0      
ref|NP_001050140.1|  Os03g0356700                                       546   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABF96040.1|  Villin-3, putative, expressed                           546   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHG05180.1|  Villin-2 -like protein                                  527   0.0      
gb|KHN07369.1|  Villin-2                                                543   0.0      
ref|XP_009400158.1|  PREDICTED: villin-3-like                           541   0.0      
ref|XP_004984323.1|  PREDICTED: villin-3-like                           541   0.0      
gb|ABR16365.1|  unknown                                                 529   0.0      Picea sitchensis
ref|XP_008660141.1|  PREDICTED: villin-3-like                           539   1e-180   
gb|KHN14972.1|  Villin-2                                                540   2e-180   
ref|XP_008786910.1|  PREDICTED: villin-2-like isoform X1                539   8e-180   
ref|XP_008655853.1|  PREDICTED: villin-3-like                           536   2e-179   
tpg|DAA45442.1|  TPA: hypothetical protein ZEAMMB73_935992              536   3e-179   
ref|XP_009382600.1|  PREDICTED: villin-3-like                           537   8e-179   
ref|XP_002467837.1|  hypothetical protein SORBIDRAFT_01g034950          533   3e-178   Sorghum bicolor [broomcorn]
emb|CDY22538.1|  BnaC03g23480D                                          529   1e-176   
emb|CDY35401.1|  BnaA03g19590D                                          524   1e-174   
gb|KDO49845.1|  hypothetical protein CISIN_1g002006mg                   520   6e-173   
gb|EPS70251.1|  hypothetical protein M569_04508                         516   9e-172   
gb|EMS56739.1|  Villin-2                                                518   4e-171   
ref|XP_006851110.1|  hypothetical protein AMTR_s00025p00248490          489   3e-161   
ref|XP_006600494.1|  PREDICTED: villin-4-like                           485   2e-159   
ref|XP_006593529.1|  PREDICTED: villin-4-like isoform X1                483   1e-158   
ref|XP_007154736.1|  hypothetical protein PHAVU_003G143200g             483   2e-158   
ref|XP_003610075.1|  Villin-4                                           482   3e-158   
ref|XP_011069945.1|  PREDICTED: villin-4-like                           482   3e-158   
gb|AES92272.2|  actin filament bundling protein P-115-ABP               482   3e-158   
ref|XP_004507882.1|  PREDICTED: villin-4-like isoform X3                479   5e-157   
ref|XP_004507880.1|  PREDICTED: villin-4-like isoform X1                479   6e-157   
gb|EMT05627.1|  Villin-2                                                468   1e-156   
ref|XP_004163020.1|  PREDICTED: LOW QUALITY PROTEIN: villin-4-like      478   2e-156   
ref|XP_009345234.1|  PREDICTED: villin-4-like                           470   3e-156   
gb|KGN61158.1|  hypothetical protein Csa_2G060390                       477   5e-156   
ref|XP_008460295.1|  PREDICTED: villin-4-like                           475   6e-156   
ref|XP_008801549.1|  PREDICTED: villin-4-like                           476   6e-156   
ref|XP_004148322.1|  PREDICTED: villin-4-like                           476   7e-156   
ref|XP_010265407.1|  PREDICTED: villin-4-like isoform X2                476   7e-156   
ref|XP_010265408.1|  PREDICTED: villin-4-like isoform X3                476   8e-156   
ref|XP_008372288.1|  PREDICTED: villin-4-like                           465   8e-156   
ref|XP_010265402.1|  PREDICTED: villin-4-like isoform X1                476   9e-156   
ref|XP_001781287.1|  predicted protein                                  474   1e-155   
ref|XP_009358744.1|  PREDICTED: villin-4                                473   1e-154   
gb|KHN22680.1|  Villin-4                                                470   5e-154   
gb|KHN17615.1|  Villin-4                                                469   5e-154   
ref|XP_010545398.1|  PREDICTED: villin-5 isoform X1                     470   1e-153   
ref|XP_010545405.1|  PREDICTED: villin-5 isoform X2                     470   1e-153   
ref|XP_004296465.1|  PREDICTED: villin-4-like                           470   1e-153   
ref|XP_008340592.1|  PREDICTED: villin-4                                470   2e-153   
gb|AFW83946.1|  hypothetical protein ZEAMMB73_866328                    469   2e-153   
ref|XP_002979365.1|  hypothetical protein SELMODRAFT_177604             467   4e-153   
emb|CAB43851.1|  putative villin, fragment                              454   7e-153   Arabidopsis thaliana [mouse-ear cress]
gb|AFW87618.1|  hypothetical protein ZEAMMB73_119984                    451   1e-152   
ref|XP_008659878.1|  PREDICTED: villin-4-like isoform X2                451   2e-152   
ref|XP_008659877.1|  PREDICTED: villin-4-like isoform X1                451   2e-152   
ref|XP_008453585.1|  PREDICTED: LOW QUALITY PROTEIN: villin-4           466   5e-152   
ref|XP_010451986.1|  PREDICTED: villin-5                                465   1e-151   
ref|XP_008223740.1|  PREDICTED: villin-4                                465   1e-151   
ref|XP_002990339.1|  hypothetical protein SELMODRAFT_235997             464   1e-151   
gb|EAZ26972.1|  hypothetical protein OsJ_10899                          465   3e-151   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75286.1|  hypothetical protein OsI_11627                          465   4e-151   Oryza sativa Indica Group [Indian rice]
ref|XP_007225365.1|  hypothetical protein PRUPE_ppa000861mg             464   4e-151   
ref|XP_004161789.1|  PREDICTED: LOW QUALITY PROTEIN: villin-4-like      463   6e-151   
ref|XP_004146329.1|  PREDICTED: villin-4-like                           463   7e-151   
ref|XP_008789645.1|  PREDICTED: villin-4-like                           462   2e-150   
ref|XP_010656852.1|  PREDICTED: villin-4                                461   6e-150   
ref|XP_006381776.1|  hypothetical protein POPTR_0006s17890g             453   3e-149   
gb|AFW88338.1|  hypothetical protein ZEAMMB73_487687                    459   2e-148   
ref|XP_001768101.1|  predicted protein                                  456   2e-148   
ref|XP_010443416.1|  PREDICTED: villin-5 isoform X4                     456   2e-148   
ref|XP_010443415.1|  PREDICTED: villin-5 isoform X3                     456   2e-148   
ref|XP_010483241.1|  PREDICTED: villin-5-like isoform X2                456   3e-148   
ref|XP_006412744.1|  hypothetical protein EUTSA_v10024322mg             456   4e-148   
ref|XP_006586987.1|  PREDICTED: villin-4-like                           456   4e-148   
ref|XP_010483240.1|  PREDICTED: villin-5-like isoform X1                456   4e-148   
ref|XP_010447761.1|  PREDICTED: villin-4-like                           456   4e-148   
ref|XP_010438211.1|  PREDICTED: villin-4                                456   5e-148   
gb|KDP35406.1|  hypothetical protein JCGZ_10390                         456   7e-148   
ref|XP_010525718.1|  PREDICTED: villin-4                                455   9e-148   
emb|CDY42253.1|  BnaC02g11620D                                          439   1e-147   
ref|XP_007138797.1|  hypothetical protein PHAVU_009G238200g             455   1e-147   
ref|XP_009109002.1|  PREDICTED: villin-4-like                           455   1e-147   
ref|XP_003546420.1|  PREDICTED: villin-4-like isoform 1                 455   1e-147   
gb|EPS57833.1|  hypothetical protein M569_16984                         439   1e-147   
ref|XP_002438788.1|  hypothetical protein SORBIDRAFT_10g026230          454   1e-147   Sorghum bicolor [broomcorn]
dbj|BAK02464.1|  predicted protein                                      456   2e-147   
ref|NP_194745.1|  villin 4                                              454   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137891.1|  PREDICTED: villin-4-like                           454   2e-147   
ref|XP_010927065.1|  PREDICTED: villin-4-like                           454   2e-147   
ref|XP_010913698.1|  PREDICTED: villin-4-like                           454   3e-147   
ref|XP_006401217.1|  hypothetical protein EUTSA_v10012571mg             454   4e-147   
ref|XP_006285670.1|  hypothetical protein CARUB_v10007127mg             454   4e-147   
ref|NP_001190869.1|  villin 4                                           454   4e-147   
ref|XP_009418552.1|  PREDICTED: villin-4-like                           453   4e-147   
ref|XP_009414812.1|  PREDICTED: villin-4-like isoform X1                454   4e-147   
ref|XP_006282227.1|  hypothetical protein CARUB_v10028500mg             454   5e-147   
gb|ABK35296.1|  actin-binding protein ABP29                             429   7e-147   Lilium longiflorum [Easter lily]
ref|XP_009414821.1|  PREDICTED: villin-4-like isoform X2                452   8e-147   
ref|XP_010433022.1|  PREDICTED: villin-4-like                           452   1e-146   
ref|XP_006845710.1|  hypothetical protein AMTR_s00019p00240770          452   1e-146   
ref|XP_009120257.1|  PREDICTED: villin-4-like                           452   2e-146   
ref|XP_008781818.1|  PREDICTED: villin-4-like                           451   2e-146   
ref|XP_010046961.1|  PREDICTED: villin-4                                451   2e-146   
gb|KCW78680.1|  hypothetical protein EUGRSUZ_C00137                     451   3e-146   
ref|XP_011012988.1|  PREDICTED: villin-4-like                           451   3e-146   
emb|CDY03547.1|  BnaC03g68060D                                          451   4e-146   
emb|CDM87042.1|  unnamed protein product                                452   4e-146   
ref|XP_009128035.1|  PREDICTED: villin-4                                450   9e-146   
gb|KFK29570.1|  villin 4                                                449   1e-145   
ref|XP_004487964.1|  PREDICTED: villin-4-like                           449   1e-145   
ref|NP_200542.1|  putative villin                                       449   2e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KDO61844.1|  hypothetical protein CISIN_1g037000mg                   448   4e-145   
ref|XP_006656321.1|  PREDICTED: villin-4-like isoform X1                447   8e-145   
emb|CDY51644.1|  BnaAnng10840D                                          447   1e-144   
emb|CDY14188.1|  BnaA08g13190D                                          447   1e-144   
ref|XP_007014318.1|  Villin 4 isoform 4                                 446   1e-144   
ref|XP_007014316.1|  Villin 4 isoform 2                                 446   2e-144   
ref|XP_011079274.1|  PREDICTED: villin-4-like                           446   3e-144   
emb|CDY62397.1|  BnaC07g50870D                                          446   3e-144   
ref|XP_006453314.1|  hypothetical protein CICLE_v10007360mg             445   6e-144   
gb|KHG28533.1|  Villin-4 -like protein                                  445   8e-144   
gb|EEE66162.1|  hypothetical protein OsJ_22231                          445   2e-143   Oryza sativa Japonica Group [Japonica rice]
gb|KCW48016.1|  hypothetical protein EUGRSUZ_K017494                    420   2e-143   
ref|XP_011043930.1|  PREDICTED: villin-4-like                           443   2e-143   
ref|XP_010240180.1|  PREDICTED: villin-4-like isoform X2                444   3e-143   
ref|XP_002864511.1|  hypothetical protein ARALYDRAFT_495830             444   3e-143   
ref|XP_003560396.1|  PREDICTED: villin-4-like isoform X1                444   3e-143   
gb|AES65225.2|  actin filament bundling protein P-115-ABP               443   3e-143   
emb|CDY38289.1|  BnaA10g11370D                                          443   3e-143   
ref|NP_001058263.1|  Os06g0659300                                       444   4e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460813.1|  hypothetical protein SORBIDRAFT_02g035390          441   6e-143   Sorghum bicolor [broomcorn]
emb|CDY28164.1|  BnaA01g06850D                                          442   1e-142   
emb|CDX68632.1|  BnaC01g08210D                                          442   1e-142   
ref|XP_010240183.1|  PREDICTED: villin-4-like isoform X3                442   2e-142   
gb|EYU20753.1|  hypothetical protein MIMGU_mgv1a001028mg                440   2e-142   
ref|XP_010443412.1|  PREDICTED: villin-5 isoform X1                     442   2e-142   
ref|XP_009790195.1|  PREDICTED: villin-4-like                           441   3e-142   
ref|XP_009624205.1|  PREDICTED: villin-4-like                           441   3e-142   
ref|XP_010526358.1|  PREDICTED: villin-4-like                           441   3e-142   
ref|XP_010443414.1|  PREDICTED: villin-5 isoform X2                     441   3e-142   
ref|XP_009400156.1|  PREDICTED: villin-3-like                           418   3e-142   
dbj|BAJ99758.1|  predicted protein                                      440   3e-142   
emb|CDY47936.1|  BnaA02g08200D                                          440   4e-142   
emb|CDY25919.1|  BnaC09g32910D                                          440   5e-142   
ref|XP_001755877.1|  predicted protein                                  439   6e-142   
ref|XP_009403310.1|  PREDICTED: villin-4-like                           439   7e-142   
ref|XP_004231539.1|  PREDICTED: villin-4                                440   8e-142   
ref|XP_006361544.1|  PREDICTED: villin-4-like                           439   2e-141   
dbj|BAC77209.1|  actin filament bundling protein P-115-ABP              437   5e-141   Lilium longiflorum [Easter lily]
ref|XP_003580415.1|  PREDICTED: villin-4-like                           437   5e-141   
emb|CDP03021.1|  unnamed protein product                                436   1e-140   
ref|XP_002869393.1|  hypothetical protein ARALYDRAFT_491737             436   3e-140   
ref|XP_009126847.1|  PREDICTED: villin-4-like                           434   7e-140   
ref|XP_010688446.1|  PREDICTED: villin-4                                433   2e-139   
gb|KHN35788.1|  Villin-4                                                432   3e-139   
ref|XP_010928694.1|  PREDICTED: villin-4-like isoform X1                431   1e-138   
ref|XP_010928695.1|  PREDICTED: villin-4-like isoform X2                431   1e-138   
ref|XP_003594974.1|  Villin-4                                           431   2e-138   
ref|XP_010094189.1|  hypothetical protein L484_016732                   431   3e-138   
gb|KHN15316.1|  Villin-4                                                430   3e-138   
emb|CAD41877.2|  OSJNBa0041A02.24                                       429   4e-138   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66716.1|  OSIGBa0118P15.6                                        429   4e-138   Oryza sativa [red rice]
ref|NP_001053784.1|  Os04g0604000                                       429   5e-138   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77939.1|  hypothetical protein OsI_17280                          429   5e-138   
ref|XP_006372075.1|  hypothetical protein POPTR_0018s09690g             429   9e-138   
gb|EYU20891.1|  hypothetical protein MIMGU_mgv1a000827mg                429   1e-137   
ref|XP_007014315.1|  Villin 4 isoform 1                                 430   1e-137   
ref|XP_006659234.1|  PREDICTED: villin-4-like isoform X2                428   1e-137   
ref|NP_001061335.1|  Os08g0240800                                       428   1e-137   
ref|XP_006659233.1|  PREDICTED: villin-4-like isoform X1                428   2e-137   
ref|XP_002324461.1|  Villin 4 family protein                            428   2e-137   
gb|EYU37298.1|  hypothetical protein MIMGU_mgv1a000766mg                429   3e-137   
ref|XP_010234504.1|  PREDICTED: villin-4-like                           427   3e-137   
ref|XP_006652771.1|  PREDICTED: villin-4-like                           427   5e-137   
ref|XP_004976710.1|  PREDICTED: villin-4-like                           427   1e-136   
ref|XP_008668936.1|  PREDICTED: villin-4-like                           425   2e-136   
ref|XP_003625145.1|  Villin-2                                           429   3e-136   
gb|EEC81116.1|  hypothetical protein OsI_23984                          424   6e-136   
gb|EPS72001.1|  hypothetical protein M569_02755                         421   9e-135   
ref|XP_004964782.1|  PREDICTED: villin-4-like                           419   7e-134   
gb|EMS62507.1|  Villin-4                                                417   4e-133   
ref|XP_008668402.1|  PREDICTED: uncharacterized protein LOC100383...    414   5e-132   
ref|XP_008668401.1|  PREDICTED: uncharacterized protein LOC100383...    414   6e-132   
gb|EMS53936.1|  Villin-4                                                411   6e-131   
ref|XP_002448472.1|  hypothetical protein SORBIDRAFT_06g027650          409   3e-130   
gb|EMT04048.1|  Villin-4                                                406   5e-129   
gb|EEC83154.1|  hypothetical protein OsI_28366                          404   6e-128   
gb|ABF96039.1|  Villin-3, putative, expressed                           400   1e-127   
gb|EEE68295.1|  hypothetical protein OsJ_26546                          403   2e-127   
gb|EMT14415.1|  Villin-4                                                403   3e-127   
dbj|BAD05388.1|  putative villin                                        396   1e-125   
tpg|DAA36156.1|  TPA: hypothetical protein ZEAMMB73_799395              396   5e-125   
ref|XP_010088411.1|  hypothetical protein L484_009344                   379   6e-125   
gb|EMT21478.1|  Villin-4                                                393   1e-123   
emb|CDX88616.1|  BnaA03g10330D                                          372   2e-116   
emb|CDY11874.1|  BnaC03g13000D                                          363   3e-113   
ref|XP_010923066.1|  PREDICTED: villin-1 isoform X3                     362   8e-113   
gb|KDP46507.1|  hypothetical protein JCGZ_08479                         354   2e-112   
ref|XP_010923064.1|  PREDICTED: villin-1 isoform X1                     362   2e-112   
ref|XP_006848187.1|  hypothetical protein AMTR_s00029p00238270          359   2e-111   
ref|XP_010256571.1|  PREDICTED: villin-1 isoform X4                     352   5e-110   
ref|XP_010256570.1|  PREDICTED: villin-1 isoform X3                     351   5e-110   
ref|XP_010256568.1|  PREDICTED: villin-1 isoform X2                     350   4e-108   
ref|XP_010256566.1|  PREDICTED: villin-1 isoform X1                     350   5e-108   
gb|KDO66867.1|  hypothetical protein CISIN_1g002853mg                   343   4e-107   
ref|XP_008464046.1|  PREDICTED: villin-1                                347   8e-107   
ref|XP_008785366.1|  PREDICTED: villin-1 isoform X2                     346   9e-107   
ref|XP_010650913.1|  PREDICTED: villin-1 isoform X3                     346   9e-107   
ref|XP_010650910.1|  PREDICTED: villin-1 isoform X1                     346   1e-106   
gb|KDO66866.1|  hypothetical protein CISIN_1g002853mg                   344   3e-106   
ref|XP_004143215.1|  PREDICTED: villin-1-like                           344   9e-106   
ref|XP_006425053.1|  hypothetical protein CICLE_v10027779mg             343   1e-105   
ref|XP_007016120.1|  Villin-like 1                                      343   2e-105   
ref|XP_006488502.1|  PREDICTED: villin-1-like                           342   3e-105   
gb|KEH34240.1|  actin filament bundling protein P-115-ABP               338   3e-105   
ref|XP_002525631.1|  villin 1-4, putative                               342   4e-105   
ref|XP_010104639.1|  hypothetical protein L484_022016                   342   5e-105   
gb|KEH34239.1|  actin filament bundling protein P-115-ABP               338   2e-104   
gb|KEH34238.1|  actin filament bundling protein P-115-ABP               339   5e-104   
ref|XP_010521943.1|  PREDICTED: villin-1 isoform X2                     338   7e-104   
ref|XP_010521941.1|  PREDICTED: villin-1 isoform X1                     338   7e-104   
ref|XP_008220688.1|  PREDICTED: villin-1                                337   3e-103   
ref|XP_007208368.1|  hypothetical protein PRUPE_ppa001117mg             336   9e-103   
ref|XP_002314108.1|  hypothetical protein POPTR_0009s04960g             336   1e-102   
ref|XP_011032129.1|  PREDICTED: villin-1-like isoform X2                335   1e-102   
dbj|BAH56756.1|  AT2G29890                                              320   2e-102   
ref|XP_009374253.1|  PREDICTED: villin-1                                334   3e-102   
ref|XP_004294229.1|  PREDICTED: villin-1-like                           334   4e-102   
ref|XP_011032128.1|  PREDICTED: villin-1-like isoform X1                335   4e-102   
emb|CDY58946.1|  BnaAnng15630D                                          334   5e-102   
ref|XP_009144346.1|  PREDICTED: villin-1                                334   5e-102   
ref|XP_006296359.1|  hypothetical protein CARUB_v10025531mg             335   5e-102   
ref|XP_008785367.1|  PREDICTED: villin-1 isoform X3                     332   7e-102   
ref|XP_008785364.1|  PREDICTED: villin-1 isoform X1                     332   9e-102   
ref|XP_008355197.1|  PREDICTED: villin-1                                333   1e-101   
emb|CDX93121.1|  BnaA03g38430D                                          318   2e-101   
ref|XP_010923067.1|  PREDICTED: villin-1 isoform X4                     330   2e-101   
emb|CDY02014.1|  BnaC04g14870D                                          331   6e-101   
ref|XP_004500245.1|  PREDICTED: villin-1-like                           330   9e-101   
ref|XP_007028724.1|  Villin 2 isoform 4                                 325   1e-100   
ref|XP_010685572.1|  PREDICTED: villin-1                                329   3e-100   
ref|XP_010923065.1|  PREDICTED: villin-1 isoform X2                     328   9e-100   
ref|XP_010414335.1|  PREDICTED: villin-1-like isoform X2                328   1e-99    
ref|XP_008654097.1|  PREDICTED: villin-4-like                           329   1e-99    
ref|XP_010414337.1|  PREDICTED: villin-1-like isoform X4                327   2e-99    
ref|XP_010510431.1|  PREDICTED: villin-1 isoform X1                     325   9e-99    
ref|XP_010510432.1|  PREDICTED: villin-1 isoform X2                     325   1e-98    
ref|XP_007146722.1|  hypothetical protein PHAVU_006G064200g             325   1e-98    
ref|XP_006410037.1|  hypothetical protein EUTSA_v10016199mg             325   2e-98    
gb|KHN01783.1|  Villin-1                                                323   7e-98    
ref|XP_010414334.1|  PREDICTED: villin-1-like isoform X1                323   7e-98    
ref|XP_010414336.1|  PREDICTED: villin-1-like isoform X3                323   7e-98    
gb|KHN06263.1|  Villin-1                                                321   1e-97    
ref|NP_029567.1|  villin-1                                              322   1e-97    
ref|XP_011016357.1|  PREDICTED: villin-1-like isoform X2                322   2e-97    
ref|NP_001031444.2|  villin-1                                           322   2e-97    
ref|NP_001189635.1|  villin-1                                           322   2e-97    
ref|XP_011016354.1|  PREDICTED: villin-1-like isoform X1                322   3e-97    
ref|XP_006602104.1|  PREDICTED: villin-1-like isoform X1                321   3e-97    
gb|AAC31605.1|  villin 1                                                321   3e-97    
ref|XP_006586191.1|  PREDICTED: villin-1-like                           321   4e-97    
tpg|DAA62987.1|  TPA: hypothetical protein ZEAMMB73_927200              320   1e-96    
ref|XP_002879238.1|  predicted protein                                  318   6e-96    
ref|XP_010043438.1|  PREDICTED: LOW QUALITY PROTEIN: villin-1           311   9e-94    
gb|EEC83153.1|  hypothetical protein OsI_28365                          293   5e-93    
gb|ABK35295.1|  actin-binding protein ABP29                             288   8e-93    
gb|AAU44156.1|  putative villin                                         300   1e-91    
ref|XP_002439306.1|  hypothetical protein SORBIDRAFT_09g004120          300   1e-90    
ref|NP_001054676.1|  Os05g0153000                                       300   9e-90    
gb|EEC78540.1|  hypothetical protein OsI_18497                          300   1e-89    
gb|AAZ31071.1|  villin 3                                                278   8e-89    
ref|XP_010231690.1|  PREDICTED: villin-1-like                           296   4e-88    
gb|AFW77137.1|  hypothetical protein ZEAMMB73_526205                    295   4e-88    
ref|XP_008649346.1|  PREDICTED: villin-1-like                           295   5e-88    
ref|XP_008802636.1|  PREDICTED: villin-2-like isoform X2                294   1e-87    
emb|CDP09180.1|  unnamed protein product                                295   1e-87    
gb|EMT04763.1|  Villin-1                                                290   2e-86    
ref|XP_004977059.1|  PREDICTED: villin-1-like                           290   3e-86    
gb|EMS56492.1|  Villin-1                                                286   2e-85    
ref|XP_006654058.1|  PREDICTED: villin-1-like                           283   2e-83    
ref|XP_010650912.1|  PREDICTED: villin-1 isoform X2                     274   1e-79    
ref|XP_002736967.1|  PREDICTED: villin-1-like isoform X1                271   5e-79    
ref|XP_006819231.1|  PREDICTED: villin-1-like isoform X3                271   5e-79    
ref|XP_006819230.1|  PREDICTED: villin-1-like isoform X2                271   5e-79    
ref|XP_002072074.1|  GK22516                                            269   1e-78    
ref|XP_009519437.1|  hypothetical protein PHYSODRAFT_349852             272   2e-78    
gb|EFW45931.2|  villin                                                  269   3e-78    
ref|XP_004363643.1|  villin                                             268   5e-78    
ref|XP_967392.1|  PREDICTED: gelsolin                                   260   2e-77    
gb|KDO34602.1|  hypothetical protein SPRG_00665                         266   2e-77    
ref|XP_001993828.1|  GH19024                                            266   3e-77    
emb|CAN61893.1|  hypothetical protein VITISV_028790                     272   3e-77    
ref|XP_008605400.1|  hypothetical protein SDRG_01644                    266   4e-77    
ref|XP_008891600.1|  hypothetical protein PPTG_02292                    266   4e-77    
ref|XP_008867870.1|  hypothetical protein H310_05039                    266   4e-77    
emb|CAA53295.1|  secreted gelsolin                                      265   4e-77    
ref|NP_996148.2|  gelsolin, isoform K                                   265   4e-77    
ref|NP_730788.1|  gelsolin, isoform A                                   264   4e-77    
emb|CAA53294.1|  cytoplasmic gelsolin                                   264   4e-77    
gb|AAA28568.1|  The biology of this fly protein has not yet been ...    265   4e-77    
ref|NP_524865.2|  gelsolin, isoform B                                   265   4e-77    
gb|ETI50251.1|  hypothetical protein F443_06160                         266   5e-77    
ref|XP_001657433.1|  Gelsolin precursor                                 255   5e-77    
gb|ETL96713.1|  hypothetical protein L917_05858                         266   6e-77    
gb|ETL43532.1|  hypothetical protein L916_05974                         266   7e-77    
ref|XP_001954279.1|  GF18195                                            265   8e-77    
ref|XP_002058487.1|  GJ14452                                            265   8e-77    
ref|XP_001657437.1|  Gelsolin precursor                                 254   8e-77    
gb|ABY20529.1|  RE15339p                                                265   1e-76    
gb|ENN79901.1|  hypothetical protein YQE_03720                          258   1e-76    
gb|ETK90134.1|  hypothetical protein L915_06037                         265   1e-76    
gb|ERL89958.1|  hypothetical protein D910_07317                         258   1e-76    
ref|XP_002901851.1|  villin-like protein                                264   3e-76    
ref|XP_002001525.1|  GI10844                                            263   4e-76    
ref|XP_002102062.1|  gelsolin                                           261   1e-75    
ref|XP_009838044.1|  hypothetical protein H257_12512                    262   1e-75    
gb|ETN65859.1|  Gelsolin precursor                                      251   2e-75    
ref|XP_002038258.1|  GM10736                                            260   4e-75    
ref|XP_001978789.1|  GG12208                                            260   4e-75    
ref|XP_001846163.1|  Gelsolin                                           249   7e-75    
gb|EFA75226.1|  severin                                                 248   1e-74    
ref|XP_002095915.1|  gelsolin                                           258   2e-74    
ref|XP_005791607.1|  gelsolin with villin headpeace                     259   2e-74    
ref|XP_003736820.1|  GA10732, isoform C                                 255   1e-73    
gb|AAD24195.1|  fragmin A                                               245   1e-73    
ref|XP_001359628.1|  GA10732, isoform A                                 255   2e-73    
ref|XP_002019311.1|  GL12306                                            255   2e-73    
ref|XP_005183725.1|  PREDICTED: LOW QUALITY PROTEIN: gelsolin-like      255   2e-73    
ref|XP_001846164.1|  Gelsolin                                           254   2e-73    
ref|XP_003736819.1|  GA10732, isoform B                                 254   6e-73    
ref|XP_009064502.1|  hypothetical protein LOTGIDRAFT_221805             253   1e-72    
gb|KFB47217.1|  hypothetical protein ZHAS_00015241                      243   1e-72    
gb|EFA11080.1|  hypothetical protein TcasGA2_TC004676                   257   2e-72    
ref|XP_001949775.1|  PREDICTED: gelsolin-like                           243   3e-72    
ref|XP_001630721.1|  predicted protein                                  246   4e-72    
ref|XP_008356191.1|  PREDICTED: villin-4-like                           246   4e-72    
ref|XP_004922200.1|  PREDICTED: gelsolin-like                           241   5e-72    
pdb|3FFK|A  Chain A, Crystal Structure Of Human Gelsolin Domains ...    241   5e-72    
ref|XP_008286570.1|  PREDICTED: gelsolin-like isoform X3                247   1e-71    
ref|XP_002115268.1|  hypothetical protein TRIADDRAFT_29352              251   1e-71    
gb|AAC47528.1|  actin-binding protein fragmin P                         240   2e-71    
ref|XP_002110432.1|  hypothetical protein TRIADDRAFT_54421              249   4e-71    
ref|XP_004075070.1|  PREDICTED: gelsolin-like                           248   4e-71    
ref|XP_554876.3|  AGAP011369-PA                                         248   4e-71    
ref|XP_005008007.1|  PREDICTED: gelsolin isoform X3                     248   4e-71    
ref|XP_004326479.1|  PREDICTED: gelsolin-like                           241   5e-71    
ref|XP_007421537.1|  PREDICTED: gelsolin                                248   5e-71    
ref|NP_990265.1|  gelsolin precursor                                    248   6e-71    
ref|XP_008286571.1|  PREDICTED: gelsolin-like isoform X4                248   6e-71    
emb|CCI71880.1|  gelsolin                                               247   8e-71    
ref|XP_005008006.1|  PREDICTED: gelsolin isoform X2                     247   8e-71    
ref|XP_003478882.2|  PREDICTED: gelsolin isoform X1                     248   9e-71    
ref|XP_002115269.1|  hypothetical protein TRIADDRAFT_29447              248   9e-71    
ref|XP_008286568.1|  PREDICTED: gelsolin-like isoform X1                247   1e-70    
ref|XP_005799741.1|  PREDICTED: gelsolin-like                           247   1e-70    
ref|XP_008286569.1|  PREDICTED: gelsolin-like isoform X2                247   1e-70    
emb|CCI71879.1|  gelsolin                                               247   1e-70    
emb|CDQ68988.1|  unnamed protein product                                246   1e-70    
pdb|1RGI|G  Chain G, Crystal Structure Of Gelsolin Domains G1-G3 ...    237   2e-70    
gb|ETN65858.1|  Gelsolin                                                246   2e-70    
gb|KFQ22347.1|  Gelsolin                                                241   2e-70    
ref|XP_005030093.1|  PREDICTED: gelsolin isoform X1                     246   3e-70    
ref|XP_004344468.1|  fragmin60                                          236   4e-70    
ref|XP_009927676.1|  PREDICTED: gelsolin                                246   4e-70    
ref|XP_010719339.1|  PREDICTED: gelsolin isoform X2                     245   5e-70    
gb|AAG31138.1|AF303112_1  fragmin60                                     241   5e-70    
ref|XP_008047977.1|  PREDICTED: gelsolin                                246   5e-70    
ref|XP_005030094.1|  PREDICTED: gelsolin isoform X2                     245   7e-70    
gb|EFB13293.1|  hypothetical protein PANDA_004040                       244   7e-70    
ref|XP_003211386.1|  PREDICTED: gelsolin isoform X1                     245   8e-70    
ref|XP_008150357.1|  PREDICTED: gelsolin isoform X4                     244   9e-70    
ref|XP_009679361.1|  PREDICTED: gelsolin                                245   9e-70    
ref|NP_001232935.1|  gelsolin                                           244   1e-69    
ref|XP_002915999.1|  PREDICTED: gelsolin-like isoform 2                 244   1e-69    
ref|XP_005320973.1|  PREDICTED: gelsolin isoform X5                     244   1e-69    
ref|XP_007539988.1|  PREDICTED: gelsolin isoform X3                     244   1e-69    
ref|XP_002915998.1|  PREDICTED: gelsolin-like isoform 1                 244   1e-69    
ref|XP_006120828.1|  PREDICTED: gelsolin isoform X4                     243   1e-69    
gb|KFP97309.1|  Gelsolin                                                243   1e-69    
ref|NP_001107669.1|  advillin                                           245   1e-69    
ref|XP_007539987.1|  PREDICTED: gelsolin isoform X2                     244   1e-69    
ref|XP_005320969.1|  PREDICTED: gelsolin isoform X1                     244   1e-69    
ref|XP_007539989.1|  PREDICTED: gelsolin isoform X4                     244   1e-69    
ref|XP_007539986.1|  PREDICTED: gelsolin isoform X1                     244   2e-69    



>ref|XP_006350184.1| PREDICTED: villin-2-like [Solanum tuberosum]
Length=948

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/358 (80%), Positives = 327/358 (91%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VK L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSSSVKTLDPAFQGAGQRVGTEIWRIEDFQPVPLPKSDYGKFYSGDSYIILQTTSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HE+D+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDVVLGGRAVQYREVQGHETDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY+CKGKRVVRMKQVPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYICKGKRVVRMKQVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAK+LEVIQFLK+ YH G C+VAIV+DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKSLEVIQFLKEKYHEGTCDVAIVDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDI+PEKTPPKL  I +GQV+PVDGELSKS+LEN+KCYLLDCG+EVFVW+GR TQL
Sbjct  241   VITEDDIVPEKTPPKLSSITDGQVSPVDGELSKSSLENNKCYLLDCGAEVFVWIGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA QTAEE+LV + RPKAT++TR+ QG+ET SFK  FDSWPS SA  PEEGRGK
Sbjct  301   EERKAAIQTAEEYLVSENRPKATRVTRVIQGYETHSFKSNFDSWPSGSAPAPEEGRGK  358


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/365 (26%), Positives = 173/365 (47%), Gaps = 39/365 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+WRI      P+PK D GKFYSGD YVVL           + 
Sbjct  380   IEEVPPLLEEGGK---LEVWRINGSAKTPVPKEDIGKFYSGDCYVVLYNYHSHERRDDYY  436

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             + +W+GKD+ +++  TAA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG
Sbjct  437   LCWWIGKDSIEEDQITAARLASTMCNSLKGRPVLGRVFQGKEPPQFVAIFQPMLV-LKGG  495

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+K    ++      Y      ++R+            V     SLN ++ F+L + 
Sbjct  496   LSSGYKNYIADKGLNDETYTADSVALIRLSGTSVHNNKAVHVDAVPSSLNSNECFLLQSG  555

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G  S+ +++  A +V +FLK         V   ++G      +S  FW     
Sbjct  556   SSLFSWHGNQSSYEQQQLAAKVAEFLKPG-----ATVKHTKEGT-----ESSAFW-----  600

Query  807   FAPMGRKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSE  974
             FA  G++  +   + PE +  P LF    + G++   +    ++ +L      LLD  SE
Sbjct  601   FALGGKQSYTSKKVAPEVSRDPHLFAYSFNKGKIEVEEIYNFAQDDLLTEDVLLLDTHSE  660

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVWVG++    E+++A +  ++++      +       + ++ +G+E   F   F SW 
Sbjct  661   VFVWVGQSADSKEKQSAFEIGQKYVEMAASLEGLSPNVPLYKITEGNEPCFFTTFF-SWD  719

Query  1143  SASAT  1157
              A A+
Sbjct  720   PAKAS  724



>ref|XP_009620592.1| PREDICTED: villin-3-like [Nicotiana tomentosiformis]
Length=950

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 327/358 (91%), Gaps = 1/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+ AFQ AGQ+ G EIWRIE+F+PVPLPK+DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSSSAKALDSAFQGAGQRVGTEIWRIEDFQPVPLPKSDYGKFYSGDSYIILQTTSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLY+CKGKRVVRMKQVPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYICKGKRVVRMKQVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G+C+VAIV+DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGLCDVAIVDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDI+PEKTPPKL+ I NGQV+P+DGELSKS+LEN+KCYLLDCG+EVFVWVGR TQL
Sbjct  241   VVTEDDIVPEKTPPKLYSI-NGQVSPMDGELSKSSLENNKCYLLDCGAEVFVWVGRVTQL  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA QTAEE+LV Q RPKAT++TR+ QG+E  SFK  FDSWPS SA  PEEGRGK
Sbjct  300   EERKAAIQTAEEYLVSQNRPKATRVTRVIQGYEPHSFKSNFDSWPSGSAPAPEEGRGK  357


 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 91/365 (25%), Positives = 168/365 (46%), Gaps = 39/365 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+WRI      P+PK D GKFYSGD Y+VL           + 
Sbjct  379   IEEVPPLLEGGGK---VEVWRINGSAKTPVPKEDIGKFYSGDCYIVLYNYHSHDRREDYY  435

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             + +W+GKD+ +++   AA     +     G+ V  R  Q  E  +F++ F+P ++ L+GG
Sbjct  436   LCWWIGKDSIEEDQSMAARLASTMCNSFKGRPVLGRVFQGKEPPQFVAIFQPMLV-LKGG  494

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+K    ++      Y      ++R+           QV     SLN ++ F+L + 
Sbjct  495   LSSGYKNYIADKGLNDETYAADSVALIRLSGTSVHNNKAVQVDAVPASLNSNECFLLQSG  554

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               I+ ++G  S  +++  A +V +FLK         V   ++G      +S  FW     
Sbjct  555   SSIFSWHGNQSTYEQQQLAAKVAEFLKPG-----ATVKHTKEGT-----ESSAFW-----  599

Query  807   FAPMGRKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSE  974
             FA  G++  +   +  E +  P LF    + G+    +    S+ +L      LLD  +E
Sbjct  600   FAVGGKQSYTSKKVATEVSRDPHLFAYSFNKGKFEVEEIYNFSQDDLLTEDVLLLDTHAE  659

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVW+G++    E+++A    ++++      +       + ++ +G+E   F   F SW 
Sbjct  660   VFVWIGQSADSKEKQSAFDVGQKYVEMAASLEGLSPNVPLYKVTEGNEPCFFTTFF-SWD  718

Query  1143  SASAT  1157
              A A+
Sbjct  719   PAKAS  723



>ref|XP_004236608.1| PREDICTED: villin-2 [Solanum lycopersicum]
Length=948

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 327/358 (91%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VK L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSGSVKTLDPAFQGAGQRVGTEIWRIEDFQPVPLPKSDYGKFYSGDSYIILQTTSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGK+TSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HE+D+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKNTSQDEAGTAAIKTVELDVVLGGRAVQYREVQGHETDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFET+LY+CKGKRVVRMKQVPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETKLYICKGKRVVRMKQVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDI+PEKTPPKL  I +GQV+PVDGELSKS+LEN+KCYLLDCG+EVFVW+GR TQL
Sbjct  241   VITEDDIVPEKTPPKLSSITDGQVSPVDGELSKSSLENNKCYLLDCGAEVFVWIGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA QTAEE+LV + RPKAT++TR+ QG+ET SFK  FDSWPS SA  PEEGRGK
Sbjct  301   EERKAAIQTAEEYLVSENRPKATRVTRVIQGYETHSFKSNFDSWPSGSAPAPEEGRGK  358


 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 173/365 (47%), Gaps = 39/365 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+WRI      P+PK D GKFYSGD YVVL           + 
Sbjct  380   IEEVPPLLEEGGK---LEVWRINGNAKTPVPKEDIGKFYSGDCYVVLYNYHSHERRDDYY  436

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             + +W+GKD+ +++  TAA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG
Sbjct  437   LCWWIGKDSIEEDQITAARLASTMCNSLKGRPVLGRVFQGKEPPQFVAIFQPMLV-LKGG  495

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             +++G+K    ++      Y      ++R+           QV     SLN ++ F+L + 
Sbjct  496   LSTGYKNYIADKGLNDETYTADSVALIRLSGTSVHNNKAVQVDAVPSSLNSNECFLLQSG  555

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G  S+ +++  A +V +FLK         V   ++G      +S  FW     
Sbjct  556   SSLFSWHGNQSSYEQQQLAAKVAEFLKPG-----ATVKHTKEGT-----ESSAFW-----  600

Query  807   FAPMGRKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSE  974
             FA  G++  +   + PE +  P LF    + G+    +    ++ +L      LLD  +E
Sbjct  601   FALGGKQSYTSKKVAPEVSRDPHLFAYSFNKGKFEVEEIYNFAQDDLLTEDVLLLDTHAE  660

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVWVG++    E+++A +  ++++      +       + ++ +G+E   F   F SW 
Sbjct  661   VFVWVGQSADSKEKQSAFEIGQKYVEMAASLEGLSPNVPLYKITEGNEPCFFTT-FFSWD  719

Query  1143  SASAT  1157
              A A+
Sbjct  720   PAKAS  724



>ref|XP_009799721.1| PREDICTED: villin-3-like [Nicotiana sylvestris]
Length=950

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 326/358 (91%), Gaps = 1/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIE+F+PVPLPK+DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIEDFQPVPLPKSDYGKFYSGDSYIILQTTSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLY+CKGKRVVRMKQVPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYICKGKRVVRMKQVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALE+IQFLK+ YH G C+VAIV+DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEIIQFLKEKYHEGTCDVAIVDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIPEKTPPKL+ I NGQV+ +DGELSKS+LEN+KCYLLDCG+EVFVWVGR TQL
Sbjct  241   VVTEDDIIPEKTPPKLYSI-NGQVSSMDGELSKSSLENNKCYLLDCGAEVFVWVGRVTQL  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA QTAEE+LV Q RPKAT++TR+ QG+E  SFK  FDSWPS SA  PEEGRGK
Sbjct  300   EERKAAIQTAEEYLVSQNRPKATRVTRVIQGYEPHSFKSNFDSWPSGSAPAPEEGRGK  357


 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 170/365 (47%), Gaps = 39/365 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             V+ + P  +  G+   +E+WRI      P+PK D GKFYSGD YVVL           + 
Sbjct  379   VEEVPPLLEGGGK---VEVWRINGSAKTPVPKEDIGKFYSGDCYVVLYNYHSHDRREDYY  435

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             + +W+GKD+ +++   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG
Sbjct  436   LCWWIGKDSIEEDQSMAARLASTMCNSLKGRPVLGRVFQGKEPPQFVAIFQPMLV-LKGG  494

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+K    ++      Y      ++R+           QV     SLN ++ F+L + 
Sbjct  495   LSSGYKNYIADKGLNDETYAADSVALIRLSGTSVHNNKAVQVDAVPASLNSNECFLLQSG  554

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G  S  +++  A +V +FLK         V   ++G      +S  FW     
Sbjct  555   SSLFSWHGNQSTYEQQQLAAKVAEFLKPG-----ATVKHTKEGT-----ESSAFW-----  599

Query  807   FAPMGRKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSE  974
             FA  G++  +   + PE +  P LF    + G+    +    S+ +L      LLD  +E
Sbjct  600   FALGGKQSYTSKKVAPEVSRDPHLFAYSFNKGKFEVEEIYNFSQDDLLTEDVLLLDTHAE  659

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VF+W+G++    E+++A    ++++      +       + ++ +G+E   F   F SW 
Sbjct  660   VFIWIGQSADSKEKQSAFDVGQKYVEMAASLEGLSPNVPLYKVTEGNEPCFFTTFF-SWD  718

Query  1143  SASAT  1157
              A A+
Sbjct  719   PAKAS  723



>ref|XP_006351312.1| PREDICTED: villin-2-like [Solanum tuberosum]
Length=945

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 322/358 (90%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VKALEPAFQ AGQ+ G EIWRIE+F+PVPLPK++ GKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSNSVKALEPAFQGAGQRIGTEIWRIEDFQPVPLPKSECGKFYSGDSYIILQTTSGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y++DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHREIQ HESD+FLS+FKPCI+P
Sbjct  61    YIYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREIQGHESDKFLSFFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVCKGKRVVRMKQVPF+R SLNHDDVF+LD+KDKIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFSRSSLNHDDVFILDSKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLKD YH G C+V IV+DGNLQAE DSG FW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKDKYHEGTCDVVIVDDGNLQAETDSGSFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PEKTP KL+ I +GQV+PVDGELSKS+LEN+KCYLLDCG+EVFVWVGR TQL
Sbjct  241   VASEDDIVPEKTPAKLYSITDGQVSPVDGELSKSSLENNKCYLLDCGAEVFVWVGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA Q AEEFL  Q RPK+T +TRL QG+ET SFK  FDSWPS SA   EEGRGK
Sbjct  301   EERKAATQAAEEFLSSQNRPKSTHVTRLIQGYETYSFKSNFDSWPSGSAPAAEEGRGK  358


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 169/359 (47%), Gaps = 39/359 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+WRI      P+   D GKF+ GD Y+VL T         + + +W+
Sbjct  385   PLLEGGGK---IEVWRINGNAKTPVTGDDIGKFHCGDCYIVLYTYHHSDRKEDYYLCWWI  441

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  442   GKDSVEEDQNMAAKLASTMCNSLKGRPVLGRIYQGKEPPQFVAIFQPLLV-LKGGLSSGY  500

Query  495   K-----KPEEEEFET----RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K     K   +E  T     L    G  V   K  QV     SLN ++ F+L +   ++ 
Sbjct  501   KIYIADKGLNDETYTADSVALIQVSGTSVHNNKAVQVDAVAASLNSNECFLLQSGSSVFS  560

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A  + +FLK     GV  V   ++G      +S  FW     FA  G
Sbjct  561   WHGNQSTYEQQQLAATLAEFLKP----GV-TVKHTKEGT-----ESSSFW-----FAVGG  605

Query  822   RKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE T  P LF   I+ G+    +    S+ +L      LLD  +EVFVWV
Sbjct  606   KQSYTSKKVAPEVTRDPHLFVYSINKGKFEIEEIYNFSQDDLLTEDVLLLDTHAEVFVWV  665

Query  990   GRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+++   E++++ +  ++++      +       + ++ +G+E   F   F SW  A A
Sbjct  666   GQSSDPKEKQSSFEIGQKYIEMAACLEGLSPNVPLYKVTEGNEPCFFTTFF-SWDPAKA  723



>ref|XP_011078908.1| PREDICTED: villin-3-like [Sesamum indicum]
Length=935

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/359 (78%), Positives = 322/359 (90%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KALEPAFQ AGQ+ G EIWRIENF+PVPLPK+DYGKFYSGDSY++LQT +GKGG 
Sbjct  1     MSSSAKALEPAFQGAGQRVGTEIWRIENFQPVPLPKSDYGKFYSGDSYIILQTITGKGGG  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HES++FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQYRELQGHESEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF+KPEEEEFETRLY+C+GKRVV++KQVPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGIASGFRKPEEEEFETRLYICRGKRVVKLKQVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIPEKTPP+L+CI +G+V  VDGELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VATEDDIIPEKTPPQLYCIIDGEVKNVDGELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             DERKAA Q AE+FL  Q RPK+T ITRL QG+ET SFK  FDSWP  SA +  EEGRGK
Sbjct  301   DERKAASQVAEDFLASQNRPKSTHITRLIQGYETHSFKSNFDSWPLGSAPSVVEEGRGK  359


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 163/361 (45%), Gaps = 53/361 (15%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+W I +     +P  D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEGGGK---IEVWYINDNTKTLVPNEDIGKFYSGDCYIVLYTYHSHERKEDYYLCCWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TAA  +  + T L G+ VQ R             F+P ++ L+GG++SG+
Sbjct  443   GKDSIEEDQETAARLSTTMYTSLKGRPVQGR------------VFQPMVV-LKGGMSSGY  489

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y   G  ++ +           QV     SLN ++ F+L +   I+ 
Sbjct  490   KNYIADKGLNDETYTADGVALISISGTSRHKNKAVQVEAVATSLNSNECFLLQSGSSIFS  549

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G  S+I+++  A +V +FLK         V   ++G      +S  FW     FA  G
Sbjct  550   WQGNQSSIEQQQLAAKVAEFLKPG-----SPVKHTKEGT-----ESSSFW-----FALGG  594

Query  822   RKVTSDDDIIPE-KTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  +   + PE    P L  F I  G  QV  +    S+ +L      +LD  +EVFVW
Sbjct  595   KQNYTSKKLSPEVARDPHLFEFSIRKGKFQVEEIYN-FSQDDLLTEDMLILDTHAEVFVW  653

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSASA  1154
             +G++    E++ A +  ++++              + ++ +G+E   F   F SW  A A
Sbjct  654   IGQSVDAKEKQNALEIGQKYVEMAASLDGLAPDVPLYKVTEGNEPCFFTKYF-SWDPAKA  712

Query  1155  T  1157
             +
Sbjct  713   S  713



>ref|XP_010496943.1| PREDICTED: villin-2-like, partial [Camelina sativa]
Length=395

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+D+GKFY GD+Y+VLQTT  K G 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSDHGKFYMGDTYIVLQTTQNKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARTSLNHDDVFILDTEEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDI PE TPPKL+CI +G+V P+DG+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VANDDDITPESTPPKLYCIADGKVEPIDGDLSKSMLENTKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERK A Q+AE+ L  + RPKAT++TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   DERKVASQSAEDLLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  359



>ref|XP_004249261.1| PREDICTED: villin-2-like [Solanum lycopersicum]
 ref|XP_010312125.1| PREDICTED: villin-2-like [Solanum lycopersicum]
 ref|XP_010312126.1| PREDICTED: villin-2-like [Solanum lycopersicum]
Length=945

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 323/358 (90%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VKALEPAFQ AGQ+ G EIWRIE+F+PVPLPK++ GKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSNSVKALEPAFQGAGQRIGTEIWRIEDFQPVPLPKSECGKFYSGDSYIILQTTSGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y++DIHFWLGK+TSQDEAGTAAIKTVELD I+GG+ VQHREIQ HESD+FLSYFKPC++P
Sbjct  61    YIYDIHFWLGKNTSQDEAGTAAIKTVELDAIIGGRAVQHREIQGHESDKFLSYFKPCLIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPF+R SLNHDDVF+LD+KDKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFSRSSLNHDDVFILDSKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLKD YH G C+VAIV+DGNLQAE DSG FW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKDKYHEGTCDVAIVDDGNLQAETDSGSFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VTS+DDI+PEKTP KL+ I +GQV+PVDGE SKS+LEN+KC+LLDCG+EVFVWVGR TQL
Sbjct  241   VTSEDDIVPEKTPAKLYSITDGQVSPVDGEFSKSSLENNKCFLLDCGAEVFVWVGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA Q AEEFL  Q RPK+T +TRL QG+ET SFK  FDSWPS SA   EEGRGK
Sbjct  301   EERKAATQAAEEFLSSQNRPKSTHVTRLIQGYETYSFKSNFDSWPSGSAPAAEEGRGK  358


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 152/320 (48%), Gaps = 34/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+WRI       +   D GKF+ GD Y++L T         + + +W+
Sbjct  385   PLLEGGGK---IEVWRINGSAKTSVTGDDIGKFHCGDCYIILYTYHHSDRKEDYYLCWWI  441

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  442   GKDSVEEDQNMAAKLASTMCNSLKGRPVLGRIYQGKEPPQFVANFQPMLV-LKGGLSSGY  500

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y      ++R+           QV     SLN ++ F+L +   ++ 
Sbjct  501   KNYVADKGLNDETYTADSVALIRVSGTSVHNNKAVQVDAVAASLNSNECFLLQSGSSVFS  560

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++    ++ +FLK     GV  V   ++G      +S  FW     FA  G
Sbjct  561   WHGNQSTYEQQQLTAKLAEFLKP----GV-TVKHTKEGT-----ESSSFW-----FAVGG  605

Query  822   RKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE T  P LF   I+ G+    +     + +L      LLD  +EVFVWV
Sbjct  606   KQSYTSKKVAPEVTRDPHLFAYSINKGKFEIEEIYNFCQDDLLTEDVLLLDTHAEVFVWV  665

Query  990   GRATQLDERKAACQTAEEFL  1049
             G+++   E++++ +  ++++
Sbjct  666   GQSSDPKEKQSSFEIGQKYI  685



>ref|XP_009767117.1| PREDICTED: villin-2-like [Nicotiana sylvestris]
Length=944

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 322/358 (90%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M  +VKALEPAFQ A Q+ G EIWRIE+F+PVPLPK++YGKFYSGDSY+VLQTTSGKGG 
Sbjct  1     MPNSVKALEPAFQGADQRIGTEIWRIEDFQPVPLPKSEYGKFYSGDSYIVLQTTSGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y++DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YIYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             L+GG+ASGFKKPEEEEFETRLY+CKGKRVVRMKQVPF+R SLNHDDVF+LD+KDKIYQFN
Sbjct  121   LQGGIASGFKKPEEEEFETRLYICKGKRVVRMKQVPFSRSSLNHDDVFILDSKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANS+IQERAKALEVIQFLKD YH G C+VAIV+DGNLQAE+DSG FW LFGGFAP+G+K
Sbjct  181   GANSSIQERAKALEVIQFLKDKYHEGTCDVAIVDDGNLQAESDSGSFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PEKTP KL+ I +GQV+PVDGELSKS+LEN+KCYLLDCG+EVF+WVGR TQL
Sbjct  241   VASEDDIVPEKTPAKLYSITDGQVSPVDGELSKSSLENNKCYLLDCGAEVFIWVGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA Q AEE+L  Q RPK+T +TRL QG+ET SFK  FDSWPS S    EEGRGK
Sbjct  301   EERKAAIQAAEEYLTSQNRPKSTHVTRLIQGYETHSFKSSFDSWPSGSVPAAEEGRGK  358


 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/358 (27%), Positives = 170/358 (47%), Gaps = 37/358 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+WRI       +P  D GKFYSGD Y+VL T         + + +W+
Sbjct  385   PLLEGGGK---IEVWRINGSAKSTVPGDDIGKFYSGDCYIVLYTYHSNERKEDYYLSWWI  441

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TAA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  442   GKDSIEEDQNTAAKLASTMCNSLKGRPVLGRVYQGKEPPQFVAIFQPMLV-LKGGLSSGY  500

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y      ++R+           QV     SLN ++ F+L +   ++ 
Sbjct  501   KNYISDKGLNDETYTADSVALIRLSGTSVHNNKAVQVDVVATSLNSNECFLLQSGSSVFN  560

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGF-APM  818
             ++G  S  +++  A +V +FLK     GV  V   ++G      +S  FW   GG  +  
Sbjct  561   WHGNQSTYEQQQLAAKVTEFLKP----GVT-VKHAKEGT-----ESSTFWFALGGKQSYT  610

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGR  995
              +KV S+    P       + I+ G+    +    S+ +L      LLD  +EVFVWVG+
Sbjct  611   SKKVASEVARDPHLIA---YSINEGKFEIEEIYNFSQDDLSTEDVLLLDTHAEVFVWVGQ  667

Query  996   ATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             ++   E++++ +  ++++     ++   P    + ++ +G+E   F   F SW  A A
Sbjct  668   SSDPKEKQSSFEVGQKYIEIAASLEGLSPNVP-LYKVTEGNEPCFFTT-FFSWDPAKA  723



>ref|XP_009624540.1| PREDICTED: villin-2 [Nicotiana tomentosiformis]
Length=946

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 324/358 (91%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS ++KALEPAFQ AGQ+ G EIWRIE+F+PVPL K++YGKFYSGDSYV+LQTTSGKGG 
Sbjct  1     MSNSIKALEPAFQGAGQRIGTEIWRIEDFQPVPLQKSEYGKFYSGDSYVILQTTSGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y++DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YMYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLY+CKGKRVVRMKQVPF+R SLNHDDVF+LD+KDKIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYICKGKRVVRMKQVPFSRSSLNHDDVFILDSKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVI FLKD YH G C+VAIV+DGNLQAE+DSG FW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIPFLKDKYHEGTCDVAIVDDGNLQAESDSGSFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DDI+PEKTP KL+ I++GQV+P+D ELSKS+LEN+KCYLLDCG+EVF+WVGR TQL
Sbjct  241   VSSEDDIVPEKTPAKLYSINDGQVSPMDSELSKSSLENNKCYLLDCGAEVFIWVGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERKAA Q AEE+L  Q RPK+T +TRL QG+ET SFK  FDSWPS SA   EEGRGK
Sbjct  301   EERKAAIQAAEEYLTSQNRPKSTHVTRLIQGYETHSFKSNFDSWPSGSAPAAEEGRGK  358


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 93/359 (26%), Positives = 167/359 (47%), Gaps = 39/359 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+WRI      P+P  D GKFYSGD Y+VL T         + + +W+
Sbjct  385   PLLEGGGK---IEVWRINGSAKTPVPGDDIGKFYSGDCYIVLYTYHCNDRKEDYYLCWWI  441

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA     +   L  + V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  442   GKDSVEEDQNMAAKLASTMCNSLKARPVLGRVYQGKEPPQFVAIFQPMLV-LKGGLSSGY  500

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y      ++R+           QV     SLN ++ F+L +   ++ 
Sbjct  501   KSYIADKGLNDETYTADSVALIRLSGTSVHNNKAVQVDAVATSLNSNECFLLQSGSSVFS  560

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK     GV  V   ++G      +S  FW     FA  G
Sbjct  561   WHGNQSTYEQQQLAAKVAEFLKP----GVT-VKHAKEGT-----ESSTFW-----FALGG  605

Query  822   RKVTSDDDIIPE-KTPPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   +  E    P LF    + G+    +    S+ +L      LLD  +EVFVWV
Sbjct  606   KQSYTSKKVASEVARDPHLFAYSFNKGKFEIEEIYNFSQDDLLTEDVLLLDTHAEVFVWV  665

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             G+++   E++++ +  ++++      +       + ++ +G+E   F   F SW  A A
Sbjct  666   GQSSDPKEKQSSFEVGQKYIEMAASLEGLSPNVPLYKVMEGNEPCFFTTFF-SWDPAKA  723



>emb|CDP14114.1| unnamed protein product [Coffea canephora]
Length=955

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 320/358 (89%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VKALEPAFQ AGQ+ G EIWRIENF+PVPLPK+DYGKFYSGDSY+VLQT+ GKGG 
Sbjct  1     MSSSVKALEPAFQGAGQRIGTEIWRIENFQPVPLPKSDYGKFYSGDSYIVLQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVCKGKRVVR+KQVPF+R SLNHDDVF+LDTKDKI+QFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRLKQVPFSRSSLNHDDVFILDTKDKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG LQ E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLQTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPEKTP KL+ + +GQV PVD ELSKS LEN+KC+LLDCGSE+FVWVGR TQ+
Sbjct  241   VASEDDIIPEKTPAKLYSVVDGQVKPVDDELSKSILENNKCFLLDCGSEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             DERK A Q AEEF+V Q RPK+T ITRL QG+ET SFK  FDSWPS SA   EEGRGK
Sbjct  301   DERKTAIQAAEEFVVSQNRPKSTSITRLIQGYETHSFKSNFDSWPSGSAPVAEEGRGK  358


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/369 (26%), Positives = 169/369 (46%), Gaps = 51/369 (14%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   IE+W I      P+P  D GKF+SGD Y++L T         + + +W+
Sbjct  385   PLLEVGGK---IEVWCINGSAKTPVPIEDIGKFFSGDCYIILYTYHSHDKKEEYYLCYWI  441

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GGV+SG+
Sbjct  442   GKDSIQEDQIMAAGLANTMCNSLKGRPVLGRIYQGKEPPQFVAIFQPMVV-LKGGVSSGY  500

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y      ++R+           QV     SLN ++ F+L +   ++ 
Sbjct  501   KNYIADKGLNDETYTPDSVALIRISGTSVHNDIVVQVDAVPASLNSNESFLLQSGSSLFS  560

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G+ S  +++  A +V +FLK     GV      E        +S  FW     FA  G
Sbjct  561   WHGSQSTFEQQQLAAKVAEFLKP----GVAMKHTKEG------TESSAFW-----FALGG  605

Query  822   RKVTSDDDIIPEKT-PPKLF------------CIDNGQVNPVDGELSKSNLENSKCYLLD  962
             ++  +   + PE +  P LF            C+    +  V    S+ +L      +LD
Sbjct  606   KQSYTSKKVTPEVSRDPHLFTFSFNKGSSFSMCLTLKLIEEVYN-FSQDDLLTEDVLILD  664

Query  963   CGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCE  1127
               +EVF+WVG++    E+++A +  ++++     ++   PK   + ++ +G+E   F   
Sbjct  665   THAEVFIWVGQSVDAKEKQSAFENGQKYVELAASLEGLSPK-VPLYKVTEGNEPCFFTTY  723

Query  1128  FDSWPSASA  1154
             F SW  A A
Sbjct  724   F-SWDPAKA  731



>ref|XP_006351385.1| PREDICTED: villin-2-like [Solanum tuberosum]
Length=929

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/358 (77%), Positives = 315/358 (88%), Gaps = 0/358 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS++VK LEPAFQ AGQK G EIWRIENF+PVP+PK+++GKFYSGDSY+VLQTTSG+GG 
Sbjct  1     MSISVKDLEPAFQGAGQKPGTEIWRIENFQPVPVPKSEHGKFYSGDSYIVLQTTSGRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y  DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YWHDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE FETRLYVC GKRVVRMKQVPFAR SLNHDDVF+LDT+DKIYQFN
Sbjct  121   LEGGVASGFKKPEEEVFETRLYVCNGKRVVRMKQVPFARSSLNHDDVFLLDTEDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV Q LK+ YH GVC+VAI++DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVTQILKEKYHDGVCDVAIIDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDI+PE+T  +L+ I +GQVN +DGEL+KS LEN KCY+LDCGSEVF+WVGR TQL
Sbjct  241   VATDDDIVPERTTAQLYSITDGQVNSLDGELTKSILENDKCYILDCGSEVFMWVGRHTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             +ERK+  QT EE+L  Q RPK+T+ITR+ QG+ET SFK  FDSWPS S   PE+GRGK
Sbjct  301   EERKSTIQTTEEYLANQNRPKSTRITRIIQGYETHSFKSNFDSWPSGSTPAPEDGRGK  358


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 149/309 (48%), Gaps = 31/309 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+WRI+      +PK D GKFYSGD Y+VL T         + + +W+GKD+ +++   
Sbjct  393   IEVWRIDGSAKTLIPKEDIGKFYSGDCYIVLYTYHSHERKEDYYLCWWIGKDSIEEDREM  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFET  524
             AA     +   L G+ V  R  Q  E  +F++ F P ++ L+GG++SG+K    E     
Sbjct  453   AAQLASTMCNSLKGRPVLGRVYQGKEPPQFVAIFHPMLV-LKGGLSSGYKNHIAENGLND  511

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y      + R+           QV     SLN  + F+L +   ++ ++G  S  +++
Sbjct  512   ETYASDTVGLFRISGTSSHNNKAVQVDVVATSLNTYECFLLQSSSSVFIWHGKQSTHEQQ  571

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A ++++FLK     GV  V   ++G      +S  FW   G      ++  + + + P
Sbjct  572   QLAAKIVEFLKP----GV-TVKHTKEGT-----ESSAFWLGIG-----EKQDFTSNKLAP  616

Query  855   EKT-PPKLF--CIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
             E T  P LF   ++ G+    +     + +L      +LD  SEVFVWVG++T   E+++
Sbjct  617   EATREPHLFSCSVNRGKFEVEEIYNFCQDDLLTEDVMVLDTHSEVFVWVGQSTDSKEKQS  676

Query  1023  ACQTAEEFL  1049
             A +  ++++
Sbjct  677   AFEIGQKYV  685



>ref|XP_006411441.1| hypothetical protein EUTSA_v10016183mg [Eutrema salsugineum]
 gb|ESQ52894.1| hypothetical protein EUTSA_v10016183mg [Eutrema salsugineum]
Length=979

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/359 (76%), Positives = 315/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+D+GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSDHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DD+ IPE TPPKL+CI +GQ+ P+DG+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VANDDETIPESTPPKLYCITDGQMEPIDGDLSKSMLENTKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKAA Q+AEEFL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   DERKAASQSAEEFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  359


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 162/362 (45%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +++W ++     PL K D GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LDVWYVDGKAKTPLAKEDIGKLYSGDCYLVLYTYHSGDRKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             WLGK++ Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  441   WLGKNSIQEDQDTAVRLATTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K   EE+  T          L    G  V   K  QV     SLN  + F+L +   +
Sbjct  500   GYKNSVEEKGSTDETYTPESIALIQVSGTGVHNNKALQVESVATSLNSYECFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +    A +V +FLK     G+  +   ++G      +S  FW   GG   
Sbjct  560   FLWHGNQSGHELLELAAKVAEFLKP----GIT-LKHAKEGT-----ESSTFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         Q+  +    ++ +L     YLLD  +EVFV
Sbjct  610   FISKKASSEIV----RDPHLFSFSFNRGKFQIEEIHN-FAQDDLLTEDIYLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW   
Sbjct  665   WVGQCVDPKEKQTVFEIGQKYVDRAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDHT  722

Query  1149  SA  1154
              A
Sbjct  723   KA  724



>ref|XP_006381007.1| hypothetical protein POPTR_0006s04870g [Populus trichocarpa]
 gb|ERP58804.1| hypothetical protein POPTR_0006s04870g [Populus trichocarpa]
Length=724

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 315/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSTKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKT+ELD +LGG+ VQHRE+Q HESD+FL+YFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTIELDAVLGGRAVQHRELQGHESDKFLAYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVATGFKKAEEEAFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TP KL+ I +G+V  VDGELSK  LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VVSEDDIIPETTPAKLYSITDGEVKMVDGELSKGLLENNKCYLLDCGSEVFLWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+V Q RPKAT+ITRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVVSQNRPKATRITRLIQGYETHSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/318 (25%), Positives = 135/318 (42%), Gaps = 56/318 (18%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G ++ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+
Sbjct  443   GNNSIEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPLVI-LKGGQSSGY  501

Query  495   KKPEEEEF---------ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    E+             L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KNSLAEKGSPDETYTADSVALFRISGTSVHNNKAVQVEAVATSLNPAECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A ++ +FLK                            EL    +P  
Sbjct  562   WHGNQSTFEQQQLAAKIAEFLK----------------------------ELKAHLSP--  591

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGR  995
              +   D  +         F ++ G  QV  +    S+ +L      +LD  +EVFVWVG+
Sbjct  592   -ETVRDPHLFE-------FSLNKGKFQVEEIYN-FSQDDLLTEDILILDTHAEVFVWVGQ  642

Query  996   ATQLDERKAACQTAEEFL  1049
             +    E++      ++++
Sbjct  643   SVDPKEKQIVFDIGQKYI  660



>ref|XP_011075326.1| PREDICTED: villin-2-like [Sesamum indicum]
Length=936

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/359 (79%), Positives = 320/359 (89%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K+LEPAFQ AGQK G EIWRIENF+PVPLPK+DYGKFYSGDSY++LQT+ GKGG 
Sbjct  1     MSSSAKSLEPAFQGAGQKVGTEIWRIENFQPVPLPKSDYGKFYSGDSYIILQTSPGKGGG  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQ+RE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQYRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY+CKGKRVVR+K+VPF+R SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYICKGKRVVRLKKVPFSRSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLKD YH G C+VAIV+DG LQAE DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKDKYHEGKCDVAIVDDGKLQAETDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIPEKTP +L+ I +GQV  +DGELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VATEDDIIPEKTPAQLYSIIDGQVKSIDGELSKSALENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             DERKAA Q AE+F+  Q RPK+T ITRL QG+ET SFK  FDSWPS SA +  EEGRGK
Sbjct  301   DERKAAIQVAEDFVASQNRPKSTHITRLIQGYETHSFKSNFDSWPSGSAPSVAEEGRGK  359


 Score = 98.2 bits (243),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 89/361 (25%), Positives = 162/361 (45%), Gaps = 52/361 (14%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+    E+W I      P+P  D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEGGGK---TEVWCINGSAKTPVPNEDIGKFYSGDCYIVLYTYHSYERKEDYYLCCWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK + +++   AA  +  +   L G+ VQ           F++ F+P ++ L+GG++SG+
Sbjct  443   GKVSVEEDQKMAAKLSTTMCNSLKGRPVQ-----------FVAIFQPMVV-LKGGLSSGY  490

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y   G  ++R+           QV     SLN +D F+L +   I+ 
Sbjct  491   KNYIADKGLNDETYTADGVALIRISGTSRHNNKAVQVEAVATSLNSNDCFLLQSGSSIFS  550

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G     +++    +V +FLK         +   ++G      +S  FW     FA  G
Sbjct  551   WHGNQGTFEQQQLVAKVAEFLKPG-----STIKHTKEG-----TESSSFW-----FALGG  595

Query  822   RKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE    P LF    + G+    +    S+ +L      +LD  +EVFVWV
Sbjct  596   KQNYTSKKVSPEVVRDPHLFAFSFNKGKFEVEEIYNFSQDDLLTEDILILDTHAEVFVWV  655

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G++  L +++ A +  ++++     ++   P    + ++ +G+E   F   F SW  A A
Sbjct  656   GQSVDLKDKQNAFEIGQKYVDMAVSLEGLLPN-VPLYKVTEGNEPCFFTTYF-SWDPAKA  713

Query  1155  T  1157
             +
Sbjct  714   S  714



>ref|XP_002308941.2| Villin 2 family protein [Populus trichocarpa]
 gb|EEE92464.2| Villin 2 family protein [Populus trichocarpa]
Length=950

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 315/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSTKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKT+ELD +LGG+ VQHRE+Q HESD+FL+YFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTIELDAVLGGRAVQHRELQGHESDKFLAYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVATGFKKAEEEAFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TP KL+ I +G+V  VDGELSK  LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VVSEDDIIPETTPAKLYSITDGEVKMVDGELSKGLLENNKCYLLDCGSEVFLWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+V Q RPKAT+ITRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVVSQNRPKATRITRLIQGYETHSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 136/318 (43%), Gaps = 56/318 (18%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G ++ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+
Sbjct  443   GNNSIEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPLVI-LKGGQSSGY  501

Query  495   KK-------PEEEEF--ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K        P+E        L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KNSLAEKGSPDETYTADSVALFRISGTSVHNNKAVQVEAVATSLNPAECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A ++ +FLK                            EL    +P  
Sbjct  562   WHGNQSTFEQQQLAAKIAEFLK----------------------------ELKAHLSP--  591

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGR  995
              +   D  +         F ++ G  QV  +    S+ +L      +LD  +EVFVWVG+
Sbjct  592   -ETVRDPHLFE-------FSLNKGKFQVEEIYN-FSQDDLLTEDILILDTHAEVFVWVGQ  642

Query  996   ATQLDERKAACQTAEEFL  1049
             +    E++      ++++
Sbjct  643   SVDPKEKQIVFDIGQKYI  660



>gb|KDP26061.1| hypothetical protein JCGZ_21094 [Jatropha curcas]
Length=978

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/359 (77%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+DYGKFY GDSY+VLQT+ GKGG 
Sbjct  1     MSSSTKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDYGKFYMGDSYIVLQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+ PEEE FETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFRTPEEEVFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH GVC+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGVCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V SDDDI+PE TP KL+ I NG++  V+GELSK  LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VLSDDDIVPEATPAKLYSITNGEIKAVEGELSKGMLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKAA Q AEEF+  Q RPKAT+ITR+ QG+ET SFK  F SWP+ SA P  EEGRGK
Sbjct  301   DERKAASQAAEEFVKSQGRPKATRITRVIQGYETHSFKSNFGSWPAGSAAPGAEEGRGK  359


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 163/357 (46%), Gaps = 35/357 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GKDSIEEDQKMAVRLASTMSNSLKGRPVQGRIFQGKEPPQFIALFQPMVL-LKGGLSSGY  501

Query  495   KKPEEEEFET---------RLYVCKGK--RVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  E++  T          L+   G      +++QV     SLN    F+L +   I+ 
Sbjct  502   KKHIEDKGLTDGTYTTDCVALFRISGTSPHKNKIEQVDAVATSLNSTQCFLLQSGSSIFL  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG  S  +++  A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WNGNQSTFEQQQLATKVAEFLKP----GV-TLKHAKEGT-----ESSAFWFPLGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGR  995
              K  S +  I        F  + G  QV  V    S+ +L      +LD  +EVFVW+G+
Sbjct  612   SKKASAE--IARDPHLFTFSFNKGKFQVEEVY-NFSQDDLLTEDILILDTHAEVFVWIGQ  668

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             +    E++ A    ++++              + ++ +G+E  SF   + SW ++ A
Sbjct  669   SVDPKEKQNAFDIGQKYIEMAASLDGLSPNVPLYKVTEGNEP-SFFTTYFSWDTSKA  724



>gb|EPS59596.1| hypothetical protein M569_15209, partial [Genlisea aurea]
Length=543

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/360 (78%), Positives = 315/360 (88%), Gaps = 2/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K LEPAFQ  GQK G EIWRIENF+PVPLPK+DYGKFYSGDSY+VLQTT+GKGG 
Sbjct  1     MSTAAKTLEPAFQGVGQKVGTEIWRIENFQPVPLPKSDYGKFYSGDSYIVLQTTAGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREPQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVC+GKRVVR+KQVPF+R SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCRGKRVVRLKQVPFSRSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANS+IQERAKALEVIQFLK+ YH G  +VAIV+DGNLQ E++SGEFW LFGGFAP+ +K
Sbjct  181   GANSDIQERAKALEVIQFLKEKYHEGKSDVAIVDDGNLQVESNSGEFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPEKT P L+ I +G+V  VDG+LSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VASEDDIIPEKTVPLLYSITDGEVKLVDGDLSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP--EEGRGK  1181
             DERKAA Q AE+FL  Q RP +T++TR+ QG+ET SFK  FDSWPS SA PP  EE RGK
Sbjct  301   DERKAAIQVAEDFLAAQSRPSSTRVTRVIQGYETHSFKLNFDSWPSGSALPPVSEEARGK  360


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 81/144 (56%), Gaps = 5/144 (3%)
 Frame = +3

Query  135  PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
            P  +A G+   +E+WRI      P+P  D GKFYSGD Y+VL +   +     + + +W+
Sbjct  386  PLLEAGGK---LEVWRISGNAKTPVPNGDIGKFYSGDCYIVLYSYHSQEKKEDYYLCYWI  442

Query  315  GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
            GKD+++++  TAA  T  +   + G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443  GKDSAEEDRHTAARLTTAIFNTMKGRPVQGRIFQGKEPPQFVAIFEPMVV-LKGGLSSGY  501

Query  495  KK-PEEEEFETRLYVCKGKRVVRM  563
            K    ++      Y   G  ++R+
Sbjct  502  KNYISDKGLNDETYTADGVALIRI  525



>emb|CAN70540.1| hypothetical protein VITISV_034183 [Vitis vinifera]
Length=683

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 316/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK+DYGKFY+GDSY+VLQT+ GKGG 
Sbjct  1     MSSSGKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSDYGKFYTGDSYIVLQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDE+GTAAIKTVELDT+LGG+ VQHRE+Q +ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDESGTAAIKTVELDTVLGGRAVQHRELQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEE FET+LYVCKGKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEVFETQLYVCKGKRVVRLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQF KD YH G C+VAIV+DG L AE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFFKDKYHEGKCDVAIVDDGKLVAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD+IPE TP KL+ I +GQVN V+GELSK+ LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VATEDDVIPETTPAKLYSITDGQVNAVEGELSKAMLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-PPEEGRGK  1181
             ++RKAA Q AEEF+  Q RPKAT+ TR+ QG+ET SFK  FDSWPS SA    EEGRGK
Sbjct  301   EDRKAASQAAEEFVSSQNRPKATRXTRVIQGYETHSFKSNFDSWPSGSAAGGAEEGRGK  359


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 102/202 (50%), Gaps = 15/202 (7%)
 Frame = +3

Query  135  PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
            P  +A G+   IE+WRI      P+ K D GKFYSGD Y+VL T         + +  W+
Sbjct  386  PLLEAGGK---IEVWRINGSAKTPVLKEDIGKFYSGDCYIVLYTYHSGDKKEEYFLCCWI  442

Query  315  GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
            G ++ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443  GNESIEEDQNMAARLANTMFNSLKGRPVQGRIFQGKEPPQFVAIFQPMVV-LKGGMSSGY  501

Query  495  KKP-EEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
            KK   ++      Y      ++R+           QV  A  SLN ++ F+L +   I+ 
Sbjct  502  KKSIADKGLNDETYTADCIALLRISGTSVHNNKVVQVDAAATSLNSNECFLLQSGSSIFT  561

Query  642  FNGANSNIQERAKALEVIQFLK  707
            ++G  S  +++  A +V  FLK
Sbjct  562  WHGNQSTFEQQQLAAKVADFLK  583



>ref|XP_010505982.1| PREDICTED: villin-2 [Camelina sativa]
Length=978

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/359 (75%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+D+GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSDHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDI PE TPPKL+CI +G+V P+DG+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VANDDDITPESTPPKLYCITDGKVEPIDGDLSKSMLENTKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERK A Q+AE+FL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   DERKVASQSAEDFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  359


 Score =   104 bits (260),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 162/365 (44%), Gaps = 41/365 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+W +      PLPK D GK YSGD Y+VL T         + 
Sbjct  381   IEDIPPLLEGGGK---LEVWYVNGNAKTPLPKEDVGKLYSGDCYLVLYTYHAGDRKDNYF  437

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GK ++Q++  TA +    +   L G+ VQ R  +  E  +F++ F+P ++ L+GG
Sbjct  438   LCCWFGKKSNQEDQDTAILLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGG  496

Query  480   VASGFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTK  626
             ++SG+     E   T          L    G  V   K  QV     SLN  + F+L + 
Sbjct  497   LSSGYINSVGETGSTDETYTPESIALIQVSGTGVHNNKAVQVESVATSLNSYECFLLQSG  556

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G  S  ++   A +V +FLK     G+  +   ++G      +S  FW   GG
Sbjct  557   TSMFLWHGNQSAHEQLDLAAKVAEFLKP----GIT-LKHAKEG-----TESSTFWFALGG  606

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSE  974
                   K  S D +      P LF         QV  +    ++ +L     YLLD  +E
Sbjct  607   KQNFTSKKASSDTV----RDPHLFSFSYNREKFQVEEIYN-FAQDDLLTEDIYLLDTHAE  661

Query  975   VFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
             VFVWVG   +  E++   +  ++++     ++   PK   + ++ +G+E   F   F SW
Sbjct  662   VFVWVGHCVETKEKQTVFEIGQKYIDLAGSLEGLSPK-VPLYKINEGNEPCFFTTYF-SW  719

Query  1140  PSASA  1154
                 A
Sbjct  720   DPTKA  724



>ref|XP_010653770.1| PREDICTED: villin-2 [Vitis vinifera]
 emb|CBI29827.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 317/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK+DYGKFY+GDSY+VLQT+ GKGG 
Sbjct  1     MSSSGKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSDYGKFYTGDSYIVLQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDE+GTAAIKTVELDT+LGG+ VQHRE+Q +ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDESGTAAIKTVELDTVLGGRAVQHRELQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEE FETRLYVCKGKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEVFETRLYVCKGKRVVRLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQF KD YH G C+VAIV+DG L AE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFFKDKYHEGKCDVAIVDDGKLVAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD+IPE TP KL+ I +GQVN V+GELSK+ LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VATEDDVIPETTPAKLYSITDGQVNAVEGELSKAMLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-PPEEGRGK  1181
             ++RKAA Q AEEF+  Q RPKAT++TR+ QG+ET SFK  FDSWPS SA    EEGRGK
Sbjct  301   EDRKAASQAAEEFVSSQNRPKATRVTRVIQGYETHSFKSNFDSWPSGSAAGGAEEGRGK  359


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 166/359 (46%), Gaps = 37/359 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A G+   IE+WRI      P+ K D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEAGGK---IEVWRINGSAKTPVLKEDIGKFYSGDCYIVLYTYHSGDKKEEYFLCCWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G ++ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GNESIEEDQNMAARLANTMFNSLKGRPVQGRIFQGKEPPQFVAIFQPMVV-LKGGMSSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+           QV  A  SLN ++ F+L +   I+ 
Sbjct  502   KKSIADKGLNDETYTADCIALLRISGTSVHNNKVVQVDAAATSLNSNECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V  FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WHGNQSTFEQQQLAAKVADFLKP----GVT-LKHAKEGT-----ESSAFWFALGGKQNYT  611

Query  822   RKVTSDDDIIPEKTPPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  S + +      P LF    + G+    +    ++ +L      +LD  +EVFVWVG
Sbjct  612   SKKASQEIV----RDPHLFTFSFNKGKFEVEEIYNFNQDDLLTEDILILDTHAEVFVWVG  667

Query  993   RATQLDERKAACQTAEEFLVKQKRPKATKIT----RLAQGHETISFKCEFDSWPSASAT  1157
             +     E+++A +  ++++      +   +     R+ +G+E   F   F SW S  AT
Sbjct  668   QTVDPKEKQSAFEIGQKYIEVAASLEGLALNVPLYRVTEGNEPCFFTIYF-SWDSTKAT  725



>ref|XP_009133510.1| PREDICTED: villin-2-like [Brassica rapa]
Length=971

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/359 (75%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK ++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSAKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKTEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQ E+GTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQVESGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDD+IPE TPPKL+CI +GQ+ P+DG+LSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VANDDDVIPESTPPKLYCITDGQMEPIDGDLSKSMLENTKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKAA Q+AEEFL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SA P  EEGRGK
Sbjct  301   DERKAANQSAEEFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSAAPGNEEGRGK  359


 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 165/360 (46%), Gaps = 41/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A G+   +E+W ++     PLPK D GKFYSGD Y+VL T         + +  W 
Sbjct  387   PLLEAGGK---LEVWVVDGKAKSPLPKEDIGKFYSGDCYLVLYTYHAGDRKEDYFLCCWF  443

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK + Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+
Sbjct  444   GKSSIQEDQDTAIRLANAMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVI-LKGGLSSGY  502

Query  495   KKPEEEEF---------ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K   EE+             L    G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  503   KSNVEEKGSPDETYTPDSISLIQVSGTGVHNNKALQVEPVATSLNTYECFLLQSGTSMFL  562

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +    A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  563   WHGNQSAHELLELAAKVAEFLKP----GVT-LKHAKEGT-----ESSTFWFALGGKQNFT  612

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EVFVWV
Sbjct  613   SKKASPETV----RDPHLFSFSINRGKFQVEEIYN-FAQDDLLTEDIYLLDTHAEVFVWV  667

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW  + A
Sbjct  668   GQCVDPKEKQTVFEIGQKYIDRAGSLEGLSPK-VPLYKINEGNEPCFFTTYF-SWDHSKA  725



>gb|KDO49840.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
Length=983

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/359 (76%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K+L+PAFQ AGQ+ G EIWRIENF+PVPLPK+++GKFY GD Y+VLQTT GKGG 
Sbjct  1     MSTSAKSLDPAFQGAGQRVGTEIWRIENFQPVPLPKSEHGKFYMGDCYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFRKTEEEEFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGNCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD+I E TPPKL+ I++ QV  V+GELSKS LEN+KCYLLD GSEVFVWVGR TQ+
Sbjct  241   VATEDDVIAETTPPKLYSIEDSQVKIVEGELSKSMLENNKCYLLDRGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK+ +ITR+ QG+ET +FK  FDSWPS S  P  EEGRGK
Sbjct  301   EERKAASQAAEEFISSQNRPKSIRITRVIQGYETYAFKSNFDSWPSGSTAPGAEEGRGK  359


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/362 (27%), Positives = 165/362 (46%), Gaps = 43/362 (12%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       LPK D GKFYSGD Y+VL T         + +  W 
Sbjct  386   PLLEGGGK---MEVWRINGSAKTSLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ ++GG+ SG+
Sbjct  443   GKDSIEEDQKMATRLANTMCNSLKGRPVQGRIFQGREPPQFVALFQPMVV-VKGGLCSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+          +QV     SLN  + F+L +   ++ 
Sbjct  502   KKSLADKGLTDETYTADSIALIRISGTSIHNNKTEQVDAVATSLNSSECFLLQSGSTMFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VAI    + +   +S  FW     F   G
Sbjct  562   WHGNQSTFEQQQLAAKVAEFLKP-------GVAI---KHAKEGTESSAFW-----FPLGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  +   + PE    P LF         QV  V    S+ +L      +LD  +EVFVW
Sbjct  607   KQSYTSKKVSPEIVRDPHLFTFSFNKGAFQVEEVYN-FSQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             VG++    E+++A +  + ++     ++   PK   + ++ +G+E   F   F SW    
Sbjct  666   VGQSVDSKEKQSAFEFGQNYIDMATSLEGLSPKV-PLYKVTEGNEPC-FCTTFFSWDPTK  723

Query  1152  AT  1157
             AT
Sbjct  724   AT  725



>ref|XP_007204293.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
 gb|EMJ05492.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
Length=968

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 315/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIENF+PVPLPK+++GKFY+GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIENFQPVPLPKSEHGKFYTGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF K EEEEFETRLY+CKGKRVVRMKQVPFAR SLNHDDVF+LDT++K++QFN
Sbjct  121   LEGGIASGFTKVEEEEFETRLYICKGKRVVRMKQVPFARSSLNHDDVFILDTENKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VT++DD++PE TPP L+ I  G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VTTEDDVVPEATPPVLYSITGGEVKAVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKA  QTAEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SAT   EEGRGK
Sbjct  301   EDRKAVSQTAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPSGSATSGTEEGRGK  359


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/361 (27%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWFINGGAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A+     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++S +
Sbjct  443   GKDSIEEDQKIASHLANTMSNSLKGRPVQGHLFQGKEPPQLVALFQPMVV-LKGGLSSAY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKHVEEKGLTDETYTEDCVALFRLSGTSVHNNKTVQVDAVAASLNSTECFLLQSGSSIFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG    I+++    ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WNGNQCTIEQQQLLAKLAEFLKP----GV-TLKHAKEGT-----ESSAFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFTFSFNKGKFQVEEIYN-FTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+   L E++ A +  ++++      +  P    + ++ +G+E   F   F +W  A A
Sbjct  666   VGQCVDLKEKQNAFEIGKKYIAMAASLEGLPHNVPLYKVTEGNEPRFFTIYF-AWDHAKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>ref|XP_007204294.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
 ref|XP_007204295.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
 gb|EMJ05493.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
 gb|EMJ05494.1| hypothetical protein PRUPE_ppa000858mg [Prunus persica]
Length=980

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 315/359 (88%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIENF+PVPLPK+++GKFY+GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIENFQPVPLPKSEHGKFYTGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF K EEEEFETRLY+CKGKRVVRMKQVPFAR SLNHDDVF+LDT++K++QFN
Sbjct  121   LEGGIASGFTKVEEEEFETRLYICKGKRVVRMKQVPFARSSLNHDDVFILDTENKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VT++DD++PE TPP L+ I  G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VTTEDDVVPEATPPVLYSITGGEVKAVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKA  QTAEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SAT   EEGRGK
Sbjct  301   EDRKAVSQTAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPSGSATSGTEEGRGK  359


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/361 (27%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWFINGGAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A+     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++S +
Sbjct  443   GKDSIEEDQKIASHLANTMSNSLKGRPVQGHLFQGKEPPQLVALFQPMVV-LKGGLSSAY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKHVEEKGLTDETYTEDCVALFRLSGTSVHNNKTVQVDAVAASLNSTECFLLQSGSSIFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG    I+++    ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WNGNQCTIEQQQLLAKLAEFLKP----GVT-LKHAKEGT-----ESSAFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFTFSFNKGKFQVEEIYN-FTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+   L E++ A +  ++++      +  P    + ++ +G+E   F   F +W  A A
Sbjct  666   VGQCVDLKEKQNAFEIGKKYIAMAASLEGLPHNVPLYKVTEGNEPRFFTIYF-AWDHAKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>gb|KDO49841.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
 gb|KDO49842.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
 gb|KDO49843.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
 gb|KDO49844.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
Length=983

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/359 (76%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K+L+PAFQ AGQ+ G EIWRIENF+PVPLPK+++GKFY GD Y+VLQTT GKGG 
Sbjct  1     MSTSAKSLDPAFQGAGQRVGTEIWRIENFQPVPLPKSEHGKFYMGDCYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFRKTEEEEFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGNCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD+I E TPPKL+ I++ QV  V+GELSKS LEN+KCYLLD GSEVFVWVGR TQ+
Sbjct  241   VATEDDVIAETTPPKLYSIEDSQVKIVEGELSKSMLENNKCYLLDRGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK+ +ITR+ QG+ET +FK  FDSWPS S  P  EEGRGK
Sbjct  301   EERKAASQAAEEFISSQNRPKSIRITRVIQGYETYAFKSNFDSWPSGSTAPGAEEGRGK  359


 Score =   108 bits (271),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 166/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       LPK D GKFYSGD Y+VL T         + +  W 
Sbjct  386   PLLEGGGK---MEVWRINGSAKTSLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ ++GG+ SG+
Sbjct  443   GKDSIEEDQKMATRLANTMCNSLKGRPVQGRIFQGREPPQFVALFQPMVV-VKGGLCSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+          +QV     SLN  + F+L +   ++ 
Sbjct  502   KKSLADKGLTDETYTADSIALIRISGTSIHNNKTEQVDAVATSLNSSECFLLQSGSTMFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VAI    + +   +S  FW     F   G
Sbjct  562   WHGNQSTFEQQQLAAKVAEFLKP-------GVAI---KHAKEGTESSAFW-----FPLGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE    P LF    + G+    +    S+ +L      +LD  +EVFVWV
Sbjct  607   KQSYTSKKVSPEIVRDPHLFTFSFNKGKFEVEEVYNFSQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G++    E+++A +  + ++     ++   PK   + ++ +G+E   F   F SW    A
Sbjct  667   GQSVDSKEKQSAFEFGQNYIDMATSLEGLSPKV-PLYKVTEGNEPC-FCTTFFSWDPTKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>gb|EYU18732.1| hypothetical protein MIMGU_mgv1a000936mg [Erythranthe guttata]
Length=938

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/359 (78%), Positives = 318/359 (89%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KALEPAF+ AGQK G E WRIENF+PVPLPK+DYGKFYSGDSY++LQT+ GKGG 
Sbjct  1     MSSSAKALEPAFRGAGQKIGTETWRIENFQPVPLPKSDYGKFYSGDSYIILQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQYRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLY+CKGKRVVR+KQVPF+R SLNHDDVF+LD+KDKIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYICKGKRVVRLKQVPFSRSSLNHDDVFILDSKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG LQAE DSGEFW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLQAETDSGEFWVLFGGFAPIAKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIPEKTP +L  I +GQVN +DGELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VATEDDIIPEKTPAQLHSIIDGQVNSIDGELSKSLLENNKCYLLDCGAEVFVWVGRVTQI  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             DERKAA Q AE+F+  Q RPK+T ITRL QG+ET SFK  FDSWPS SA +  EEGRGK
Sbjct  301   DERKAAIQAAEDFVTSQNRPKSTHITRLIQGYETHSFKASFDSWPSGSAPSVAEEGRGK  359


 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 93/359 (26%), Positives = 163/359 (45%), Gaps = 37/359 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+    E+W I +     +PK D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEGGGK---TEVWCINSSAKTSVPKEDVGKFYSGDCYIVLYTYHSHERKEDYYLCSWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA  +  +   L GK VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GKDSIEEDRQMAAKLSTTMYNSLKGKPVQGRIFQGKEPPQFVAIFQPMVI-LKGGMSSGY  501

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    ++      Y   G  ++R+           QV     SLN ++ F+L +   I+ 
Sbjct  502   KNYIADKGLNDETYTADGVALIRISGTSPHNNKAVQVEAVATSLNSNECFLLQSGSSIFN  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G     +++  A ++ +FLK         V   ++G      +S  FW   GG     
Sbjct  562   WHGTQGTFEQQQLAAKIAEFLKPG-----STVKHSKEGT-----ESSSFWFALGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K    D +      P LF    + G+    +    S+ +L      +LD  +EVFVWVG
Sbjct  612   SKKLPSDAV----RDPHLFTFSFNKGKFEVEEIYNFSQDDLLTEDILILDTHAEVFVWVG  667

Query  993   RATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
              +    E++ A +  ++++      +  P    + ++ +G+E   F   F SW +A A+
Sbjct  668   HSVDSKEKQNAFEIGQKYVEMAASLEGLPPYVPLYKVTEGNEPCFFTTYF-SWDTAKAS  725



>ref|XP_011048056.1| PREDICTED: villin-3-like isoform X1 [Populus euphratica]
 ref|XP_011048057.1| PREDICTED: villin-3-like isoform X1 [Populus euphratica]
 ref|XP_011048058.1| PREDICTED: villin-3-like isoform X1 [Populus euphratica]
Length=978

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSTKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKT+ELD +LGG+ VQHRE+Q HESD+FL+YFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTIELDAVLGGRAVQHRELQGHESDKFLAYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FETRLY C+GKRVVRMKQVPFAR SLNHDDVF+LDT++K+YQFN
Sbjct  121   LEGGVATGFKKAEEEAFETRLYACRGKRVVRMKQVPFARSSLNHDDVFILDTENKVYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TP KL+ I +G+V  VDGELSK  LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPAKLYSIADGEVKMVDGELSKGLLENNKCYLLDCGSEVFLWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+V Q RPKAT+ITRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVVSQNRPKATRITRLIQGYETHSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/320 (27%), Positives = 147/320 (46%), Gaps = 35/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G D+ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+
Sbjct  443   GNDSIEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPLVI-LKGGQSSGY  501

Query  495   KKPEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF  644
             K    E+     Y      + R+           Q+     SLN  + F+L +   I+ +
Sbjct  502   KNSLAEKGSDETYTADSVALFRISGTSVHNNKAVQIKAVASSLNPAECFLLQSGSSIFTW  561

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             +G  S  +++  A ++ +FLK         VA+    + +   +S  FW     FA  G+
Sbjct  562   HGNQSTFEQQQLAAKIAEFLKP-------GVAL---KHAKEGTESSSFW-----FALGGK  606

Query  825   KVTSDDDIIPEKT-PPKLFC--IDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
             +  +   + PE    P LF   ++ G  QV  +    S+ +L      +LD  +EVFVWV
Sbjct  607   QSYTSKKVSPETVRDPHLFTFSLNKGKFQVEEIY-NFSQDDLLTEDILILDTHAEVFVWV  665

Query  990   GRATQLDERKAACQTAEEFL  1049
             G++    E++      ++++
Sbjct  666   GQSVDPKEKQIVFDIGQKYI  685



>ref|XP_011048059.1| PREDICTED: villin-3-like isoform X2 [Populus euphratica]
Length=976

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSTKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKT+ELD +LGG+ VQHRE+Q HESD+FL+YFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTIELDAVLGGRAVQHRELQGHESDKFLAYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FETRLY C+GKRVVRMKQVPFAR SLNHDDVF+LDT++K+YQFN
Sbjct  121   LEGGVATGFKKAEEEAFETRLYACRGKRVVRMKQVPFARSSLNHDDVFILDTENKVYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TP KL+ I +G+V  VDGELSK  LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPAKLYSIADGEVKMVDGELSKGLLENNKCYLLDCGSEVFLWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+V Q RPKAT+ITRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVVSQNRPKATRITRLIQGYETHSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/320 (27%), Positives = 147/320 (46%), Gaps = 35/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G D+ +++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+
Sbjct  443   GNDSIEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPLVI-LKGGQSSGY  501

Query  495   KKPEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF  644
             K    E+     Y      + R+           Q+     SLN  + F+L +   I+ +
Sbjct  502   KNSLAEKGSDETYTADSVALFRISGTSVHNNKAVQIKAVASSLNPAECFLLQSGSSIFTW  561

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             +G  S  +++  A ++ +FLK         VA+    + +   +S  FW     FA  G+
Sbjct  562   HGNQSTFEQQQLAAKIAEFLKP-------GVAL---KHAKEGTESSSFW-----FALGGK  606

Query  825   KVTSDDDIIPEKT-PPKLFC--IDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
             +  +   + PE    P LF   ++ G  QV  +    S+ +L      +LD  +EVFVWV
Sbjct  607   QSYTSKKVSPETVRDPHLFTFSLNKGKFQVEEIY-NFSQDDLLTEDILILDTHAEVFVWV  665

Query  990   GRATQLDERKAACQTAEEFL  1049
             G++    E++      ++++
Sbjct  666   GQSVDPKEKQIVFDIGQKYI  685



>ref|XP_010508658.1| PREDICTED: villin-2-like [Camelina sativa]
Length=980

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+D+GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSDHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK  EEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKTAEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDI PE TPPKL+CI +G+V P+DG+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VANDDDITPESTPPKLYCITDGKVEPIDGDLSKSMLENTKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERK A Q+AE+ L  + RPKAT++TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   DERKVANQSAEDLLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  359


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 93/367 (25%), Positives = 163/367 (44%), Gaps = 43/367 (12%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+W +      PLPK D GK YSGD Y+VL T         + 
Sbjct  381   IEDIPPLLEGGGK---LEVWYVNGNAKTPLPKEDVGKLYSGDCYLVLYTYHAGDRKDNYF  437

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GK ++Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG
Sbjct  438   LCCWFGKKSNQEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGG  496

Query  480   VASGFKKPEEEEFET-RLYVCKGKRVVRMK------------QVPFARPSLNHDDVFVLD  620
             ++SG+     E   T   Y  +   ++++             QV     SLN  + F+L 
Sbjct  497   LSSGYMNSVGETGSTDETYTPESIALIQVSGTGVHXDRTXAVQVESVATSLNSYECFLLQ  556

Query  621   TKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELF  800
             +   ++ ++G  S  ++   A +V +FLK     G+  +   ++G      +S  FW   
Sbjct  557   SGTSMFLWHGNQSAHEQLDLAAKVAEFLKP----GIT-LKHAKEG-----TESSTFWFAL  606

Query  801   GGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCG  968
             GG      K  S D +      P LF         QV  +    ++ +L     YLLD  
Sbjct  607   GGKQNFTSKKASSDTV----RDPHLFSFSYNRGKFQVEEIYN-FAQDDLLTEDIYLLDTH  661

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFD  1133
             +EVFVWVG   +  E++   +  ++++     ++   PK   + ++ +G+E   F   F 
Sbjct  662   AEVFVWVGHCVETKEKQTVFEIGQKYIDLAGSLEGLSPK-VPLYKINEGNEPCFFTTYF-  719

Query  1134  SWPSASA  1154
             SW    A
Sbjct  720   SWDPTKA  726



>ref|XP_008443130.1| PREDICTED: villin-3 [Cucumis melo]
 ref|XP_008443131.1| PREDICTED: villin-3 [Cucumis melo]
Length=986

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQA GQ+ G EIWRIENF+PVPLPK+DYGKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSAKVLDPAFQAVGQRVGTEIWRIENFQPVPLPKSDYGKFYMGDSYIVLQTTQGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +L+DIHFW+G+DTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HES++FLSYFKPCI+P
Sbjct  61    FLYDIHFWIGRDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KI+QFN
Sbjct  121   LEGGVASGFKKPEEEQFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLKD  H G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQFLKDKNHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P KL+ ID G+V  VDGELSKS LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VASEDDIIPESAPAKLYSIDGGEVKVVDGELSKSLLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPKAT++TR+ QG+ET SFK  F+SWP  S T   EEGRGK
Sbjct  301   EERKAAIQVAEEFIASQNRPKATRVTRVIQGYETHSFKSNFESWPVGSVTTGAEEGRGK  359


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 162/354 (46%), Gaps = 39/354 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWRINGSAKTPLLAEDIGKFYSGDCYIILYTYHSGERKEDYFLCSWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A   T  +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GKDSIEEDQKMATRLTNTMSNSLKGRPVQGRIFEGKEPPQFIALFQPFVV-LKGGLSSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+           QV     SLN  + FVL +   ++ 
Sbjct  502   KKVIADKALADETYTEDSVALIRLSQTSIHNNKAVQVEAVATSLNSAECFVLQSGSSVFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WHGNQSTFEQQQLAAKVAEFLKP----GVT-LKHAKEG-----TESSTFWFALGGKQSYN  611

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S D +      P L  F  + G  QV  +    S+ +L      +LD  +EVF+WV
Sbjct  612   SKKVSQDTV----RDPHLYAFSFNRGKFQVEEIYN-FSQDDLLTEDILILDTQAEVFIWV  666

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSW  1139
             G++    E++ A +  ++++      +       + ++++G+E   F   F SW
Sbjct  667   GQSVDPKEKQNAWEIGQKYVEMAASLEGLSPNVPLYKISEGNEPCFFTTYF-SW  719



>ref|XP_006489971.1| PREDICTED: villin-3-like isoform X1 [Citrus sinensis]
 ref|XP_006489972.1| PREDICTED: villin-3-like isoform X2 [Citrus sinensis]
Length=983

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K+L+PAFQ AGQ+ G EIWRIENF+PVPLPK+++GKFY GD Y+VLQTT GKGG 
Sbjct  1     MSTSAKSLDPAFQGAGQRVGTEIWRIENFQPVPLPKSEHGKFYMGDCYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFRKTEEEEFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGNCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD+I E TPPKL+ I++ QV  V+ ELSKS LEN+KCYLLD GSEVFVWVGR TQ+
Sbjct  241   VATEDDVIAETTPPKLYSIEDSQVKIVEVELSKSMLENNKCYLLDRGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK+ +ITR+ QG+ET +FK  FDSWPS S  P  EEGRGK
Sbjct  301   EERKAASQAAEEFISSQNRPKSIRITRVIQGYETYAFKSNFDSWPSGSTAPGAEEGRGK  359


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 166/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       LPK D GKFYSGD Y+VL T         + +  W 
Sbjct  386   PLLEGGGK---MEVWRINGSAKTSLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ ++GG+ SG+
Sbjct  443   GKDSIEEDQKMATRLANTMCNSLKGRPVQGRIFQGREPPQFVALFQPMVV-VKGGLCSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+          +QV     SLN  + F+L +   ++ 
Sbjct  502   KKSLADKGLTDETYTADSIALIRISGTSIHNNKTEQVDAVATSLNSSECFLLQSGSTMFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VAI    + +   +S  FW     F   G
Sbjct  562   WHGNQSTFEQQQLAAKVAEFLKP-------GVAI---KHAKEGTESSAFW-----FPLGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE    P LF    + G+    +    S+ +L      +LD  +EVFVWV
Sbjct  607   KQSYTSKKVSPEIVRDPHLFTFSFNKGKFEVEEVYNFSQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G++    E+++A +  + ++     ++   PK   + ++ +G+E   F   F SW    A
Sbjct  667   GQSVDSKEKQSAFEFGQNYIDMATSLECLSPKV-PLYKVTEGNEPCFFTT-FFSWDPTKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>ref|XP_009142774.1| PREDICTED: villin-2 [Brassica rapa]
Length=973

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDIIPE TPPKL+ I +GQ+  +DG+L+KS LEN+KCYLLDCG+EVF+WVGR TQ+
Sbjct  241   VANDDDIIPESTPPKLYSIIDGQMEAIDGDLTKSMLENTKCYLLDCGAEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERKAA Q+ E++L  + RPKAT++TR+ QG+E+ SFK  FDSWPS S+ P  EEGRGK
Sbjct  301   DERKAASQSVEDYLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSSAPSNEEGRGK  359


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 100/360 (28%), Positives = 162/360 (45%), Gaps = 41/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A G+   +E+W +      PLPK D GK YSGD Y+VL T         F +  W 
Sbjct  386   PLLEAGGK---LEVWYVNGKAKTPLPKEDIGKLYSGDCYLVLYTYHSGERKDEFFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK+++QD+  TA      +   L G+ VQ R  +  E  +F++ F+P I+ L+GG++SG+
Sbjct  443   GKNSTQDDQETALRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMII-LKGGLSSGY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K   EE+             L    G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KNMVEEKGSADETYTPDSIALIQVSGTGVHNHKALQVEPVATSLNSYECFLLQSGTSMFL  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +    A +V + LK         +   ++G      +S  FW   GG     
Sbjct  562   WHGNQSAHELLELAAKVAEILKPG-----MTLKHAKEGT-----ESSTFWFALGGKQNFT  611

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  + + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EVFVWV
Sbjct  612   SKKAASETV----RDPHLYSFSINRGKFQVEEIYN-FAQDDLLTEDVYLLDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW S  A
Sbjct  667   GQCVDPKEKQTVFEIGQKYVERAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDSTKA  724



>emb|CDX79917.1| BnaA05g02390D [Brassica napus]
Length=973

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDIIPE TPPKL+ I +GQ+  +DG+L+KS LEN+KCYLLDCG+EVF+WVGR TQ+
Sbjct  241   VANDDDIIPESTPPKLYSIIDGQMEAIDGDLTKSMLENTKCYLLDCGAEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERKAA Q+ E++L  + RPKAT++TR+ QG+E+ SFK  FDSWPS S+ P  EEGRGK
Sbjct  301   DERKAASQSVEDYLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSSAPSNEEGRGK  359


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/360 (28%), Positives = 161/360 (45%), Gaps = 41/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A G+   +E+W +      PLPK D GK YSGD Y+VL T         F +  W 
Sbjct  386   PLLEAGGK---LEVWYVNGKAKTPLPKEDIGKLYSGDCYLVLYTYHSGDRKDEFFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK++ Q++  TA      +   L G+ VQ R  +  E  +F++ F+P I+ L+GG++SG+
Sbjct  443   GKNSIQEDQETALRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMII-LKGGLSSGY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K   EE+             L    G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KNMVEEKGSADETYTPDSIALIQVSGTGVHNHKALQVEPVATSLNSYECFLLQSGTSMFL  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +    A +V + LK         +   ++G      +S  FW   GG     
Sbjct  562   WHGNQSAHELLELAAKVAEILKPG-----MTLKHAKEGT-----ESSTFWFALGGKQNFT  611

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  + + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EVFVWV
Sbjct  612   SKKAASETV----RDPHLYSFSINRGKFQVEEIYN-FAQDDLLTEDIYLLDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW S  A
Sbjct  667   GQCVDPKEKQTVFEIGQKYVERAGSLEGLSPK-VPLYKVTEGNEPCFFTTYF-SWDSTKA  724



>emb|CDY23826.1| BnaC04g02110D [Brassica napus]
Length=973

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDD IPE TPPKL+ I +GQ+  +DG+L+KS LEN+KCYLLDCG+EVF+WVGR TQ+
Sbjct  241   VANDDDTIPESTPPKLYSIIDGQMEAIDGDLTKSMLENTKCYLLDCGAEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERKAA Q+ E++L  + RPKAT++TR+ QG+E+ SFK  FDSWPS SA P  EEGRGK
Sbjct  301   DERKAASQSVEDYLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSAAPSNEEGRGK  359


 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 162/362 (45%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +A G+   +E+W +      PL K D GK YSGD Y+VL T         F +  
Sbjct  384   IPPLLEAGGK---LEVWYVNGKAKTPLAKEDIGKLYSGDCYLVLYTYHSGDRKDEFFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+P I+ L+GG++S
Sbjct  441   WFGKNSTQEDQETALRLASTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMII-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K   EE+             L    G  V   K  QV     SLN  + F+L +   +
Sbjct  500   GYKNMVEEKGSADETYTPDLIALIQVSGTGVHNHKALQVEPVATSLNSYECFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +    A +V + LK         +   ++G      +S  FW   GG   
Sbjct  560   FLWHGNQSAHELLELAAKVAEILKPG-----MTLKHAKEGT-----ESSTFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  + + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EVFV
Sbjct  610   FTSKKAASETV----RDPHLYSFSINRGKFQVEEIYN-FAQDDLLTEDIYLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW S 
Sbjct  665   WVGQCVDPKEKQTVFEIGQKYVERAGSLEGLSPK-VPLYKVTEGNEPCFFTTYF-SWDST  722

Query  1149  SA  1154
              A
Sbjct  723   KA  724



>ref|NP_565958.1| villin 2 [Arabidopsis thaliana]
 sp|O81644.2|VILI2_ARATH RecName: Full=Villin-2 [Arabidopsis thaliana]
 gb|AAL85012.1| putative villin 2 protein [Arabidopsis thaliana]
 gb|AAC02774.2| putative villin 2 [Arabidopsis thaliana]
 gb|AAM91716.1| putative villin 2 protein [Arabidopsis thaliana]
 dbj|BAE98961.1| putative villin 2 protein [Arabidopsis thaliana]
 gb|AEC10027.1| villin 2 [Arabidopsis thaliana]
Length=976

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/357 (74%), Positives = 312/357 (87%), Gaps = 1/357 (0%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYL  293
             ++ K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG YL
Sbjct  1     MSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQNKGGAYL  60

Query  294   FDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLE  473
             FDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+PLE
Sbjct  61    FDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIPLE  120

Query  474   GGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGA  653
             GGVASGFK  EEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNGA
Sbjct  121   GGVASGFKTVEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNGA  180

Query  654   NSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVT  833
             NSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRKV 
Sbjct  181   NSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKVA  240

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
             +DDDI+PE TPPKL+CI +G++ P+DG+LSKS LEN+KCYLLDCG+E+++WVGR TQ+DE
Sbjct  241   NDDDIVPESTPPKLYCITDGKMEPIDGDLSKSMLENTKCYLLDCGAEIYIWVGRVTQVDE  300

Query  1014  RKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             RKAA Q+AEEFL  + RPKAT +TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   RKAASQSAEEFLASENRPKATHVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  357


 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 164/362 (45%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  ++ G+   +E+W +      PLPK D GK YSGD Y+VL T         + +  
Sbjct  382   IPPLLESGGK---LEVWYVNGKVKTPLPKEDIGKLYSGDCYLVLYTYHSGERKDEYFLSC  438

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK +  ++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  439   WFGKKSIPEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  497

Query  489   GFKKPE-EEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E E     Y  +   +V++           QV     SLN  + F+L +   +
Sbjct  498   GYKSSMGESESTDETYTPESIALVQVSGTGVHNNKAVQVETVATSLNSYECFLLQSGTSM  557

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  ++   A +V +FLK     G+  +   ++G      +S  FW   GG   
Sbjct  558   FLWHGNQSTHEQLELATKVAEFLKP----GIT-LKHAKEG-----TESSTFWFALGGKQN  607

Query  816   MGRKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + I      P L  F  + G  QV  +    ++ +L     Y LD  +EVFV
Sbjct  608   FTSKKASSETI----RDPHLFSFAFNRGKFQVEEIYN-FAQDDLLTEDIYFLDTHAEVFV  662

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+  +  E++   +  ++++     ++   PK   I ++ +G+E   F   F SW + 
Sbjct  663   WVGQCVEPKEKQTVFEIGQKYIDLAGSLEGLHPK-VPIYKINEGNEPCFFTTYF-SWDAT  720

Query  1149  SA  1154
              A
Sbjct  721   KA  722



>ref|XP_010554829.1| PREDICTED: villin-3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010554830.1| PREDICTED: villin-3 isoform X1 [Tarenaya hassleriana]
Length=977

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K LEPAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD Y++LQTT  KGG 
Sbjct  1     MSSSTKVLEPAFQGVGQKPGTEIWRIENFQPVPVPKSEHGKFYMGDCYIILQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ +ESD+FLSYFKPCI+P
Sbjct  61    YQYDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+KPEEEEFETRLY CKGKR VR+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKPEEEEFETRLYTCKGKRAVRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DD+IPE TPPKL  I NGQ+ P++G+LSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VASEDDVIPETTPPKLSSIVNGQLEPIEGDLSKSMLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AE+FL  + RPKAT+I+R+ QG+E  SFK  FDSWPS SA P  EEGRGK
Sbjct  301   EERKAASQAAEDFLASENRPKATRISRVIQGYEPHSFKSIFDSWPSGSAAPGNEEGRGK  359


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 90/361 (25%), Positives = 156/361 (43%), Gaps = 39/361 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     PL K D GKFYSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWCIDGKAKTPLAKEDIGKFYSGDCYLVLYTYHSGDRKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK + Q++  T       +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  441   WFGKHSIQEDQETVIRLANTMFNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  499

Query  489   GFKK-------PEEEEFETRLYVCK----GKRVVRMKQVPFARPSLNHDDVFVLDTKDKI  635
             G+K        P+E      + + +    G    +  QV     SLN  + F+L +   +
Sbjct  500   GYKNSVAEKGSPDETYMPESIALIQVSGTGVHNNKALQVDAVATSLNSYECFLLQSGSSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +++  A +V + LK         +   ++G      +S  FW   GG   
Sbjct  560   FLWHGNQSTHEQQQLAAKVAEILKPG-----ITIKHAKEGT-----ESSSFWYALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +    ++ +L     Y+LD  +EVFV
Sbjct  610   FTSKKASSETV----RDPHLFSFSFNKGKFQVEEIYN-FAQDDLLTEDMYILDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             WVG+     E++      + ++      +  P    + ++ +G+E   F   F SW  A 
Sbjct  665   WVGQCVDSKEKQMTFDIGQRYIEMAAALEGLPLKVPLYKITEGNEPCFFTTYF-SWEPAK  723

Query  1152  A  1154
             A
Sbjct  724   A  724



>ref|XP_010554831.1| PREDICTED: villin-3 isoform X2 [Tarenaya hassleriana]
Length=976

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K LEPAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD Y++LQTT  KGG 
Sbjct  1     MSSSTKVLEPAFQGVGQKPGTEIWRIENFQPVPVPKSEHGKFYMGDCYIILQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ +ESD+FLSYFKPCI+P
Sbjct  61    YQYDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+KPEEEEFETRLY CKGKR VR+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKPEEEEFETRLYTCKGKRAVRLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DD+IPE TPPKL  I NGQ+ P++G+LSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VASEDDVIPETTPPKLSSIVNGQLEPIEGDLSKSMLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AE+FL  + RPKAT+I+R+ QG+E  SFK  FDSWPS SA P  EEGRGK
Sbjct  301   EERKAASQAAEDFLASENRPKATRISRVIQGYEPHSFKSIFDSWPSGSAAPGNEEGRGK  359


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 90/361 (25%), Positives = 156/361 (43%), Gaps = 39/361 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     PL K D GKFYSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWCIDGKAKTPLAKEDIGKFYSGDCYLVLYTYHSGDRKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK + Q++  T       +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  441   WFGKHSIQEDQETVIRLANTMFNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  499

Query  489   GFKK-------PEEEEFETRLYVCK----GKRVVRMKQVPFARPSLNHDDVFVLDTKDKI  635
             G+K        P+E      + + +    G    +  QV     SLN  + F+L +   +
Sbjct  500   GYKNSVAEKGSPDETYMPESIALIQVSGTGVHNNKALQVDAVATSLNSYECFLLQSGSSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +++  A +V + LK         +   ++G      +S  FW   GG   
Sbjct  560   FLWHGNQSTHEQQQLAAKVAEILKPG-----ITIKHAKEGT-----ESSSFWYALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +    ++ +L     Y+LD  +EVFV
Sbjct  610   FTSKKASSETV----RDPHLFSFSFNKGKFQVEEIYN-FAQDDLLTEDMYILDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             WVG+     E++      + ++      +  P    + ++ +G+E   F   F SW  A 
Sbjct  665   WVGQCVDSKEKQMTFDIGQRYIEMAAALEGLPLKVPLYKITEGNEPCFFTTYF-SWEPAK  723

Query  1152  A  1154
             A
Sbjct  724   A  724



>ref|XP_006295976.1| hypothetical protein CARUB_v10025119mg [Capsella rubella]
 gb|EOA28874.1| hypothetical protein CARUB_v10025119mg [Capsella rubella]
Length=973

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/358 (75%), Positives = 310/358 (87%), Gaps = 1/358 (0%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             S + K L+PAFQ AGQK G EIWRIENF+ VP+PK+D+GKFY GD+Y+VLQTT  KGG Y
Sbjct  3     SGSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSDHGKFYMGDTYIVLQTTQNKGGAY  62

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
             LFDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+PL
Sbjct  63    LFDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIPL  122

Query  471   EGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNG  650
             EGGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNG
Sbjct  123   EGGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNG  182

Query  651   ANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKV  830
             ANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRKV
Sbjct  183   ANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKV  242

Query  831   TSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLD  1010
              +DDDI PE TPPKL+ I +G+V P+DG+LSKS LEN+KCYLLDCG+EVF+WVGR TQ+D
Sbjct  243   ANDDDITPESTPPKLYSITDGKVEPIDGDLSKSMLENTKCYLLDCGAEVFIWVGRVTQVD  302

Query  1011  ERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ERKAA Q AEEFL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SAT   EEGRGK
Sbjct  303   ERKAASQFAEEFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSATTGNEEGRGK  360


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 161/361 (45%), Gaps = 39/361 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             ++ + P  +  G+   +E+W +      PLPK D GK YSGD Y+VL T         F 
Sbjct  382   IEDIPPLLEGGGK---LEVWYVNGKAKTPLPKEDVGKLYSGDCYLVLYTYHSGDRKDEFF  438

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GK++ Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG
Sbjct  439   LCCWFGKNSIQEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVI-LKGG  497

Query  480   VASGFK------KPEEEEF---ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTK  626
             ++SG+        P +E +      L    G  V   K  QV     SLN  + F+L + 
Sbjct  498   LSSGYSISVGETGPTDETYTPESIALIQVSGTGVHNNKAVQVESVATSLNSYECFLLQSG  557

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G  S  ++   A +V +FLK     G+  +   ++G      +S  FW   GG
Sbjct  558   TSMFLWHGNQSAHEQLEVAAKVAEFLKP----GIT-LKHAKEGT-----ESSTFWFALGG  607

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
                   K  S + I      P LF       N      ++ +L     YLLD  +EVFVW
Sbjct  608   KQNFTSKKASSETI----RDPHLFSF---SYNREIYNFAQDDLLTEDVYLLDTHAEVFVW  660

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             VG      E++   +  ++++     ++   PK   + R+ +G+E   F   F SW S  
Sbjct  661   VGHCVDPKEKQTVFEIGQKYIDLAGSLEGLSPK-VPLYRINEGNEPCFFTTYF-SWDSTK  718

Query  1152  A  1154
             A
Sbjct  719   A  719



>ref|XP_010545843.1| PREDICTED: villin-3-like [Tarenaya hassleriana]
Length=982

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/359 (75%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PV +PK+++GKFY GDSY++LQTT  KGG 
Sbjct  1     MSASTKVLDPAFQGIGQKPGTEIWRIENFQPVLVPKSEHGKFYMGDSYIILQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFW+GKDTSQDEAGTAA KTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YQYDIHFWIGKDTSQDEAGTAAAKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+KPEEEEFETRLY+CKGKR VR+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKPEEEEFETRLYICKGKRAVRLKQVPFARASLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TPPKL+ I NGQ+ P++G+LSKS LEN KCY LDCG+EVFVWVGR TQ+
Sbjct  241   VASEDDIIPETTPPKLYSIANGQLEPIEGDLSKSLLENDKCYFLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AE+ L  + RPKAT ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKAASQAAEDCLASENRPKATLITRVIQGYEPHSFKSNFDSWPSGSATPGSEEGRGK  359


 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 163/362 (45%), Gaps = 40/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W ++     PL K D GKFYSGDSY+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWCVDGKAKTPLAKEDIGKFYSGDSYLVLYTYHSGDRKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W G  + Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  441   WFGNHSIQEDQETALRLANTMFNSLKGRPVQGRIHEGKEPPQFIALFQPMVV-LKGGLSS  499

Query  489   GFKK-------PEEEEFET---RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDK  632
             G+K        PEEE + +    L    G  V   K  QV     SLN  + F+L +   
Sbjct  500   GYKNSGAEKGSPEEEAYTSDSIALIQVSGTGVHNNKALQVEAIATSLNSYECFLLQSGSS  559

Query  633   IYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFA  812
             ++ ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW   GG  
Sbjct  560   MFLWHGNQSTHEQQQLAAKVAEFLKP----GV-TIKHAKEGT-----ESSSFWFALGGKQ  609

Query  813   PMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVF  980
                 K  S + +      P LF         QV  +    ++ +L     Y+LD  +EVF
Sbjct  610   NFTSKKASSETV----RDPHLFSFSFNKGKFQVEEIHN-FAQDDLLTEDMYVLDTHAEVF  664

Query  981   VWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             VWVG+     E++ A    + ++      +  P    + ++ +G+E   F   F SW  A
Sbjct  665   VWVGQYVDSKEKQTAFDIGQRYIEMAASLEGLPLKVPLYKITEGNEPCFFTTYF-SWEPA  723

Query  1149  SA  1154
              A
Sbjct  724   KA  725



>ref|XP_008222112.1| PREDICTED: villin-3-like isoform X1 [Prunus mume]
 ref|XP_008222113.1| PREDICTED: villin-3-like isoform X1 [Prunus mume]
Length=980

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIENF+P PLPK+++GKFY GDSY++LQT+  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIENFQPAPLPKSEHGKFYMGDSYIILQTSQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDT++K++QFN
Sbjct  121   LEGGIASGFTKVEEEEFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTQNKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHHGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD++PE TPP L+ I  G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VITEDDVVPEATPPILYSITGGEVKAVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKA  QTAEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SAT   EEGRGK
Sbjct  301   EDRKAVSQTAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPSGSATSGAEEGRGK  359


 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWFINGGAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   A+     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++S +
Sbjct  443   GKDSIQEDQKIASHLANTMSNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSAY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKHVEEKGLTDETYTEDCVALFRLSGTSVHNNKTVQVDAVAASLNSTECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG    I+++    ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WNGNQCTIEQQQLLAKLAEFLKP----GV-TLKHAKEGT-----ESSAFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFTFSFNKGKFQVEEIYN-FTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+   L E++ A +  ++++      +  P    + ++ +G+E   F   F +W  A A
Sbjct  666   VGQCVDLKEKQNAFEIGKKYIAMAASLEGLPHNVPLYKVTEGNEPRFFTIYF-AWDHAKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>ref|XP_008222114.1| PREDICTED: villin-2-like isoform X2 [Prunus mume]
Length=968

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIENF+P PLPK+++GKFY GDSY++LQT+  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIENFQPAPLPKSEHGKFYMGDSYIILQTSQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDT++K++QFN
Sbjct  121   LEGGIASGFTKVEEEEFETRLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTQNKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHHGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD++PE TPP L+ I  G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VITEDDVVPEATPPILYSITGGEVKAVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKA  QTAEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SAT   EEGRGK
Sbjct  301   EDRKAVSQTAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPSGSATSGAEEGRGK  359


 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWFINGGAKTPLPKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   A+     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++S +
Sbjct  443   GKDSIQEDQKIASHLANTMSNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSAY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKHVEEKGLTDETYTEDCVALFRLSGTSVHNNKTVQVDAVAASLNSTECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG    I+++    ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WNGNQCTIEQQQLLAKLAEFLKP----GV-TLKHAKEGT-----ESSAFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFTFSFNKGKFQVEEIY-NFTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+   L E++ A +  ++++      +  P    + ++ +G+E   F   F +W  A A
Sbjct  666   VGQCVDLKEKQNAFEIGKKYIAMAASLEGLPHNVPLYKVTEGNEPRFFTIYF-AWDHAKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>ref|XP_010672856.1| PREDICTED: villin-2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=952

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/360 (75%), Positives = 312/360 (87%), Gaps = 2/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQK G EIWRIE+F PVPLPK+DYGKFYSGDSY+VLQT+SG+GG 
Sbjct  1     MSSSTKALDPAFQGAGQKPGTEIWRIEDFLPVPLPKSDYGKFYSGDSYIVLQTSSGRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDE+GTAAIKTVELD +LGGK VQHRE+Q  ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDESGTAAIKTVELDAVLGGKAVQHRELQGFESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKP EEEFETRLY+C GKR V+MKQVPFAR SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFKKPVEEEFETRLYICHGKRAVKMKQVPFARSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLKD +H G C+VAIV+DG LQAE+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALEVVQFLKDQHHEGTCDVAIVDDGKLQAESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+++PE+T  KL+ I++GQ   ++GELSK  LEN+KCYLLDCG EV +W GR TQL
Sbjct  241   VISEDEVVPEETAAKLYSINDGQAQALEGELSKGRLENNKCYLLDCGVEVSLWFGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP--EEGRGK  1181
             ++RKAACQ AE+F+  QKRPK T++TR+ QG+ET SFK  FDSWPS SA P   E GRGK
Sbjct  301   EDRKAACQAAEDFISSQKRPKTTRVTRVIQGYETHSFKSHFDSWPSGSAAPSTDEGGRGK  360


 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 91/355 (26%), Positives = 161/355 (45%), Gaps = 31/355 (9%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A+G+   IE+WRI      P+ K D GKFYSGD Y++L T         + + +W+
Sbjct  387   PLLEASGK---IEVWRINGSAKTPVSKEDVGKFYSGDCYIILYTYHSGEKKEDYYLCWWI  443

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +D+   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  444   GKDSIEDDQKMAARLANTMCNSLKGRPVLGRIFQGKEPPQFVAIFQPMVV-LKGGLSSGY  502

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+      Y      ++ +           QV     SLN  + F+L +   ++ 
Sbjct  503   KKFIEEKGLTDTTYSADDVALIEISETSLHKNKAMQVEAVAASLNSHNCFILQSGSSLFI  562

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++    ++ +FLK         +   ++G      ++  FW   GG  P  
Sbjct  563   WHGNQSTFEQQQLVAKIAEFLKPG-----STIKHAKEGT-----ENSVFWSALGGKQPYT  612

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
                +S + +         F     QV  V    ++ +L      +LD   EVFVWVG++ 
Sbjct  613   SNKSSQELVRDPHMFFFSFKKGKFQVEEVYN-FTQDDLLTEDMMILDTHVEVFVWVGQSV  671

Query  1002  QLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                E+++A +  + ++ +    +       + R+ +G+E   F   F SW  A A
Sbjct  672   DAKEKQSAFEIGQNYIQRAVSLEGLSPQIPLYRITEGNEPCFFTTYF-SWEPAKA  725



>gb|AAC31606.1| villin 2 [Arabidopsis thaliana]
Length=976

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 311/357 (87%), Gaps = 1/357 (0%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYL  293
             ++ K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG YL
Sbjct  1     MSTKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKSEHGKFYMGDTYIVLQTTQNKGGAYL  60

Query  294   FDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLE  473
             FDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ VQHR IQ HESD+FLSYFKPCI+PLE
Sbjct  61    FDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAVQHRVIQGHESDKFLSYFKPCIIPLE  120

Query  474   GGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGA  653
             GGVASGFK  EEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNGA
Sbjct  121   GGVASGFKTVEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNGA  180

Query  654   NSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVT  833
             NSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRKV 
Sbjct  181   NSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKVA  240

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
             +DDDI+PE TPPKL+CI +G++ P+DG+LSKS LEN+KCYLLDCG+E+++WVGR TQ+DE
Sbjct  241   NDDDIVPESTPPKLYCITDGKMEPIDGDLSKSMLENTKCYLLDCGAEIYIWVGRVTQVDE  300

Query  1014  RKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             RKAA Q+AEEFL  + RPKAT +TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   RKAASQSAEEFLASENRPKATHVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  357


 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 164/362 (45%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  ++ G+   +E+W +      PLPK D GK YSGD Y+VL T         + +  
Sbjct  382   IPPLLESGGK---LEVWYVNGKVKTPLPKEDIGKLYSGDCYLVLYTYHSGERKDEYFLSC  438

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK +  ++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  439   WFGKKSIPEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  497

Query  489   GFKKPE-EEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E E     Y  +   +V++           QV     SLN  + F+L +   +
Sbjct  498   GYKSSMGESESTDETYTPESIALVQVSGTGVHNNKAVQVETVATSLNSYECFLLQSGTSM  557

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  ++   A +V +FLK     G+  +   ++G      +S  FW   GG   
Sbjct  558   FLWHGNQSTHEQLELATKVAEFLKP----GIT-LKHAKEG-----TESSTFWFALGGKQN  607

Query  816   MGRKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + I      P L  F  + G  QV  +    ++ +L     Y LD  +EVFV
Sbjct  608   FTSKKASSETI----RDPHLFSFAFNRGKFQVEEIYN-FAQDDLLTEDIYFLDTHAEVFV  662

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+  +  E++   +  ++++     ++   PK   I ++ +G+E   F   F SW + 
Sbjct  663   WVGQCVEPKEKQTVFEIGQKYIDLAGSLEGLHPK-VPIYKINEGNEPCFFTTYF-SWDAT  720

Query  1149  SA  1154
              A
Sbjct  721   KA  722



>ref|XP_010672854.1| PREDICTED: villin-3 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672855.1| PREDICTED: villin-3 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=988

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/360 (75%), Positives = 312/360 (87%), Gaps = 2/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQK G EIWRIE+F PVPLPK+DYGKFYSGDSY+VLQT+SG+GG 
Sbjct  1     MSSSTKALDPAFQGAGQKPGTEIWRIEDFLPVPLPKSDYGKFYSGDSYIVLQTSSGRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDE+GTAAIKTVELD +LGGK VQHRE+Q  ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDESGTAAIKTVELDAVLGGKAVQHRELQGFESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKP EEEFETRLY+C GKR V+MKQVPFAR SLNHDDVF+LDTKDKIYQFN
Sbjct  121   LEGGVASGFKKPVEEEFETRLYICHGKRAVKMKQVPFARSSLNHDDVFILDTKDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLKD +H G C+VAIV+DG LQAE+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALEVVQFLKDQHHEGTCDVAIVDDGKLQAESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+++PE+T  KL+ I++GQ   ++GELSK  LEN+KCYLLDCG EV +W GR TQL
Sbjct  241   VISEDEVVPEETAAKLYSINDGQAQALEGELSKGRLENNKCYLLDCGVEVSLWFGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP--EEGRGK  1181
             ++RKAACQ AE+F+  QKRPK T++TR+ QG+ET SFK  FDSWPS SA P   E GRGK
Sbjct  301   EDRKAACQAAEDFISSQKRPKTTRVTRVIQGYETHSFKSHFDSWPSGSAAPSTDEGGRGK  360


 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 91/355 (26%), Positives = 161/355 (45%), Gaps = 31/355 (9%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A+G+   IE+WRI      P+ K D GKFYSGD Y++L T         + + +W+
Sbjct  387   PLLEASGK---IEVWRINGSAKTPVSKEDVGKFYSGDCYIILYTYHSGEKKEDYYLCWWI  443

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +D+   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  444   GKDSIEDDQKMAARLANTMCNSLKGRPVLGRIFQGKEPPQFVAIFQPMVV-LKGGLSSGY  502

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+      Y      ++ +           QV     SLN  + F+L +   ++ 
Sbjct  503   KKFIEEKGLTDTTYSADDVALIEISETSLHKNKAMQVEAVAASLNSHNCFILQSGSSLFI  562

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++    ++ +FLK         +   ++G      ++  FW   GG  P  
Sbjct  563   WHGNQSTFEQQQLVAKIAEFLKPG-----STIKHAKEGT-----ENSVFWSALGGKQPYT  612

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
                +S + +         F     QV  V    ++ +L      +LD   EVFVWVG++ 
Sbjct  613   SNKSSQELVRDPHMFFFSFKKGKFQVEEVYN-FTQDDLLTEDMMILDTHVEVFVWVGQSV  671

Query  1002  QLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                E+++A +  + ++ +    +       + R+ +G+E   F   F SW  A A
Sbjct  672   DAKEKQSAFEIGQNYIQRAVSLEGLSPQIPLYRITEGNEPCFFTTYF-SWEPAKA  725



>ref|XP_002881794.1| hypothetical protein ARALYDRAFT_483257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58053.1| hypothetical protein ARALYDRAFT_483257 [Arabidopsis lyrata subsp. 
lyrata]
Length=1012

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 311/357 (87%), Gaps = 1/357 (0%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYL  293
             ++ K L+PAFQ AGQK G EIWRIENF+ VP+PK+++GKFY GD+Y+VLQTT  KGG YL
Sbjct  1     MSTKVLDPAFQGAGQKPGTEIWRIENFEVVPVPKSEHGKFYMGDTYIVLQTTQNKGGAYL  60

Query  294   FDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLE  473
             FDIHFW+GKDTSQDEAGTAA+KTVELD +LGG+ +QHRE+Q HESD+FLSYFKPCI+PLE
Sbjct  61    FDIHFWIGKDTSQDEAGTAAVKTVELDAVLGGRAIQHRELQGHESDKFLSYFKPCIIPLE  120

Query  474   GGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGA  653
             GGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNGA
Sbjct  121   GGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTEEKIYQFNGA  180

Query  654   NSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVT  833
             NSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSG FW LFGGFAP+GRKV 
Sbjct  181   NSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIGRKVA  240

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
             +DDDIIPE TPPKL+C  +G++ P+DG+LSKS LEN+KCYLLDCG+EVF+WVGR TQ+DE
Sbjct  241   NDDDIIPESTPPKLYCTTDGKIEPIDGDLSKSMLENTKCYLLDCGAEVFIWVGRVTQVDE  300

Query  1014  RKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             RKAA  +AEEFL  + RP AT++TR+ QG+E+ SFK  FDSWPS SATP  EEGRGK
Sbjct  301   RKAASNSAEEFLASENRPIATRVTRVIQGYESHSFKSNFDSWPSGSATPGNEEGRGK  357


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 94/398 (24%), Positives = 161/398 (40%), Gaps = 77/398 (19%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W +       LPK D GK YSGD Y+VL T         + +  
Sbjct  382   IPPLLEGGGK---LEVWYVNGKAKTLLPKEDIGKLYSGDCYLVLYTYHSGERKDEYFLCC  438

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK + Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  439   WFGKKSIQEDQDTAIRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVV-LKGGLSS  497

Query  489   GFKKPEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIY  638
             G+K    E      Y  +   ++++           QV     SLN  + F+L +   ++
Sbjct  498   GYKNNVGEGSTDETYTPESIALIQVSGTGVHNYKAVQVELVATSLNSYECFLLQSGTSMF  557

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
              ++G  S  ++   A +V +FLK    G     A       +   +S  FW   GG    
Sbjct  558   LWHGNQSTHEQLELATKVAEFLKP---GSTLKHA-------KEGTESSTFWFALGGKQNF  607

Query  819   GRKVTSDDDIIPEKTPPKLF---------------CID----------------------  887
               K  S + I      P LF               CI                       
Sbjct  608   TSKKASSETI----RDPHLFSFSFNREVENVLYSNCIIFLLNVSAWIPAGKFQVRYWRNY  663

Query  888   ----NGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL--  1049
                 N +V  +    ++ +L     YLLD  +EVFVWVG+  +  E++   +  ++++  
Sbjct  664   TTFFNREVEEIYN-FAQDDLLTEDIYLLDTHAEVFVWVGQCVEPKEKQTVFEIGQKYIDL  722

Query  1050  ---VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                ++   PK   + ++ +G+E   F   F SW +  A
Sbjct  723   AGSLEGLHPK-VPLYKINEGNEPCFFTTYF-SWDATKA  758



>ref|XP_002322720.1| Villin 2 family protein [Populus trichocarpa]
 gb|EEF04481.1| Villin 2 family protein [Populus trichocarpa]
Length=975

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT+GKGG 
Sbjct  1     MSSSAKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTTGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FE RLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVATGFKKVEEEAFEIRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQER KALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERGKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIPE TP KL+ I +G+V  V+GELSK  LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VANEDDIIPETTPAKLYSITDGEVKIVEGELSKGLLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK T++TRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVASQNRPKTTQLTRLIQGYETRSFKTNFDSWPAGSAAPGAEEGRGK  359


 Score =   105 bits (261),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 145/328 (44%), Gaps = 43/328 (13%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSSKTPLPKEDVGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTS-------QDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLE  473
             G D+S       Q++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+
Sbjct  443   GNDSSEIHGHPIQEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPIVI-LK  501

Query  474   GGVASGFKKP-EEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLD  620
             GG++SG+KK   E+      Y      + R+           QV     SLN  + F+L 
Sbjct  502   GGLSSGYKKSIAEKGLSDETYTADSVALFRISGTSVHNDKAVQVDAVATSLNSAECFLLQ  561

Query  621   TKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELF  800
             +   I+ ++G  S  +++  A ++ +FLK         VA+    + +   +S  FW   
Sbjct  562   SGSSIFTWHGNQSTFEQQQLAAKIAEFLKP-------GVAL---KHAKEGTESSAFW---  608

Query  801   GGFAPMGRKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDC  965
               FA  G++  +     PE    P LF         QV  V    S+ +L      +LD 
Sbjct  609   --FALGGKQSYTSKKFSPETVRDPHLFTFSFNKGKFQVEEVY-NFSQDDLLTEDILILDT  665

Query  966   GSEVFVWVGRATQLDERKAACQTAEEFL  1049
              +EVFVWVG+     E++      ++++
Sbjct  666   HAEVFVWVGQYVDPKEKQNVFDIGQKYI  693



>ref|XP_006575257.1| PREDICTED: villin-3-like isoform X5 [Glycine max]
Length=877

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK++YGKFY GDSY++LQTT GKG  
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSEYGKFYMGDSYIILQTTQGKGST  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GK TSQDEAGTAAIKTVELD  +GG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKHTSQDEAGTAAIKTVELDAAIGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FET LYVC+GKRVVR++QVPFAR SLNH+DVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEKFETCLYVCRGKRVVRLRQVPFARSSLNHEDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I +G+V PV+GELSKS LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VISEDDIIPETIPAQLYSIVDGEVKPVEGELSKSLLENNKCYLLDCGAEMFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERKAACQ  EEF+  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SA T  EEGRGK
Sbjct  301   EERKAACQAVEEFVASQNRPKSTRITRIIQGYETHSFKSNFDSWPSGSASTNAEEGRGK  359


 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 161/348 (46%), Gaps = 36/348 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+WRI       LPK + GKFYSGD Y+VL T         + +  W GKD+ +++  T
Sbjct  394   IEVWRINGNAKTALPKEEIGKFYSGDCYIVLYTYHSGERKEDYFVCCWFGKDSVEEDQTT  453

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-  524
             A      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+KK   ++  + 
Sbjct  454   ATRLANTMSTSLKGRPVQGRIFEGKEPPQFVAIFQPMVV-LKGGLSSGYKKLMADKGASD  512

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y  +   ++R+           QV     SLN  + FVL +   I+ ++G   + +++
Sbjct  513   ETYTAESIALIRISGTSIHNNKSVQVDAVPSSLNSTECFVLQSGSTIFTWHGNQCSFEQQ  572

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V  FL+         +   ++G      +S  FW   GG     +  TS   +  
Sbjct  573   QLAAKVADFLRPG-----ATLKHAKEGT-----ESSAFWSALGG----KQSYTSKKVVNE  618

Query  855   EKTPPKLFCI--DNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
                 P LF I  + G+ N  +    S+ +L      +LD   EVF+W+G +    E++ A
Sbjct  619   FVRDPHLFTISFNKGKFNVEEVYNFSQDDLLPEDILILDTHVEVFIWIGHSVDPKEKQNA  678

Query  1026  CQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 ++++     +++  P    + ++ +G+E   F   F SW  A A
Sbjct  679   FDIGQKYIDLAASLEELSPH-VPLYKVTEGNEPCFFTTYF-SWDHAKA  724



>ref|XP_007145600.1| hypothetical protein PHAVU_007G252400g [Phaseolus vulgaris]
 gb|ESW17594.1| hypothetical protein PHAVU_007G252400g [Phaseolus vulgaris]
Length=982

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/360 (74%), Positives = 310/360 (86%), Gaps = 2/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY++LQTT GKGG 
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSDHGKFYMGDSYIILQTTQGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GKDTSQDEAGTAAIKT+ELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKDTSQDEAGTAAIKTIELDAALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             L GG+ASGF KPEEEEFETRLYVC+GKRVVR++Q+PFAR SLNHDDVF++DT+ KIYQFN
Sbjct  121   LAGGIASGFSKPEEEEFETRLYVCRGKRVVRLRQIPFARSSLNHDDVFIVDTESKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALE+IQ LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEIIQLLKEKYHKGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFC-IDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             V S+DDIIPE  P +L+  I NG+V PV+GELSKS LEN+KCYLLDCG+E+F WVGR TQ
Sbjct  241   VISEDDIIPESIPAQLYSIIANGEVKPVEGELSKSLLENNKCYLLDCGAEIFTWVGRVTQ  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             ++ERKAACQ  EEF+  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SA T PEEGRGK
Sbjct  301   VEERKAACQAVEEFVASQNRPKSTRITRIIQGYETHSFKSNFDSWPSGSASTNPEEGRGK  360


 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 169/361 (47%), Gaps = 39/361 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   IE+WRI       LPK + GKFYSGD Y+VL T         F +  
Sbjct  385   IPPLLEGGGK---IEVWRINGNAKTALPKEEIGKFYSGDCYIVLYTYHTGERKEDFFLCC  441

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++  TA      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG++S
Sbjct  442   WFGKDSIEEDQTTATRLASTMCTSLKGRPVQGRIFEGKEPPQFVALFQPMVV-LKGGLSS  500

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++  E   Y  +    +R+           QV     SLN  + FVL +   +
Sbjct  501   GYKKLIADKNAEDETYTAESIAFIRISGTSIHNNKSVQVDAVPSSLNSTECFVLQSGSTV  560

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G   + +++  A +V +FL+     GV  +   ++G      +S  FW   G    
Sbjct  561   FTWHGNQCSFEQQQLAAKVAEFLRP----GV-TLKHAKEGT-----ESSAFWSALG----  606

Query  816   MGRKVTSDDDIIPEKT-PPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFV  983
              G++  +   ++ E    P LF I   +      E+   S+ +L     ++LD  +EVF+
Sbjct  607   -GKQAYTSKKVVNEVVRDPHLFTISFNKAKFKVEEVYNFSQDDLLPEDIHVLDTHAEVFI  665

Query  984   WVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSAS  1151
             W+G + +  E++ A +  ++++      +       + ++ +G+E   F   F SW  A 
Sbjct  666   WIGNSVEPKEKQNAFEVGQKYIDMAASLEGLSPHVPLYKITEGNEPCFFTTYF-SWDHAK  724

Query  1152  A  1154
             A
Sbjct  725   A  725



>ref|XP_004136595.1| PREDICTED: villin-2-like [Cucumis sativus]
 ref|XP_004167431.1| PREDICTED: villin-2-like [Cucumis sativus]
 gb|KGN59352.1| hypothetical protein Csa_3G812240 [Cucumis sativus]
Length=986

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQA GQ+ G EIWRIENF+PVPL K+DYGKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSAKVLDPAFQAVGQRVGTEIWRIENFQPVPLSKSDYGKFYMGDSYIVLQTTQGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +L+DIHFW+G+DTSQDEAGTAAIKTVELD  LGG+ VQ+REIQ HES++FLSYFKPCI+P
Sbjct  61    FLYDIHFWIGRDTSQDEAGTAAIKTVELDASLGGRAVQYREIQGHESEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KI+QFN
Sbjct  121   LEGGVASGFKKPEEEQFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLKD  H G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQFLKDKNHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P KL+ ID G+V  VDGELSKS LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VASEDDIIPESAPAKLYSIDGGEVKVVDGELSKSLLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPKAT++TR+ QG+ET SFK  F+SWP  S T   EEGRGK
Sbjct  301   EERKAAIQEAEEFIASQNRPKATRVTRVIQGYETHSFKSNFESWPVGSVTTGAEEGRGK  359


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/319 (27%), Positives = 149/319 (47%), Gaps = 32/319 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWRINGSAKTPLLAEDIGKFYSGDCYIILYTYHSGERKEDYFLCSWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A   T  +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GKDSIEEDQKMATRLTNTMSNSLKGRPVQGRIFEGKEPPQFIALFQPFVV-LKGGLSSGY  501

Query  495   KKP-EEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+           QV     SLN  + FVL +   ++ 
Sbjct  502   KKVIADKALADETYTEDSVALIRISQTSIHNNKAVQVEAVATSLNSAECFVLQSGSSVFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-  818
             ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WHGNQSTFEQQQLAAKVAEFLKP----GVT-LKHAKEG-----TESSTFWFALGGKQSYN  611

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVG  992
             G+KV  D    P       F  + G  QV  +    S+ +L      +LD  +EVF+W+G
Sbjct  612   GKKVPQDTVRDPHLYA---FSFNRGKFQVEEIYN-FSQDDLLTEDILILDTQAEVFIWIG  667

Query  993   RATQLDERKAACQTAEEFL  1049
             ++    E++ A +  ++++
Sbjct  668   QSVDPKEKQNAWEIGQKYV  686



>gb|KCW48056.1| hypothetical protein EUGRSUZ_K01803 [Eucalyptus grandis]
Length=452

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DD I E TP KL+ I +GQ+  V+GELSK  LEN+ CYLLDCG+EVFVWVGR TQ+
Sbjct  241   VSSEDDAILEATPAKLYSIVDGQLKLVEGELSKGMLENNTCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERK A Q AE+F+  Q RPK+T+ITR+ QG+ET SFK +FD+WPS SA PP EEGRGK
Sbjct  301   DERKTAIQAAEDFISSQNRPKSTRITRVIQGYETHSFKSKFDTWPSGSAAPPSEEGRGK  359



>ref|XP_008387300.1| PREDICTED: villin-3-like [Malus domestica]
Length=967

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ +GQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSTKALDPAFQGSGQRIGAEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EE+EFETRLY+CKGKRVVRMKQVPFAR SLNHDDVF+LDT++KI+QFN
Sbjct  121   LEGGVASGFKKVEEDEFETRLYICKGKRVVRMKQVPFARSSLNHDDVFILDTENKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHHGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD++PE TP  L+ I  G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VITEDDVVPEATPAILYSITEGEVKTVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RK+A Q AEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SAT   EEGRGK
Sbjct  301   EDRKSASQAAEEFLATQNRPKSTRITRVIQGYETHSFKSNFDSWPSGSATSGTEEGRGK  359


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PL K D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGGAKTPLXKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK++ +++  TA+     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++SG+
Sbjct  443   GKBSXEEDQKTASHLASTMSNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSGY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T          L+   G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KKSVEEKGLTDETYTADCVALFRLSGTYVHNSKAVQVDAVATSLNSTECFILQSGSSMFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG    I+++  A ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WNGNQCTIEQQQLAAKLAEFLKP----GV-TLKHAKEGT-----ESSSFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFSFSFNRGKFQVEEIY-NFTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+     E++ A +  ++++      +       + ++ +G+E   F   F SW  + A
Sbjct  666   VGQCVDSKEKQNAFEIGKKYIALAASLEGLAPNVPLYKVTEGNEPRFFTTYF-SWDLSKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>gb|AES81363.2| villin [Medicago truncatula]
Length=983

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/360 (76%), Positives = 312/360 (87%), Gaps = 2/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K LEPAFQ  GQK G +IWRIENF+PVPLPK+D+GKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLEPAFQGVGQKVGTDIWRIENFQPVPLPKSDHGKFYMGDSYIILQTTQGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAAIKT+ELD  LGG+ VQ REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAIKTIELDAALGGRAVQWREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVCKGKRVVR+KQ+PFAR SLNHDDVF+LDT+DKI+QFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRIKQIPFARSSLNHDDVFILDTQDKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQLLKEKYHEGTCSVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PE  P +L+ I +G+V PV+GELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIVPETIPAQLYSIADGEVKPVEGELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP--PEEGRGK  1181
             DERKAAC  AE+F+  QKRPKAT+ITR+ QG+ET SFK  FDSWPS SA     EEGRGK
Sbjct  301   DERKAACTAAEDFVASQKRPKATRITRVIQGYETHSFKSNFDSWPSGSANTAGAEEGRGK  360


 Score =   117 bits (292),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 171/363 (47%), Gaps = 40/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I      PLPK D GKFYSGD Y+VL T         + +  
Sbjct  385   IPPLLEGGGK---LEVWIINGSAKTPLPKEDVGKFYSGDCYIVLYTYHSGERKEDYFLCS  441

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK++ +++   A      +   L G+ VQ R     ES +F++ F+P ++ L+GGV+S
Sbjct  442   WFGKNSIEEDQKMATRLATTMSNSLKGRPVQGRIFDGKESPQFVALFQPMVV-LKGGVSS  500

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y  +   ++R+           QV     SLN  + F+L +   +
Sbjct  501   GYKKLIADKGLPDETYTAESIALIRISGTAIHNSKTMQVDAVAASLNSTECFLLQSGSTV  560

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S+++++  A +V +FL+     G+  +   ++G      ++  FW   GG   
Sbjct  561   FTWHGNQSSVEQQQLAAKVAEFLRP----GIA-LKYSKEGT-----ETSTFWFAVGGKQS  610

Query  816   M-GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE----LSKSNLENSKCYLLDCGSEVF  980
                +KVT  +DI+ +   P LF     +   +  E     S+ +L      +LD  +EVF
Sbjct  611   FTSKKVT--NDIVRD---PHLFTFSLNKAGKLQIEEVYNFSQDDLLTEDILILDTHAEVF  665

Query  981   VWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSA  1148
             VW+G+     E++ A + A++++ K            + ++ +G+E   F   F +W  A
Sbjct  666   VWIGQCVDPKEKQNAFEIAQKYIEKAGSLDGLSPHVPLYKVTEGNEPCFFTTYF-TWDHA  724

Query  1149  SAT  1157
              AT
Sbjct  725   KAT  727



>ref|XP_011033340.1| PREDICTED: villin-3-like isoform X1 [Populus euphratica]
Length=979

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSAKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FE RLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVATGFKKAEEEAFEIRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQER KALEVIQFLK+ YH G C+VAI++DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERGKALEVIQFLKEKYHEGTCDVAIIDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIP+ TP KL+ I +G+V  V+GELSK +LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VANEDDIIPDTTPAKLYSITDGEVKIVEGELSKGSLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q R K T++TRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVASQNRSKTTRLTRLIQGYETRSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 146/320 (46%), Gaps = 34/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSSKTPLPKEDVGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G D+S+++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GNDSSEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPIVI-LKGGLSSGY  501

Query  495   KKP------EEEEF---ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK        +E +      L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKSIADKGLSDETYTADSVALFRISGTSVHNDKAVQVDAVATSLNSAECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A ++ +FLK         VA+    + +  A+S  FW   GG     
Sbjct  562   WHGNQSTFEQQQLAAKIAEFLKP-------GVAL---KHAKEGAESSAFWSALGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S + +      P LF         QV  V    S+ +L      +LD  +EVFVWV
Sbjct  612   SKKFSPETV----RDPHLFTFSFNKGKFQVEEVY-NFSQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL  1049
             G+     E++      ++++
Sbjct  667   GQYVDPKEKQNVFDIGQKYI  686



>ref|XP_011033341.1| PREDICTED: villin-3-like isoform X2 [Populus euphratica]
Length=968

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ  GQ+ G EIWRIENF+PVPLPK+D+GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSSAKALDPAFQGVGQRPGTEIWRIENFQPVPLPKSDHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVA+GFKK EEE FE RLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVATGFKKAEEEAFEIRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQER KALEVIQFLK+ YH G C+VAI++DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERGKALEVIQFLKEKYHEGTCDVAIIDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDIIP+ TP KL+ I +G+V  V+GELSK +LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VANEDDIIPDTTPAKLYSITDGEVKIVEGELSKGSLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q R K T++TRL QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EERKAASQAAEEFVASQNRSKTTRLTRLIQGYETRSFKSNFDSWPAGSAAPGAEEGRGK  359


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 146/320 (46%), Gaps = 34/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSSKTPLPKEDVGKFYSGDCYIILYTYHSGDRKEDYLLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G D+S+++   AA     +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GNDSSEEDQKMAARLANTMSNSLKGRPVQGRIFQGKEPPQFVALFQPIVI-LKGGLSSGY  501

Query  495   KKP------EEEEF---ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK        +E +      L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKSIADKGLSDETYTADSVALFRISGTSVHNDKAVQVDAVATSLNSAECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A ++ +FLK         VA+    + +  A+S  FW   GG     
Sbjct  562   WHGNQSTFEQQQLAAKIAEFLKP-------GVAL---KHAKEGAESSAFWSALGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S + +      P LF         QV  V    S+ +L      +LD  +EVFVWV
Sbjct  612   SKKFSPETV----RDPHLFTFSFNKGKFQVEEVY-NFSQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL  1049
             G+     E++      ++++
Sbjct  667   GQYVDPKEKQNVFDIGQKYI  686



>ref|XP_006575253.1| PREDICTED: villin-3-like isoform X1 [Glycine max]
 ref|XP_006575254.1| PREDICTED: villin-3-like isoform X2 [Glycine max]
 ref|XP_006575255.1| PREDICTED: villin-3-like isoform X3 [Glycine max]
Length=973

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK++YGKFY GDSY++LQTT GKG  
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSEYGKFYMGDSYIILQTTQGKGST  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GK TSQDEAGTAAIKTVELD  +GG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKHTSQDEAGTAAIKTVELDAAIGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FET LYVC+GKRVVR++QVPFAR SLNH+DVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEKFETCLYVCRGKRVVRLRQVPFARSSLNHEDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I +G+V PV+GELSKS LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VISEDDIIPETIPAQLYSIVDGEVKPVEGELSKSLLENNKCYLLDCGAEMFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERKAACQ  EEF+  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SA T  EEGRGK
Sbjct  301   EERKAACQAVEEFVASQNRPKSTRITRIIQGYETHSFKSNFDSWPSGSASTNAEEGRGK  359


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 161/348 (46%), Gaps = 36/348 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+WRI       LPK + GKFYSGD Y+VL T         + +  W GKD+ +++  T
Sbjct  394   IEVWRINGNAKTALPKEEIGKFYSGDCYIVLYTYHSGERKEDYFVCCWFGKDSVEEDQTT  453

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-  524
             A      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+KK   ++  + 
Sbjct  454   ATRLANTMSTSLKGRPVQGRIFEGKEPPQFVAIFQPMVV-LKGGLSSGYKKLMADKGASD  512

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y  +   ++R+           QV     SLN  + FVL +   I+ ++G   + +++
Sbjct  513   ETYTAESIALIRISGTSIHNNKSVQVDAVPSSLNSTECFVLQSGSTIFTWHGNQCSFEQQ  572

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V  FL+         +   ++G      +S  FW   GG      K   ++ +  
Sbjct  573   QLAAKVADFLRPG-----ATLKHAKEGT-----ESSAFWSALGGKQSYTSKKVVNEFV--  620

Query  855   EKTPPKLFCI--DNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
                 P LF I  + G+ N  +    S+ +L      +LD   EVF+W+G +    E++ A
Sbjct  621   --RDPHLFTISFNKGKFNVEEVYNFSQDDLLPEDILILDTHVEVFIWIGHSVDPKEKQNA  678

Query  1026  CQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 ++++     +++  P    + ++ +G+E   F   F SW  A A
Sbjct  679   FDIGQKYIDLAASLEELSPH-VPLYKVTEGNEPCFFTTYF-SWDHAKA  724



>ref|XP_004493486.1| PREDICTED: villin-2-like isoform X1 [Cicer arietinum]
 ref|XP_004493487.1| PREDICTED: villin-2-like isoform X2 [Cicer arietinum]
 ref|XP_004493488.1| PREDICTED: villin-2-like isoform X3 [Cicer arietinum]
 ref|XP_004493489.1| PREDICTED: villin-2-like isoform X4 [Cicer arietinum]
Length=984

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/361 (76%), Positives = 311/361 (86%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K LEPAFQ  GQK G EIWRIENF+PVPLPK+DYGKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLEPAFQGVGQKVGSEIWRIENFQPVPLPKSDYGKFYMGDSYIILQTTQGKGGN  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKRVVR+KQ+PFAR SLNHDDVF+LDT+DKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYACKGKRVVRIKQIPFARSSLNHDDVFILDTQDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALE+IQ LK+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEIIQLLKEKYHEGKCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PE  P +L+ I +G+V  V+ ELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIVPETIPAQLYSIGDGEVKSVESELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP---PEEGRG  1178
             DERKAACQ AE+F+  QKRPK+T++TR+ QG+ET SFK  FDSWPS S+      EEGRG
Sbjct  301   DERKAACQAAEDFVASQKRPKSTRVTRVIQGYETHSFKSNFDSWPSGSSATTAGAEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 97/363 (27%), Positives = 172/363 (47%), Gaps = 40/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I      PLPK D GKFYSGD Y+VL T         + +  
Sbjct  386   IPPLLEGGGK---LEVWLINGSAKTPLPKEDVGKFYSGDCYIVLYTYHSGERKDDYFLCS  442

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++   A      +   L G+ VQ R     E+ +F++ F+P +  L+GG++S
Sbjct  443   WFGKDSIEEDQKMATRLATTMSNSLKGRPVQGRIFDGKEAPQFVALFQPMVT-LKGGLSS  501

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   E+      Y  +   ++R+           QV     SLN  + F+L +   +
Sbjct  502   GYKKLIAEKGLPDETYTAESIALIRISGTSVHNNKTMQVDAVATSLNSTECFLLQSGSTV  561

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S+I+++  A +V +FL+         VA+    + +   ++  FW   GG   
Sbjct  562   FTWHGNQSSIEQQQLAAKVAEFLRP-------GVAL---KHAKEGTETSAFWFAVGGKQS  611

Query  816   M-GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE----LSKSNLENSKCYLLDCGSEVF  980
             +  +KVT  +DI+ +   P LF +   +   +  E     S+ +L      +LD  +EVF
Sbjct  612   VTSKKVT--NDIVRD---PHLFTLSFTKAGKLQEEELYNFSQDDLLTEDILILDTHAEVF  666

Query  981   VWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSA  1148
             VW+G+     E++ A + A++++ K    +       + ++ +G+E   F   F SW  A
Sbjct  667   VWIGQCVDPKEKQNAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTYF-SWDHA  725

Query  1149  SAT  1157
              AT
Sbjct  726   KAT  728



>ref|XP_004493490.1| PREDICTED: villin-2-like isoform X5 [Cicer arietinum]
Length=984

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/361 (76%), Positives = 311/361 (86%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K LEPAFQ  GQK G EIWRIENF+PVPLPK+DYGKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLEPAFQGVGQKVGSEIWRIENFQPVPLPKSDYGKFYMGDSYIILQTTQGKGGN  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKRVVR+KQ+PFAR SLNHDDVF+LDT+DKIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYACKGKRVVRIKQIPFARSSLNHDDVFILDTQDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALE+IQ LK+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEIIQLLKEKYHEGKCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PE  P +L+ I +G+V  V+ ELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIVPETIPAQLYSIGDGEVKSVESELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP---PEEGRG  1178
             DERKAACQ AE+F+  QKRPK+T++TR+ QG+ET SFK  FDSWPS S+      EEGRG
Sbjct  301   DERKAACQAAEDFVASQKRPKSTRVTRVIQGYETHSFKSNFDSWPSGSSATTAGAEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 172/363 (47%), Gaps = 40/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I      PLPK D GKFYSGD Y+VL T         + +  
Sbjct  386   IPPLLEGGGK---LEVWLINGSAKTPLPKEDVGKFYSGDCYIVLYTYHSGERKDDYFLCS  442

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++   A      +   L G+ VQ R     E+ +F++ F+P +  L+GG++S
Sbjct  443   WFGKDSIEEDQKMATRLATTMSNSLKGRPVQGRIFDGKEAPQFVALFQPMVT-LKGGLSS  501

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   E+      Y  +   ++R+           QV     SLN  + F+L +   +
Sbjct  502   GYKKLIAEKGLPDETYTAESIALIRISGTSVHNNKTMQVDAVATSLNSTECFLLQSGSTV  561

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S+I+++  A +V +FL+         VA+    + +   ++  FW   GG   
Sbjct  562   FTWHGNQSSIEQQQLAAKVAEFLRP-------GVAL---KHAKEGTETSAFWFAVGGKQS  611

Query  816   M-GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE----LSKSNLENSKCYLLDCGSEVF  980
             +  +KVT  +DI+ +   P LF +   +   +  +     S+ +L      +LD  +EVF
Sbjct  612   VTSKKVT--NDIVRD---PHLFTLSFTKAGKLQVKELYNFSQDDLLTEDILILDTHAEVF  666

Query  981   VWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSA  1148
             VW+G+     E++ A + A++++ K    +       + ++ +G+E   F   F SW  A
Sbjct  667   VWIGQCVDPKEKQNAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTYF-SWDHA  725

Query  1149  SAT  1157
              AT
Sbjct  726   KAT  728



>ref|XP_006575256.1| PREDICTED: villin-3-like isoform X4 [Glycine max]
Length=969

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PVPLPK++YGKFY GDSY++LQTT GKG  
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSEYGKFYMGDSYIILQTTQGKGST  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GK TSQDEAGTAAIKTVELD  +GG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKHTSQDEAGTAAIKTVELDAAIGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FET LYVC+GKRVVR++QVPFAR SLNH+DVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEKFETCLYVCRGKRVVRLRQVPFARSSLNHEDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I +G+V PV+GELSKS LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VISEDDIIPETIPAQLYSIVDGEVKPVEGELSKSLLENNKCYLLDCGAEMFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERKAACQ  EEF+  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SA T  EEGRGK
Sbjct  301   EERKAACQAVEEFVASQNRPKSTRITRIIQGYETHSFKSNFDSWPSGSASTNAEEGRGK  359


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 161/348 (46%), Gaps = 36/348 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+WRI       LPK + GKFYSGD Y+VL T         + +  W GKD+ +++  T
Sbjct  394   IEVWRINGNAKTALPKEEIGKFYSGDCYIVLYTYHSGERKEDYFVCCWFGKDSVEEDQTT  453

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-  524
             A      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+KK   ++  + 
Sbjct  454   ATRLANTMSTSLKGRPVQGRIFEGKEPPQFVAIFQPMVV-LKGGLSSGYKKLMADKGASD  512

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y  +   ++R+           QV     SLN  + FVL +   I+ ++G   + +++
Sbjct  513   ETYTAESIALIRISGTSIHNNKSVQVDAVPSSLNSTECFVLQSGSTIFTWHGNQCSFEQQ  572

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V  FL+         +   ++G      +S  FW   GG      K   ++ +  
Sbjct  573   QLAAKVADFLRPG-----ATLKHAKEGT-----ESSAFWSALGGKQSYTSKKVVNEFV--  620

Query  855   EKTPPKLFCI--DNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
                 P LF I  + G+ N  +    S+ +L      +LD   EVF+W+G +    E++ A
Sbjct  621   --RDPHLFTISFNKGKFNVEEVYNFSQDDLLPEDILILDTHVEVFIWIGHSVDPKEKQNA  678

Query  1026  CQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 ++++     +++  P    + ++ +G+E   F   F SW  A A
Sbjct  679   FDIGQKYIDLAASLEELSPH-VPLYKVTEGNEPCFFTTYF-SWDHAKA  724



>ref|XP_007162188.1| hypothetical protein PHAVU_001G131700g [Phaseolus vulgaris]
 ref|XP_007162189.1| hypothetical protein PHAVU_001G131700g [Phaseolus vulgaris]
 gb|ESW34182.1| hypothetical protein PHAVU_001G131700g [Phaseolus vulgaris]
 gb|ESW34183.1| hypothetical protein PHAVU_001G131700g [Phaseolus vulgaris]
Length=993

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQK G EIWRIENF+PVPLP+++YGKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLDPAFQGVGQKVGTEIWRIENFQPVPLPRSEYGKFYMGDSYIILQTTQGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+ LSYFKPCI+P
Sbjct  61    YFYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKCLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCRGKRVVRIKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQLLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I +G+V PV+GELSKS LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIIPEAIPAQLYSIADGEVKPVEGELSKSLLENYKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERKAACQ AEEF+  QKRPK+T+ITR+ QG+ET SFK  FDSWPS SA T  +EGRGK
Sbjct  301   EERKAACQAAEEFVASQKRPKSTRITRIIQGYETHSFKSNFDSWPSGSATTSADEGRGK  359


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 94/367 (26%), Positives = 168/367 (46%), Gaps = 36/367 (10%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             V+ + P  +  G+   +E+W+I      PLPK D GK YSGD Y+VL T         + 
Sbjct  381   VEEIPPLLEGGGK---MEVWQINGSAKTPLPKEDIGKLYSGDCYIVLYTYHSSERKEDYY  437

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GKD+++++   A      +   L G+ VQ R     E  +F++ F+P ++ L+GG
Sbjct  438   LCSWFGKDSTEEDQRMAIRLANTMFNSLKGRPVQGRIFDGKEPPQFIALFQPMVV-LKGG  496

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+KK   ++      Y      ++R+           QV     SLN  + FVL + 
Sbjct  497   LSSGYKKFIADKGLPDDTYTADSVALIRISGTSPHNNKVVQVDAIAASLNSTECFVLQSG  556

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G   +++++  A +V +FLK     GV  + + ++G      ++  FW   GG
Sbjct  557   SAVFTWHGNQCSLEQQLLATKVAEFLKP----GVA-LKLAKEGT-----ETSAFWFAVGG  606

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE----LSKSNLENSKCYLLDCGSE  974
                   K  ++D  I        F  + G ++    E     S+ +L      +LD  +E
Sbjct  607   KQSYTNKKATND--IVRDAHLFTFSFNRGTLSSSSVEEVYNFSQDDLLTEDILILDTHAE  664

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVW+G+     E++ A + A++++ K            + ++ +G+E   F   F SW 
Sbjct  665   VFVWIGQCVDPKEKQNAFEIAQKYIDKAASLDGLSPQVPLYKVTEGNEPCFFTAYF-SWD  723

Query  1143  SASATPP  1163
              A A  P
Sbjct  724   HAKALVP  730



>ref|XP_004513861.1| PREDICTED: villin-3-like [Cicer arietinum]
Length=976

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQ+ G EIWRIENF+PVPLPK++YGKFY+GDSY++LQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGVGQRVGTEIWRIENFQPVPLPKSEYGKFYTGDSYIILQTTQGKGGT  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GKDTSQDEAGTAAIK VELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKDTSQDEAGTAAIKAVELDAALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGF+KPEEEEFET LYVCKGKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFRKPEEEEFETHLYVCKGKRVVRLKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVVQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE+ P +L+ I +G+V   +GELSKS LEN+KCYLLDCG+EVF+W GR T +
Sbjct  241   VISEDDIIPEEIPAQLYSIIDGEVKSEEGELSKSLLENNKCYLLDCGTEVFIWFGRVTPV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERKAACQ A+EF+  Q RPK+T+ITR+ QG+ET SFK  FDSWPS SA T  EEG+GK
Sbjct  301   EERKAACQAADEFVSSQNRPKSTRITRIIQGYETRSFKSNFDSWPSGSAGTSAEEGKGK  359


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/361 (24%), Positives = 165/361 (46%), Gaps = 37/361 (10%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+WRI       LP  + GKF+ GD Y+VL T         + +  
Sbjct  384   IPPLLEIGGK---MEVWRINGSDKTSLPNEEIGKFHIGDCYIVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++   A      +   L G+ VQ R  +  ES +F++ F+P I+ L+GG++S
Sbjct  441   WFGKDSVEEDQTMATRLANTMSNSLKGRPVQGRIFEGKESPQFVALFQPMIV-LKGGLSS  499

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y  +   ++R+           QV     SLN  + F+L      
Sbjct  500   GYKKLLADKGLSDETYTAESIALIRISGTSTHSNKAVQVDSVPSSLNSTECFILQFGSTN  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G + ++ ++  A ++ ++L+     GV  +  V++G      +S  FW   GG   
Sbjct  560   FAWHGNHCSVAQQQLAAKIAEYLRP----GV-PLKHVKEGT-----ESSSFWMAIGGKQS  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCID--NGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVW  986
                K  +++ +      P LF      G+++  +    S+ +L      LLD  +EVFVW
Sbjct  610   YTSKKVTNEVV----RDPHLFTFSFYKGKLHVEEVYNFSQDDLLTEDILLLDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             +G+     E++ A +  ++++      +       + ++ +G+E   F   F SW  A A
Sbjct  666   IGQCVDPTEKQNAFEIGQKYVDMAASLEGLSPCVPLYKVTEGNEPCFFTTYF-SWDHAKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>emb|CAB66098.1| villin 3 fragment [Arabidopsis thaliana]
Length=583

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL VIQ+LKD +H G  +VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +GQV  +DG+LSKS LEN+KCYLLDCGSE+F+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGQVESIDGDLSKSMLENNKCYLLDCGSEIFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 97/204 (48%), Gaps = 15/204 (7%)
 Frame = +3

Query  129  LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
            + P  +  G+   +E+W I+      L K   GK YSGD Y+VL T         + +  
Sbjct  384  IPPLLEGGGK---LEVWYIDANSKTVLSKDHVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309  WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
            W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441  WFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVV-LKGGLSS  499

Query  489  GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
            G+K    E+  +          L    G  V   K  QV     SLN  D F+L +   +
Sbjct  500  GYKNSMTEKGSSGETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636  YQFNGANSNIQERAKALEVIQFLK  707
            + + G +S  +++  A +V +FLK
Sbjct  560  FLWVGNHSTHEQQELAAKVAEFLK  583



>ref|XP_002878148.1| hypothetical protein ARALYDRAFT_486186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54407.1| hypothetical protein ARALYDRAFT_486186 [Arabidopsis lyrata subsp. 
lyrata]
Length=965

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/359 (74%), Positives = 307/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQ+T  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQSTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+KPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +G V  +DG+LSKS LEN KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGLVESIDGDLSKSMLENGKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 161/363 (44%), Gaps = 41/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     PL K D GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  +          L    G  V   K  QV     SLN  D F+L +   +
Sbjct  500   GYKNSMTEKGSSDETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + + G +S  +++  A +V +FLK         +   ++G      +S  FW   GG   
Sbjct  560   FLWVGNHSTHEQQELAAKVAEFLKPG-----ITIKHAKEGT-----ESSSFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +     + +L   + +LLD  +EVFV
Sbjct  610   FTSKKVSSETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW   
Sbjct  665   WVGQCVDPKEKQTAFEIGQRYINLAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDPT  722

Query  1149  SAT  1157
              AT
Sbjct  723   KAT  725



>ref|XP_003521173.1| PREDICTED: villin-2-like isoform X1 [Glycine max]
 ref|XP_006576819.1| PREDICTED: villin-2-like isoform X2 [Glycine max]
 ref|XP_006576820.1| PREDICTED: villin-2-like isoform X3 [Glycine max]
 ref|XP_006576821.1| PREDICTED: villin-2-like isoform X4 [Glycine max]
Length=984

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQK G EIWRIE+F+PVPLP+ DYGKFY GDSY++LQTT GKG  
Sbjct  1     MSSATKVLDPAFQGVGQKVGTEIWRIEDFQPVPLPRPDYGKFYMGDSYIILQTTQGKGSA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRIKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQLLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             + S+DDI+PE  P +L+ I +G+  PV+GELSKS LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   IISEDDIVPETIPAQLYSIADGEAKPVEGELSKSLLENYKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAACQ AEEFL  QKRPK+T+ITR+ QG+ET SFK  FDSWPS SAT   +EGRGK
Sbjct  301   EERKAACQAAEEFLTSQKRPKSTRITRIIQGYETHSFKSNFDSWPSGSATTGADEGRGK  359


 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 169/372 (45%), Gaps = 40/372 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             T SV V+ + P  +  G+   +E+W+I      PLPK D GKFYSGD Y+VL T      
Sbjct  377   TTSV-VEEIPPLLEGGGK---MEVWQINGSAKTPLPKEDIGKFYSGDCYIVLYTYHSSER  432

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GKD+++++   A      +   L G+ VQ R     E  +F+  F P ++
Sbjct  433   KEDYYLCCWFGKDSTEEDQRMAIRLANTMFNSLKGRPVQGRIFDGKEPPQFIVLFHPMVV  492

Query  465   PLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVF  611
              L+GG++SG+KK   ++      Y  +    +R+           QV      LN  + F
Sbjct  493   -LKGGLSSGYKKLIADKGLPDETYTAESVAFIRISGTSTHNNKVVQVDAVAALLNSTECF  551

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             VL +   ++ ++G   +++++  A +V +FL+     GV  + + ++G      ++  FW
Sbjct  552   VLQSGSAVFTWHGNQCSLEQQQLAAKVAEFLRP----GVA-LKLAKEGT-----ETSTFW  601

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  ++D +      P LF         QV  V    S+ +L      +L
Sbjct  602   FALGGKQSYNNKKVTNDIV----RDPHLFTFSFNRGKLQVEEVY-NFSQDDLLTEDILIL  656

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCE  1127
             D  +EVFVW+G+     E++ A + A++++ K    +       + ++ +G+E   F   
Sbjct  657   DTHAEVFVWIGQCVDPKEKQNAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTY  716

Query  1128  FDSWPSASATPP  1163
             F SW    A  P
Sbjct  717   F-SWDHTKAMVP  727



>gb|AAM13051.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91332.1| unknown protein [Arabidopsis thaliana]
Length=618

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL VIQ+LKD +H G  +VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +GQV  +DG+LSKS LEN+KCYLLDCGSE+F+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGQVESIDGDLSKSMLENNKCYLLDCGSEIFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 98/207 (47%), Gaps = 15/207 (7%)
 Frame = +3

Query  129  LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
            + P  +  G+   +E+W I+      L K   GK YSGD Y+VL T         + +  
Sbjct  384  IPPLLEGGGK---LEVWYIDANSKTVLSKDHVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309  WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
            W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441  WFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVV-LKGGLSS  499

Query  489  GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
            G+K    E+  +          L    G  V   K  QV     SLN  D F+L +   +
Sbjct  500  GYKNSMTEKGSSGETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636  YQFNGANSNIQERAKALEVIQFLKDTY  716
            + + G +S  +++  A +V +FLK  +
Sbjct  560  FLWVGNHSTHEQQELAAKVAEFLKSAW  586



>ref|XP_010427613.1| PREDICTED: villin-3-like [Camelina sativa]
Length=965

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGIGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EE+EFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKTEEDEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +G+V  ++G+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGKVESIEGDLSKSMLENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 100/371 (27%), Positives = 167/371 (45%), Gaps = 42/371 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             + +VN + + P  +  G+   +E+W I+     PL K D GK YSGD YVVL T      
Sbjct  377   STTVN-EEIPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYVVLYTYHSGER  432

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++
Sbjct  433   KEDYFLCCWFGKNSNQEDQETAVRLAGIMTNSLKGRPVQARVYEGKEPPQFVALFQHMVV  492

Query  465   PLEGGVASGFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVF  611
              L+GG++SG+K    E+  +          L    G  V   K  QV     SLN  D F
Sbjct  493   -LKGGLSSGYKNSMTEKGSSDETYTPESIALIQVSGTGVHNNKALQVESVATSLNSYDCF  551

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L +   ++ ++G  S  +++  A +V +FLK         +   ++G      +S  FW
Sbjct  552   LLQSGTSMFLWHGNQSTHEQQELAAKVAEFLKPG-----TTIKHAKEGT-----ESSSFW  601

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  S + +      P LF         QV  +     + +L   + +LL
Sbjct  602   FALGGKQNFTSKKVSAETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLL  656

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKC  1124
             D  +EVFVWVG+     E++ A +  + ++     ++   PK   + R+ +G+E   F  
Sbjct  657   DTHAEVFVWVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPKVP-LYRITEGNEPCFFTT  715

Query  1125  EFDSWPSASAT  1157
              F SW S  AT
Sbjct  716   YF-SWDSTKAT  725



>ref|XP_010504669.1| PREDICTED: villin-3 [Camelina sativa]
Length=965

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGIGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EE+EFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKTEEDEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +G+V  ++G+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGKVESIEGDLSKSMLENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 100/371 (27%), Positives = 170/371 (46%), Gaps = 42/371 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             + +VN + + P  +  G+   +E+W I+     PL K D GK YSGD YVVL T      
Sbjct  377   STTVN-EEIPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYVVLYTYHSGER  432

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++
Sbjct  433   KEDYFLCCWFGKNSNQEDQETAVRLASIMTNSLKGRPVQVRIYEGKEPPQFVALFQHMVV  492

Query  465   PLEGGVASGFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVF  611
              L+GG++SG+K    E+  +          L    G  V   K  QV     SLN  D F
Sbjct  493   -LKGGLSSGYKNSMTEKGSSDETYTPESIALIQVSGTGVHNNKALQVETVATSLNSYDCF  551

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L +   ++ ++G +S  +++  A +V +FLK     G+  +   ++G      +S  FW
Sbjct  552   LLQSGTSMFLWHGNHSTHEQQELAAKVAEFLKP----GIT-IKHAKEGT-----ESSSFW  601

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  S + +      P LF         QV  +     + +L   + +LL
Sbjct  602   FALGGKQNFTSKKVSAETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLL  656

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKC  1124
             D  +EVFVWVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F  
Sbjct  657   DTHAEVFVWVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPKV-PLYKITEGNEPCFFTT  715

Query  1125  EFDSWPSASAT  1157
              F SW S  AT
Sbjct  716   YF-SWDSTKAT  725



>ref|XP_010269772.1| PREDICTED: villin-2 [Nelumbo nucifera]
Length=946

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K ++PAFQ  GQ+ G EIWRIENF+PVPLPK+++GKFY GDSY+VLQTTSGKGG 
Sbjct  1     MANSTKVVDPAFQGVGQRVGTEIWRIENFQPVPLPKSEHGKFYMGDSYIVLQTTSGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIK VELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKAVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEE+FETRLYVC+GKRVV++KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEKFETRLYVCRGKRVVKLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ+ K+ YH G C V+IV+DG L AE+DSGEFW LFGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVIQYFKEKYHEGKCEVSIVDDGKLVAESDSGEFWVLFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               +++D+I E TP KL+ I +GQV PVDG LSK+ LEN++CYLLDCG+EVFVWVGR TQ+
Sbjct  241   AATEEDVILETTPGKLYSITDGQVKPVDGALSKAMLENNQCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK+T+ITR+ QG+ET SFK  F+SWP  AS +  ++GRGK
Sbjct  301   EERKAASQAAEEFINSQNRPKSTRITRIIQGYETHSFKSNFESWPVGASTSGADDGRGK  359


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 99/359 (28%), Positives = 168/359 (47%), Gaps = 35/359 (10%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  ++ G+   IE+WRI      P+PK + GKFYSGD Y+VL T         + +  
Sbjct  384   IPPLLESGGK---IEVWRINGSAKTPIPKEEIGKFYSGDCYIVLYTYHSGDKREDYYLTC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             WLGKD+ QD+   A      +   L G+ VQ R  Q  E  +F++ F+  ++ L+GGV+S
Sbjct  441   WLGKDSIQDDQMMATRLASTMCNSLKGRPVQGRIFQGKEPPQFIAIFESMVV-LKGGVSS  499

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y   G  ++R+           QV     SL+ +D F+L +   I
Sbjct  500   GYKKFIADKNLTDETYTADGIALIRICGTSVHNDKAVQVDAVATSLSSNDCFLLQSGSSI  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG-FA  812
             + ++G  S  +++  A ++ +FLK    G V   A       +   +S  FW   GG  +
Sbjct  560   FTWHGNQSTFEQQQLAAKIAEFLKP---GVVLKHA-------KEGTESSAFWFALGGKQS  609

Query  813   PMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
              + +KVT +    P      +F  + G+    +    S+ +L      +LD  +EVFVWV
Sbjct  610   YISKKVTQETVRDPHLY---MFSFNKGKFEVSEVYNFSQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFLVKQKR----PKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++ A +  ++++         P    + ++ +G+E   F   F SW S+ A
Sbjct  667   GQCVDSKEKQKAFEIGQKYIELAANLEGLPPDVPLYKVTEGNEPCFFTTYF-SWDSSKA  724



>ref|XP_009419900.1| PREDICTED: villin-3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419901.1| PREDICTED: villin-3-like [Musa acuminata subsp. malaccensis]
Length=953

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/361 (71%), Positives = 315/361 (87%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K ++PAFQ  GQK G EIWRIENF+PVPLPK+DYGKFYSGD+Y++LQT+SGKGG 
Sbjct  1     MSSSTKYVDPAFQGVGQKVGTEIWRIENFQPVPLPKSDYGKFYSGDTYIILQTSSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GK++SQDE+GTAAIKTVELD+ILGG+ VQHRE+Q  ESD+ LSYFKPCI+P
Sbjct  61    YLYDIHFWIGKESSQDESGTAAIKTVELDSILGGRAVQHRELQGFESDKLLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGF+KPEEE+FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGFASGFRKPEEEKFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKDTYH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQYLKDTYHEGKCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             + S+DD++PE TP +L+ I +GQ+   +G L K+ LEN+KCYLLDCG+E+F+WVGR TQ+
Sbjct  241   IISEDDVVPETTPSRLYSIVDGQLKLEEGTLCKAMLENNKCYLLDCGAEIFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             DERKAA + AE+F++ Q RPK T+IT++ QG+ET S+K  F+SWP+ +AT     EEGRG
Sbjct  301   DERKAASKVAEDFIISQNRPKTTRITQVIQGYETHSYKSNFESWPAGTATGTSGGEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/356 (27%), Positives = 170/356 (48%), Gaps = 33/356 (9%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI +    P+PK + GKFYSGD Y+VL T         + +  W+
Sbjct  388   PLLEGGGK---LEVWRINSSAKSPVPKEEIGKFYSGDCYIVLYTYHSGEKKEDYFLTCWM  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             G D+ QD+   A      + + L  + VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  445   GNDSIQDDQMMATQLANTMWSSLKERPVQGRIFQGKEPPQFIALFQPMVV-LKGGISSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K+   ++      Y   G  ++++           QV     SL+  D F+L + + ++ 
Sbjct  504   KEFIADKNLNDETYTSDGIALMQVSGASVYNNKAVQVDAVATSLSSTDCFILQSGNSLFN  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG++S+ +++  A ++ +FLK     GV  +  V++G      +S  FW   GG     
Sbjct  564   WNGSSSSFEQQQWAAQIAEFLKP----GVA-LKHVKEG-----TESSAFWFALGGKQSYT  613

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
              K    D +        LF  +  +VN V    S+ +L      L D  +EVFVW+G + 
Sbjct  614   SKKIKQDIVRDPHLYTFLFKKEKLEVNEV-FNYSQDDLLTEDMLLFDTHAEVFVWIGHSV  672

Query  1002  QLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               +E++ A    ++++     ++   P A  + ++ +G+E   F   F SW  A A
Sbjct  673   DSNEKQNAFDIGQKYIELAVPLEGLSPHA-PLYKITEGNEPCFFTTYF-SWDPAKA  726



>ref|XP_007028722.1| Villin 2 isoform 2 [Theobroma cacao]
 gb|EOY09224.1| Villin 2 isoform 2 [Theobroma cacao]
Length=946

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIE+F+PVPLPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKVLDPAFQGVGQKPGTEIWRIEDFQPVPLPKSDYGKFYMGDSYIVLQTTPSKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWMGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V  +DD+IPE TP KL+ I +G+V  V+GELSK  LEN+KCYLLDCG EVFVWVGR TQ+
Sbjct  241   VAGEDDVIPETTPAKLYSITDGEVKIVEGELSKGLLENNKCYLLDCGVEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKAA Q AEEF+    RPKAT++TR+ QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EDRKAASQVAEEFVAGHNRPKATRMTRVIQGYETNSFKSNFDSWPAGSAAPGGEEGRGK  359


 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/359 (27%), Positives = 165/359 (46%), Gaps = 37/359 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA     +   L G+ VQ R  +  E  +F++ F+P ++ L+GG+++G+
Sbjct  443   GKDSIEEDQKMAARLANTMSNSLKGRPVQGRVFEGKEPPQFIALFQPMVV-LKGGLSTGY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKSIADKGLTDETYTADCVALFRISGTSVHNNKALQVDAVATSLNSTECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VA+    + +   +S  FW   GG     
Sbjct  562   WHGNQSTYEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSTFWFALGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  S + +      P L  F ++ G+    +    S+ +L      +LD  +EVFVWVG
Sbjct  612   SKKASTETV----RDPHLFMFSLNKGKFEVEEVYNFSQDDLLTEDSLILDTHAEVFVWVG  667

Query  993   RATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASAT  1157
             ++    E++   +  ++++      +       + ++ +G+E   F   F SW S  AT
Sbjct  668   QSVDTKEKQNVFEIGQKYIDMAASLEGLSPNVPLYKVTEGNEPCFFTTFF-SWDSTRAT  725



>ref|XP_010246733.1| PREDICTED: villin-2-like [Nelumbo nucifera]
Length=926

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 307/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K ++PAF   G K G EIWRIENF+PVPLPK +YGKFY GDSY++LQTT+GKGG 
Sbjct  1     MASSTKNVDPAFHGVGHKVGTEIWRIENFQPVPLPKTEYGKFYMGDSYIILQTTAGKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +L+DIHFW+GKDTSQDEAGTAAIKTVELDT LGG+ +QHRE+Q +ESD+FLSYFKPCI+P
Sbjct  61    HLYDIHFWIGKDTSQDEAGTAAIKTVELDTALGGRAIQHRELQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE FETRLYVC+GKRVV++KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEETFETRLYVCRGKRVVKLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ+ KDTYH G C+VAI++DG L AE+ SGEFW +FGGFAP+GRK
Sbjct  181   GANSNIQERAKALEVIQYFKDTYHEGKCDVAIIDDGKLVAESASGEFWVIFGGFAPIGRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               ++DD I E TP KL+ I NGQV PVDG LSKS LEN++CYLLDCG+EVFVWVGRATQ+
Sbjct  241   AATEDDAILETTPGKLYSITNGQVTPVDGALSKSMLENNQCYLLDCGAEVFVWVGRATQM  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAA Q AEEF+  Q RPK+T ITR+ QG+ET  FK  F+SWPS S T   E+GR +
Sbjct  301   EERKAANQAAEEFISSQNRPKSTHITRVVQGYETHFFKSNFESWPSGSGTSGAEDGRSR  359


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 165/359 (46%), Gaps = 39/359 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  ++ G+   IE+W I+     P+P+ + GKFY GD Y++L T         + +  W+
Sbjct  386   PLLESGGK---IEVWCIDGSAKTPVPQEEIGKFYCGDCYIILYTYHSGDKKEEYYLSCWV  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  443   GKDSIQEDQMMAMQLANTMFNSLKGRPVQGRIFQGKEPPQFIAIFQPMVV-LKGGLSSGY  501

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K+  E++      Y      ++R+           QV     SLN +D F L +    + 
Sbjct  502   KQFIEDKGLNDETYTVDSVALIRISATSVHNNKAVQVDAVATSLNSNDCFFLQSGSSNFI  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G  S ++++    ++  FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WQGHQSTLEQQQLTAKIADFLKP----GVT-LKHAKEG-----TESSTFWSPLGG----K  607

Query  822   RKVTSDDDIIPEKTPPKLFCI----DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
             +  TS+ +       P L+      +  +V+ V    S+ +L      +LD  +EVF+WV
Sbjct  608   QSYTSNKETQETFRDPHLYTFSFLNEKFEVSEVYN-FSQDDLLPEDIMILDTHAEVFIWV  666

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKATKIT----RLAQGHETISFKCEFDSWPSASA  1154
             G+     E++ A +  E+++    + +   +     ++ +G+E   F   F SW S+ A
Sbjct  667   GQCVDSKEKQKAFEIGEKYVELAAKLEGLSLEVPLYKVLEGNEPCFFTTYF-SWDSSKA  724



>ref|XP_010516356.1| PREDICTED: villin-3-like isoform X1 [Camelina sativa]
Length=965

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/359 (73%), Positives = 307/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EE+EFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKTEEDEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+ IPE TPPKL+ I +G+V  ++G+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDESIPETTPPKLYSIADGKVESIEGDLSKSMLENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 170/371 (46%), Gaps = 42/371 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             + +VN + + P  +  G+   +E+W I+     PL K D GK YSGD YVVL T      
Sbjct  377   STTVN-EEIPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYVVLYTYHSGER  432

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++
Sbjct  433   KEDYFLCCWFGKNSNQEDQETAVRLASIMTNSLKGRPVQVRIYEGKEPPQFVALFQHMVV  492

Query  465   PLEGGVASGFK-----KPEEEEFETR----LYVCKGKRVVRMK--QVPFARPSLNHDDVF  611
              L+GG++SG+K     K   +E  T+    L    G  V   K  QV     SLN  D F
Sbjct  493   -LKGGLSSGYKNSMTEKGSSDETYTQESIALIQVSGTGVHNNKALQVETVATSLNSYDCF  551

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L +   ++ ++G +S  +++  A +V +FLK         +   ++G      +S  FW
Sbjct  552   LLQSGTSMFLWHGNHSTHEQQELAAKVAEFLKPG-----TTIKHAKEGT-----ESSSFW  601

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  S + +      P LF         QV  +     + +L   + +LL
Sbjct  602   FALGGKQNFTSKKVSAETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLL  656

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKC  1124
             D  +EVFVWVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F  
Sbjct  657   DTHAEVFVWVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPKV-PLYKITEGNEPCFFTT  715

Query  1125  EFDSWPSASAT  1157
              F SW S  AT
Sbjct  716   YF-SWDSTKAT  725



>ref|XP_010516357.1| PREDICTED: villin-3-like isoform X2 [Camelina sativa]
Length=963

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/359 (73%), Positives = 307/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF+K EE+EFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFRKTEEDEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+ IPE TPPKL+ I +G+V  ++G+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDESIPETTPPKLYSIADGKVESIEGDLSKSMLENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 170/371 (46%), Gaps = 42/371 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             + +VN + + P  +  G+   +E+W I+     PL K D GK YSGD YVVL T      
Sbjct  377   STTVN-EEIPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYVVLYTYHSGER  432

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++
Sbjct  433   KEDYFLCCWFGKNSNQEDQETAVRLASIMTNSLKGRPVQVRIYEGKEPPQFVALFQHMVV  492

Query  465   PLEGGVASGFK-----KPEEEEFETR----LYVCKGKRVVRMK--QVPFARPSLNHDDVF  611
              L+GG++SG+K     K   +E  T+    L    G  V   K  QV     SLN  D F
Sbjct  493   -LKGGLSSGYKNSMTEKGSSDETYTQESIALIQVSGTGVHNNKALQVETVATSLNSYDCF  551

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L +   ++ ++G +S  +++  A +V +FLK         +   ++G      +S  FW
Sbjct  552   LLQSGTSMFLWHGNHSTHEQQELAAKVAEFLKPG-----TTIKHAKEGT-----ESSSFW  601

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  S + +      P LF         QV  +     + +L   + +LL
Sbjct  602   FALGGKQNFTSKKVSAETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLL  656

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKC  1124
             D  +EVFVWVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F  
Sbjct  657   DTHAEVFVWVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPKV-PLYKITEGNEPCFFTT  715

Query  1125  EFDSWPSASAT  1157
              F SW S  AT
Sbjct  716   YF-SWDSTKAT  725



>ref|XP_007028721.1| Villin 2 isoform 1 [Theobroma cacao]
 gb|EOY09223.1| Villin 2 isoform 1 [Theobroma cacao]
Length=980

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIE+F+PVPLPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKVLDPAFQGVGQKPGTEIWRIEDFQPVPLPKSDYGKFYMGDSYIVLQTTPSKGGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWMGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V  +DD+IPE TP KL+ I +G+V  V+GELSK  LEN+KCYLLDCG EVFVWVGR TQ+
Sbjct  241   VAGEDDVIPETTPAKLYSITDGEVKIVEGELSKGLLENNKCYLLDCGVEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKAA Q AEEF+    RPKAT++TR+ QG+ET SFK  FDSWP+ SA P  EEGRGK
Sbjct  301   EDRKAASQVAEEFVAGHNRPKATRMTRVIQGYETNSFKSNFDSWPAGSAAPGGEEGRGK  359


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/360 (27%), Positives = 167/360 (46%), Gaps = 39/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PLPK D GKFYSGD Y+VL T         + +  W+
Sbjct  386   PLLEGGGK---MEVWCINGSAKTPLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWI  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   AA     +   L G+ VQ R  +  E  +F++ F+P ++ L+GG+++G+
Sbjct  443   GKDSIEEDQKMAARLANTMSNSLKGRPVQGRVFEGKEPPQFIALFQPMVV-LKGGLSTGY  501

Query  495   KKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++  T          L+   G  V   K  QV     SLN  + F+L +   I+ 
Sbjct  502   KKSIADKGLTDETYTADCVALFRISGTSVHNNKALQVDAVATSLNSTECFLLQSGSSIFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VA+    + +   +S  FW   GG     
Sbjct  562   WHGNQSTYEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSTFWFALGGKQSYT  611

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  S + +      P L  F ++ G+    +    S+ +L      +LD  +EVFVWVG
Sbjct  612   SKKASTETV----RDPHLFMFSLNKGKFEVEEVYNFSQDDLLTEDSLILDTHAEVFVWVG  667

Query  993   RATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             ++    E++   +  ++++     ++   P    + ++ +G+E   F   F SW S  AT
Sbjct  668   QSVDTKEKQNVFEIGQKYIDMAASLEGLSPNVP-LYKVTEGNEPCFFTTFF-SWDSTRAT  725



>ref|XP_003554172.1| PREDICTED: villin-3-like isoform X1 [Glycine max]
 ref|XP_006604359.1| PREDICTED: villin-3-like isoform X2 [Glycine max]
 ref|XP_006604360.1| PREDICTED: villin-3-like isoform X3 [Glycine max]
Length=984

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQK G EIWRIE+F+PVPLP+++YGKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLDPAFQGVGQKVGTEIWRIEDFQPVPLPRSEYGKFYMGDSYIILQTTQGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIK VELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKNVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYVCRGKRVVRIKQVPFARSSLNHDDVFILDTQNKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQLLKEKHHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PE  P +L+ I +G+V PV+GELSKS LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIVPETIPAQLYSIADGEVKPVEGELSKSLLENYKCYLLDCGTEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-PPEEGRGK  1181
             ++RKAACQ AEEF+  QKRPK+T+ITR+ QG+ET SFK  FD WPS SAT   +EGRGK
Sbjct  301   EDRKAACQAAEEFVASQKRPKSTRITRIIQGYETHSFKSNFDFWPSGSATNSADEGRGK  359


 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 94/367 (26%), Positives = 169/367 (46%), Gaps = 39/367 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             V+ + P  +  G+   +E+W+I      PL K D GKFYSGD Y+VL T         + 
Sbjct  381   VEDIPPLLEGGGK---MEVWQISGSAKTPLSKEDIGKFYSGDCYIVLYTYHSSERKEDYY  437

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GKD+ +++   A      +   L G+ VQ R     E  +F++ F P ++ L+GG
Sbjct  438   LCCWFGKDSIEEDQRMAIRLANSMFNSLKGRPVQGRIFDGKEPPQFIALFHPMVV-LKGG  496

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+KK   ++      Y  +   ++R+           QV      LN  + FVL + 
Sbjct  497   LSSGYKKFIADKGLPDETYAAESVALIRISGTSIHNNKVVQVDAVAALLNSTECFVLQSG  556

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G   +++++  A +V +FL+     GV ++ + ++G      ++  FW   GG
Sbjct  557   SAVFTWHGNQCSLEQQQLAAKVAEFLRP----GV-SLKLAKEGT-----ETSTFWFALGG  606

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSE  974
                   K  ++D +      P LF +       QV  V    S+ +L      +LD  +E
Sbjct  607   KQSYTSKNVTNDIV----RDPHLFTLSFNRGKLQVEEVYN-FSQDDLLTEDILILDTHTE  661

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVW+G+     E++ A + A++++ K    +       + ++ +G+E   F   F SW 
Sbjct  662   VFVWIGQCVDPKEKQKAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTYF-SWD  720

Query  1143  SASATPP  1163
              A A  P
Sbjct  721   HAKAMVP  727



>ref|XP_006589014.1| PREDICTED: villin-3-like isoform X4 [Glycine max]
Length=969

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PV LPK++YGKFY+GDSY++LQTT GKGG 
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVALPKSEYGKFYTGDSYIILQTTQGKGGT  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR++QVPFAR SLNH+DVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLRQVPFARSSLNHEDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I + ++ PV+GELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIIPETIPAQLYSIVDVEIKPVEGELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERK+ACQ  EEF+  Q RPK+T+ITR+ QG+E  SFK  FDSWPS SA T  EEGRGK
Sbjct  301   EERKSACQAVEEFVASQNRPKSTRITRIIQGYEPHSFKSNFDSWPSGSASTSAEEGRGK  359


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/361 (26%), Positives = 166/361 (46%), Gaps = 39/361 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   IE+WRI       LPK + GKFYSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---IEVWRINGNAKNALPKEEIGKFYSGDCYIVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++  TA      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG +S
Sbjct  441   WFGKDSVEEDQTTATRLANTMSTSLKGRPVQGRIFEGKEPPQFVAIFQPMVV-LKGGFSS  499

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y  +   ++R+           QV     SLN  + FVL +   I
Sbjct  500   GYKKLIADKGVSDETYTAESIALIRISGTSIYNNKSVQVDAVPSSLNSTECFVLQSGSTI  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G   + +++  A +V  FL+         +   ++G      +S  FW   GG   
Sbjct  560   FTWHGNQCSFEQQQLAAKVADFLRPG-----ATLKHAKEGT-----ESSAFWSALGG---  606

Query  816   MGRKVTSDDDIIPEKTPPKLFCI--DNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVW  986
               +  TS   +      P LF +  + G+ N  +    S+ +L      +LD  +EVF+W
Sbjct  607   -KQSYTSKKVVNEVVRDPHLFTLSFNKGKFNVEEVYNFSQDDLLPEDILILDTHAEVFIW  665

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             +G + +  E++ A +  ++++     ++   P    + ++ +G+E   F   F SW  A 
Sbjct  666   IGHSVEPKEKRNAFEIGQKYIDLVASLEGLSPH-VPLYKVTEGNEPCFFTTYF-SWDHAK  723

Query  1152  A  1154
             A
Sbjct  724   A  724



>ref|XP_003535925.1| PREDICTED: villin-3-like isoformX1 [Glycine max]
 ref|XP_006589012.1| PREDICTED: villin-3-like isoform X2 [Glycine max]
 ref|XP_006589013.1| PREDICTED: villin-3-like isoform X3 [Glycine max]
 gb|KHN28511.1| Villin-2 [Glycine soja]
Length=973

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQ+ G EIWRIENF+PV LPK++YGKFY+GDSY++LQTT GKGG 
Sbjct  1     MSSSAKVLDPAFQGVGQRVGTEIWRIENFQPVALPKSEYGKFYTGDSYIILQTTQGKGGT  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D+HFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YFYDLHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR++QVPFAR SLNH+DVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLRQVPFARSSLNHEDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE  P +L+ I + ++ PV+GELSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   VISEDDIIPETIPAQLYSIVDVEIKPVEGELSKSLLENNKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +ERK+ACQ  EEF+  Q RPK+T+ITR+ QG+E  SFK  FDSWPS SA T  EEGRGK
Sbjct  301   EERKSACQAVEEFVASQNRPKSTRITRIIQGYEPHSFKSNFDSWPSGSASTSAEEGRGK  359


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/361 (26%), Positives = 166/361 (46%), Gaps = 39/361 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   IE+WRI       LPK + GKFYSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---IEVWRINGNAKNALPKEEIGKFYSGDCYIVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GKD+ +++  TA      + T L G+ VQ R  +  E  +F++ F+P ++ L+GG +S
Sbjct  441   WFGKDSVEEDQTTATRLANTMSTSLKGRPVQGRIFEGKEPPQFVAIFQPMVV-LKGGFSS  499

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y  +   ++R+           QV     SLN  + FVL +   I
Sbjct  500   GYKKLIADKGVSDETYTAESIALIRISGTSIYNNKSVQVDAVPSSLNSTECFVLQSGSTI  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G   + +++  A +V  FL+         +   ++G      +S  FW   GG   
Sbjct  560   FTWHGNQCSFEQQQLAAKVADFLRPG-----ATLKHAKEGT-----ESSAFWSALGG---  606

Query  816   MGRKVTSDDDIIPEKTPPKLFCI--DNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVW  986
               +  TS   +      P LF +  + G+ N  +    S+ +L      +LD  +EVF+W
Sbjct  607   -KQSYTSKKVVNEVVRDPHLFTLSFNKGKFNVEEVYNFSQDDLLPEDILILDTHAEVFIW  665

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             +G + +  E++ A +  ++++     ++   P    + ++ +G+E   F   F SW  A 
Sbjct  666   IGHSVEPKEKRNAFEIGQKYIDLVASLEGLSPH-VPLYKVTEGNEPCFFTTYF-SWDHAK  723

Query  1152  A  1154
             A
Sbjct  724   A  724



>ref|XP_008367397.1| PREDICTED: villin-3-like isoform X2 [Malus domestica]
Length=965

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVR+KQVPFAR SLNHDDVF+LDT++KI+QFN
Sbjct  121   LEGGVASGFKKAEEEEFETRLYTCKGKRVVRLKQVPFARSSLNHDDVFILDTQNKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIAKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VT++DD++PE TP  L+ I +G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VTTEDDVVPEATPAILYSITDGEVKTVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RK+A Q AEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWP  SAT   EEGRGK
Sbjct  301   EDRKSASQAAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPLGSATSGTEEGRGK  359


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 96/360 (27%), Positives = 160/360 (44%), Gaps = 39/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PL K D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGGAKTPLSKEDIGKFYSGDXYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TAA     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++SG+
Sbjct  443   GKDSVEEDQKTAAHLASTISNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSGY  501

Query  495   KKPEEEEF---ET------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+    ET       L+   G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KKSVEEKGLMDETYTADCVALFRLSGTSVHNNKAVQVDAVATSLNSTECFILQSGSSMFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G    I+++  A ++ +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WIGNQCTIEQQQLAAKLAEFLKP----GV-TLKHAKEGT-----ESSSFWFALGGKQSYN  611

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
                 S + +      P LF         QV  +    ++ +L      +LD  +EVFVWV
Sbjct  612   SNKVSQEIV----RDPHLFTFSFNRGKFQVEEIY-NFTQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSASAT  1157
             G+     E++ A +  ++++      +       + ++ +G E   F   F SW  + AT
Sbjct  667   GQCVDSKEKQNAFEIGKKYIALAASLEGLAPNVPLYKVTEGSEPRFFTTYF-SWDLSKAT  725



>ref|XP_008367394.1| PREDICTED: villin-3-like isoform X1 [Malus domestica]
 ref|XP_008367395.1| PREDICTED: villin-3-like isoform X1 [Malus domestica]
 ref|XP_008367396.1| PREDICTED: villin-3-like isoform X1 [Malus domestica]
Length=966

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 312/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVR+KQVPFAR SLNHDDVF+LDT++KI+QFN
Sbjct  121   LEGGVASGFKKAEEEEFETRLYTCKGKRVVRLKQVPFARSSLNHDDVFILDTQNKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIAKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VT++DD++PE TP  L+ I +G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VTTEDDVVPEATPAILYSITDGEVKTVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RK+A Q AEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWP  SAT   EEGRGK
Sbjct  301   EDRKSASQAAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPLGSATSGTEEGRGK  359


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 96/360 (27%), Positives = 160/360 (44%), Gaps = 39/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PL K D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGGAKTPLSKEDIGKFYSGDXYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TAA     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++SG+
Sbjct  443   GKDSVEEDQKTAAHLASTISNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSGY  501

Query  495   KKPEEEEF---ET------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+    ET       L+   G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KKSVEEKGLMDETYTADCVALFRLSGTSVHNNKAVQVDAVATSLNSTECFILQSGSSMFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G    I+++  A ++ +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WIGNQCTIEQQQLAAKLAEFLKP----GV-TLKHAKEGT-----ESSSFWFALGGKQSYN  611

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
                 S + +      P LF         QV  +    ++ +L      +LD  +EVFVWV
Sbjct  612   SNKVSQEIV----RDPHLFTFSFNRGKFQVEEIY-NFTQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSASAT  1157
             G+     E++ A +  ++++      +       + ++ +G E   F   F SW  + AT
Sbjct  667   GQCVDSKEKQNAFEIGKKYIALAASLEGLAPNVPLYKVTEGSEPRFFTTYF-SWDLSKAT  725



>ref|XP_010036436.1| PREDICTED: villin-3-like isoform X2 [Eucalyptus grandis]
Length=978

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DD I E TP KL+ I +GQ+  V+GELSK  LEN+ CYLLDCG+EVFVWVGR TQ+
Sbjct  241   VSSEDDAILEATPAKLYSIVDGQLKLVEGELSKGMLENNTCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERK A Q AE+F+  Q RPK+T+ITR+ QG+ET SFK +FD+WPS SA PP EEGRGK
Sbjct  301   DERKTAIQAAEDFISSQNRPKSTRITRVIQGYETHSFKSKFDTWPSGSAAPPSEEGRGK  359


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/367 (27%), Positives = 169/367 (46%), Gaps = 38/367 (10%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             SVN + + P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T        
Sbjct  379   SVN-EEVPPLLEGGGK---LEVWRINGSAKTPLSNEDIGKFYSGDCYIILYTYHSGERKE  434

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
              + +  W+GKD+ ++E   AA  +  +   L G+ VQ R  Q  E  +F++ F+P ++ L
Sbjct  435   DYFLSCWIGKDSVEEEQKMAARLSNTIFNSLKGRPVQGRIFQGKEPAQFIALFQPMVI-L  493

Query  471   EGGVASGFKKPEEEEF--------ETRLYVC-KGKRVVRMK--QVPFARPSLNHDDVFVL  617
             +GG++SG+KK   E+         E+   +C  G  +   K  QV     SL+    F+L
Sbjct  494   KGGLSSGYKKLIAEKGLMDDTYMQESVALICISGTSIHNNKAVQVDAVATSLDSAKCFLL  553

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +   ++ ++G  S  +++  A +V +FLK         VA+    + +   +S  FW  
Sbjct  554   QSGASVFNWHGNQSTFEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSSFWFA  603

Query  798   FGGFAPMGRKVTSDDDIIPEKTPPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCG  968
              GG     +  TS    +     P LF    + G+    +    S+ +L      +LD  
Sbjct  604   LGG----KQSYTSKKVSLEIARDPHLFTFSFNKGKFEVEEVYNFSQDDLLTEDILVLDTQ  659

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDS  1136
             +EVFVWVG+     E++ A ++ ++++      +       + R+ +G+E   F   F S
Sbjct  660   AEVFVWVGQCVDSKEKQNAFESGQKYIEMAASLENLAPTVPLYRVTEGNEPCFFTTYF-S  718

Query  1137  WPSASAT  1157
             W  A A 
Sbjct  719   WDPAKAN  725



>ref|XP_006421372.1| hypothetical protein CICLE_v10006928mg, partial [Citrus clementina]
 gb|ESR34612.1| hypothetical protein CICLE_v10006928mg, partial [Citrus clementina]
Length=964

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/340 (77%), Positives = 298/340 (88%), Gaps = 1/340 (0%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
             G EIWRIENF+PVPLPK+++GKFY GD Y+VLQTT GKGG YL+DIHFW+GKDTSQDEAG
Sbjct  1     GTEIWRIENFQPVPLPKSEHGKFYMGDCYIVLQTTPGKGGAYLYDIHFWIGKDTSQDEAG  60

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET  524
             TAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+PLEGGVASGF+K EEEEFET
Sbjct  61    TAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIPLEGGVASGFRKTEEEEFET  120

Query  525   RLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFL  704
             RLYVCKGKRVVRMKQVPFAR SLNHDDVF+LDTKDKIYQFNGANSNIQERAKALEVIQFL
Sbjct  121   RLYVCKGKRVVRMKQVPFARSSLNHDDVFILDTKDKIYQFNGANSNIQERAKALEVIQFL  180

Query  705   KDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCI  884
             K+ YH G CNVAIV+DG L  E+DSGEFW LFGGFAP+G+KV ++DD+I E TPPKL+ I
Sbjct  181   KEKYHDGNCNVAIVDDGKLDTESDSGEFWVLFGGFAPIGKKVATEDDVIAETTPPKLYSI  240

Query  885   DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFLVKQKR  1064
             ++ QV  V+GELSKS LEN+KCYLLD GSEVFVWVGR TQ++ERKAA Q AEEF+  Q R
Sbjct  241   EDSQVKIVEGELSKSMLENNKCYLLDRGSEVFVWVGRVTQVEERKAASQAAEEFISSQNR  300

Query  1065  PKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             PK+ +ITR+ QG+ET +FK  FDSWPS S  P  EEGRGK
Sbjct  301   PKSIRITRVIQGYETYAFKSNFDSWPSGSTAPGAEEGRGK  340


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/362 (27%), Positives = 165/362 (46%), Gaps = 43/362 (12%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       LPK D GKFYSGD Y+VL T         + +  W 
Sbjct  367   PLLEGGGK---MEVWRINGSAKTSLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWF  423

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ ++GG+ SG+
Sbjct  424   GKDSIEEDQKMATRLANTMCNSLKGRPVQGRIFQGREPPQFVALFQPMVV-VKGGLCSGY  482

Query  495   KKP-EEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+          +QV     SLN  + F+L +   ++ 
Sbjct  483   KKSLADKGLTDETYTADSIALIRISGTSIHNNKTEQVDAVATSLNSSECFLLQSGSTMFT  542

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VAI    + +   +S  FW     F   G
Sbjct  543   WHGNQSTFEQQQLAAKVAKFLKP-------GVAI---KHAKEGTESSAFW-----FPLGG  587

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  +   + PE    P LF         QV  V    S+ +L      +LD  +EVFVW
Sbjct  588   KQSYTSKKVSPEIVRDPHLFTFSFNKGAFQVEEVYN-FSQDDLLTEDILILDTHAEVFVW  646

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             VG++    E+++A +  + ++     ++   PK   + ++ +G+E   F   F SW    
Sbjct  647   VGQSVDSKEKQSAFEFGQNYIDMATSLEGLSPK-VPLYKVTEGNEPC-FCTTFFSWDPTK  704

Query  1152  AT  1157
             AT
Sbjct  705   AT  706



>ref|XP_010036435.1| PREDICTED: villin-3-like isoform X1 [Eucalyptus grandis]
Length=982

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DD I E TP KL+ I +GQ+  V+GELSK  LEN+ CYLLDCG+EVFVWVGR TQ+
Sbjct  241   VSSEDDAILEATPAKLYSIVDGQLKLVEGELSKGMLENNTCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERK A Q AE+F+  Q RPK+T+ITR+ QG+ET SFK +FD+WPS SA PP EEGRGK
Sbjct  301   DERKTAIQAAEDFISSQNRPKSTRITRVIQGYETHSFKSKFDTWPSGSAAPPSEEGRGK  359


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/367 (27%), Positives = 169/367 (46%), Gaps = 38/367 (10%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             SVN + + P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T        
Sbjct  379   SVN-EEVPPLLEGGGK---LEVWRINGSAKTPLSNEDIGKFYSGDCYIILYTYHSGERKE  434

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
              + +  W+GKD+ ++E   AA  +  +   L G+ VQ R  Q  E  +F++ F+P ++ L
Sbjct  435   DYFLSCWIGKDSVEEEQKMAARLSNTIFNSLKGRPVQGRIFQGKEPAQFIALFQPMVI-L  493

Query  471   EGGVASGFKKPEEEEF--------ETRLYVC-KGKRVVRMK--QVPFARPSLNHDDVFVL  617
             +GG++SG+KK   E+         E+   +C  G  +   K  QV     SL+    F+L
Sbjct  494   KGGLSSGYKKLIAEKGLMDDTYMQESVALICISGTSIHNNKAVQVDAVATSLDSAKCFLL  553

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +   ++ ++G  S  +++  A +V +FLK         VA+    + +   +S  FW  
Sbjct  554   QSGASVFNWHGNQSTFEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSSFWFA  603

Query  798   FGGFAPMGRKVTSDDDIIPEKTPPKLFC--IDNGQVNPVD-GELSKSNLENSKCYLLDCG  968
              GG     +  TS    +     P LF    + G+    +    S+ +L      +LD  
Sbjct  604   LGG----KQSYTSKKVSLEIARDPHLFTFSFNKGKFEVEEVYNFSQDDLLTEDILVLDTQ  659

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDS  1136
             +EVFVWVG+     E++ A ++ ++++      +       + R+ +G+E   F   F S
Sbjct  660   AEVFVWVGQCVDSKEKQNAFESGQKYIEMAASLENLAPTVPLYRVTEGNEPCFFTTYF-S  718

Query  1137  WPSASAT  1157
             W  A A 
Sbjct  719   WDPAKAN  725



>ref|XP_008790943.1| PREDICTED: villin-3-like [Phoenix dactylifera]
 ref|XP_008790944.1| PREDICTED: villin-3-like [Phoenix dactylifera]
Length=983

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/361 (73%), Positives = 307/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K L+PAFQ  GQK GIEIWRIENF+PVPLPK+DYGKFYSGDSY+VLQTT+GKGG 
Sbjct  1     MAGSTKNLDPAFQGVGQKVGIEIWRIENFQPVPLPKSDYGKFYSGDSYIVLQTTAGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LG + VQHRE+Q HESD+FLS FKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGSRAVQHRELQGHESDKFLSLFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE F+TRLY+C+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEETFQTRLYICRGKRVVRLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LKD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQHLKDKYHEGTCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD   E TP KL+ I++GQ+   +  LSK+ LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   TVSEDDHTLESTPGKLYSINDGQLMLEESALSKAMLENDKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA + AEEF++ Q RPKAT+IT++ QG ET SFK  F+SWP    T     E+GRG
Sbjct  301   EDRKAASKAAEEFIINQNRPKATRITQIIQGFETHSFKSNFESWPIGMGTATSVGEDGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 164/358 (46%), Gaps = 37/358 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  Q AG+   IE+WRI      P+PK + GKFYSGD Y+VL T         + +  WL
Sbjct  388   PLLQGAGK---IEVWRINGSAKTPIPKEEVGKFYSGDCYIVLYTYHSSEKKEEYFLACWL  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ QD+   A      +   L G+ VQ R +Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  445   GKDSVQDDRVMANRLANTMCNSLKGRPVQGRIVQGKEPPQFIALFQPMVI-LKGGISSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   E+      Y   G  ++R+           QV     SL+  D F+L +   ++ 
Sbjct  504   KKLISEKNGNDDTYTSDGIALIRVSGTSVHNNQAVQVDAVAASLSSTDCFLLQSGHSVFI  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G+++  +++  A +V +FLK    G     A       +   +S  FW   GG     
Sbjct  564   WHGSSTTFEQQNWAAKVAEFLKP---GATLKHA-------KEGTESSAFWFALGGKQSFT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K    D +      P L  F    G++   +    S+ +L      +LD  +EVFVWVG
Sbjct  614   TKKVIQDTV----RDPHLYTFSFSKGKLEVTEVYNFSQDDLLTEDILILDTHAEVFVWVG  669

Query  993   RATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             ++    ER+ A +  ++++      +       + R+ +G+E   F   F SW    A
Sbjct  670   QSVDPKERQKAFEIGQKYIELAAALEGLSPDVPLYRVTEGNEPCFFATYF-SWDGTKA  726



>ref|XP_009355490.1| PREDICTED: villin-3-like [Pyrus x bretschneideri]
Length=966

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/359 (75%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + KAL+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSSAKALDPAFQGAGQRVGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVR+KQVPF R SLNHDDVF+LDT++KI+QFN
Sbjct  121   LEGGVASGFKKAEEEEFETRLYTCKGKRVVRLKQVPFVRSSLNHDDVFILDTQNKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPIAKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             VT++DD++PE TP  L+ I +G+V  V+GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VTTEDDVVPEATPAILYSITDGEVKTVEGELSKSLLENNKCYLLDCGSEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RK+A Q AEEFL  Q RPK+T+ITR+ QG+ET SFK  FDSWP  SAT   EEGRGK
Sbjct  301   EDRKSASQAAEEFLASQNRPKSTRITRVIQGYETHSFKSNFDSWPLGSATSGTEEGRGK  359


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 97/361 (27%), Positives = 165/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I      PL K D GKFYSGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGGAKTPLSKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TAA     +   L G+ VQ    Q  E  + ++ F+P ++ L+GG++SG+
Sbjct  443   GKDSVEEDQKTAAHLASTISNSLKGRPVQGHIFQGKEPPQLVALFQPMVV-LKGGLSSGY  501

Query  495   KKPEEEEF---ET------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+    ET       L+   G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  502   KKLVEEKGLMDETYTADCVALFRLSGTSVHNNKAVQVDAVATSLNSTECFILQSGSSMFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G    I+++  A ++ +FLK     GV  +   ++G      +S  FW     FA  G
Sbjct  562   WIGNQCTIEQQQLAAKLAEFLKP----GV-TLKHAKEGT-----ESSSFW-----FALGG  606

Query  822   RKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             ++  + + +  E    P LF         QV  +    ++ +L      +LD  +EVFVW
Sbjct  607   KQSYTSNKVSQEIVRDPHLFTFSFNRGKFQVEEIY-NFTQDDLLTEDILILDTHAEVFVW  665

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+     E++ A +  ++++      +       + ++ +G+E   F   F SW  + A
Sbjct  666   VGQCVDSKEKQNAFEIGKKYIALAASLEGLAPNVPLYKVTEGNEPRFFTTYF-SWDLSKA  724

Query  1155  T  1157
             T
Sbjct  725   T  725



>ref|NP_567048.1| villin 3 [Arabidopsis thaliana]
 sp|O81645.2|VILI3_ARATH RecName: Full=Villin-3 [Arabidopsis thaliana]
 dbj|BAH56741.1| AT3G57410 [Arabidopsis thaliana]
 gb|AEE79652.1| villin 3 [Arabidopsis thaliana]
Length=965

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL VIQ+LKD +H G  +VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +GQV  +DG+LSKS LEN+KCYLLDCGSE+F+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGQVESIDGDLSKSMLENNKCYLLDCGSEIFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 94/363 (26%), Positives = 160/363 (44%), Gaps = 41/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+      L K   GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDANSKTVLSKDHVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  +          L    G  V   K  QV     SLN  D F+L +   +
Sbjct  500   GYKNSMTEKGSSGETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + + G +S  +++  A +V +FLK         +   ++G      +S  FW   GG   
Sbjct  560   FLWVGNHSTHEQQELAAKVAEFLKPG-----TTIKHAKEGT-----ESSSFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +     + +L   + +LLD  +EVFV
Sbjct  610   FTSKKVSSETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW S 
Sbjct  665   WVGQCVDPKEKQTAFEIGQRYINLAGSLEGLSPKV-PLYKITEGNEPCFFTTYF-SWDST  722

Query  1149  SAT  1157
              AT
Sbjct  723   KAT  725



>gb|AAC31607.1| villin 3 [Arabidopsis thaliana]
Length=966

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL VIQ+LKD +H G  +VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVIQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +GQV  +DG+LSKS LEN+KCYLLDCGSE+F+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGQVESIDGDLSKSMLENNKCYLLDCGSEIFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 94/363 (26%), Positives = 160/363 (44%), Gaps = 41/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+      L K   GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDANSKTVLSKDHVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSNQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFQHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  +          L    G  V   K  QV     SLN  D F+L +   +
Sbjct  500   GYKNSMTEKGSSGETYTPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + + G +S  +++  A +V +FLK         +   ++G      +S  FW   GG   
Sbjct  560   FLWVGNHSTHEQQELAAKVAEFLKPG-----TTIKHAKEGT-----ESSSFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +     + +L   + +LLD  +EVFV
Sbjct  610   FTSKKVSSETV----RDPHLFSFSFNRGKFQVEEIHN-FDQDDLLTEEMHLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW S 
Sbjct  665   WVGQCVDPKEKQTAFEIGQRYINLAGSLEGLSPKV-PLYKITEGNEPCFFTTYF-SWDST  722

Query  1149  SAT  1157
              AT
Sbjct  723   KAT  725



>ref|XP_004304349.1| PREDICTED: villin-2-like [Fragaria vesca subsp. vesca]
Length=969

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 311/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + KA++PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT  KGG 
Sbjct  1     MASSTKAMDPAFQGAGQRVGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAAIKTVELDT LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAIKTVELDTALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY+C+GKRVVRMKQVPFAR SLNHDDVF+LD+KDKI+QFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYICRGKRVVRMKQVPFARSSLNHDDVFILDSKDKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ+LK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+ +K
Sbjct  181   GANSNIQERAKALEVIQYLKEKYHNGTCDVAIVDDGKLDTESDSGEFWVLMGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             + ++DD+IPE TP  L+ I + +V  V+GELSKS LEN+KCYLLDCGSEVFVW GR TQ+
Sbjct  241   IANEDDVIPESTPATLYSITDAEVKIVEGELSKSLLENNKCYLLDCGSEVFVWFGRLTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKAA Q AEEF+  Q RPK+T+ITR+ QG+ET SFK  FDSWP  +AT   EEGRGK
Sbjct  301   EDRKAASQAAEEFVSHQNRPKSTRITRVIQGYETRSFKSNFDSWPLGTATSGSEEGRGK  359


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/320 (26%), Positives = 148/320 (46%), Gaps = 34/320 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I       +PK D GKF+SGD Y++L T         + +  W 
Sbjct  386   PLLEGGGK---MEVWCINGSAKTQVPKEDIGKFFSGDCYIILYTYHSGDRKDDYFLCCWF  442

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++  TA+     +   L G+ VQ    Q  E  +F++ F+P ++ LEGG++SG+
Sbjct  443   GKDSIEEDQKTASHLATSMSNSLKGRPVQGHIFQGKEPPQFIALFQPMVV-LEGGLSSGY  501

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+      Y  +   + R+           QV     SLN ++ F+L +   ++ 
Sbjct  502   KKFVEEKGLADETYTAECVALFRLSGTSIHNNKAVQVDAVATSLNSNECFLLQSGSSVFA  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG   +++++  A ++ +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  562   WNGNQCSVEQQQLAAKLAEFLKP----GV-TIKHAKEGT-----ESSTFWHALGG----K  607

Query  822   RKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
             +  TS+         P LF         QV  +    ++ +L      +LD  +EVFVWV
Sbjct  608   QNYTSNKVASEISRDPHLFTFSFNKGKFQVEEI-YNFTQDDLLTEDILILDTHAEVFVWV  666

Query  990   GRATQLDERKAACQTAEEFL  1049
             G+      ++ A +  ++++
Sbjct  667   GQCVDSKAKQNAFEIGKKYI  686



>ref|XP_010931980.1| PREDICTED: villin-2-like [Elaeis guineensis]
Length=946

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K L+PAFQ  GQK G EIWRIENF+PVPL KADYGKFYSGDSY+VLQTT+GKGG 
Sbjct  1     MASSTKNLDPAFQGVGQKVGTEIWRIENFQPVPLSKADYGKFYSGDSYIVLQTTAGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LG + VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGSRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FETRLY C+GKRV R+KQVPFAR +LNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEKFETRLYTCRGKRVGRLKQVPFARSALNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV Q+LKD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVTQYLKDKYHEGKCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD   E TP KL+ ID+GQ+   +  LSK+ LEN+KCYLLDCG+EVFVWVGR T++
Sbjct  241   TVSEDDHTLESTPGKLYSIDDGQLKLEESALSKAMLENNKCYLLDCGAEVFVWVGRVTKV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             ++RKAA + AEEF++ Q RPKAT+IT++ QG ET SFK  F+SWP+  AT   E+GRGK
Sbjct  301   EDRKAASKAAEEFIINQNRPKATRITQVIQGFETHSFKSYFESWPAGIATSGGEDGRGK  359


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 96/359 (27%), Positives = 169/359 (47%), Gaps = 35/359 (10%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  + AG+   IE+W+I      P+PK + GKFYSGD Y+VL T         + +  
Sbjct  384   VSPLLEGAGK---IEVWQINGNANTPVPKEEIGKFYSGDCYIVLYTYHSSEKKEEYFLAC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             WLGKD+ QD+          +   L G+ VQ R +Q  E  +F++ F+P ++ L+GG++S
Sbjct  441   WLGKDSIQDDRMMVNQLANTMCNSLKGRPVQGRIVQGKEPPQFIALFQPMVI-LKGGISS  499

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y   G  ++R+           QV     SL+  D F+L + + +
Sbjct  500   GYKKLIADKNVNDDTYTSDGIALIRVSSTSVHNNKAVQVDAVATSLSSTDCFLLQSGNSV  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG-FA  812
             + ++G++S  +++  A +V +FLK    G +   A       +   +S  FW   GG  +
Sbjct  560   FIWHGSSSTFEQQQCAAKVAEFLKP---GAMLKHA-------KEGTESSAFWFALGGKQS  609

Query  813   PMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
                RKVT D    P       F    G++   +    S+ +L      +LD  +EVF+WV
Sbjct  610   YTSRKVTQDTVRDPHLY---TFSFSKGKLEVTEVYNFSQDDLLTEDILILDTHAEVFIWV  666

Query  990   GRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G++    E++ A +  ++++      +       + ++ +G+E   F   F SW   +A
Sbjct  667   GQSVDPKEKQKAFEIGQKYMELAAALEGLSPDVPLYKVTEGNEPCFFTTYF-SWDGTNA  724



>ref|XP_006292629.1| hypothetical protein CARUB_v10018871mg [Capsella rubella]
 gb|EOA25527.1| hypothetical protein CARUB_v10018871mg [Capsella rubella]
Length=997

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ  GQK G EIWRIENF+PVP+PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGVGQKPGTEIWRIENFEPVPVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQ+REIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQYREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKLEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+D+IIPE TPPKL+ I +GQV  +DG+LSKS LEN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDEIIPETTPPKLYSIADGQVESIDGDLSKSMLENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 101/395 (26%), Positives = 172/395 (44%), Gaps = 73/395 (18%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     PL K D GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDGNSKTPLSKDDVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK+++Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSNQEDQETAIRLASIMTNSLKGRPVQARIYEGKEPPQFVAIFQHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET---------RLYVCKGKRV--VRMKQVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  +          L    G  V   R  QV     SLN ++ F+L +   +
Sbjct  500   GYKNSMTEKGSSDETYTPDSIALIQVSGTGVHNNRALQVEAVATSLNSNECFLLQSGTNM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G +S  +++  A +V +FLK     G+  +   ++G      +S  FW   GG   
Sbjct  560   FLWHGNHSTHEQQELAAKVAEFLKP----GI-TIKHAKEGT-----ESSSFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLF--------CIDNGQVNPVDGELSKSN-------------  932
                K  S + +      P LF         I N  +  VD +L+ SN             
Sbjct  610   FTSKKVSSETV----RDPHLFSFSFNRGLSISNRLIYVVD-KLAYSNFVFFFSMCLHGSS  664

Query  933   ---------------LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL-----V  1052
                            L   + +LLD  +EVFVWVG+   + E++ A +  + ++     +
Sbjct  665   GKFQVEEIHNFDQDDLLTEEMHLLDTHAEVFVWVGQCVDVKEKQTAFEIGQRYIDLAGSL  724

Query  1053  KQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             +   PK   + ++ +G+E   F   F SW S  AT
Sbjct  725   EGLSPKV-PLYKITEGNEPCFFTTYF-SWDSTKAT  757



>tpg|DAA55799.1| TPA: hypothetical protein ZEAMMB73_503572 [Zea mays]
Length=651

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 310/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLDT++KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDTENKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E T PKL+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++VWVGR TQ+++R
Sbjct  243   DDDVVLETTAPKLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATP-PEEGRGK  1181
             K+A +  +EFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +A+  P  EEGRGK
Sbjct  303   KSATKAVDEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNAAGNPGTEEGRGK  360


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 123/257 (48%), Gaps = 27/257 (11%)
 Frame = +3

Query  168  IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
            +E+W ++      LPK D GKFYSGD Y++L T         + + +W+GKD+  D+  +
Sbjct  396  LEVWCVDGNTKTALPKEDIGKFYSGDCYIILYTHHSGDKKEEYYLSYWIGKDSLVDDQVS  455

Query  348  AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-  524
            A+     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG+ SG+KK  EE+    
Sbjct  456  ASQIINTMWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGIGSGYKKLIEEKGAMG  514

Query  525  RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
              Y  +G  ++R+           QV     SL+  + FVL + + ++ + G +S  +++
Sbjct  515  ETYTTEGIALIRVSETSIYNNKTLQVDAVATSLSSTESFVLQSGNAMFTWFGNSSTYEQQ  574

Query  675  AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
              A +V +FLK         VA+    + +   +S  FW   GG      K T  D I  
Sbjct  575  QWAAKVAEFLKP-------GVAV---KHCKEGTESSAFWFALGGKQSYTNKNTPQDIITR  624

Query  855  EKTPPKL--FCIDNGQV  899
            E   P L  F   NGQ+
Sbjct  625  E---PHLYAFSFKNGQL  638



>ref|XP_008786911.1| PREDICTED: villin-2-like isoform X2 [Phoenix dactylifera]
 ref|XP_008786912.1| PREDICTED: villin-2-like isoform X2 [Phoenix dactylifera]
Length=949

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/361 (72%), Positives = 309/361 (86%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K L+PAFQ  GQK G EIWRIENF+PVPL KADYGKFYSGDSY+VLQTT+GKGG 
Sbjct  2     MASSTKNLDPAFQGVGQKVGTEIWRIENFQPVPLSKADYGKFYSGDSYIVLQTTAGKGGA  61

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  62    YLYDIHFWLGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  121

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE+FETRLY C+GKRVVR+KQVPFAR SLNHDDVF+LDT++KI+QFN
Sbjct  122   LEGGVASGFKKPEEEKFETRLYTCRGKRVVRLKQVPFARSSLNHDDVFILDTENKIFQFN  181

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ+LKD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  182   GANSNIQERAKALEVIQYLKDKYHEGKCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  241

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD   E TP KL+ I++ Q+   +  LSK+ LEN+KCYL+DCG+EVFVWVGR TQ+
Sbjct  242   TVSEDDHALESTPGKLYSINDDQLKLEESALSKAMLENNKCYLMDCGAEVFVWVGRVTQV  301

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA + AEEF++ Q RPK T+IT++ QG ET SFK  F+SWP+++ T     E+GRG
Sbjct  302   EDRKAASKAAEEFVINQNRPKVTRITQVIQGFETRSFKSYFESWPASTGTAASGGEDGRG  361

Query  1179  K  1181
             K
Sbjct  362   K  362


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 152/319 (48%), Gaps = 32/319 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  + AG+   IE+WRI      P+PK + GKFYSGD Y+VL T         + +  WL
Sbjct  389   PLLEGAGK---IEVWRINGNAKTPVPKEEIGKFYSGDCYIVLYTYHSSEKKEEYFLACWL  445

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ QD+   A      +   L G+ VQ   +Q  E  +F++ F+P ++ L+GGV+SG+
Sbjct  446   GKDSVQDDWMMANRLANTMCNSLKGRPVQGHIVQGKEPPQFIALFQPMVI-LKGGVSSGY  504

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y   G  ++R+           QV     SL+  D F+L + + ++ 
Sbjct  505   KKLIADKNVNDDTYTSDGIALIRVSDTSVHNNKAVQVEAVATSLSSTDCFLLQSGNSVFI  564

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G++S  +++  A +V +FLK    G     A       +   +S  FW   GG     
Sbjct  565   WDGSSSTFEQQQWAAKVAEFLKP---GATLKHA-------KEGTESSAFWFALGGKQSFT  614

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D +      P L  F    G++   +    S+ +L      +LD  +EVFVWVG
Sbjct  615   TKKVAQDTV----RDPHLYTFSFSKGKLEVTEVHNFSQDDLLTEDILILDTHAEVFVWVG  670

Query  993   RATQLDERKAACQTAEEFL  1049
             ++    E++ A +  ++++
Sbjct  671   QSVDPKEKQKAFEIGQKYM  689



>ref|XP_010036453.1| PREDICTED: villin-3-like isoform X2 [Eucalyptus grandis]
Length=1027

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DD I E TP KL+ I +GQ+  V+GELSK  LEN+ CYLLDCG+EVFVWVGR TQ+
Sbjct  241   VSSEDDAILEATPAKLYSIVDGQLKLVEGELSKGMLENNTCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERK A Q AE+F+  Q RPK+T+ITR+ QG+ET SFK +FD+WPS SA PP EEGRGK
Sbjct  301   DERKTAIQAAEDFISSQNRPKSTRITRVIQGYETHSFKSKFDTWPSGSAAPPSEEGRGK  359


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 169/368 (46%), Gaps = 40/368 (11%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             SVN + + P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T        
Sbjct  379   SVN-EEVPPLLEGGGK---LEVWRINGSAKTPLSNEDIGKFYSGDCYIILYTYHSGERKE  434

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
              + +  W+GKD+ ++E   AA  +  +   L G+ VQ R  Q  E  +F++ F+P ++ L
Sbjct  435   DYFLSCWIGKDSVEEEQKMAARLSNTIFNSLKGRPVQGRIFQGKEPAQFIALFQPMVI-L  493

Query  471   EGGVASGFKKPEEEEF--------ETRLYVC-KGKRVVRMK--QVPFARPSLNHDDVFVL  617
             +GG++SG+KK   E+         E+   +C  G  +   K  QV     SL+    F+L
Sbjct  494   KGGLSSGYKKLIAEKGLMDDTYMQESVALICISGTSIHNNKAVQVDAVATSLDSAKCFLL  553

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +   ++ ++G  S  +++  A +V +FLK         VA+    + +   +S  FW  
Sbjct  554   QSGASVFNWHGNQSTFEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSSFWFA  603

Query  798   FGGFAPMGRKVTSDDDIIPEKTPPKLFCID----NGQVNPVDGELSKSNLENSKCYLLDC  965
              GG     +  TS    +     P LF       N +V  V    S+ +L      +LD 
Sbjct  604   LGG----KQSYTSKKVSLEIARDPHLFTFSFNKGNFEVEEVY-NFSQDDLLTEDILVLDT  658

Query  966   GSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFD  1133
              +EVFVWVG+     E++ A ++ ++++      +       + R+ +G+E   F   F 
Sbjct  659   QAEVFVWVGQCVDSKEKQNAFESGQKYIEMAASLENLAPTVPLYRVTEGNEPCFFTTYF-  717

Query  1134  SWPSASAT  1157
             SW  A A 
Sbjct  718   SWDPAKAN  725



>ref|XP_009391537.1| PREDICTED: villin-2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391538.1| PREDICTED: villin-2-like [Musa acuminata subsp. malaccensis]
Length=955

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/363 (70%), Positives = 310/363 (85%), Gaps = 5/363 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K ++PAFQ  GQK G EIWRIE+F+PVPLPK+DYGKF+SGDSY++LQT+SGKGG 
Sbjct  1     MSSSTKYIDPAFQGVGQKVGTEIWRIEDFQPVPLPKSDYGKFHSGDSYIILQTSSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GK++SQDEAGTAAIKTVELD +LGG+ VQHRE+Q  ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKESSQDEAGTAAIKTVELDAVLGGRAVQHRELQGFESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPE E+FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGFASGFKKPEVEKFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCGVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DDII E +P KL+ I++GQ+   +  LSK+ LEN KCYLLDCG+E+F+WVGR TQ+
Sbjct  241   VVNEDDIILEASPAKLYSINDGQLKLEENTLSKAMLENYKCYLLDCGAEIFIWVGRVTQI  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-----PPEEG  1172
             +ERKAA + AE+F++ Q RPK T+IT++ QG+ET SFK  F+SWP+ + T       EEG
Sbjct  301   EERKAASKAAEDFIINQNRPKTTRITQVIQGYETHSFKSNFESWPAGTVTGTGTSSGEEG  360

Query  1173  RGK  1181
             RGK
Sbjct  361   RGK  363


 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 93/360 (26%), Positives = 169/360 (47%), Gaps = 37/360 (10%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+WRI      P+PK + GKFYSGD Y+VL T         + +  
Sbjct  388   IPPLLEGGGK---LEVWRINGSAKNPVPKEEIGKFYSGDCYIVLYTYHSSEKKEDYFLAC  444

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W+GKD+ QD+   A      + + L G+ VQ R  Q  E  +F++ F+P ++ L+GG++S
Sbjct  445   WMGKDSIQDDQMMATRLANTMWSSLKGRPVQGRIFQGKEPPQFIALFQPMVV-LKGGISS  503

Query  489   GFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+KK   ++      Y   G  ++++           QV     SL+  D F+L + + +
Sbjct  504   GYKKFIADKNLNDETYTSDGIALIQVSGTSVHNNKAVQVDAVATSLSSTDCFILQSGNSL  563

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G++S  +++  A  + + LK     GV  +  V++G      +S  FW   GG   
Sbjct  564   FIWSGSSSTFEQQQWAARIAELLKP----GVT-LKHVKEGT-----ESSAFWFGLGGKQG  613

Query  816   MGRKVTSDDDIIPEKTPPKL--FCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVW  986
                K  + D I      P L  F    G++   +    S+ +L      +LD  +E+FVW
Sbjct  614   FTSKKIAQDII----RDPHLYTFSFKKGKLEVTEVFNYSQDDLLTEDMLVLDTHAELFVW  669

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             +G++    E++ A    ++++      +       + ++ +G+E   F   F SW +A A
Sbjct  670   IGQSVDSKEKQKAFDIGQKYIELATSLEGLSPDVPLYKITEGNEPCFFTTYF-SWDNAKA  728



>ref|XP_009414165.1| PREDICTED: villin-2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009414167.1| PREDICTED: villin-2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009414168.1| PREDICTED: villin-2-like [Musa acuminata subsp. malaccensis]
Length=953

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/361 (70%), Positives = 309/361 (86%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K ++PAFQ  GQK G EIWRIENF+PVPLPK DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSSSTKYVDPAFQGVGQKVGTEIWRIENFQPVPLPKTDYGKFYSGDSYIILQTTSGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL DIHFW+G++++QDEAGTAAIKTVELD +LGG+ VQHRE+Q +ESD+FLSYFKPCI+P
Sbjct  61    YLHDIHFWIGRESTQDEAGTAAIKTVELDAVLGGRAVQHRELQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPEEE FETRLYVC+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGFASGFKKPEEEVFETRLYVCRGKRVVRMKQVPFARSSLNHDDVFILDTEMKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD++ E  P K + I++GQ+   +  LSK+ LEN+KCYLLDCG+E+F+WVGR TQ+
Sbjct  241   VVNEDDVVLEMAPAKFYSINDGQLKLEENTLSKATLENNKCYLLDCGAEIFIWVGRVTQI  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             +ERKAA + AE+F++ Q RPK T +T++ QG+ET +FK  F+SWP+++ T     EEGRG
Sbjct  301   EERKAASKAAEDFIISQNRPKTTHVTQVIQGYETHAFKSNFESWPASTVTGNSGGEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   120 bits (301),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 99/359 (28%), Positives = 172/359 (48%), Gaps = 39/359 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  + +G+   +E+WRI++     +PK + GKFYSGD Y+VL T         + +  W+
Sbjct  388   PLLEGSGK---LEVWRIDDGAKNQVPKEEIGKFYSGDCYIVLYTYHSGERKEDYFLTSWM  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ QD+   A      + T L G+ VQ R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  445   GKDSIQDDQIMATQLATTMWTSLKGRPVQGRIFQGKEPPQFVALFQPLVL-LKGGISSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K    E+      Y   G  ++++           QV     SL   D F+L + + ++ 
Sbjct  504   KTFIAEKNQNDETYTSDGIALIQVSGTSVHNNKAVQVDAVATSLCSTDCFILQSGNSLFI  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             +NG++S  + +  A ++ +FLK     GV  +  V++G      +S  FW   GG     
Sbjct  564   WNGSSSTHEHQHWAAKIAEFLKP----GVT-LKYVKEGT-----ESSAFWFALGGKQSFT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D +      P L  F +  G++   +    S+ ++      LLD  +EVFVW+G
Sbjct  614   SKKITQDVV----RDPHLYTFSLKKGKIEVFEVFNYSQDDMLTEDMLLLDSHAEVFVWIG  669

Query  993   RATQLDERKAACQTAEEF-----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
              +   +E++ A    +++     L++   P    + R+ +G+E   F   F SW SA A
Sbjct  670   HSVDPNEKQKAFDIGQKYIELAVLLEGLSPNV-PLYRITEGNEPCFFTTYF-SWDSAKA  726



>gb|AAD54660.1|AF088901_1 actin bundling protein ABP135 [Lilium longiflorum]
Length=965

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 308/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K L+PAFQ  GQ+ G EIWRIENF+PV LPK+D+GKFYSGDSY+VLQTT+GKGG 
Sbjct  1     MANSSKNLDPAFQGVGQRLGTEIWRIENFQPVSLPKSDHGKFYSGDSYIVLQTTAGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +L+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYF+PCI+P
Sbjct  61    HLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFRPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGV SGFK PEEE FETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVVSGFKTPEEETFETRLYVCRGKRVVRLKQVPFARTSLNHDDVFILDTEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLKD YH G C+VAI++DG L AE+ SGEFW LFGGFAP+G++
Sbjct  181   GANSNIQERAKALEVIQFLKDKYHEGTCDVAIIDDGRLAAESGSGEFWVLFGGFAPIGKR  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V  DDD+  E TP KL+ I++GQ+   +G LSK+ LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  241   VVGDDDVTLETTPGKLYSINDGQLKLEEGTLSKAMLENNKCYLLDCGAEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA ++AEEF++ + RPK T+ITR+ QG ET +FK  F+SWP  SAT     EEGRG
Sbjct  301   EDRKAASKSAEEFIINENRPKVTRITRVIQGFETRTFKSNFESWPLGSATGTSGGEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   107 bits (268),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 82/318 (26%), Positives = 149/318 (47%), Gaps = 30/318 (9%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+    E+W I      P+P+ + GKFYSGD Y+VL T         + +  W+
Sbjct  388   PLIEGTGK---TEVWLISGSAKTPVPQEEIGKFYSGDCYIVLHTYHSGEKKDEYFLSCWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK++++D+   A      +   L GK VQ R +Q  E  +F++ F+P ++ L+GG++ G+
Sbjct  445   GKNSAKDDQLMATKLASSMCNSLKGKPVQGRIVQGREPPQFIALFQPMVV-LKGGISPGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      YV  G  ++R+           QV     SL+  D F+L + + ++ 
Sbjct  504   KKLIADKNLNDDTYVSDGIALIRISKTSVHNNKVIQVDAVATSLSSTDSFLLQSGNSMFL  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK    G V   A       +   +S  FW   GG     
Sbjct  564   WHGNASTFEQQQWAAKVAEFLKP---GVVLKHA-------KEGTESSAFWFALGGKQSYS  613

Query  822   RKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGR  995
              K  + + +   + P    C  + G++   +    S+ +L      +LD   E+FVWVG+
Sbjct  614   PKKDAQEIV---RDPHLYVCSFNKGKLEVTEVYNFSQDDLLTEDILILDTHEEIFVWVGQ  670

Query  996   ATQLDERKAACQTAEEFL  1049
             +    E++ A    ++++
Sbjct  671   SVDSKEKQNAFDIGQKYI  688



>ref|XP_010036452.1| PREDICTED: villin-3-like isoform X1 [Eucalyptus grandis]
Length=1031

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1     MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+S+DD I E TP KL+ I +GQ+  V+GELSK  LEN+ CYLLDCG+EVFVWVGR TQ+
Sbjct  241   VSSEDDAILEATPAKLYSIVDGQLKLVEGELSKGMLENNTCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             DERK A Q AE+F+  Q RPK+T+ITR+ QG+ET SFK +FD+WPS SA PP EEGRGK
Sbjct  301   DERKTAIQAAEDFISSQNRPKSTRITRVIQGYETHSFKSKFDTWPSGSAAPPSEEGRGK  359


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 169/368 (46%), Gaps = 40/368 (11%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             SVN + + P  +  G+   +E+WRI      PL   D GKFYSGD Y++L T        
Sbjct  379   SVN-EEVPPLLEGGGK---LEVWRINGSAKTPLSNEDIGKFYSGDCYIILYTYHSGERKE  434

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
              + +  W+GKD+ ++E   AA  +  +   L G+ VQ R  Q  E  +F++ F+P ++ L
Sbjct  435   DYFLSCWIGKDSVEEEQKMAARLSNTIFNSLKGRPVQGRIFQGKEPAQFIALFQPMVI-L  493

Query  471   EGGVASGFKKPEEEEF--------ETRLYVC-KGKRVVRMK--QVPFARPSLNHDDVFVL  617
             +GG++SG+KK   E+         E+   +C  G  +   K  QV     SL+    F+L
Sbjct  494   KGGLSSGYKKLIAEKGLMDDTYMQESVALICISGTSIHNNKAVQVDAVATSLDSAKCFLL  553

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +   ++ ++G  S  +++  A +V +FLK         VA+    + +   +S  FW  
Sbjct  554   QSGASVFNWHGNQSTFEQQQLAAKVAEFLKP-------GVAL---KHAKEGTESSSFWFA  603

Query  798   FGGFAPMGRKVTSDDDIIPEKTPPKLFCID----NGQVNPVDGELSKSNLENSKCYLLDC  965
              GG     +  TS    +     P LF       N +V  V    S+ +L      +LD 
Sbjct  604   LGG----KQSYTSKKVSLEIARDPHLFTFSFNKGNFEVEEVY-NFSQDDLLTEDILVLDT  658

Query  966   GSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFD  1133
              +EVFVWVG+     E++ A ++ ++++      +       + R+ +G+E   F   F 
Sbjct  659   QAEVFVWVGQCVDSKEKQNAFESGQKYIEMAASLENLAPTVPLYRVTEGNEPCFFTTYF-  717

Query  1134  SWPSASAT  1157
             SW  A A 
Sbjct  718   SWDPAKAN  725



>ref|XP_006402881.1| hypothetical protein EUTSA_v10005772mg [Eutrema salsugineum]
 gb|ESQ44334.1| hypothetical protein EUTSA_v10005772mg [Eutrema salsugineum]
Length=968

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 305/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+PV +PK+++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSTKVLDPAFQGAGQKPGTEIWRIENFQPVLVPKSEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAALGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSG FW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALVVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGAFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TPPKL+ I +GQV  + G LSKS LENSKCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPPKLYSITDGQVESMGGVLSKSMLENSKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK +   AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTSIHAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 160/363 (44%), Gaps = 41/363 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     PL K D GK YSGD Y+VL T         + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDGKSKTPLSKDDVGKLYSGDCYLVLYTYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK + Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKSSIQEDQETAVRLASAMTNSLKGRPVQARIFEGTEPPQFVALFQHMVV-LKGGLSS  499

Query  489   GFKK-------PEEEEFETRLYVCK----GKRVVRMKQVPFARPSLNHDDVFVLDTKDKI  635
             G+K        PEE      + + +    G    +  QV     SLN  D F+L +   +
Sbjct  500   GYKNSMTGKGSPEETYTPDSIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + +NG  S  +++  A +V +FLK         +   ++G      +S  FW   GG   
Sbjct  560   FLWNGNQSTHEQQELAAKVAEFLKPG-----ITIKHAKEGT-----ESSSFWFALGGKQN  609

Query  816   MGRKVTSDDDIIPEKTPPKLFCID----NGQVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
                K  S + +      P LF         QV  +     + +L     +LLD  +EVFV
Sbjct  610   FTSKKVSSETV----RDPHLFSFSFKRGKFQVEEIH-NFDQDDLLTEDMHLLDTHAEVFV  664

Query  984   WVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             WVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW + 
Sbjct  665   WVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDAT  722

Query  1149  SAT  1157
              AT
Sbjct  723   KAT  725



>ref|XP_003565080.1| PREDICTED: villin-3-like [Brachypodium distachyon]
Length=981

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 310/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK GIEIWRIE+FKPVPLPK+DYGKFY GDSY+VLQTTS KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGIEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTTSPKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD+ILGG+ VQHRE+Q +ESD+FLSYFKPCI+P+EG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDSILGGRAVQHRELQGYESDKFLSYFKPCIIPMEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFK PEE++FETRLY+CKG+R +R+K+VPFAR SLNHDDVF+LDT+ KIYQFNGAN
Sbjct  123   GFASGFKTPEEDKFETRLYICKGRRAIRIKEVPFARSSLNHDDVFILDTESKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAK+LEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKSLEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E TPPKL+ I++GQ+   D  L+K+ LEN++C+LLDCG+E+FVWVGR TQLD+R
Sbjct  243   DDDVVLETTPPKLYSINDGQLKLEDTALTKAVLENTRCFLLDCGAEMFVWVGRVTQLDDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRGK  1181
             KA  +  EEF++ QKRPK T++T++ QG+E+ +FK +F+SWP    A  +  E+GRGK
Sbjct  303   KATTKAVEEFIIDQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNVAGNSGAEDGRGK  360


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 164/353 (46%), Gaps = 36/353 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W ++      LPK D GKFYSGD Y+VL T         + +++W+
Sbjct  388   PLLEGGGK---LEVWCVDGSAKTVLPKEDNGKFYSGDCYIVLYTYHSGDKKEEYYLNYWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD++ D+   AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG+ SG+
Sbjct  445   GKDSTTDDQAMAAELANTMWNSLKGRPVLGRIFQGKEPPQFVALFQPMVI-LKGGIGSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+   + +Y  +G  + R+           QV     SL+  D FVL +   ++ 
Sbjct  504   KKIAEEKGVGSGMYSAEGIALFRVSGTAIHNNKTLQVDAKATSLSSTDCFVLQSGSAMFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G +S  +++  A +V +FLK         V   ++G      +S  FW    G     
Sbjct  564   WHGNSSTYEQQQWAAKVAEFLKPG-----ATVKHSKEGT-----ESSAFWFALDGKQSYT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D I+ E   P L  F    G++   +     + +L      +LD   EVF+W+G
Sbjct  614   NKTVTQDIIVRE---PHLYAFSFRKGRLEVTEIFNFCQDDLLTEDMMILDTHGEVFIWIG  670

Query  993   RATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSW  1139
             +  +  E+  A    ++++      +       + ++++G+E   FK  F SW
Sbjct  671   QCVESKEKHKAFDIGQKYIEHAMSIEDLSAYVPLYKVSEGNEPSFFKTYF-SW  722



>ref|XP_010922147.1| PREDICTED: villin-2-like [Elaeis guineensis]
Length=982

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/361 (71%), Positives = 307/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ + K L+PAFQ  GQK GIEIWRIENF+PVPLPK+DYGKFYSGDSY+VLQT++G+GG 
Sbjct  1     MAGSAKNLDPAFQGVGQKVGIEIWRIENFQPVPLPKSDYGKFYSGDSYIVLQTSAGRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFWLGKDTSQDEAGTAAIKT+ELD +LGG+ VQHRE+Q HESD+FLS FKPCI+P
Sbjct  61    YLYDIHFWLGKDTSQDEAGTAAIKTIELDAVLGGRAVQHRELQGHESDKFLSLFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFK PEEE FETRLY C+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKTPEEETFETRLYTCRGKRVVRLKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANS+IQERAKALEVIQ+LKD YH G C+VAI++DG LQAE+D+GEFW LFGGFAP+G+K
Sbjct  181   GANSSIQERAKALEVIQYLKDKYHEGKCDVAIIDDGKLQAESDTGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD   E TP KL+ I++GQ    +  LSK+ LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  241   TVSEDDHTLESTPGKLYSINDGQWKLEESALSKAMLENDKCYLLDCGAEVFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA + AEEF++ Q RPKAT+IT++ QG ET SFK  F+SWP  + T     E+GRG
Sbjct  301   EDRKAASKAAEEFIMNQNRPKATRITQVIQGFETHSFKSNFESWPVGTGTATSVGEDGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 163/358 (46%), Gaps = 37/358 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  Q  G+   IE+WRI      P+P  + GKFYSGD Y+VL T         + +  WL
Sbjct  388   PLLQGGGK---IEVWRINGSAKTPIPSEEVGKFYSGDCYIVLYTYHSSEKKEEYFLACWL  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ QD+   A      +   L G+ VQ R +Q  E  +F++ F+P ++ L+GGV+SG+
Sbjct  445   GKDSVQDDRVMANRLANTMCNSLKGRPVQGRIVQGKEPPQFIALFQPMVI-LKGGVSSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   +       Y   G  ++R+           QV     SL+  D F+L +   ++ 
Sbjct  504   KKLIADNNGNDDTYTSDGIALIRVSGTSVHNNKAVQVDAVATSLSSTDCFLLQSGHSVFI  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G+++  +++    +V +FLK         +   ++G      +S  FW   GG     
Sbjct  564   WHGSSTTFEQQNWTAKVAEFLKP-----AATLKHAKEGT-----ESSAFWFALGGKQSFT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D +      P L  F  + G++   +    S+ +L      +LD  +EVF+WVG
Sbjct  614   TKKVTQDTV----RDPHLYTFSFNKGKLEITEVYNFSQDDLLTEDILILDTHAEVFIWVG  669

Query  993   RATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             ++    E++ A +  ++++      +       + R+ +G+E   F   F SW    A
Sbjct  670   QSVDPKEKQNAFEIGQKYIELAATLEGLSPDVPLYRVTEGNEPCFFTTYF-SWDGTKA  726



>emb|CDX72038.1| BnaC08g28360D [Brassica napus]
Length=954

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/359 (74%), Positives = 304/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQK G EIWRIENF+PV +PK+++ KFY GD+Y+VLQTT  K G 
Sbjct  1     MSGPAKVLDPAFQGAGQKPGTEIWRIENFQPVLVPKSEHRKFYMGDTYIVLQTTQSKAGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAGLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKLEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALAVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TPPKL+ I +GQV  +DG LSKS +EN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPPKLYSIADGQVESIDGNLSKSMMENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+FL  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFLASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 167/362 (46%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     P+ K D GK YSGD Y+VL           + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDGKAKTPVSKDDVGKLYSGDCYLVLYAYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK++ Q++  TA      +   L G+ VQ R  +  E  +F++ FK  ++ L+GG++S
Sbjct  441   WFGKNSIQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFKHMVV-LKGGLSS  499

Query  489   GFK-----KPEEEEFETR----LYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKI  635
             G+K     K   +E  TR    L    G  V   K  Q+     SLN  D F+L +   +
Sbjct  500   GYKNCMTEKGSPDETYTRESIALIQVSGTGVHNNKALQIEPVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW     FA 
Sbjct  560   FLWHGNQSTHEQQELAAKVAEFLKP----GV-TIKHAKEGT-----ESSSFW-----FAL  604

Query  816   MGRKVTSDDDIIPEKT-PPKL--FCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
              G++  +   + PE    P L  F  + G V  +     + +L     +LLD  +EVFVW
Sbjct  605   GGKQNFTSKKVSPETVRDPHLFSFSFNRGNVEEIH-NFDQDDLLTEDMHLLDTHAEVFVW  663

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             VG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW +  
Sbjct  664   VGQCVDPKEKQTAFEIGQRYIDLAGSMEGLSPK-VPLYKITEGNEPCFFTTYF-SWDATK  721

Query  1152  AT  1157
             AT
Sbjct  722   AT  723



>ref|XP_008802634.1| PREDICTED: villin-2-like isoform X1 [Phoenix dactylifera]
 ref|XP_008802635.1| PREDICTED: villin-2-like isoform X1 [Phoenix dactylifera]
Length=952

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 306/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS +VK  +PAFQ  GQ+ G EIWRIENF+PVPL K+DYGKFYSGDSY+VLQTT GKGG 
Sbjct  1     MSNSVKNSDPAFQGVGQRVGTEIWRIENFQPVPLAKSDYGKFYSGDSYIVLQTTPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+G+DTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q +ESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGQDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPEEE+FETRLY+C+GKRVVRMKQVPFAR SLNHDDVF+LDT  KIYQFN
Sbjct  121   LEGGFASGFKKPEEEKFETRLYICRGKRVVRMKQVPFARSSLNHDDVFILDTIKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LKD YH G C+VAI++DG L AE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQHLKDKYHEGKCDVAIIDDGKLVAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD++PE TP KL+ ID+GQ+   +  LSK+ LEN+KCYLLDCGSE+FVWVGR TQ+
Sbjct  241   TISEDDVVPEATPAKLYSIDDGQLKLEEDTLSKALLENNKCYLLDCGSEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA + AEEF+  + R KAT+I+++ QGHE  SFK +F+ WP  + T     E+GRG
Sbjct  301   EDRKAASKAAEEFIANENRSKATRISQIIQGHEPHSFKSKFELWPVGTGTGNSGGEDGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/319 (28%), Positives = 155/319 (49%), Gaps = 32/319 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  ++ G+   +E+WRI      P+PK + GKFYSGD Y+VL T         + +  W+
Sbjct  388   PLLESGGK---LEVWRINGSAKTPVPKEEIGKFYSGDCYIVLYTYHSGEKKEEYFLSCWM  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   +      +   L G+ VQ R I+  E  +F++ F+P I+ L+GG++SG+
Sbjct  445   GKDSVQNDQMMSTRLANTMWNSLKGRPVQGRIIEGKEPPQFIALFQPMIV-LKGGISSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   E+      Y   G  ++R+           QV     SL+  D F+L + + ++ 
Sbjct  504   KKFIAEKNLNDETYTSDGIALIRVSGTSVHNNKAVQVDAVSKSLSSTDCFLLQSGNSLFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G ++  +++  A +V +FLK     GV  +  V++G      +S  FW   GG     
Sbjct  564   WHGNSTTFEQQQWAAKVAEFLKP----GVV-LKHVKEG-----TESSAFWFALGGKQNFT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D I      P L  F  + G++   +    S+ +L      +LD  +EVFVWVG
Sbjct  614   TKKLTQDII----RDPHLYTFSFNEGKLEVTEVYNFSQDDLLTEDILILDTQAEVFVWVG  669

Query  993   RATQLDERKAACQTAEEFL  1049
             ++    E++ A     +++
Sbjct  670   QSVDSKEKQKAFDIGHKYI  688



>emb|CDY06107.1| BnaA09g36730D [Brassica napus]
Length=954

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/359 (74%), Positives = 304/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQK G EIWRIENF+PV +PK+++GKFY GD+Y+VLQTT  K G 
Sbjct  1     MSGPTKVLDPAFQGAGQKPGTEIWRIENFQPVLVPKSEHGKFYMGDTYIVLQTTQNKAGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAGLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  121   LEGGVASGFKKLEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFILDTKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G  +VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALAVVQYLKDKFHEGTSDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TPPKL+ I +GQV  +DG LSKS +EN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPPKLYSIADGQVESIDGNLSKSMMENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SATP  EEGRGK
Sbjct  301   EERKTAIQAAEDFVANENRPKATRITRVIQGYEPHSFKSNFDSWPSGSATPANEEGRGK  359


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/362 (26%), Positives = 168/362 (46%), Gaps = 41/362 (11%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I+     P+ K D GK YSGD Y+VL           + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDGKAKTPVSKDDVGKLYSGDCYLVLYAYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK++ Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSIQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFEHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  T   Y+ +   ++++           QV     SLN  D F+L +   +
Sbjct  500   GYKNSVTEKGSTDETYMPESIALIQVSGTGVHNNKALQVEAVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW     FA 
Sbjct  560   FLWHGNQSTHEQQEVAAKVAEFLKP----GVT-IKHAKEGT-----ESSSFW-----FAL  604

Query  816   MGRKVTSDDDIIPEKT-PPKL--FCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
              G++  +   + P+    P L  F  + G V  +     + +L     +LLD  +EVFVW
Sbjct  605   GGKQNFTSKKVSPQTVRDPHLFSFSFNRGNVEEIH-NFDQDDLLTEDMHLLDTHAEVFVW  663

Query  987   VGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS  1151
             VG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW +  
Sbjct  664   VGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDATK  721

Query  1152  AT  1157
             AT
Sbjct  722   AT  723



>ref|XP_010057051.1| PREDICTED: villin-2-like isoform X2 [Eucalyptus grandis]
Length=937

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 305/359 (85%), Gaps = 3/359 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ+ GQ+ G EIWRIENF+PV LPK++YGKFY GDSY+VLQTTS KGG 
Sbjct  1     MSSPAKLLDPAFQSVGQRVGTEIWRIENFQPVALPKSEYGKFYMGDSYIVLQTTSAKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y  DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    Y--DIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  118

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVCKGKR VR+KQVPFAR SLNHDDVF+LDT++K+YQFN
Sbjct  119   LEGGVASGFKKPEEEEFETRLYVCKGKRAVRLKQVPFARSSLNHDDVFILDTQNKVYQFN  178

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G NSNIQER KALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  179   GTNSNIQERGKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  238

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V SDD++IP  TP KL+ I  G V  V+GELSKS LEN+KCY+LDCGSE+FVWVGR T +
Sbjct  239   VASDDEVIPVTTPAKLYSIIEGDVKAVEGELSKSILENNKCYMLDCGSEIFVWVGRVTTV  298

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKA+ Q AE F+  Q RPK+T++TR+ QG+ET +FK +FDSWP+ S  P  EEGRGK
Sbjct  299   DERKASSQVAEGFVASQNRPKSTRVTRVIQGYETRAFKSKFDSWPAGSTAPGAEEGRGK  357


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 171/355 (48%), Gaps = 42/355 (12%)
 Frame = +3

Query  156   QKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQD  335
             Q   +E+WRI      PLPK D GKF+SGD Y+VL T         + +  W+GKD+ ++
Sbjct  388   QGGRMEVWRINGSAKTPLPKEDVGKFFSGDCYIVLYTYHSGDRKEDYFLCCWIGKDSIEE  447

Query  336   EAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEE  512
             +   AA     +   L G+ VQ R +Q  E  +F++ F+P ++ L+GG++SG+KK   E+
Sbjct  448   DQKMAARLANTMSNSLKGRPVQGRILQDKEPPQFIALFQPMVV-LKGGLSSGYKKFIAEK  506

Query  513   EFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSN  662
                   Y  +   ++++           QV     SL+  + F+L +   ++ ++G  S 
Sbjct  507   GLTDETYTQESIALIKVSGTASHNSKAVQVDAVATSLDSAECFLLQSGSSVFTWHGNQST  566

Query  663   IQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDD  842
              + +  A +V + LK         VA+    + +   +S  FW       P+G K +   
Sbjct  567   FEHQQLAAKVAELLKP-------GVAL---KHAKEGTESSAFW------FPLGGKQSYTS  610

Query  843   DIIPEKT--PPKLFC--IDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             + I ++T   P LF   ++ G  +V  V    S+ +L      +LD  +EVFVWVG++  
Sbjct  611   NKISQETVRDPHLFAYSLNKGKFEVEEVHN-FSQDDLLTEDIMILDTHAEVFVWVGQSVD  669

Query  1005  LDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               E+++A +  ++++     ++   P    + ++ +G+E   F   F SW SA A
Sbjct  670   SKEKQSAFEVGQKYIDMAVSLENLSPD-VPLYKVTEGNEPSFFTVYF-SWDSAKA  722



>ref|XP_004167476.1| PREDICTED: villin-2-like, partial [Cucumis sativus]
Length=746

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 304/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K ++PAFQ  GQ+ G EIWRIENF+PVPLPK+D GKFY GDSY+VLQT+  K   
Sbjct  1     MSGPTKVMDPAFQGVGQRVGTEIWRIENFQPVPLPKSDLGKFYMGDSYIVLQTSQNKSSS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +LFDIHFW+G+DTSQDEAGTAAIK+VELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    FLFDIHFWIGRDTSQDEAGTAAIKSVELDASLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVRMKQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKVEEEEFETRLYTCKGKRVVRMKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLK+ YH GVC+VA+V+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQFLKEKYHQGVCDVAVVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+++DD+I E  P KL+ I +G+V+ ++ ELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VSTEDDVIAEAMPAKLYSIADGEVSIIEDELSKSLLENNKCYLLDCGSEVFVWVGRITQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERK A Q AEEF+  Q RP++T ITRL QG+ET SFK  F SWP+ SA    EEGRGK
Sbjct  301   EERKTAIQVAEEFVANQNRPRSTHITRLIQGYETHSFKSHFGSWPAGSAASGNEEGRGK  359


 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 97/379 (26%), Positives = 168/379 (44%), Gaps = 44/379 (12%)
 Frame = +3

Query  87    ENLSI*TMSVNVKALE---PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVV  257
             + + I  MS N +A E   P  +  G+   +E+W I      P+P  D GKFYSGD Y++
Sbjct  367   QGVGIKGMSKNTQANEEVPPLLEGGGK---LEVWCINEDTKTPVPSEDVGKFYSGDCYII  423

Query  258   LQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRF  437
             L           + ++ W GKD+ +++  TA      +   L GK VQ R  Q  E  +F
Sbjct  424   LYAYHSGERKEDYILYTWYGKDSIEEDQMTADRIASSMSNSLKGKPVQGRIFQGKEPPQF  483

Query  438   LSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFAR  584
             ++ F+P ++ L+GGV++G+KK   +++ E   Y      ++++           QV    
Sbjct  484   VALFQPMVV-LKGGVSAGYKKFIADKDLEDETYSVDNVALIKVSGTSVHNNKAVQVDAVA  542

Query  585   PSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQ  764
              SL+    FVL +   ++ ++G     + +  A +V +FLK            V   + +
Sbjct  543   TSLDSSHSFVLQSGSSLFTWHGNQCAFELQQSAAKVAEFLKPG----------VTLKHAK  592

Query  765   AEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSN  932
                +S  FW   GG      K  + D +      P L+ I +     QV  V    S+ +
Sbjct  593   EGTESSAFWSALGGKQNYVSKKAAPDIV----RDPHLYTISSNKGRFQVEEVY-NFSQDD  647

Query  933   LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQ  1097
             L      +LD  +EVFVW+G+     E+  A +  + ++     ++   PK   + ++ +
Sbjct  648   LLTEDILILDTHAEVFVWIGQMVDTKEKPKAFEIGQSYIEMAVSLEGLSPK-VPLYKVNE  706

Query  1098  GHETISFKCEFDSWPSASA  1154
             G E  SF   + SW +  A
Sbjct  707   GTEP-SFFTTYFSWDNTKA  724



>ref|XP_009116444.1| PREDICTED: villin-3 [Brassica rapa]
Length=956

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/359 (74%), Positives = 303/359 (84%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ AGQK G EIWRIENF+PV +PK+++GKFY GD+Y+VLQTT  K G 
Sbjct  1     MSGPTKVLDPAFQGAGQKPGTEIWRIENFQPVLVPKSEHGKFYMGDTYIVLQTTQNKAGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDEAGTAA+KTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDTSQDEAGTAAVKTVELDAGLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKR V +KQVPFAR SLNHDDVF++D K+KIYQFN
Sbjct  121   LEGGVASGFKKLEEEEFETRLYTCKGKRAVHLKQVPFARSSLNHDDVFIMDPKEKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKAL V+Q+LKD +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+ RK
Sbjct  181   GANSNIQERAKALAVVQYLKDKFHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDIIPE TPPKL+ I +GQV  +DG LSKS +EN+KCYLLDCGSEVF+WVGR TQ+
Sbjct  241   VASEDDIIPETTPPKLYSIADGQVESIDGNLSKSMMENNKCYLLDCGSEVFIWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP-EEGRGK  1181
             +ERK A Q AE+F+  + RPKAT+ITR+ QG+E  SFK  FDSWPS SA P  EEGRGK
Sbjct  301   EERKTAIQAAEDFVASENRPKATRITRVIQGYEPHSFKSNFDSWPSGSAAPANEEGRGK  359


 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 94/364 (26%), Positives = 168/364 (46%), Gaps = 43/364 (12%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+W I++    P+ K D GK YSGD Y+VL           + +  
Sbjct  384   IPPLLEGGGK---LEVWYIDDKAKTPVSKDDVGKLYSGDCYLVLYAYHSGERKEDYFLCC  440

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W GK++ Q++  TA      +   L G+ VQ R  +  E  +F++ F+  ++ L+GG++S
Sbjct  441   WFGKNSIQEDQETAVRLASTMTNSLKGRPVQARIFEGKEPPQFVALFEHMVV-LKGGLSS  499

Query  489   GFKKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKI  635
             G+K    E+  T   Y+ +   ++++           QV     SLN  D F+L +   +
Sbjct  500   GYKNSVTEKGSTDETYMPESIALIQVSGTGVHNNKALQVEPVATSLNSYDCFLLQSGTSM  559

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             + ++G  S  +++  A +V +FLK     GV  +   ++G      +S  FW     FA 
Sbjct  560   FLWHGNQSTHEQQELAAKVAEFLKP----GVT-IKHAKEGT-----ESSSFW-----FAL  604

Query  816   MGRKVTSDDDIIPEKT-PPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSEVF  980
              G++  +   + PE    P LF         QV  +     + +L     +LLD  +EVF
Sbjct  605   GGKQNFTSKKVSPETVRDPHLFSFSFNRGKFQVEEIH-NFDQDDLLTEDMHLLDTHAEVF  663

Query  981   VWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPS  1145
             VWVG+     E++ A +  + ++     ++   PK   + ++ +G+E   F   F SW +
Sbjct  664   VWVGQCVDPKEKQTAFEIGQRYIDLAGSLEGLSPK-VPLYKITEGNEPCFFTTYF-SWDA  721

Query  1146  ASAT  1157
               AT
Sbjct  722   TKAT  725



>ref|XP_010938536.1| PREDICTED: villin-2-like [Elaeis guineensis]
Length=947

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 306/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +VK L+PAFQ  GQK G EIWRIENF+PVPL K+DYGKFYSGDSY+VLQTT+GK G 
Sbjct  1     MANSVKNLDPAFQGVGQKVGTEIWRIENFQPVPLAKSDYGKFYSGDSYIVLQTTAGKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFW+G+ TSQDEAGTAAIKTVELD ILGG+ VQHRE+Q +ESD+FLS FKPCI+P
Sbjct  61    YQYDIHFWIGQYTSQDEAGTAAIKTVELDAILGGRAVQHRELQGYESDKFLSCFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPEEE+FETRLY+C+GKRVVRMKQVPFAR SLNHDDVF+LDT +KIYQFN
Sbjct  121   LEGGFASGFKKPEEEKFETRLYICRGKRVVRMKQVPFARSSLNHDDVFILDTINKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LKD YHGG C+VAI++DG L AE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQHLKDKYHGGKCDVAIIDDGKLVAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               S+DD++PE T  KLF I++GQ+   +  LSK+ LEN+KCYLLDCGSE+FVWVGR TQ+
Sbjct  241   TISEDDVVPEATTTKLFSINDGQLKLEEDALSKAMLENNKCYLLDCGSEIFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRG  1178
             ++RKAA + AEEF+  + RPKAT+I+++ QGHE   FK +F++WP  S T     EEGRG
Sbjct  301   EDRKAASKAAEEFIANKNRPKATRISQIIQGHEPHFFKSKFEAWPVGSGTGNSGGEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 96/358 (27%), Positives = 167/358 (47%), Gaps = 37/358 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  ++ G+   +E+WRI      P+PK + GKFYSGD Y+VL T         + +  W+
Sbjct  388   PLLESGGK---LEVWRINGSAKTPVPKEEIGKFYSGDCYIVLYTYHSGEKKEEYFLSCWM  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++   A      +   L G+ VQ R I+  E  +F++ F+P I+ L+GG++SG+
Sbjct  445   GKDSVQNDQMMATRLANTMWNSLKGRPVQGRIIEGKEPSQFIALFQPMIV-LKGGISSGY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   E+      Y   G  ++R+           QV     SL+  D F+L + + ++ 
Sbjct  504   KKFIAEKNLNDETYSSDGIALIRISGISVHNNKAVQVDAVATSLSSTDCFLLQSGNSLFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G ++  +++  A +V +FLK         VA+    + +   +S  FW   GG     
Sbjct  564   WHGNSTTFEQQQWAAKVAEFLKP-------GVAL---KHAKEGTESSAFWFALGGKQSFT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D I      P L  F  + G++   +    S+ +L      +LD  +EVFVWVG
Sbjct  614   TKKLTQDVI----RDPHLYTFSFNEGKLEVTEVYNFSQDDLLTEDILILDTHAEVFVWVG  669

Query  993   RATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             ++    E++ A     +++      +       + ++ +G+E   F   F SW  A A
Sbjct  670   QSVDSKEKQKAFDIGHKYIELAASLEGLSPDLPLYKVTEGNEPCFFTTYF-SWDGAKA  726



>ref|XP_010057040.1| PREDICTED: villin-3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010057045.1| PREDICTED: villin-3-like isoform X1 [Eucalyptus grandis]
 gb|KCW90156.1| hypothetical protein EUGRSUZ_A02344 [Eucalyptus grandis]
Length=972

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 305/359 (85%), Gaps = 3/359 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ+ GQ+ G EIWRIENF+PV LPK++YGKFY GDSY+VLQTTS KGG 
Sbjct  1     MSSPAKLLDPAFQSVGQRVGTEIWRIENFQPVALPKSEYGKFYMGDSYIVLQTTSAKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y  DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    Y--DIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIP  118

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYVCKGKR VR+KQVPFAR SLNHDDVF+LDT++K+YQFN
Sbjct  119   LEGGVASGFKKPEEEEFETRLYVCKGKRAVRLKQVPFARSSLNHDDVFILDTQNKVYQFN  178

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G NSNIQER KALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  179   GTNSNIQERGKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  238

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V SDD++IP  TP KL+ I  G V  V+GELSKS LEN+KCY+LDCGSE+FVWVGR T +
Sbjct  239   VASDDEVIPVTTPAKLYSIIEGDVKAVEGELSKSILENNKCYMLDCGSEIFVWVGRVTTV  298

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKA+ Q AE F+  Q RPK+T++TR+ QG+ET +FK +FDSWP+ S  P  EEGRGK
Sbjct  299   DERKASSQVAEGFVASQNRPKSTRVTRVIQGYETRAFKSKFDSWPAGSTAPGAEEGRGK  357


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 171/355 (48%), Gaps = 42/355 (12%)
 Frame = +3

Query  156   QKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQD  335
             Q   +E+WRI      PLPK D GKF+SGD Y+VL T         + +  W+GKD+ ++
Sbjct  388   QGGRMEVWRINGSAKTPLPKEDVGKFFSGDCYIVLYTYHSGDRKEDYFLCCWIGKDSIEE  447

Query  336   EAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEE  512
             +   AA     +   L G+ VQ R +Q  E  +F++ F+P ++ L+GG++SG+KK   E+
Sbjct  448   DQKMAARLANTMSNSLKGRPVQGRILQDKEPPQFIALFQPMVV-LKGGLSSGYKKFIAEK  506

Query  513   EFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSN  662
                   Y  +   ++++           QV     SL+  + F+L +   ++ ++G  S 
Sbjct  507   GLTDETYTQESIALIKVSGTASHNSKAVQVDAVATSLDSAECFLLQSGSSVFTWHGNQST  566

Query  663   IQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDD  842
              + +  A +V + LK         VA+    + +   +S  FW       P+G K +   
Sbjct  567   FEHQQLAAKVAELLKP-------GVAL---KHAKEGTESSAFW------FPLGGKQSYTS  610

Query  843   DIIPEKT--PPKLFC--IDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             + I ++T   P LF   ++ G  +V  V    S+ +L      +LD  +EVFVWVG++  
Sbjct  611   NKISQETVRDPHLFAYSLNKGKFEVEEVH-NFSQDDLLTEDIMILDTHAEVFVWVGQSVD  669

Query  1005  LDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               E+++A +  ++++     ++   P    + ++ +G+E   F   F SW SA A
Sbjct  670   SKEKQSAFEVGQKYIDMAVSLENLSPD-VPLYKVTEGNEPSFFTVYF-SWDSAKA  722



>gb|AFW83947.1| hypothetical protein ZEAMMB73_866328 [Zea mays]
Length=982

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 309/358 (86%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPVPLPK+DYGKFY GDSY+VLQTT  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTTCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLD ++KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDAENKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E T P+L+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++VWVGR TQ+++R
Sbjct  243   DDDVVLETTAPRLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRGK  1181
             K+A +  EEFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +AT     EEGRGK
Sbjct  303   KSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNATGSPGAEEGRGK  360


 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 100/362 (28%), Positives = 173/362 (48%), Gaps = 35/362 (10%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             T  VN + + P  +  G+   +E+W ++      LPK D GKFYSGD Y++L T      
Sbjct  379   TTPVN-EEVPPLLEGGGK---LEVWCVDGNAKTALPKEDIGKFYSGDCYIILYTYHSGDK  434

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + + +W+GKD+  D+  +A+  T  +   L G+ V  R  Q  E  +F++ F+P I+
Sbjct  435   KEEYYLSYWIGKDSLVDDQVSASQITNTVWNSLKGRPVLGRIYQGKEPPQFVALFQPMII  494

Query  465   PLEGGVASGFKKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVF  611
              L+GG+ SG+KK  EE+  T   Y  +G  ++R+           QV     SL+  + F
Sbjct  495   -LKGGIGSGYKKLIEEKGATGETYTTEGIALIRVSGTSIHNNKTLQVDTVATSLSSMECF  553

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L + + ++ + G +S  +++  A +V +FLK     GV  V   ++G      +S  FW
Sbjct  554   ILQSGNAMFTWFGNSSTYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----ESSGFW  603

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCG  968
                GG      K  +  DII  +     F   NG +   +    S+ +L      +LD  
Sbjct  604   FALGGKQSYTNK-NAPQDIITREPHLYAFSFKNGLIQVTEIFNFSQDDLLTEDMMILDTH  662

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFD  1133
              EVF+W+G+  +  E++ A    ++++     +    P A  + ++ +G+E   FK  F 
Sbjct  663   GEVFIWIGQCVESKEKQKAFDIGQKYVEHANSIDDLSPYA-PLYKVMEGNEPCFFKTYF-  720

Query  1134  SW  1139
             SW
Sbjct  721   SW  722



>ref|NP_001146280.1| uncharacterized protein LOC100279855 [Zea mays]
 gb|ACL53623.1| unknown [Zea mays]
 gb|AFW83948.1| hypothetical protein ZEAMMB73_866328 [Zea mays]
Length=982

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 309/358 (86%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPVPLPK+DYGKFY GDSY+VLQTT  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTTCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLD ++KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDAENKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E T P+L+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++VWVGR TQ+++R
Sbjct  243   DDDVVLETTAPRLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRGK  1181
             K+A +  EEFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +AT     EEGRGK
Sbjct  303   KSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNATGSPGAEEGRGK  360


 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 100/362 (28%), Positives = 174/362 (48%), Gaps = 35/362 (10%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             T  VN + + P  +  G+   +E+W ++      LPK D GKFYSGD Y++L T      
Sbjct  379   TTPVN-EEVPPLLEGGGK---LEVWCVDGNAKTALPKEDIGKFYSGDCYIILYTYHSGDK  434

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + + +W+GKD+  D+  +A+  T  +   L G+ V  R  Q  E  +F++ F+P I+
Sbjct  435   KEEYYLSYWIGKDSLVDDQVSASQITNTVWNSLKGRPVLGRIYQGKEPPQFVALFQPMII  494

Query  465   PLEGGVASGFKKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVF  611
              L+GG+ SG+KK  EE+  T   Y  +G  ++R+           QV     SL+  + F
Sbjct  495   -LKGGIGSGYKKLIEEKGATGETYTTEGIALIRVSGTSIHNNKTLQVDTVATSLSSMECF  553

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             +L + + ++ + G +S  +++  A +V +FLK     GV  V   ++G      +S  FW
Sbjct  554   ILQSGNAMFTWFGNSSTYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----ESSGFW  603

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCG  968
                GG      K  +  DII  +     F   NG++   +    S+ +L      +LD  
Sbjct  604   FALGGKQSYTNK-NAPQDIITREPHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMILDTH  662

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFD  1133
              EVF+W+G+  +  E++ A    ++++     +    P A  + ++ +G+E   FK  F 
Sbjct  663   GEVFIWIGQCVESKEKQKAFDIGQKYVEHANSIDDLSPYA-PLYKVMEGNEPCFFKTYF-  720

Query  1134  SW  1139
             SW
Sbjct  721   SW  722



>ref|XP_002456939.1| hypothetical protein SORBIDRAFT_03g045970 [Sorghum bicolor]
 gb|EES02059.1| hypothetical protein SORBIDRAFT_03g045970 [Sorghum bicolor]
Length=983

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 311/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLDT++KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDTENKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E T PKL+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++VWVGR TQ+++R
Sbjct  243   DDDVVLETTAPKLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATP-PEEGRGK  1181
             K+A +  EEFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +A+ +P  EEGRGK
Sbjct  303   KSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNAAGSPGAEEGRGK  360


 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 169/352 (48%), Gaps = 34/352 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I+      LPK D GKFYSGD Y++L T         + + +W+
Sbjct  388   PLLEGGGK---LEVWCIDGNAKTALPKEDIGKFYSGDCYIILYTYHSGDKKEEYYLSYWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+  D+  +A+  T  +   L G+ V  R  Q  E  +F++ F+P ++ L+GG+ SG+
Sbjct  445   GKDSLVDDQVSASQITNTVWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGIGSGY  503

Query  495   KKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T   Y  +G  ++R+           QV     SL+  + FVL + + ++ 
Sbjct  504   KKLIEEKGATAETYSTEGIALIRVSGTSIHNNKTLQVDAVATSLSSTECFVLQSGNAMFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G +S  +++  A +V +FLK     G+  V   ++G      +S  FW   GG     
Sbjct  564   WFGNSSTYEQQQWAAKVAEFLKP----GIA-VKHCKEGT-----ESSAFWFALGGKQSYT  613

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRA  998
              K  +  DII  +     F   NG++   +    S+ +L      +LD   EVF+W+G+ 
Sbjct  614   NK-NAPQDIITREPHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMILDTHGEVFIWIGQC  672

Query  999   TQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
              +  E++ A    ++++     ++   P    + ++ +G+E   FK  F SW
Sbjct  673   VESKEKQKAFDIGQKYVEHANSIEDLSP-YVPLYKVMEGNEPCFFKTYF-SW  722



>ref|XP_010312403.1| PREDICTED: villin-2-like [Solanum lycopersicum]
Length=902

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/327 (77%), Positives = 288/327 (88%), Gaps = 0/327 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+VK LEPAFQ  GQK G EIWRIENF+PVP+PK ++GKFYSGDSY+VLQTTSG+GG 
Sbjct  1     MSVSVKDLEPAFQGTGQKPGTEIWRIENFQPVPVPKFEHGKFYSGDSYIVLQTTSGRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y  DIHFWLGKDTSQDEAGTAAIKTVELD ILGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YWHDIHFWLGKDTSQDEAGTAAIKTVELDAILGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEE FETRLYVC GKRVVRMKQVPF+R SLNHDDVF+LDT+DKIYQFN
Sbjct  121   LEGGVASGFKKPEEEVFETRLYVCNGKRVVRMKQVPFSRSSLNHDDVFLLDTEDKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV Q LK+ YH GVC+VAI++DGNLQAE+DSG FW LFGGFAP+ +K
Sbjct  181   GANSNIQERAKALEVTQILKEKYHDGVCDVAIIDDGNLQAESDSGSFWVLFGGFAPISKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDDI+PE+T  +L+ I +GQVN +DGEL+KS LEN KCY+LDCGSEVF WVGR TQL
Sbjct  241   VATDDDIVPERTTAQLYSITDGQVNQLDGELTKSILENDKCYILDCGSEVFTWVGRHTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITR  1088
             +ERK+  QTAEE+L  Q RPK+T + +
Sbjct  301   EERKSTIQTAEEYLANQNRPKSTPLVK  327


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 164/349 (47%), Gaps = 36/349 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+WRI+      +PK D GKFY GD Y+VL T         + + +W+G+D+ +++   
Sbjct  356   IEVWRIDGSAKTQIPKEDIGKFYGGDCYIVLYTYHSHERKEDYYLCWWIGEDSIEEDRKM  415

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFET  524
             AA     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+K   EE     
Sbjct  416   AAQLASTMCNSLKGRPVLGRVYQGKEPPQFVAIFQPMLV-LKGGLSSGYKNHIEENGLND  474

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y      + R+           QV     SLN  + F+L +   ++ ++G  S  +++
Sbjct  475   ETYASDTVGLFRISGTSSHNNKAVQVDVVATSLNTYECFLLQSSSSVFIWHGKQSTHEQQ  534

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A ++++FLK     GV  V   ++G      +S  FW   G      ++  + + + P
Sbjct  535   NLAAKIVEFLKP----GVT-VKHTKEG-----TESSAFWLGIG-----EKQDYTSNKLAP  579

Query  855   EKT-PPKLF--CIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
             E T  P LF   +  G+    +    ++ +L      +LD  +EVFVWVG++T   E+++
Sbjct  580   EATREPHLFSCSVTRGKFEVEEIYNFTQDDLLTEDVMVLDTHAEVFVWVGQSTDSKEKQS  639

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             A +  ++++      +       + ++ +G+E   F   F SW    AT
Sbjct  640   AFEIGQKYVELATSLEGLSSYVPLYKVTEGNEPCFFTT-FFSWDPVKAT  687



>ref|XP_008460777.1| PREDICTED: villin-2-like [Cucumis melo]
Length=945

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 306/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K ++PAF   GQ+ G EIWRIENF PVPLPK+D+GKFY GDSY++LQT+  K G 
Sbjct  1     MSGPTKVMDPAFLGVGQRVGTEIWRIENFLPVPLPKSDFGKFYMGDSYIILQTSQNKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +LFDIHFW+G+DTSQDEAGTAAIK+VELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    FLFDIHFWIGRDTSQDEAGTAAIKSVELDASLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVRMKQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKVEEEEFETRLYTCKGKRVVRMKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLK+ YH GVC+VA+V+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQFLKEKYHQGVCDVAVVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+++DD+I E  P KL+ I +G+V+ ++GELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VSTEDDVIAEAMPAKLYSIADGEVSIIEGELSKSLLENNKCYLLDCGSEVFVWVGRITQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             +ERK A Q AEEF+  Q RP++T ITRL QG+ET SFK  F SWP+ S A+  EEGRGK
Sbjct  301   EERKTAIQVAEEFVASQNRPRSTHITRLIQGYETHSFKSNFGSWPAGSAASGAEEGRGK  359


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 91/339 (27%), Positives = 155/339 (46%), Gaps = 37/339 (11%)
 Frame = +3

Query  87    ENLSI*TMSVNVKALE---PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVV  257
             + + I  MS N +A E   P  +  G+   +E+W I      P+P  D GKFYSGDSY+V
Sbjct  367   QGVGIKGMSKNTQANEEVPPLLEGGGK---LEVWCINEDTKTPVPSEDVGKFYSGDSYIV  423

Query  258   LQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRF  437
             L           + ++ W GKD+ +++  TA      +   L GK VQ R  Q  E  +F
Sbjct  424   LYAYHSGERKEDYILYTWYGKDSIEEDQMTADRIASSMSNSLKGKPVQGRIFQGKEPPQF  483

Query  438   LSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFAR  584
             ++ F+P ++ L+GGV++G+KK   +++     Y      ++++           QV    
Sbjct  484   VALFQPMVV-LKGGVSAGYKKFIADKDLADETYSVDNVALIKVSGTSVHNNKAVQVDAVA  542

Query  585   PSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQ  764
              SL+    FVL +   ++ ++G     + +  A +V +FLK     GV  +   ++G   
Sbjct  543   TSLDSSHSFVLQSGSSLFTWHGNQCAFELQQSAAKVAEFLKP----GVT-LKHAKEGT--  595

Query  765   AEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSN  932
                +S  FW   GG      K  + D +      P L+ I +     QV  V    S+ +
Sbjct  596   ---ESSAFWSALGGKQNYVSKKAAPDIV----RDPHLYTISSNKGRFQVEEV-YNFSQDD  647

Query  933   LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL  1049
             L      +LD  +EVF+W+G+     E++ A Q  + ++
Sbjct  648   LLTEDILILDTHAEVFIWIGQMVDTKEKQKAFQIGQSYI  686



>ref|XP_006650096.1| PREDICTED: villin-3-like [Oryza brachyantha]
Length=979

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/362 (70%), Positives = 306/362 (85%), Gaps = 4/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-  284
             MS     L+PAFQ AGQK G EIWRI++FKPVPLPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSSAKPVLDPAFQGAGQKPGTEIWRIQDFKPVPLPKSDYGKFYCGDSYIVLQTTCNKGGG  60

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              YLFDIHFW+GKD+SQDE+GTAAIKTVE DT+LGG+ VQHRE+Q +ESD+FLSYFKPCI+
Sbjct  61    AYLFDIHFWIGKDSSQDESGTAAIKTVEFDTMLGGRAVQHRELQGYESDKFLSYFKPCII  120

Query  465   PLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQF  644
             PLEGG ASGFKKPEEE+FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT++KIYQF
Sbjct  121   PLEGGFASGFKKPEEEKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTENKIYQF  180

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             NGANSNIQERAKALE IQ LK+TYH GVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+
Sbjct  181   NGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGK  240

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             K  SDDD++ E T PKL+ I+NGQ+   D  LSKS LEN+KC+L+DCG+++F+WVGR TQ
Sbjct  241   KAVSDDDVVLEATAPKLYSINNGQLKLEDTVLSKSILENNKCFLVDCGADLFIWVGRLTQ  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGR  1175
             +DERKAA    EEF+  Q RPK T++TR+ QG+E  +FK +F+SWP   +A +   EEGR
Sbjct  301   VDERKAANAAVEEFIATQNRPKTTRVTRVIQGYENHTFKSKFESWPLNSAAGSASMEEGR  360

Query  1176  GK  1181
             GK
Sbjct  361   GK  362


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 148/308 (48%), Gaps = 28/308 (9%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             IE+W I       LPK + GKFYSGD Y+VL T         F + +W+GKD+  ++   
Sbjct  398   IEVWCINGSSKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFYLTYWIGKDSMPEDQEM  457

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A      +   L G+    R  Q  E  +F++ F+P ++ L+GG++SG+KK  EE+  + 
Sbjct  458   AFQTANSIWNSLKGRPALGRIYQGKEPPQFIALFQPMVV-LKGGISSGYKKFVEEKGLKD  516

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  +VR+           QV     SL+  D FVL + + ++ + G  S+ +++
Sbjct  517   ETYSGDGIALVRVSGTSMHNNKALQVDAVSSSLSPTDCFVLQSGNSMFTWIGNASSYEQQ  576

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A ++ +FLK     GV  V   ++G      +S  FW   GG      +  + D ++ 
Sbjct  577   QWAAKIAEFLKP----GVA-VKHCKEGT-----ESSAFWFALGGKQNYTSRNVTHDVVVR  626

Query  855   EKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             +   P L  F + NG++   +    S+ +L      +LD   EVFVW+G+     E++ A
Sbjct  627   D---PHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMILDTHGEVFVWMGQCVDTKEKQKA  683

Query  1026  CQTAEEFL  1049
              +  ++++
Sbjct  684   FEIGQKYV  691



>ref|XP_004971280.1| PREDICTED: villin-2-like [Setaria italica]
Length=981

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 310/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPV LPK+D+GKFY GDSY+VLQT+  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVALPKSDHGKFYCGDSYIVLQTSCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDE+GTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDESGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+CKGKR +R+KQVPFAR SLNHDDVFVLDT+ KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICKGKRAIRVKQVPFARSSLNHDDVFVLDTESKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDDI+ E T PKL+ I++GQ+   +  L+K+ LEN+KC+L+DCG+E++VWVGR TQ+++R
Sbjct  243   DDDIVLETTAPKLYSINDGQLKLEETALTKAVLENTKCFLVDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATP-PEEGRGK  1181
             K+A +  EEFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +A+ +P  EEGRGK
Sbjct  303   KSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNAAGSPGAEEGRGK  360


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 94/352 (27%), Positives = 168/352 (48%), Gaps = 34/352 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  + +G+   +E+W ++      LPK D GKFYSGD Y++L T         + + +W+
Sbjct  388   PLLEGSGK---LEVWCVDGNAKTALPKEDIGKFYSGDCYIILYTYHSGDKKEEYYLSYWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+  D+   A+     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG+ SG+
Sbjct  445   GKDSLADDQVMASQLANTMWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGIGSGY  503

Query  495   KKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T   Y  +G  ++R+           QV     SL+  + FVL + + ++ 
Sbjct  504   KKLIEEKGVTGETYSSEGIALIRVSGTSLHNNKTLQVDAVATSLSSSECFVLQSGNAMFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G +S  +++  A +V +FLK     GV  V   ++G      +S  FW   GG     
Sbjct  564   WFGNSSTYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----ESSAFWFALGGKQSYT  613

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRA  998
              +  +  DII  +     F   NG++   +    S+ +L      +LD   EVF+W+G+ 
Sbjct  614   NR-NATLDIIAREPHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMILDTHGEVFIWIGQC  672

Query  999   TQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
              +  E++ A    ++++     ++   P    + ++ +G+E   FK  F SW
Sbjct  673   VESKEKQKAFDIGQKYIEHANSIEDLSP-YVPLYKVMEGNEPCFFKTYF-SW  722



>emb|CDM86551.1| unnamed protein product [Triticum aestivum]
 emb|CDM86572.1| unnamed protein product [Triticum aestivum]
Length=983

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/356 (70%), Positives = 311/356 (87%), Gaps = 3/356 (1%)
 Frame = +3

Query  123   KALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDI  302
             K ++PAFQ AGQK GIEIWRIE+FKPV LPK+DYGKFYSGDSY+VLQTTS KGG YL+D+
Sbjct  5     KVVDPAFQGAGQKVGIEIWRIEDFKPVALPKSDYGKFYSGDSYIVLQTTSPKGGAYLYDL  64

Query  303   HFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGV  482
             HFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQ+RE+Q +ESD+FLSYFKPCI+P+EGG 
Sbjct  65    HFWIGKDSSQDEAGTAAIKTVELDSVLGGRAVQYRELQGYESDKFLSYFKPCIIPMEGGF  124

Query  483   ASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSN  662
             ASGFK PEEE FETRLY+CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNGANSN
Sbjct  125   ASGFKTPEEETFETRLYICKGKRAIRIKQVPFARSSLNHDDVFILDTENKIYQFNGANSN  184

Query  663   IQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDD  842
             IQERAK+LEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  SDD
Sbjct  185   IQERAKSLEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVSDD  244

Query  843   DIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
             D++ E T PKL+ I++G++   D  L+K+ LEN++C+LLDCG+E+FVWVGR TQL++RKA
Sbjct  245   DVVLETTAPKLYSINDGELKFEDIPLTKAVLENTRCFLLDCGAEMFVWVGRVTQLEDRKA  304

Query  1023  ACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT---PPEEGRGK  1181
               +  EEF++ QKRPK T++T++ QG+E+ +FK +F+SWP+ +AT     E+GRGK
Sbjct  305   VTKAVEEFIINQKRPKTTRVTQVIQGYESHAFKSKFESWPAGTATGNSGAEDGRGK  360


 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 97/354 (27%), Positives = 166/354 (47%), Gaps = 38/354 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I+     PLPK D GKFYSGD Y+VL T         + +++W+
Sbjct  388   PLLEGGGR---LEVWCIDGNTRSPLPKEDNGKFYSGDCYIVLYTYHSGDKKEEYYLNYWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK+++ D+    A     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  445   GKESTADDQVMGAELANTMWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGISSGY  503

Query  495   KKPEEEEFETR---------LYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+             L+   G  +   K   V     SL+  D FVL T   ++ 
Sbjct  504   KKITEEKGAASGSYSPEGIALFRVSGTAIHNNKTLHVDALATSLSSTDCFVLQTGSAMFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G +S  +++  A +V +FLK     GV  V   ++G      +S  FW    G     
Sbjct  564   WHGNSSTYEQQQWAAKVAEFLKP----GV-TVKHCKEGT-----ESSAFWFALDGKQSYT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K      I+ E   P L  F I  G++   +     + +L      +LD   EVF+WVG
Sbjct  614   SKPIMQYTIVRE---PHLYAFSIRKGRLEVTEIFNFCQDDLLTEDLMILDTHGEVFIWVG  670

Query  993   RATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
             +  +  E++ A +  ++++     ++   P    + ++++G+E   FK  F SW
Sbjct  671   QCVEPKEKQKAFEIGQKYIEHAMSIEDLSP-YVPLYKVSEGNEPCFFKTYF-SW  722



>ref|XP_008672462.1| PREDICTED: uncharacterized protein LOC100273789 isoform X1 [Zea 
mays]
 tpg|DAA55800.1| TPA: hypothetical protein ZEAMMB73_503572 [Zea mays]
Length=982

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/358 (70%), Positives = 310/358 (87%), Gaps = 3/358 (1%)
 Frame = +3

Query  117   NVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLF  296
               K L+PAFQ AGQK G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG YL+
Sbjct  3     TAKVLDPAFQGAGQKVGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTCTKGGAYLY  62

Query  297   DIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEG  476
             DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLSYFKPCI+PLEG
Sbjct  63    DIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLSYFKPCIIPLEG  122

Query  477   GVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGAN  656
             G ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLDT++KIYQFNGAN
Sbjct  123   GFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDTENKIYQFNGAN  182

Query  657   SNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTS  836
             SNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  S
Sbjct  183   SNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVS  242

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             DDD++ E T PKL+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++VWVGR TQ+++R
Sbjct  243   DDDVVLETTAPKLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYVWVGRVTQMEDR  302

Query  1017  KAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATP-PEEGRGK  1181
             K+A +  +EFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +A+  P  EEGRGK
Sbjct  303   KSATKAVDEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNAAGNPGTEEGRGK  360


 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 164/343 (48%), Gaps = 35/343 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E+W ++      LPK D GKFYSGD Y++L T         + + +W+GKD+  D+  +
Sbjct  396   LEVWCVDGNTKTALPKEDIGKFYSGDCYIILYTHHSGDKKEEYYLSYWIGKDSLVDDQVS  455

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-  524
             A+     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG+ SG+KK  EE+    
Sbjct  456   ASQIINTMWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGIGSGYKKLIEEKGAMG  514

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y  +G  ++R+           QV     SL+  + FVL + + ++ + G +S  +++
Sbjct  515   ETYTTEGIALIRVSETSIYNNKTLQVDAVATSLSSTESFVLQSGNAMFTWFGNSSTYEQQ  574

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V +FLK     GV  V   ++G      +S  FW   GG      K T  D I  
Sbjct  575   QWAAKVAEFLKP----GVA-VKHCKEGT-----ESSAFWFALGGKQSYTNKNTPQDIITR  624

Query  855   EKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             E   P L  F   NG++   +    S+ +L      +LD   EVF+W+G+  +  E++ A
Sbjct  625   E---PHLYAFSFKNGRLEVTEIFNFSQDDLLTEDMMVLDTHGEVFIWIGQYVESKEKQKA  681

Query  1026  CQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
                 ++++     ++   P    + ++ +G+E   FK  F SW
Sbjct  682   FDIGQKYVEHANSIEDLSPHV-PLYKVMEGNEPCFFKTYF-SW  722



>ref|XP_004149401.1| PREDICTED: villin-2-like [Cucumis sativus]
 gb|KGN53839.1| hypothetical protein Csa_4G164350 [Cucumis sativus]
Length=945

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 305/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K ++PAFQ  GQ+ G EIWRIENF+PVPLPK+D GKFY GDSY+VLQT+  K   
Sbjct  1     MSGPTKVMDPAFQGVGQRVGTEIWRIENFQPVPLPKSDLGKFYMGDSYIVLQTSQNKSSS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +LFDIHFW+G+DTSQDEAGTAAIK+VELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61    FLFDIHFWIGRDTSQDEAGTAAIKSVELDASLGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKK EEEEFETRLY CKGKRVVRMKQVPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKVEEEEFETRLYTCKGKRVVRMKQVPFARSSLNHDDVFILDTENKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+QFLK+ YH GVC+VA+V+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVVQFLKEKYHQGVCDVAVVDDGKLDTESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V+++DD+I E  P KL+ I +G+V+ ++ ELSKS LEN+KCYLLDCGSEVFVWVGR TQ+
Sbjct  241   VSTEDDVIAEAMPAKLYSIADGEVSIIEDELSKSLLENNKCYLLDCGSEVFVWVGRITQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             +ERK A Q AEEF+  Q RP++T ITRL QG+ET SFK  F SWP+ S A+  EEGRGK
Sbjct  301   EERKTAIQVAEEFVANQNRPRSTHITRLIQGYETHSFKSHFGSWPAGSAASGNEEGRGK  359


 Score =   107 bits (268),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 171/379 (45%), Gaps = 44/379 (12%)
 Frame = +3

Query  87    ENLSI*TMSVNVKALE---PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVV  257
             + + I  MS N +A E   P  +  G+   +E+W I      P+P  D GKFYSGD Y++
Sbjct  367   QGVGIKGMSKNTQANEEVPPLLEGGGK---LEVWCINEDTKTPVPSEDVGKFYSGDCYII  423

Query  258   LQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRF  437
             L           + ++ W GKD+ +++  TA      +   L GK VQ R  Q  E  +F
Sbjct  424   LYAYHSGERKEDYILYTWYGKDSIEEDQMTADRIASSMSNSLKGKPVQGRIFQGKEPPQF  483

Query  438   LSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFAR  584
             ++ F+P ++ L+GGV++G+KK   +++ E   Y      ++++           QV    
Sbjct  484   VALFQPMVV-LKGGVSAGYKKFIADKDLEDETYSVDNVALIKVSGTSVHNNKAVQVDAVA  542

Query  585   PSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQ  764
              SL+    FVL +   ++ ++G     + +  A +V +FLK     GV  +   ++G   
Sbjct  543   TSLDSSHSFVLQSGSSLFTWHGNQCAFELQQSAAKVAEFLKP----GVT-LKHAKEG---  594

Query  765   AEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSN  932
                +S  FW   GG      K  + D +      P L+ I +     QV  V    S+ +
Sbjct  595   --TESSAFWSALGGKQNYVSKKAAPDIV----RDPHLYTISSNKGRFQVEEV-YNFSQDD  647

Query  933   LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQ  1097
             L      +LD  +EVFVW+G+     E+  A +  + ++     ++   PK   + ++ +
Sbjct  648   LLTEDILILDTHAEVFVWIGQMVDTKEKPKAFEIGQSYIEMAVSLEGLSPK-VPLYKVNE  706

Query  1098  GHETISFKCEFDSWPSASA  1154
             G E  SF   + SW +  A
Sbjct  707   GTEP-SFFTTYFSWDNTKA  724



>ref|XP_010228602.1| PREDICTED: villin-2-like [Brachypodium distachyon]
Length=955

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/361 (70%), Positives = 306/361 (85%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   + L+PAFQ AGQK G EIWRIE+FKPVPLPK+DYGKFY GDSY++LQTT  +GG 
Sbjct  1     MSTAKQVLDPAFQGAGQKPGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIILQTTCNRGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKD+SQDEAGT+AIKTVELDT+LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDSSQDEAGTSAIKTVELDTMLGGRAVQHREPQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPEE++FETRLY+CKGKR +R+K+VPFAR +LNHDDVF+LD++ KIYQFN
Sbjct  121   LEGGFASGFKKPEEDKFETRLYICKGKRAIRVKEVPFARSALNHDDVFILDSEKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQHLKEKYHEGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD+I E  P KL+ I+NG++   D  L+KS LEN+KC+LLDCGSE+FVWVGR TQ+
Sbjct  241   AVSDDDVILETAPTKLYSINNGKLKLEDIVLTKSILENTKCFLLDCGSELFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             D+RKAA    EEF+V Q RPK T++T++ QG+ET +FK +F+SWP   +A     E+GRG
Sbjct  301   DDRKAASVAVEEFIVNQNRPKTTRVTQVIQGYETHTFKSKFESWPISSTAGNASMEDGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 93/358 (26%), Positives = 164/358 (46%), Gaps = 37/358 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I+      LPK D GKFYSGD Y+VL T         F + +W+
Sbjct  388   PLLEGGGK---LEVWYIDGSAKTALPKEDLGKFYSGDCYIVLYTYHSGDKREEFYLTYWI  444

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+  D+   A      +   + G+ V  R  Q  E  +F++ F+P ++  +GG++  +
Sbjct  445   GKDSVLDDQQMACQMANTIWNAMKGRPVLGRIYQGKEPPQFIALFQPMVI-FKGGISFRY  503

Query  495   KK-PEEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  +   Y   G  +V++           QV     SL+  D FVL + + ++ 
Sbjct  504   KKFIEEKGLKDATYSATGIALVQIIGTSTHNNKTLQVDAVSTSLSSTDCFVLQSGNSMFT  563

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G  S+ +++  A +V +FLK    GG          + +   +S  FW   GG     
Sbjct  564   WIGNTSSHEQQQWAAKVAEFLKP---GGTIK-------HCKEGTESSAFWSALGGKQNYT  613

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWVG  992
              +  S  D++ E   P L  F   NG++   +    S+ +L      +LD  +EVFVW+G
Sbjct  614   NRNAS-QDVLRE---PHLYTFSFRNGKLEVTEVFNFSQDDLLTEDVMVLDTHAEVFVWMG  669

Query  993   RATQLDERKAACQTAEEF----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             +     E++ A +  +++    +  +       + + ++G+E   F+  F SW +  A
Sbjct  670   QCVDTKEKQNAFEIGQKYVEHAVTFEGLSPDVPLYKFSEGNEPCFFRTYF-SWDNTRA  726



>ref|NP_001050140.1| Os03g0356700 [Oryza sativa Japonica Group]
 gb|ABF96038.1| Villin-3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12054.1| Os03g0356700 [Oryza sativa Japonica Group]
Length=966

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/361 (70%), Positives = 304/361 (84%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-  284
             MS     L+PAFQ  GQK G EIWRI++FKPVPLPKADYGKFY+GDSY+VLQTT  KGG 
Sbjct  1     MSSAKPVLDPAFQGVGQKPGTEIWRIQDFKPVPLPKADYGKFYNGDSYIVLQTTCSKGGG  60

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              YLFDIHFW+GKD+SQDEAGTAAIKTVELDT+LGG+ VQHRE+Q +ESD+FLSYFKPCI+
Sbjct  61    AYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDKFLSYFKPCII  120

Query  465   PLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQF  644
             PLEGG ASGFK PEE++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT+ KIYQF
Sbjct  121   PLEGGFASGFKTPEEDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTEKKIYQF  180

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             NGANSNIQERAKALE IQ LK+TYH GVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+
Sbjct  181   NGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGK  240

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             K   DDD++ E T PKL+ I+NGQ+   D  L+KS LEN+KC+L+DCGS++F+WVGR TQ
Sbjct  241   KAICDDDVVLETTAPKLYSINNGQLKLEDTVLTKSILENNKCFLVDCGSDLFIWVGRLTQ  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATPPEEGRG  1178
             ++ERKAA    EEF+  Q RPK T++TR+ QG+E  +FK +F+SWP  SA +   EEGRG
Sbjct  301   VEERKAASAAVEEFIATQNRPKTTRVTRVIQGYENHTFKSKFESWPVNSAGSAGAEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 159/342 (46%), Gaps = 34/342 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E++ +       LPK + GKFYSGD Y+VL T         F + +W+GKD+  ++   
Sbjct  397   LEVYCVNGSAKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFYLTYWIGKDSIPEDQEM  456

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A      +   L G+ +  R  Q  E  +F++ F+P ++ L+GG++SG++K  EE+  + 
Sbjct  457   AFQTANSIWNSLKGRPILGRIYQGKEPPQFIALFQPMVI-LKGGISSGYQKFVEEKGLKD  515

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  + R+           QV     +L+  D FVL + + ++ + G  S+ +++
Sbjct  516   ETYSGDGIALFRISGTSIHNNKVLQVDAVSSNLSPTDCFVLQSGNSMFTWIGNASSYEQQ  575

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V +FLK     GV  V   ++G      +S  FW   GG      +  +  D++ 
Sbjct  576   QWAAKVAEFLKP----GVA-VKHCKEGT-----ESSAFWFALGGKQNYTSR-NATHDVVR  624

Query  855   EKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             E   P L  F + NG++   +    S+ +L      +LD   EVFVW+G+     E++ A
Sbjct  625   E---PHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKA  681

Query  1026  CQT----AEEFLVKQKRPKATKITRLAQGHETISFKCEFDSW  1139
              +     AE     +       + ++ +G+E   F+  F SW
Sbjct  682   FEIGQKYAEHAAAFESLSPDVPLYKVVEGNEPCFFRTYF-SW  722



>gb|ABF96040.1| Villin-3, putative, expressed [Oryza sativa Japonica Group]
Length=973

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/361 (70%), Positives = 304/361 (84%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-  284
             MS     L+PAFQ  GQK G EIWRI++FKPVPLPKADYGKFY+GDSY+VLQTT  KGG 
Sbjct  1     MSSAKPVLDPAFQGVGQKPGTEIWRIQDFKPVPLPKADYGKFYNGDSYIVLQTTCSKGGG  60

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              YLFDIHFW+GKD+SQDEAGTAAIKTVELDT+LGG+ VQHRE+Q +ESD+FLSYFKPCI+
Sbjct  61    AYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDKFLSYFKPCII  120

Query  465   PLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQF  644
             PLEGG ASGFK PEE++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT+ KIYQF
Sbjct  121   PLEGGFASGFKTPEEDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTEKKIYQF  180

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             NGANSNIQERAKALE IQ LK+TYH GVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+
Sbjct  181   NGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGK  240

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             K   DDD++ E T PKL+ I+NGQ+   D  L+KS LEN+KC+L+DCGS++F+WVGR TQ
Sbjct  241   KAICDDDVVLETTAPKLYSINNGQLKLEDTVLTKSILENNKCFLVDCGSDLFIWVGRLTQ  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SASATPPEEGRG  1178
             ++ERKAA    EEF+  Q RPK T++TR+ QG+E  +FK +F+SWP  SA +   EEGRG
Sbjct  301   VEERKAASAAVEEFIATQNRPKTTRVTRVIQGYENHTFKSKFESWPVNSAGSAGAEEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 159/342 (46%), Gaps = 34/342 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E++ +       LPK + GKFYSGD Y+VL T         F + +W+GKD+  ++   
Sbjct  397   LEVYCVNGSAKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFYLTYWIGKDSIPEDQEM  456

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A      +   L G+ +  R  Q  E  +F++ F+P ++ L+GG++SG++K  EE+  + 
Sbjct  457   AFQTANSIWNSLKGRPILGRIYQGKEPPQFIALFQPMVI-LKGGISSGYQKFVEEKGLKD  515

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  + R+           QV     +L+  D FVL + + ++ + G  S+ +++
Sbjct  516   ETYSGDGIALFRISGTSIHNNKVLQVDAVSSNLSPTDCFVLQSGNSMFTWIGNASSYEQQ  575

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A +V +FLK     GV  V   ++G      +S  FW   GG      +  +  D++ 
Sbjct  576   QWAAKVAEFLKP----GVA-VKHCKEGT-----ESSAFWFALGGKQNYTSR-NATHDVVR  624

Query  855   EKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             E   P L  F + NG++   +    S+ +L      +LD   EVFVW+G+     E++ A
Sbjct  625   E---PHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKA  681

Query  1026  CQT----AEEFLVKQKRPKATKITRLAQGHETISFKCEFDSW  1139
              +     AE     +       + ++ +G+E   F+  F SW
Sbjct  682   FEIGQKYAEHAAAFESLSPDVPLYKVVEGNEPCFFRTYF-SW  722



>gb|KHG05180.1| Villin-2 -like protein [Gossypium arboreum]
Length=480

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/341 (75%), Positives = 299/341 (88%), Gaps = 1/341 (0%)
 Frame = +3

Query  162   AGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEA  341
             +G EIWRIENF+PVPLPK+DYGKFY GDSY+VLQTT  KGG YL+DIHFW+GKDT+QDEA
Sbjct  11    SGTEIWRIENFQPVPLPKSDYGKFYMGDSYIVLQTTPSKGGSYLYDIHFWIGKDTTQDEA  70

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFE  521
             GTAAIKT+ELD +LGG+ VQHRE+Q HESD+FLSYFKPCI+PLEGG+A+GFKKPEEEEFE
Sbjct  71    GTAAIKTIELDAVLGGRAVQHRELQGHESDKFLSYFKPCIIPLEGGIATGFKKPEEEEFE  130

Query  522   TRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQF  701
              RLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT++KIYQFNGANSNIQERAKALEVIQF
Sbjct  131   KRLYVCRGKRVVRLKQVPFARSSLNHDDVFILDTQNKIYQFNGANSNIQERAKALEVIQF  190

Query  702   LKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFC  881
             LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+KV ++DD+IPE  P KL+ 
Sbjct  191   LKEKYHDGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKKVHNEDDLIPETYPAKLYS  250

Query  882   IDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFLVKQK  1061
             I  G+V  V+GELSK  LEN+KCYLLDCG+EVFVWVGR TQ+++RKAA Q AE+F+  Q+
Sbjct  251   ITGGEVKVVEGELSKGLLENNKCYLLDCGAEVFVWVGRVTQVEDRKAATQAAEDFVGSQQ  310

Query  1062  RPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             RPKAT+ITR+ QG+ET SFK  FDSWP+ S  P  EEGRGK
Sbjct  311   RPKATRITRVIQGYETNSFKANFDSWPAGSTAPGGEEGRGK  351



>gb|KHN07369.1| Villin-2 [Glycine soja]
Length=972

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 299/359 (83%), Gaps = 13/359 (4%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQK G EIWRIE+F+PVPLP+ DYGKFY GDSY++LQTT GKG  
Sbjct  1     MSSATKVLDPAFQGVGQKVGTEIWRIEDFQPVPLPRPDYGKFYMGDSYIILQTTQGKGSA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGFKKPEEEEFETRLYV            PFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGVASGFKKPEEEEFETRLYV------------PFARSSLNHDDVFILDTQNKIYQFN  168

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  169   GANSNIQERAKALEVIQLLKEKYHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  228

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             + S+DDI+PE  P +L+ I +G+  PV+GELSKS LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  229   IISEDDIVPETIPAQLYSIADGEAKPVEGELSKSLLENYKCYLLDCGAEVFVWVGRVTQV  288

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERKAACQ AEEFL  QKRPK+T+ITR+ QG+ET SFK  FDSWPS SAT   +EGRGK
Sbjct  289   EERKAACQAAEEFLTSQKRPKSTRITRIIQGYETHSFKSNFDSWPSGSATTGADEGRGK  347


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 96/372 (26%), Positives = 168/372 (45%), Gaps = 40/372 (11%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             T SV V+ + P  +  G+   +E+W+I      PLPK D GKFYSGD Y+V  T      
Sbjct  365   TTSV-VEEIPPLLEGGGK---MEVWQINGSAKTPLPKEDIGKFYSGDCYIVPYTYHSSER  420

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                + +  W GKD+++++   A      +   L G+ VQ R     E  +F+  F P ++
Sbjct  421   KEDYYLCCWFGKDSTEEDQRMAIRLANTMFNSLKGRPVQGRIFDGKEPPQFIVLFHPMVV  480

Query  465   PLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVF  611
              L+GG++SG+KK   ++      Y  +    +R+           QV      LN  + F
Sbjct  481   -LKGGLSSGYKKLIADKGLPDETYTAESVAFIRISGTSTHNNKVVQVDAVAALLNSTECF  539

Query  612   VLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFW  791
             VL +   ++ ++G   +++++  A +V +FL+     GV  + + ++G      ++  FW
Sbjct  540   VLQSGSAVFTWHGNQCSLEQQQLAAKVAEFLRP----GVA-LKLAKEG-----TETSTFW  589

Query  792   ELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLL  959
                GG      K  ++D +      P LF         QV  V    S+ +L      +L
Sbjct  590   FALGGKQSYNNKKVTNDIV----RDPHLFTFSFNRGKLQVEEVY-NFSQDDLLTEDILIL  644

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCE  1127
             D  +EVFVW+G+     E++ A + A++++ K    +       + ++ +G+E   F   
Sbjct  645   DTHAEVFVWIGQCVDPKEKQNAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTY  704

Query  1128  FDSWPSASATPP  1163
             F SW    A  P
Sbjct  705   F-SWDHTKAMVP  715



>ref|XP_009400158.1| PREDICTED: villin-3-like [Musa acuminata subsp. malaccensis]
Length=931

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/363 (68%), Positives = 306/363 (84%), Gaps = 6/363 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K  +PAFQ  G K G EIWRIENF+PVP+PK+DYGKFYSGDSY++LQTT GKGG 
Sbjct  1     MSSSTKYADPAFQGVGHKVGTEIWRIENFQPVPIPKSDYGKFYSGDSYIILQTT-GKGGT  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GK++SQDEAGTAAIKTVELD +LGG+ VQHRE Q  ESD+FLSYFKPCI+P
Sbjct  60    YLYDIHFWIGKESSQDEAGTAAIKTVELDAVLGGRAVQHREPQGFESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPEEE+FETRLY C+GKRVVRMKQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  120   LEGGFASGFKKPEEEKFETRLYTCRGKRVVRMKQVPFARSSLNHDDVFILDTEKKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GAN+NIQERAKALEVIQ+LKD YH G C++AI++DG LQA++DSGEFW LFGGFAP+G+K
Sbjct  180   GANTNIQERAKALEVIQYLKDKYHEGTCDIAIIDDGKLQADSDSGEFWVLFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DD + + +P KL+ I++GQ+   +  LSK+ LEN+KCYLLDCG+EV +WVGR TQ+
Sbjct  240   VVSEDDTVLKTSPAKLYGINDGQLKLEENNLSKAMLENNKCYLLDCGAEVIIWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-----PPEEG  1172
             +ERKAA + AE+F++ Q RPK T++T++ QG+ET SFK +F+SW + + T       EEG
Sbjct  300   EERKAASKAAEDFIISQNRPKTTRVTQVIQGYETHSFKSKFESWSAGTVTGMGNSTGEEG  359

Query  1173  RGK  1181
             +GK
Sbjct  360   QGK  362


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 80/349 (23%), Positives = 149/349 (43%), Gaps = 36/349 (10%)
 Frame = +3

Query  129   LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
             + P  +  G+   +E+WRI      PLP+ + G+FYSGD Y+VL T         + +  
Sbjct  387   IPPLLEGGGK---LEVWRINGSAKNPLPREEIGRFYSGDCYIVLYTYRSGEKKEDYLLTC  443

Query  309   WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
             W+GKD+ Q             D +   +  +        S   +  F  CI PL   V  
Sbjct  444   WMGKDSIQASGN---------DHVFPEEAKEKLPFSVLLSHDVIKSFLWCIYPLRSNVVW  494

Query  489   GFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
                     + +T + +   K V    +      SL+  D F+L + + ++ ++G++S  +
Sbjct  495   ILDAYNPLKLQTLMKLIFSKSV----KTDTVATSLSSTDCFILQSGNSLFTWHGSSSTFE  550

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDD  845
             ++  A  + +FLK        +VA+    + +   +S  FW   GG      +KVT D  
Sbjct  551   QQQWAARIAEFLKP-------DVAL---KHAKEGTESSAFWFALGGKQSFTTKKVTQD--  598

Query  846   IIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              I        F  + G++   +    S+ +L      +LD  +EVF+W+G++    +++ 
Sbjct  599   -ITRDPHLYTFSFNKGKLEVTEVYNYSQDDLLTEDMLVLDTHAEVFLWIGQSVDSKDKQK  657

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             A    ++++    + +       + ++ +G+E   F   F SW SA AT
Sbjct  658   AFDIGQKYIELAVLFEGLSPDVPLFKVTEGNEPCFFTTYF-SWDSAKAT  705



>ref|XP_004984323.1| PREDICTED: villin-3-like [Setaria italica]
Length=960

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/361 (70%), Positives = 302/361 (84%), Gaps = 3/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS     L+PAFQ AG K G EIWRIE+FKPVPLPK+DYGKFY GDSY+VLQT+  KGG 
Sbjct  1     MSNAKVVLDPAFQGAGHKPGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTSCNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKD+SQDEAGTAAIKTVELDT+LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  61    YLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHREPQGYESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGG ASGFKKPEE++FETRLY+CKGKR +R+K+VPF+R SLNHDDVF+LDT  KIYQFN
Sbjct  121   MEGGFASGFKKPEEDKFETRLYICKGKRAIRVKEVPFSRSSLNHDDVFILDTDKKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  181   GANSNIQERAKALEVIQHLKEKYHDGVCAVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
                DDDI+ E TPPKL+ I+NGQ+   D  L+KS LEN+KC+LLDCG+E+FVWVGR TQ+
Sbjct  241   AVCDDDIVLETTPPKLYSINNGQLKLEDTVLTKSILENTKCFLLDCGAELFVWVGRVTQV  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             ++RK A  + E+F++K+ RPK T+IT++ QG+E  +FK +F+SWP    A     +EGRG
Sbjct  301   EDRKTASASVEKFIIKENRPKTTRITQVIQGYENHTFKSKFESWPVSNMAGNASTDEGRG  360

Query  1179  K  1181
             K
Sbjct  361   K  361


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 154/319 (48%), Gaps = 31/319 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W I       LPK + GKFYSGD YVVL T         F + +W+
Sbjct  389   PLLEGGGK---LEVWCINGSAKTALPKEELGKFYSGDCYVVLYTYHSGDKKEEFYLTYWI  445

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK + +++   A      L   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  446   GKHSVREDQDMAFQLASTLWNSLKGRPVLGRVYQGKEPPQFVALFQPMVI-LKGGISSGY  504

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+      Y   G  ++R+           QV     SL+  D F+L +K+ ++ 
Sbjct  505   KKFVEEKGLTDETYCVDGVALIRVSGTSVHNNKTLQVDAVPTSLSSTDCFILQSKNLMFA  564

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G +S+ +++  A++V +FLK     GV  V   ++G      +S  FW   GG     
Sbjct  565   WIGNSSSFEQQQWAIKVAEFLKP----GVA-VKHCKEGT-----ESSAFWSAIGGKQSYT  614

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D  I E   P L  F + NG++   +    S+ +L      +LD  SEVFVW+G
Sbjct  615   SKNVAADVAIRE---PHLYTFSLRNGKLEVTEVYNFSQDDLLTEDTMILDTHSEVFVWMG  671

Query  993   RATQLDERKAACQTAEEFL  1049
             +     E++ A    ++++
Sbjct  672   QCVDTKEKQKAFDIGQKYV  690



>gb|ABR16365.1| unknown [Picea sitchensis]
Length=610

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/359 (68%), Positives = 299/359 (83%), Gaps = 1/359 (0%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++PAFQ  GQK G +IWRIENF+PVP+PK+DYGKFY GDSY+VLQTT+ K G 
Sbjct  1     MAVSMKNVDPAFQGVGQKVGTDIWRIENFRPVPIPKSDYGKFYCGDSYIVLQTTATKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +DIHFWLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+D+FLSYFKPCI+P
Sbjct  61    YHYDIHFWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYRELQGHETDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGF+KPE  +FE RLYVCKG+RVVR+KQVPFAR SLNHDDVFVLDT+ K+YQFN
Sbjct  121   LEGGAASGFRKPEITKFEPRLYVCKGRRVVRVKQVPFARTSLNHDDVFVLDTESKVYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GA+SNIQERAK+LEV+Q++KD YH G C++A+++DG L AE+DSGEFW LFGGFAP+G+K
Sbjct  181   GASSNIQERAKSLEVVQYIKDEYHEGKCDIAVIDDGKLVAESDSGEFWALFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD   E TP KL+ I  G++  V+G LSK  LE++KCYLLDCG+EV+VWVGR TQL
Sbjct  241   NGSDDDSRMESTPGKLYSIVEGEIKIVEGPLSKGMLESNKCYLLDCGAEVYVWVGRVTQL  300

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +ERK+A  TAEEF+  QKRP+ T ITR+ QG ET+ F+  FDSW   + T   E+GRGK
Sbjct  301   EERKSASLTAEEFISNQKRPRNTHITRVIQGFETLPFRSNFDSWSLGTGTSGSEDGRGK  359


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 106/204 (52%), Gaps = 15/204 (7%)
 Frame = +3

Query  129  LEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHF  308
            + P  +  G+   +E+WR++N    P+PK D GKFYSGD Y++L T         + + F
Sbjct  384  IPPLLEGNGK---LEVWRVKNVSKAPVPKEDIGKFYSGDCYIILYTYHSGDRKEDYFLCF  440

Query  309  WLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVAS  488
            WLGK ++Q++   AA  T  +   L G+ VQ R ++  E  +F+  F P +  L+GG+++
Sbjct  441  WLGKQSTQEDQAVAARLTNTMANSLKGRPVQGRILEGKEPPQFIGLF-PNMAILKGGLSA  499

Query  489  GFKK------PEEEEFE----TRLYVC-KGKRVVRMKQVPFARPSLNHDDVFVLDTKDKI  635
            G+KK        +E +       + VC  G    +  QV     SLN  D F+L T   +
Sbjct  500  GYKKYITEKGINDETYNGDGIALIQVCGTGPHNSKAIQVDPVAESLNSCDCFLLQTGTSL  559

Query  636  YQFNGANSNIQERAKALEVIQFLK  707
            + ++G +S ++++     + +FLK
Sbjct  560  FAWHGNSSALEQQLSVARIAEFLK  583



>ref|XP_008660141.1| PREDICTED: villin-3-like [Zea mays]
Length=936

 Score =   539 bits (1389),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 252/361 (70%), Positives = 303/361 (84%), Gaps = 4/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS     LEPAFQ AG K G EIWRIE+FKPVPLPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSNAKAVLEPAFQGAGHKPGTEIWRIEDFKPVPLPKSDYGKFYCGDSYIVLQTTC-KGGA  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  60    YLFDIHFWIGKDSSQDEAGTAAIKTVELDSMLGGRAVQHREPQCYESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGG ASGFKKPE ++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  120   MEGGFASGFKKPEVDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTENKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW +FGGFAP+G+K
Sbjct  180   GANSNIQERAKALEVIQHLKEKYHDGVCAVAIVDDGKLQAESDSGEFWVVFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD++ E T P+LF I NGQ+   D  L+KS LEN+KC+LLDCG+E+FVWVGR TQ+
Sbjct  240   AVSDDDVVLETTSPRLFSISNGQLKLEDTVLTKSILENTKCFLLDCGAELFVWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             ++RKAA    E+F++K+ RPK T+IT++ QG E  +FK +F+SWP   +A +   EEGRG
Sbjct  300   EDRKAASAAVEKFIIKENRPKTTRITQVIQGFENHTFKSKFESWPVSNTAGSASTEEGRG  359

Query  1179  K  1181
             K
Sbjct  360   K  360


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 161/327 (49%), Gaps = 31/327 (9%)
 Frame = +3

Query  111   SVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
             +VN +   P     G+   +E+W I +   + LPK + GKFYSGD YVVL T        
Sbjct  382   AVNDEIPPPLLDGGGK---LEVWCINDSVKIALPKEELGKFYSGDCYVVLYTYHSVDKKE  438

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
              F + +W+GK++ Q++  +A          L G+ V  R  Q  E  +F++ F+P ++ L
Sbjct  439   EFYLTYWIGKNSVQEDQESAFQIANTTWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-L  497

Query  471   EGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVL  617
             +GG +SG+KK  EE+  +   Y   G  ++++           QV     SL+  D FVL
Sbjct  498   KGGTSSGYKKYVEEKGLKDETYCSDGVALIQISGTAVHSNKTIQVDAVPASLSSTDCFVL  557

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +K+ I+ +NG +S+++++  A +V +FLK         VA+    + +   +S  FW  
Sbjct  558   QSKNSIFVWNGTSSSVEQQQWASKVAEFLK-------TGVAV---KHCKEGTESSIFWSS  607

Query  798   FGGFAPMGRKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCG  968
              GG      +    D ++ E   P L  F + NG++   +    S+ +L      +LD  
Sbjct  608   LGGKQSYTSRNVVPDVVLRE---PHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMILDTH  664

Query  969   SEVFVWVGRATQLDERKAACQTAEEFL  1049
             SEVFVW+G+  +  E++ A    ++++
Sbjct  665   SEVFVWMGQCVETKEKQKAFDIGQKYV  691



>gb|KHN14972.1| Villin-2 [Glycine soja]
Length=962

 Score =   540 bits (1390),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 301/359 (84%), Gaps = 13/359 (4%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS   K L+PAFQ  GQK G EIWRIE+F+PVPLP+++YGKFY GDSY++LQTT GKGG 
Sbjct  1     MSSATKVLDPAFQGVGQKVGTEIWRIEDFQPVPLPRSEYGKFYMGDSYIILQTTQGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHREIQ HESD+FLSYFKPCI+P
Sbjct  61    YLYDIHFWIGKDTSQDEAGTAAIKTVELDASLGGRAVQHREIQGHESDKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG+ASGFKKPEEEEFETRLYV            PFAR SLNHDDVF+LDT++KIYQFN
Sbjct  121   LEGGIASGFKKPEEEEFETRLYV------------PFARSSLNHDDVFILDTQNKIYQFN  168

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ +H G C+VAIV+DG L  E+DSGEFW LFGGFAP+G+K
Sbjct  169   GANSNIQERAKALEVIQLLKEKHHEGKCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGKK  228

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V S+DDI+PE  P +L+ I +G+V PV+GELSKS LEN KCYLLDCG+EVFVWVGR TQ+
Sbjct  229   VISEDDIVPETIPAQLYSIADGEVKPVEGELSKSLLENYKCYLLDCGTEVFVWVGRVTQV  288

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT-PPEEGRGK  1181
             ++RKAACQ AEEF+  QKRPK+T+ITR+ QG+ET SFK  FD WPS SAT   +EGRGK
Sbjct  289   EDRKAACQAAEEFVASQKRPKSTRITRIIQGYETHSFKSNFDFWPSGSATNSADEGRGK  347


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 94/367 (26%), Positives = 169/367 (46%), Gaps = 39/367 (11%)
 Frame = +3

Query  120   VKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFD  299
             V+ + P  +  G+   +E+W+I      PL K D GKFYSGD Y+VL T         + 
Sbjct  369   VEDIPPLLEGGGK---MEVWQISGSAKTPLSKEDIGKFYSGDCYIVLYTYHSSERKEDYY  425

Query  300   IHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGG  479
             +  W GKD+ +++   A      +   L G+ VQ R     E  +F++ F P ++ L+GG
Sbjct  426   LCCWFGKDSIEEDQRMAIRLANSMFNSLKGRPVQGRIFDGKEPPQFIALFHPMVV-LKGG  484

Query  480   VASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTK  626
             ++SG+KK   ++      Y  +   ++R+           QV      LN  + FVL + 
Sbjct  485   LSSGYKKFIADKGLPDETYAAESVALIRISGTSIHNNKVVQVDAVAALLNSTECFVLQSG  544

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
               ++ ++G   +++++  A +V +FL+     GV ++ + ++G      ++  FW   GG
Sbjct  545   SAVFTWHGNQCSLEQQQLAAKVAEFLRP----GV-SLKLAKEGT-----ETSTFWFALGG  594

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNG----QVNPVDGELSKSNLENSKCYLLDCGSE  974
                   K  ++D +      P LF +       QV  V    S+ +L      +LD  +E
Sbjct  595   KQSYTSKNVTNDIV----RDPHLFTLSFNRGKLQVEEVYN-FSQDDLLTEDILILDTHTE  649

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWP  1142
             VFVW+G+     E++ A + A++++ K    +       + ++ +G+E   F   F SW 
Sbjct  650   VFVWIGQCVDPKEKQKAFEIAQKYIDKAASLEGLSPHVPLYKVTEGNEPCFFTTYF-SWD  708

Query  1143  SASATPP  1163
              A A  P
Sbjct  709   HAKAMVP  715



>ref|XP_008786910.1| PREDICTED: villin-2-like isoform X1 [Phoenix dactylifera]
Length=985

 Score =   539 bits (1388),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 296/342 (87%), Gaps = 3/342 (1%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
             G EIWRIENF+PVPL KADYGKFYSGDSY+VLQTT+GKGG YL+DIHFWLGKDTSQDEAG
Sbjct  57    GTEIWRIENFQPVPLSKADYGKFYSGDSYIVLQTTAGKGGAYLYDIHFWLGKDTSQDEAG  116

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET  524
             TAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+PLEGGVASGFKKPEEE+FET
Sbjct  117   TAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIPLEGGVASGFKKPEEEKFET  176

Query  525   RLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFL  704
             RLY C+GKRVVR+KQVPFAR SLNHDDVF+LDT++KI+QFNGANSNIQERAKALEVIQ+L
Sbjct  177   RLYTCRGKRVVRLKQVPFARSSLNHDDVFILDTENKIFQFNGANSNIQERAKALEVIQYL  236

Query  705   KDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCI  884
             KD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K  S+DD   E TP KL+ I
Sbjct  237   KDKYHEGKCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKKTVSEDDHALESTPGKLYSI  296

Query  885   DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFLVKQKR  1064
             ++ Q+   +  LSK+ LEN+KCYL+DCG+EVFVWVGR TQ+++RKAA + AEEF++ Q R
Sbjct  297   NDDQLKLEESALSKAMLENNKCYLMDCGAEVFVWVGRVTQVEDRKAASKAAEEFVINQNR  356

Query  1065  PKATKITRLAQGHETISFKCEFDSWPSASATPP---EEGRGK  1181
             PK T+IT++ QG ET SFK  F+SWP+++ T     E+GRGK
Sbjct  357   PKVTRITQVIQGFETRSFKSYFESWPASTGTAASGGEDGRGK  398


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 152/319 (48%), Gaps = 32/319 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  + AG+   IE+WRI      P+PK + GKFYSGD Y+VL T         + +  WL
Sbjct  425   PLLEGAGK---IEVWRINGNAKTPVPKEEIGKFYSGDCYIVLYTYHSSEKKEEYFLACWL  481

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ QD+   A      +   L G+ VQ   +Q  E  +F++ F+P ++ L+GGV+SG+
Sbjct  482   GKDSVQDDWMMANRLANTMCNSLKGRPVQGHIVQGKEPPQFIALFQPMVI-LKGGVSSGY  540

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y   G  ++R+           QV     SL+  D F+L + + ++ 
Sbjct  541   KKLIADKNVNDDTYTSDGIALIRVSDTSVHNNKAVQVEAVATSLSSTDCFLLQSGNSVFI  600

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G++S  +++  A +V +FLK    G     A       +   +S  FW   GG     
Sbjct  601   WDGSSSTFEQQQWAAKVAEFLKP---GATLKHA-------KEGTESSAFWFALGGKQSFT  650

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              K  + D +      P L  F    G++   +    S+ +L      +LD  +EVFVWVG
Sbjct  651   TKKVAQDTV----RDPHLYTFSFSKGKLEVTEVHNFSQDDLLTEDILILDTHAEVFVWVG  706

Query  993   RATQLDERKAACQTAEEFL  1049
             ++    E++ A +  ++++
Sbjct  707   QSVDPKEKQKAFEIGQKYM  725



>ref|XP_008655853.1| PREDICTED: villin-3-like [Zea mays]
Length=959

 Score =   536 bits (1382),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/361 (69%), Positives = 303/361 (84%), Gaps = 4/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS     LEPAFQ AG K G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSTAKVVLEPAFQGAGHKPGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTC-KGGA  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             ++FDIHFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  60    FIFDIHFWIGKDSSQDEAGTAAIKTVELDSMLGGRAVQHREPQCYESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGG ASGFKKPE ++FETRLY+CKGKR +R+K+VPF+R SLNHDDVF+LDT++KIYQFN
Sbjct  120   MEGGFASGFKKPEVDKFETRLYICKGKRAIRVKEVPFSRSSLNHDDVFILDTENKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  180   GANSNIQERAKALEVIQHLKEEYHDGVCAVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD++ E T PKLF I NGQ+   D  L+KS LEN+KC+LLDCG+E+FVWVGR TQ+
Sbjct  240   AISDDDVVLETTSPKLFSISNGQLKLEDAVLTKSILENTKCFLLDCGAELFVWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             ++RKAA    E++++K+ RPK T+IT++ QG+E  +FK +F+SWP   ++ +   EEGRG
Sbjct  300   EDRKAASAAVEKYIIKENRPKTTRITQVIQGYENHTFKSKFESWPVSNTSGSASTEEGRG  359

Query  1179  K  1181
             K
Sbjct  360   K  360


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 168/348 (48%), Gaps = 35/348 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQ-DEAG  344
             +E+W I+      LPK + GKFYSGD YVVL T         F + +W+GK++ Q D+  
Sbjct  396   LEVWCIDGSAKTALPKEELGKFYSGDCYVVLYTYHSAEKKEEFYLAYWIGKNSVQEDQEA  455

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
                I     ++ L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+KK  EE+  +
Sbjct  456   AFQIANTTFNS-LKGRPVQGRIYQGKEPPQFVAIFQPMVI-LKGGTSSGYKKFVEEKGLK  513

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  ++++           QV     SL+  D FVL  K+ ++ +NG  S+ ++
Sbjct  514   DETYCSDGTALIQISGTAVHNNKTLQVDAVATSLSSTDCFVLQAKNSMFIWNGNASSFEQ  573

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A +V +FLK         VA+    + +   +S  FW   GG      +  + D +I
Sbjct  574   QQWAAKVAEFLK-------TGVAV---KHCKEGTESSIFWSSIGGKQSYTNRNAAPDVVI  623

Query  852   PEKTPPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              E   P L  F + NG++   +    S+ +L      +LD   EVFVW+G+  +  E++ 
Sbjct  624   RE---PHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMILDTHCEVFVWMGQCVETKEKQK  680

Query  1023  ACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             A    ++++      +       + ++ +G+E   F+  F SW SA +
Sbjct  681   AFDIGQKYVQHAVAFEGISPDVPLYKVNEGNEPCFFRTYF-SWDSARS  727



>tpg|DAA45442.1| TPA: hypothetical protein ZEAMMB73_935992 [Zea mays]
Length=971

 Score =   536 bits (1382),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 248/361 (69%), Positives = 303/361 (84%), Gaps = 4/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS     LEPAFQ AG K G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSTAKVVLEPAFQGAGHKPGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTC-KGGA  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             ++FDIHFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  60    FIFDIHFWIGKDSSQDEAGTAAIKTVELDSMLGGRAVQHREPQCYESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGG ASGFKKPE ++FETRLY+CKGKR +R+K+VPF+R SLNHDDVF+LDT++KIYQFN
Sbjct  120   MEGGFASGFKKPEVDKFETRLYICKGKRAIRVKEVPFSRSSLNHDDVFILDTENKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  180   GANSNIQERAKALEVIQHLKEEYHDGVCAVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD++ E T PKLF I NGQ+   D  L+KS LEN+KC+LLDCG+E+FVWVGR TQ+
Sbjct  240   AISDDDVVLETTSPKLFSISNGQLKLEDAVLTKSILENTKCFLLDCGAELFVWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             ++RKAA    E++++K+ RPK T+IT++ QG+E  +FK +F+SWP   ++ +   EEGRG
Sbjct  300   EDRKAASAAVEKYIIKENRPKTTRITQVIQGYENHTFKSKFESWPVSNTSGSASTEEGRG  359

Query  1179  K  1181
             K
Sbjct  360   K  360


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 95/360 (26%), Positives = 164/360 (46%), Gaps = 38/360 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQ-DEAG  344
             +E+W I+      LPK + GKFYSGD YVVL T         F + +W+GK++ Q D+  
Sbjct  396   LEVWCIDGSAKTALPKEELGKFYSGDCYVVLYTYHSAEKKEEFYLAYWIGKNSVQEDQEA  455

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
                I     ++ L G+ VQ R  Q  E  +F++ F+P ++ L+GG +SG+KK  EE+  +
Sbjct  456   AFQIANTTFNS-LKGRPVQGRIYQGKEPPQFVAIFQPMVI-LKGGTSSGYKKFVEEKGLK  513

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  ++++           QV     SL+  D FVL  K+ ++ +NG  S+ ++
Sbjct  514   DETYCSDGTALIQISGTAVHNNKTLQVDAVATSLSSTDCFVLQAKNSMFIWNGNASSFEQ  573

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A +V +FLK     G     +    + +   +S  FW   GG      +  + D +I
Sbjct  574   QQWAAKVAEFLKIGLDLGQLETGVAVK-HCKEGTESSIFWSSIGGKQSYTNRNAAPDVVI  632

Query  852   PEKTPPKLFCIDNGQVNPV-------DGELSKS--------NLENSKCYLLDCGSEVFVW  986
              E   P L+      V  +          ++ S        +L      +LD   EVFVW
Sbjct  633   RE---PHLYTFSLRNVTLIFHFHFLASIAITSSPFVREAGDDLLTEDMMILDTHCEVFVW  689

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKATK----ITRLAQGHETISFKCEFDSWPSASA  1154
             +G+  +  E++ A    ++++      +       + ++ +G+E   F+  F SW SA +
Sbjct  690   MGQCVETKEKQKAFDIGQKYVQHAVAFEGISPDVPLYKVNEGNEPCFFRTYF-SWDSARS  748



>ref|XP_009382600.1| PREDICTED: villin-3-like [Musa acuminata subsp. malaccensis]
 ref|XP_009382601.1| PREDICTED: villin-3-like [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   537 bits (1384),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 248/363 (68%), Positives = 303/363 (83%), Gaps = 6/363 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K+L+PAFQ AGQK G EIWRIENF+PVPLPK+DYGKFYSGDSY++LQTTSGKGG 
Sbjct  1     MSSSTKSLDPAFQGAGQKVGTEIWRIENFQPVPLPKSDYGKFYSGDSYIILQTTSGKGG-  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y +D HFW+GKD+SQDEAGTAAIKTVELD +LGG+ VQHRE+Q  ESD+FLSYFKPCI+P
Sbjct  60    YGYDTHFWIGKDSSQDEAGTAAIKTVELDAVLGGRAVQHRELQGFESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG  SGFKKPEE++FETRLY+C+GKRV ++KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  120   LEGGFTSGFKKPEEQKFETRLYICRGKRVAKIKQVPFARSSLNHDDVFILDTEKKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSN+QERAKALEVIQ LKD YH G C+VAI++DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  180   GANSNVQERAKALEVIQHLKDKYHDGTCDVAIIDDGKLQAESDSGEFWVLFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V ++DD++ E  P K++ I  GQ+   +   SK+ LEN+KCYLLDCG+E+FVWVGR TQ+
Sbjct  240   VFTEDDLVLETAPVKIYSITGGQLKLEEDNPSKALLENNKCYLLDCGAEIFVWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-----SASATPPEEG  1172
             D+RKAA + AE+F++ Q RPK T+IT++ QG+ET SFK  F+SWP         +  +E 
Sbjct  300   DDRKAASKAAEDFIIDQNRPKMTRITQVIQGYETQSFKSNFESWPVGTGTGTGTSSGDEA  359

Query  1173  RGK  1181
             RGK
Sbjct  360   RGK  362


 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 94/347 (27%), Positives = 157/347 (45%), Gaps = 34/347 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E+W I      P+PK + GKFYSGD Y+VL T         + +  W+GKD+ QD+   
Sbjct  397   LEVWLINGSAKTPIPKEEIGKFYSGDCYIVLCTYRAGDKKEEYYLCCWIGKDSIQDDRVM  456

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             +      +   L G+ VQ    Q  E  +F++ F+P ++ L+GG++SG+KK   ++    
Sbjct  457   STRLCNTIWNSLKGRPVQGCVFQGKEPPQFIALFQPMVV-LKGGISSGYKKFLADKNLND  515

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y      ++++           QV     SL+ +D F+L +   ++ +NG +S  Q++
Sbjct  516   ETYTSDSIALIQVSGTSVHNNKAVQVDAVAASLSSNDCFLLQSGSSLFAWNGNSSTTQQQ  575

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A  V +FLK         VA+    + +   +S  FW   GG      K    D +  
Sbjct  576   QWAARVAEFLKP-------GVAL---KHTKEGTESSAFWFALGGKQSYTSKKVIQDIV--  623

Query  855   EKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
               + P L+ I   + N    E+   S+ +L      +LD  SEVFVWVG+     E++ A
Sbjct  624   --SDPHLYTISYVKGNLEFTEVFNFSQDDLLTEDMLILDTHSEVFVWVGQYVDSKEKQKA  681

Query  1026  CQTAEEF----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 +++    +  +       I  + +G+E   F   F SW SA A
Sbjct  682   FHIGQKYVDLAVSLEGLSSDVPIYVVIEGYEPCFFMTYF-SWNSAKA  727



>ref|XP_002467837.1| hypothetical protein SORBIDRAFT_01g034950 [Sorghum bicolor]
 gb|EER94835.1| hypothetical protein SORBIDRAFT_01g034950 [Sorghum bicolor]
Length=951

 Score =   533 bits (1374),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 250/361 (69%), Positives = 300/361 (83%), Gaps = 4/361 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS     LEPAFQ AG K G EIWRIE+FKPV LPK+DYGKFY GDSY+VLQTT  KGG 
Sbjct  1     MSNAKVVLEPAFQGAGHKPGTEIWRIEDFKPVALPKSDYGKFYCGDSYIVLQTTC-KGGA  59

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             Y+FDIHFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQHRE Q +ESD+FLSYFKPCI+P
Sbjct  60    YIFDIHFWIGKDSSQDEAGTAAIKTVELDSMLGGRAVQHREPQCYESDKFLSYFKPCIIP  119

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGG ASGFKKPE ++FE RLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT++KIYQFN
Sbjct  120   MEGGFASGFKKPEVDKFEVRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTENKIYQFN  179

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW LFGGFAP+G+K
Sbjct  180   GANSNIQERAKALEVIQHLKEKYHDGVCAVAIVDDGKLQAESDSGEFWVLFGGFAPIGKK  239

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
               SDDD++ E T PKLF I NGQ+   D  L+KS LEN+KC+LLDCG+E+FVWVGR TQ+
Sbjct  240   TISDDDVVLETTAPKLFSITNGQLKLEDTALTKSVLENTKCFLLDCGAELFVWVGRVTQV  299

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASATPPEEGRG  1178
             +ERKAA    E+F++K+ RPK  +IT++ QG+E  +FK +F+SWP   +A +   EEGR 
Sbjct  300   EERKAASAAVEKFIIKENRPKTARITQVIQGYENHTFKSKFESWPVSTTAGSASTEEGRV  359

Query  1179  K  1181
             K
Sbjct  360   K  360


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 152/309 (49%), Gaps = 30/309 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQ-DEAG  344
             +E+W +       LPK + GKFYSGD YVVL T         F + +W+GK++ Q D+  
Sbjct  396   LEVWCVNGSVKTALPKEELGKFYSGDCYVVLYTYHSADKKEEFYLTYWIGKNSVQEDQEA  455

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
                I     ++ L G+ V  R  Q  E  +F++ F+P ++ L+GG +SG+KK  EE+  +
Sbjct  456   VFQIANTTWNS-LKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGTSSGYKKFVEEKGLK  513

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  ++R+           QV     SL+  D FVL TK+ ++ +NG +S+ ++
Sbjct  514   DETYCADGVALIRISGTAVHNNKTLQVDAVPTSLSSTDCFVLQTKNSMFLWNGNSSSFEQ  573

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A +V +FLK         VA+    + +   +S  FW   GG      K  + D +I
Sbjct  574   QQWAAKVAEFLK-------TGVAV---KHCKEGTESSIFWSSIGGKQSYTSKSAAPDAVI  623

Query  852   PEKTPPKL--FCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              E   P L  F + NG++   +    S+ +L      +LD   EVFVW+G+  +  E++ 
Sbjct  624   RE---PHLYTFSLRNGKLEVTEVFNFSQDDLLTEDTMILDTHGEVFVWMGQCVETKEKQK  680

Query  1023  ACQTAEEFL  1049
             A    ++++
Sbjct  681   AFDIGQKYV  689



>emb|CDY22538.1| BnaC03g23480D [Brassica napus]
Length=944

 Score =   529 bits (1363),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 249/359 (69%), Positives = 290/359 (81%), Gaps = 27/359 (8%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK ++GKFY GD+Y+VLQTT  KGG 
Sbjct  1     MSGSAKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKTEHGKFYMGDTYIVLQTTQNKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YLFDIHFW+GKDTSQDE+GTAA+KTVELD +LGG+                         
Sbjct  61    YLFDIHFWIGKDTSQDESGTAAVKTVELDAVLGGRA------------------------  96

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
               GGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQFN
Sbjct  97    --GGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQFN  154

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GRK
Sbjct  155   GANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGRK  214

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             V +DDD+IPE TPPKL+CI +GQ+ P+DG+LSKS LEN+KCYLLDCG+EVFVWVGR TQ+
Sbjct  215   VANDDDVIPESTPPKLYCITDGQMEPMDGDLSKSMLENTKCYLLDCGAEVFVWVGRVTQV  274

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             DERKAA Q+AEEFL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SA+P  EEGRGK
Sbjct  275   DERKAANQSAEEFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSASPGNEEGRGK  333


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 162/360 (45%), Gaps = 40/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P    AG K  +E+W ++     PLPK D GK YSGD Y+VL T         + +  W 
Sbjct  360   PHLLEAGGK--LEVWLVDGKAKSPLPKEDIGKLYSGDCYLVLYTYHAGERKEDYFLCCWF  417

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK +SQ++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+
Sbjct  418   GKSSSQEDQDTALRLANAMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVI-LKGGLSSGY  476

Query  495   KKPEEEEF---------ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K   EE+             L    G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  477   KSNVEEKGSPDETYTPESISLIQVSGTGVHNNKALQVEPVATSLNSYECFLLQSGTSMFL  536

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +    A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  537   WHGNQSAHELLELAAKVAEFLKP----GVT-LKHAKEGT-----ESSTFWFALGGKQNFT  586

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EV VWV
Sbjct  587   SKKPSPETV----RDPHLFSFSINRGKFQVEEIYN-FAQDDLLTEDIYLLDTHAEVLVWV  641

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW    A
Sbjct  642   GQCVDPKEKQTVFEIGQKYIDRAGSLEGLSPK-VPLYKINEGNEPCFFTTYF-SWDHTKA  699



>emb|CDY35401.1| BnaA03g19590D [Brassica napus]
Length=946

 Score =   524 bits (1350),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 249/360 (69%), Positives = 289/360 (80%), Gaps = 28/360 (8%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ-TTSGKGG  284
             MS + K L+PAFQ AGQK G EIWRIENF+ VP+PK ++GKFY GD+Y+VLQ TT  KGG
Sbjct  1     MSGSAKVLDPAFQGAGQKPGTEIWRIENFEAVPVPKTEHGKFYMGDTYIVLQQTTQNKGG  60

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              YLFDIHFW+GKDTSQDE+GTAA+KTVELD +LGG+                        
Sbjct  61    AYLFDIHFWIGKDTSQDESGTAAVKTVELDAVLGGRA-----------------------  97

Query  465   PLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQF  644
                GGVASGFK PEEE FETRLY CKGKR +R+KQVPFAR SLNHDDVF+LDTK+KIYQF
Sbjct  98    ---GGVASGFKTPEEEVFETRLYTCKGKRAIRLKQVPFARSSLNHDDVFILDTKEKIYQF  154

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             NGANSNIQERAKALEV+Q+LKD YH G C+VAIV+DG L  E+DSGEFW LFGGFAP+GR
Sbjct  155   NGANSNIQERAKALEVVQYLKDKYHEGTCDVAIVDDGKLDTESDSGEFWVLFGGFAPIGR  214

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             KV +DDD+IPE TPPKL+CI +GQ+ P+DG+LSKS LEN+KCYLLDCG+EVFVWVGR TQ
Sbjct  215   KVANDDDVIPESTPPKLYCITDGQMEPIDGDLSKSMLENTKCYLLDCGAEVFVWVGRVTQ  274

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +DERKAA Q+AEEFL  + RPKAT++TR+ QG+E+ SFK  FDSWPS SA P  EEGRGK
Sbjct  275   VDERKAANQSAEEFLASENRPKATRVTRVIQGYESHSFKSNFDSWPSGSAAPGNEEGRGK  334


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 166/360 (46%), Gaps = 41/360 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +A G+   +E+W ++     PLPK D GKFYSGD Y+VL T         + +  W 
Sbjct  362   PLLEAGGK---LEVWVVDGKAKSPLPKEDIGKFYSGDCYLVLYTYHAGDRKEDYFLCCWF  418

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GK ++Q++  TA      +   L G+ VQ R  +  E  +F++ F+P ++ L+GG++SG+
Sbjct  419   GKSSTQEDQDTALRLANTMSNSLKGRPVQGRIYEGKEPPQFVALFQPMVI-LKGGLSSGY  477

Query  495   KKPEEEEF---------ETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
             K   EE+             L    G  V   K  QV     SLN  + F+L +   ++ 
Sbjct  478   KSNVEEKGSPDETYTPDSISLIQVSGTGVHNNKALQVEPVATSLNTYECFLLQSGTSMFL  537

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +    A +V +FLK     GV  +   ++G      +S  FW   GG     
Sbjct  538   WHGNQSAHELLELAAKVAEFLKP----GVT-LKHAKEG-----TESSTFWFALGGKQNFT  587

Query  822   RKVTSDDDIIPEKTPPKL--FCIDNG--QVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
              K  S + +      P L  F I+ G  QV  +    ++ +L     YLLD  +EVFVWV
Sbjct  588   SKKASPETV----RDPHLFSFSINRGKFQVEEI-YNFAQDDLLTEDIYLLDTHAEVFVWV  642

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G+     E++   +  ++++     ++   PK   + ++ +G+E   F   F SW  + A
Sbjct  643   GQCVDPKEKQTVFEIGQKYIDRAGSLEGLSPK-VPLYKINEGNEPCFFTTYF-SWDHSKA  700



>gb|KDO49845.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
 gb|KDO49846.1| hypothetical protein CISIN_1g002006mg [Citrus sinensis]
Length=940

 Score =   520 bits (1338),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 275/315 (87%), Gaps = 1/315 (0%)
 Frame = +3

Query  240   GDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQT  419
             GD Y+VLQTT GKGG YL+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q 
Sbjct  2     GDCYIVLQTTPGKGGAYLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQG  61

Query  420   HESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNH  599
             HESD+FLSYFKPCI+PLEGGVASGF+K EEEEFETRLYVCKGKRVVRMKQVPFAR SLNH
Sbjct  62    HESDKFLSYFKPCIIPLEGGVASGFRKTEEEEFETRLYVCKGKRVVRMKQVPFARSSLNH  121

Query  600   DDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADS  779
             DDVF+LDTKDKIYQFNGANSNIQERAKALEVIQFLK+ YH G CNVAIV+DG L  E+DS
Sbjct  122   DDVFILDTKDKIYQFNGANSNIQERAKALEVIQFLKEKYHDGNCNVAIVDDGKLDTESDS  181

Query  780   GEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLL  959
             GEFW LFGGFAP+G+KV ++DD+I E TPPKL+ I++ QV  V+GELSKS LEN+KCYLL
Sbjct  182   GEFWVLFGGFAPIGKKVATEDDVIAETTPPKLYSIEDSQVKIVEGELSKSMLENNKCYLL  241

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSW  1139
             D GSEVFVWVGR TQ++ERKAA Q AEEF+  Q RPK+ +ITR+ QG+ET +FK  FDSW
Sbjct  242   DRGSEVFVWVGRVTQVEERKAASQAAEEFISSQNRPKSIRITRVIQGYETYAFKSNFDSW  301

Query  1140  PSASATP-PEEGRGK  1181
             PS S  P  EEGRGK
Sbjct  302   PSGSTAPGAEEGRGK  316


 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 166/361 (46%), Gaps = 41/361 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       LPK D GKFYSGD Y+VL T         + +  W 
Sbjct  343   PLLEGGGK---MEVWRINGSAKTSLPKEDIGKFYSGDCYIVLYTYHSGDRKEDYFLCCWF  399

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ +++   A      +   L G+ VQ R  Q  E  +F++ F+P ++ ++GG+ SG+
Sbjct  400   GKDSIEEDQKMATRLANTMCNSLKGRPVQGRIFQGREPPQFVALFQPMVV-VKGGLCSGY  458

Query  495   KKP-EEEEFETRLYVCKGKRVVRM----------KQVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+          +QV     SLN  + F+L +   ++ 
Sbjct  459   KKSLADKGLTDETYTADSIALIRISGTSIHNNKTEQVDAVATSLNSSECFLLQSGSTMFT  518

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S  +++  A +V +FLK         VAI    + +   +S  FW     F   G
Sbjct  519   WHGNQSTFEQQQLAAKVAEFLKP-------GVAI---KHAKEGTESSAFW-----FPLGG  563

Query  822   RKVTSDDDIIPEKT-PPKL--FCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +   + PE    P L  F  + G+    +    S+ +L      +LD  +EVFVWV
Sbjct  564   KQSYTSKKVSPEIVRDPHLFTFSFNKGKFEVEEVYNFSQDDLLTEDILILDTHAEVFVWV  623

Query  990   GRATQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             G++    E+++A +  + ++     ++   PK   + ++ +G+E   F   F SW    A
Sbjct  624   GQSVDSKEKQSAFEFGQNYIDMATSLEGLSPKV-PLYKVTEGNEPC-FCTTFFSWDPTKA  681

Query  1155  T  1157
             T
Sbjct  682   T  682



>gb|EPS70251.1| hypothetical protein M569_04508 [Genlisea aurea]
Length=933

 Score =   516 bits (1330),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 250/364 (69%), Positives = 298/364 (82%), Gaps = 6/364 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ ++K+LEPAFQ  GQK G EIWRIENF+P+PLPK+DYGKFYSGDSY++LQT+ GKGG 
Sbjct  1     MASSIKSLEPAFQGVGQKVGTEIWRIENFQPLPLPKSDYGKFYSGDSYIILQTSPGKGGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             YL+DI+FWLGKDTSQDEA TAA+KTVELD ILG + VQHREIQ HES +FLSYFKPCIMP
Sbjct  61    YLYDIYFWLGKDTSQDEAETAAMKTVELDAILGCRAVQHREIQGHESYKFLSYFKPCIMP  120

Query  468   LEGGVASGFKKPEEEEFE----TRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKI  635
             LEGG A GFKK E  E E     RLYVC+GKR  R++QVPF+R SLNHDDVF+L TKDKI
Sbjct  121   LEGGAAPGFKKVEVVEEEEEFEMRLYVCRGKRAARLRQVPFSRSSLNHDDVFILHTKDKI  180

Query  636   YQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP  815
             YQFNGANSNIQERAKALEVIQFLKD +H GVC+VAIV+DGNLQAE  SGEFW LFGGFAP
Sbjct  181   YQFNGANSNIQERAKALEVIQFLKDKFHEGVCDVAIVDDGNLQAETASGEFWVLFGGFAP  240

Query  816   MGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGR  995
             + +KVTSDDDIIPE    +L+ I   +V  ++GEL+K+ LE +KCY++DCG+EVFVW GR
Sbjct  241   ISKKVTSDDDIIPETADAQLYRIVGDKVESIEGELAKALLEKNKCYVMDCGAEVFVWFGR  300

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA--TPPEE  1169
              TQ+DERK+A +T E+F+  Q +P++T +T L +G ET SFK +F+SWPS SA     E 
Sbjct  301   LTQVDERKSAIKTVEDFIASQNKPRSTLVTHLIEGFETHSFKSKFNSWPSTSAHSADAEG  360

Query  1170  GRGK  1181
             GRGK
Sbjct  361   GRGK  364


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 94/347 (27%), Positives = 161/347 (46%), Gaps = 34/347 (10%)
 Frame = +3

Query  171   EIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTA  350
             E+WRI+     P+P  D GKFYSGD Y++L T         + + +W+G D+ Q++  T 
Sbjct  401   EVWRIDGSSKTPVPHEDVGKFYSGDCYILLYTYHSSERKEDYYLCYWIGNDSIQEDRVTV  460

Query  351   AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET-R  527
             A     + + L G+ V  R  Q  E  +F+S F P ++ L+GG  SG+K+   +++ +  
Sbjct  461   AALANTMCSSLKGRPVLGRVCQEREPPQFVSIF-PAMVVLKGGNCSGYKQYIGDQYLSDE  519

Query  528   LYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERA  677
              Y   G  ++R+           QV     SLN ++ FVL T   ++ ++G     +++ 
Sbjct  520   TYTTDGVALIRLSSTSPQTERAVQVEAVATSLNSNECFVLQTPSLVFIWHGKKGTPEQQR  579

Query  678   KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPE  857
              A ++ +FLK         +   ++G      +S  FW   GG      K  S D +   
Sbjct  580   SATKIAEFLKPG-----SQIKHNKEGT-----ESSSFWFALGGKLTYTSKKVSLDIV---  626

Query  858   KTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAAC  1028
                P LF   + +      E+   S+ +L      +LD  +EVFVWVG++   +E+K + 
Sbjct  627   -RDPHLFLYSSIKGKFEFEEIYNFSQDDLLTEDIMILDTHAEVFVWVGQSVDAEEKKNSF  685

Query  1029  QTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             +  E+++    V    P    + ++ +G+E   F   F SW  A AT
Sbjct  686   EIGEKYVETAAVSDGLPYNVPLYKITEGNEPCFFTRYF-SWDPAKAT  731



>gb|EMS56739.1| Villin-2 [Triticum urartu]
Length=1066

 Score =   518 bits (1335),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 241/364 (66%), Positives = 300/364 (82%), Gaps = 25/364 (7%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
             GIEIWRIE+FKPV LPK+DYGKFYSGDSY+VLQTTS KGG YL+D+HFW+GKD+SQDEAG
Sbjct  53    GIEIWRIEDFKPVALPKSDYGKFYSGDSYIVLQTTSPKGGAYLYDVHFWIGKDSSQDEAG  112

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFET  524
             TAAIKTVELD++LGG+ VQ+RE+Q +ESD+FLSYFKPCI+P+EGG ASGFK PEEE FET
Sbjct  113   TAAIKTVELDSVLGGRAVQYRELQGYESDKFLSYFKPCIIPMEGGFASGFKTPEEETFET  172

Query  525   RLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFL  704
             RLY+CKGKR +R+KQVPFAR SLNHDDVF+LDT++KIYQFNGANSNIQERAK+LEVIQ L
Sbjct  173   RLYICKGKRAIRIKQVPFARSSLNHDDVFILDTENKIYQFNGANSNIQERAKSLEVIQHL  232

Query  705   KDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF--  878
             K+ YHGGVC+VAIV+DG LQAE+DSGEFW LFGGFAP+G+K  SDDD++ E T PKL+  
Sbjct  233   KEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKTVSDDDVVLETTAPKLYSP  292

Query  879   --------------------CIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRA  998
                                  I+ G++   D  L+K+ LEN++C+LLDCG+E+FVWVGR 
Sbjct  293   DHQLKAFKRPLGGGGAKVARSINGGELKFEDIPLTKAVLENTRCFLLDCGAEMFVWVGRV  352

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT---PPEE  1169
             TQL++RKAA +  EEF++ QKRPK T++T++ QG+E+ +FK +F+SWP+ +AT     E+
Sbjct  353   TQLEDRKAATKAVEEFIINQKRPKTTRVTQVIQGYESHAFKSKFESWPAGTATGNSGAED  412

Query  1170  GRGK  1181
             GRGK
Sbjct  413   GRGK  416


 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 112/234 (48%), Gaps = 47/234 (20%)
 Frame = +3

Query  135  PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
            P  +  G+   +E+W I+     PLPK D GKFYSGD Y+VL T         + +++W+
Sbjct  444  PLLEGGGR---LEVWCIDGNARSPLPKEDNGKFYSGDCYIVLYTYHSGDKKEEYYLNYWI  500

Query  315  GKDT---SQDEAGTAAIK-----------------TVELDTILG------------GKGV  398
            GK++   S+D+     +K                  ++ D ++G            G+ V
Sbjct  501  GKESTAISKDKLTLLVLKELTDLCLSHFYINMTHVLLKDDQVMGAELANTMWNSLKGRPV  560

Query  399  QHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK---  566
              R  Q  E  +F++ F+P ++ L+GG++SG+KK  EE+   +  Y  +G  ++R+    
Sbjct  561  LGRIYQGKEPPQFVALFQPMVI-LKGGISSGYKKITEEKGAASGTYSPEGIALLRVSGTA  619

Query  567  -------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLK  707
                    V     SL+  D FVL T   ++ ++G +S  +++  A +V +FLK
Sbjct  620  IHNNKTLHVDALATSLSSTDCFVLQTGSAMFTWHGNSSTYEQQQWAAKVAEFLK  673



>ref|XP_006851110.1| hypothetical protein AMTR_s00025p00248490 [Amborella trichopoda]
 gb|ERN12691.1| hypothetical protein AMTR_s00025p00248490 [Amborella trichopoda]
Length=934

 Score =   489 bits (1259),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/310 (73%), Positives = 268/310 (86%), Gaps = 1/310 (0%)
 Frame = +3

Query  255   VLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDR  434
             +LQTT+GKGG YL+DIHFWLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HESD+
Sbjct  23    LLQTTAGKGGAYLYDIHFWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQYRELQGHESDK  82

Query  435   FLSYFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFV  614
             FLSYFKPCI+PLEGGVASGFK PE+E+FETRLYVC+GKRVV++KQVPF+R SLNHDDVF+
Sbjct  83    FLSYFKPCIIPLEGGVASGFKTPEDEKFETRLYVCRGKRVVKLKQVPFSRSSLNHDDVFI  142

Query  615   LDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWE  794
             LDT++KIYQFNGANSNIQERAKALEVIQF KD YH G C+VA+++DG L AE+DSGEFW 
Sbjct  143   LDTENKIYQFNGANSNIQERAKALEVIQFFKDKYHEGTCDVAVIDDGKLVAESDSGEFWV  202

Query  795   LFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSE  974
             LFGGFAP+G+KV S+DD   E TP KL+ I +GQVN V+G LSKS LEN+KCYLLDCG+E
Sbjct  203   LFGGFAPIGKKVASEDDFTLETTPGKLYSITDGQVNAVEGALSKSLLENNKCYLLDCGAE  262

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VFVWVGR TQL++RK A Q AEEF+  Q  PK+T+ITR+ QG+E+ SFK  F+SWP  + 
Sbjct  263   VFVWVGRVTQLEDRKVASQAAEEFISGQNAPKSTRITRVIQGYESHSFKSNFESWPMGTG  322

Query  1155  TP-PEEGRGK  1181
             T   +EGRGK
Sbjct  323   TSGADEGRGK  332


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 171/359 (48%), Gaps = 39/359 (11%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+WRI       +PK + GKFYSGD YVVL T         + +  W 
Sbjct  359   PLLEGTGK---LEVWRINGNAKTLIPKEEIGKFYSGDCYVVLYTYHSGDKKEDYFLCCWF  415

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+ Q++  TAA     +   L G+ VQ R +Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  416   GKDSVQEDQLTAARLANTMTNSLKGRPVQGRIMQGKEPPQFIALFQPMVL-LKGGLSSGY  474

Query  495   KK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK   ++      Y      ++R+           QV     SL+  D F+L +   I+ 
Sbjct  475   KKFLSDKGLNDESYTSDSIALIRITGASAHNSKAVQVDAVGASLSSADCFLLQSGSTIFT  534

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             ++G  S ++++  A++V +FLK     GV  +   ++G      +   FW     FA  G
Sbjct  535   WHGNASTLEQQQLAVKVAEFLKP----GV-TLKHAKEGT-----EPAAFW-----FALGG  579

Query  822   RKVTSDDDIIPEKT-PPKL--FCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWV  989
             ++  +     PE T  P L  F  + G+    +    S+ +L      +LD  +E+FVWV
Sbjct  580   KQSYTTKKAPPEITRDPHLYTFSYNKGKFEVSEVFNFSQDDLLTEDMMILDTRAEIFVWV  639

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKATKIT----RLAQGHETISFKCEFDSWPSASA  1154
             G++    E++ A +  ++++      ++  +     ++ +G+E  SF   + SW  A A
Sbjct  640   GQSVDPKEKQKAFEIGQKYIDMAASLESLSVDVPLYKITEGNEP-SFFTTYFSWDPAKA  697



>ref|XP_006600494.1| PREDICTED: villin-4-like [Glycine max]
Length=960

 Score =   485 bits (1248),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS++++ L+PAF+ AGQKAG+EIWRIENF PVP+P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSISMRDLDPAFKGAGQKAGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDASLGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K++ FAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVHVKEITFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+++SGEFW  FGGFAP+ R+
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHDGKCEIASIEDGKLMADSESGEFWGCFGGFAPLPRR  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C+D G+  P++ + L+K  L+ +KCY+LDCG EVF W+GR T 
Sbjct  241   TVSDDDKPADSHPPKLLCVDKGKAEPIETDSLTKEFLDTNKCYILDCGLEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             LDERK+A   A+E +    RPK + I R+ +G ET+ FK +FDSWP AS  P  EEGRGK
Sbjct  301   LDERKSASVAADELIRGTGRPK-SHIIRVIEGFETVMFKSKFDSWPQASDAPMSEEGRGK  359


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/312 (26%), Positives = 138/312 (44%), Gaps = 38/312 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP  D  KFY+GD Y+   +  G+       I  W+GK + ++E  +
Sbjct  394   LQVWRVNGQEKILLPATDQSKFYNGDCYIFQYSYPGEDKEEHL-IGTWIGKTSVEEERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEE  515
             A   A K VE    L     Q R  +  E  +F +  + CI+  +GG++ G+K    E+E
Sbjct  453   ALSLASKMVESMKFLPS---QARIYEGSEPIQFHAILQSCIV-FKGGLSDGYKNYIAEKE  508

Query  516   FETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
                  Y   G  + R++          QV     SLN    ++L +   ++ ++G  +  
Sbjct  509   IPDETYNEDGVALFRIQGTGPDNMQAIQVEPVASSLNSTYCYILHSGPTVFIWSGGLATS  568

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDD  842
              ++     ++  +K            V+   L+   +S +FW+L GG      +K+T D 
Sbjct  569   DDQELVERMLDLIKPD----------VQCKPLKEGVESEQFWDLLGGKTEYPSQKITRDA  618

Query  843   DIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
             +       P LF  +  + N    E+   S+ +L     Y+LDC SEVFVWVG+      
Sbjct  619   E-----NDPHLFSCNFSEGNLKVKEIHNFSQDDLMTEDIYILDCHSEVFVWVGQQVDSKN  673

Query  1014  RKAACQTAEEFL  1049
             R  A    E+FL
Sbjct  674   RMQALTIGEKFL  685



>ref|XP_006593529.1| PREDICTED: villin-4-like isoform X1 [Glycine max]
 ref|XP_006593530.1| PREDICTED: villin-4-like isoform X2 [Glycine max]
 ref|XP_006593531.1| PREDICTED: villin-4-like isoform X3 [Glycine max]
 ref|XP_006593532.1| PREDICTED: villin-4-like isoform X4 [Glycine max]
 ref|XP_006593533.1| PREDICTED: villin-4-like isoform X5 [Glycine max]
 ref|XP_006593534.1| PREDICTED: villin-4-like isoform X6 [Glycine max]
 ref|XP_006593535.1| PREDICTED: villin-4-like isoform X7 [Glycine max]
 ref|XP_006593536.1| PREDICTED: villin-4-like isoform X8 [Glycine max]
Length=960

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAF+ AGQKAG+EIWRIENF PV +P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFKGAGQKAGLEIWRIENFNPVAIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K++ FAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVHVKEISFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+++SGEFW  FGGFAP+ R+
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIASIEDGKLMADSESGEFWGCFGGFAPLPRR  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C+D G+  P++ + L+K  L+ +KCY+LDCG EVF W+GR T 
Sbjct  241   TVSDDDKPADSHPPKLLCVDKGKAEPIESDSLTKELLDTNKCYILDCGLEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK+A   A+E +    RPK + I R+ +G ET+ FK +FDSWP AS AT  EEGRGK
Sbjct  301   LDERKSASGAADELISGTGRPK-SHIIRVIEGFETVMFKSKFDSWPQASHATMSEEGRGK  359


 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 81/313 (26%), Positives = 138/313 (44%), Gaps = 40/313 (13%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEAG  344
             +++WR+   + + LP  D  KFY+GD Y+   +  G+    YL  I  W+GK++ ++E  
Sbjct  394   LQVWRVNGPEKILLPATDQSKFYNGDCYIFQYSYPGEDKEEYL--IGTWVGKNSVEEERA  451

Query  345   TA---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEE  512
             +A   A K VE    L     Q R  +  E  +F +  + CI+  +GG + G+K    E+
Sbjct  452   SALSLASKMVESMKFLPS---QARIYEGSEPIQFHAILQSCIV-FKGGRSDGYKNYIAEK  507

Query  513   EFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSN  662
             E     Y   G  + R++          QV     SLN    F+L +   ++ ++G  + 
Sbjct  508   EIPDETYNEDGVALFRIQGTGPDNMQAIQVEPVASSLNSAYCFILHSGPTVFIWSGGLAT  567

Query  663   IQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSD  839
               ++     ++  +K            V+   L+   +  +FW+L GG      +K+T +
Sbjct  568   SDDQELVERMLDLIKPD----------VQCKPLKEGLEPEQFWDLLGGKTEYPSQKITRE  617

Query  840   DDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLD  1010
              +       P LF  +  + N    E+   S+ +L     Y LDC SE+FVWVG+     
Sbjct  618   AE-----NDPHLFSCNFSEGNLKVKEIHNFSQDDLMTEDIYTLDCHSEIFVWVGQQVDSK  672

Query  1011  ERKAACQTAEEFL  1049
              R  A    E+FL
Sbjct  673   SRMQALTIGEKFL  685



>ref|XP_007154736.1| hypothetical protein PHAVU_003G143200g [Phaseolus vulgaris]
 gb|ESW26730.1| hypothetical protein PHAVU_003G143200g [Phaseolus vulgaris]
Length=958

 Score =   483 bits (1243),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/359 (61%), Positives = 282/359 (79%), Gaps = 2/359 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAF+ AGQKAG+EIWRIENF PVP+P++ YGKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFKGAGQKAGLEIWRIENFNPVPIPQSSYGKFFTGDSYMILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
               +DIH+WLGK TSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRYDIHYWLGKKTSQDEAGVAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGV+SGFK  E EE   RL+VCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGVSSGFKHVEAEEHTIRLFVCKGKHVVHVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS IQERAKALEV+QF+KDTYH G C +A +EDG L +++++GEFW  FGGFAP+ RK
Sbjct  181   GSNSCIQERAKALEVVQFIKDTYHDGKCEIASIEDGKLMSDSETGEFWGCFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C+D G+  PV+ + L+K  LE +KCY++DCG EVF W+GR T 
Sbjct  241   TVSDDDKSADSHPPKLLCVDKGKTEPVETDSLTKEMLETNKCYIIDCGLEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPEEGRGK  1181
             LDERK+A   AE+ +    RPK + I R+ +G ET+ FK +FDSWP  +    EEGRGK
Sbjct  301   LDERKSASGAAEKLVSGAGRPK-SHIIRVIEGFETVMFKSKFDSWPQTTQVMSEEGRGK  358


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 158/357 (44%), Gaps = 53/357 (15%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+     + LP  D  KFY+GD Y+   +  G+       I  W+GK + ++E  +
Sbjct  393   LQVWRVNGKDKILLPATDQSKFYNGDCYIFQYSYPGEDKEEHL-IGTWIGKASVEEERAS  451

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEE  515
             A   A K VE    L       R  +  E  +F +  + CI+  +GG++ G+K    E+E
Sbjct  452   ALSLASKMVESMKFLPS---LVRIYEGSEPIQFHAILQSCIV-FKGGLSDGYKNYIAEKE  507

Query  516   FETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANS  659
                  Y   G  + R++          QV     SLN    ++L +   ++ ++G  A S
Sbjct  508   IPDATYSEDGVALFRIQGFGPDNMQAIQVEPVASSLNSTYCYILHSGSTVFTWSGGLATS  567

Query  660   NIQERA-KALEVIQ--FLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRK  827
             + QE   + L++I+      ++  GV               +S  FW+L GG +   G+K
Sbjct  568   DDQELLDRMLDLIKPDLQSKSHKEGV---------------ESELFWDLLGGKSEYPGQK  612

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRA  998
             +  D     E++ P L   D  + N    E+   S+ +L     Y+LDC SE+FVW+G+ 
Sbjct  613   IARD-----EESDPHLVSCDFSKGNLKVKEIYNFSQDDLMTEDIYILDCHSEIFVWLGQQ  667

Query  999   TQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
                  R  A    E+FL    + +K  +   I  + +G+E   F   F  W SA +T
Sbjct  668   VDAKGRMQALTIGEKFLEHDFLLEKLSREAPIYVVKEGNEP-PFFTRFFKWESAKST  723



>ref|XP_003610075.1| Villin-4 [Medicago truncatula]
Length=958

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 286/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M ++V+ L+PA + AGQK G+EIWRIENF PVP+P++ +GKF++GDSYV+L+TT+ K G 
Sbjct  1     MGISVRDLDPALKGAGQKDGLEIWRIENFNPVPIPQSSHGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD +LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAVLGGRAVQYREVQGHETQKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVYVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+++SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVASIEDGRLMADSESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C++ G+  P + + L+K  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TVSDDDKTIDSHPPKLLCVEKGKAEPFETDSLTKELLDTNKCYILDCGLEVFVWIGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A  + +E +    RPK ++I R+ +G ET+ F+ +FDSWP + +A  PE+GRGK
Sbjct  301   LDERKSASGSTDELVSSTNRPK-SQIIRVMEGFETVMFRSKFDSWPQTTNAAMPEDGRGK  359


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 134/311 (43%), Gaps = 36/311 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L   D  KFYSGD Y+   +  G+       I  W+GK++ +DE  +
Sbjct  394   LQVWRVNGQEKNLLAATDQSKFYSGDCYIFQYSYPGEDREEHL-IGTWIGKNSVEDERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEE  515
                 A K VE    +       R  +  E+ +F S  +  I+  +GG++  +K    E E
Sbjct  453   CLSLASKMVESMKFIPSMA---RIYEGSETIQFYSILQSLIV-FKGGLSDAYKNYIAENE  508

Query  516   FETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
                  Y   G  + R++          QV  A  SLN    ++L ++  ++ + G  +N 
Sbjct  509   IPDETYKEDGVALFRIQGSGPESMQAIQVNSAASSLNSSYCYILQSESVVFTWYGNLTNS  568

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDD  845
              ++  A  ++  +K       C          +  A++ +FWEL G    +  + +S   
Sbjct  569   DDQELAERMLDLIKPDLQ---CRPQ-------KEGAETEQFWELLG----VKTEYSSQKI  614

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
             +   +  P LF  +  + N    E+   S+ +L     ++LDC S++FVWVG+      R
Sbjct  615   VREAENDPHLFSCNFSEGNLKVIEIHNFSQDDLMTEDIFILDCHSQIFVWVGQQVDPKRR  674

Query  1017  KAACQTAEEFL  1049
               A    E+FL
Sbjct  675   VQALPIGEKFL  685



>ref|XP_011069945.1| PREDICTED: villin-4-like [Sesamum indicum]
Length=958

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 225/360 (63%), Positives = 287/360 (80%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+ + LEPAFQ AGQKAGIEIWRIENF+PV +PK  +GKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSARNLEPAFQGAGQKAGIEIWRIENFQPVAVPKDLHGKFFTGDSYVILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD +LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAVLGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE +TRLYVCKGK V+ +K+V FAR SLNHDDVF+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAEAEEHQTRLYVCKGKHVIHVKEVTFARSSLNHDDVFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A VEDG L AEA++GEFW  FGGFAP+ +K
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIAAVEDGRLMAEAETGEFWVFFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+ +  +    KLFC++ G+  PV+ + L++  L+ SKCY+LDCG EVFVW+G+ T 
Sbjct  241   TNTDEPMSADLISSKLFCVEKGEAVPVEADSLTRELLDTSKCYILDCGMEVFVWMGKNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDE+KAA +TA+E L    R   + + R+ +G+ET+ F+ +FDSWP S S T  EEGRG+
Sbjct  301   LDEKKAASRTADELLRGPDR-STSHVIRVMEGYETVMFRSKFDSWPQSTSVTGSEEGRGR  359


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 84/337 (25%), Positives = 146/337 (43%), Gaps = 45/337 (13%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQ-------KAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTS  272
             VNVK L       G+          +++WR++  +   L  +D  KFYSGD Y+   + S
Sbjct  369   VNVKGLVKTESPKGEPELHIDCTGDLQVWRVDGQEKTLLEASDQSKFYSGDCYIFQYSYS  428

Query  273   G-KGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYF  449
             G +   YL  I  W GK + +++   A+    ++   +     Q R  Q HE   F + F
Sbjct  429   GEQKEEYL--IGTWFGKQSVEEDRVAASGHASKMVEAMKFIPTQARIYQDHEPVMFFAIF  486

Query  450   KPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLN  596
             +  I+  +GG++ G+K    E+E     Y   G  + R++          QV     SLN
Sbjct  487   QSSIV-FKGGLSKGYKNYIAEKELPDDTYSEDGLALFRVQGSGPENMQSIQVEPVASSLN  545

Query  597   HDDVFVLDTKDKIYQFNG--ANSNIQERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
                 ++L +   I+ ++G    S+ QE A + L+VI+          C V        + 
Sbjct  546   SSYCYILHSGSSIFTWSGNLTTSDDQELAERQLDVIK------PNMQCRVH-------KE  592

Query  768   EADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GELSKSNLE  938
              ++S +FWEL G       +K+      + E  P    C +  G +   +    S+ +L 
Sbjct  593   GSESDQFWELLGEKTEYPSQKIAR----VAESDPHLFSCTLSKGDLKATEVYNFSQDDLM  648

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL  1049
                 ++LDC S+++VWVG+  +   +  A    E+F+
Sbjct  649   TEDIFILDCRSDIYVWVGQQVESKNKMNALSLGEKFM  685



>gb|AES92272.2| actin filament bundling protein P-115-ABP [Medicago truncatula]
Length=960

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 286/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M ++V+ L+PA + AGQK G+EIWRIENF PVP+P++ +GKF++GDSYV+L+TT+ K G 
Sbjct  1     MGISVRDLDPALKGAGQKDGLEIWRIENFNPVPIPQSSHGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD +LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAVLGGRAVQYREVQGHETQKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVYVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+++SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVASIEDGRLMADSESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C++ G+  P + + L+K  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TVSDDDKTIDSHPPKLLCVEKGKAEPFETDSLTKELLDTNKCYILDCGLEVFVWIGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A  + +E +    RPK ++I R+ +G ET+ F+ +FDSWP + +A  PE+GRGK
Sbjct  301   LDERKSASGSTDELVSSTNRPK-SQIIRVMEGFETVMFRSKFDSWPQTTNAAMPEDGRGK  359


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 74/313 (24%), Positives = 132/313 (42%), Gaps = 38/313 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L   D  KFYSGD Y+   +  G+       I  W+GK++ +DE  +
Sbjct  394   LQVWRVNGQEKNLLAATDQSKFYSGDCYIFQYSYPGEDREEHL-IGTWIGKNSVEDERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEE  515
                 A K VE    +       R  +  E+ +F S  +  I+  +GG++  +K    E E
Sbjct  453   CLSLASKMVESMKFIPSMA---RIYEGSETIQFYSILQSLIV-FKGGLSDAYKNYIAENE  508

Query  516   FETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
                  Y   G  + R++          QV  A  SLN    ++L ++  ++ + G  +N 
Sbjct  509   IPDETYKEDGVALFRIQGSGPESMQAIQVNSAASSLNSSYCYILQSESVVFTWYGNLTNS  568

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDD  845
              ++  A  ++  +K       C          +  A++ +FWEL G    +  + +S   
Sbjct  569   DDQELAERMLDLIKPDLQ---CRPQ-------KEGAETEQFWELLG----VKTEYSSQKI  614

Query  846   IIPEKTPPKLFCIDNGQVNPV-----DGELSKSNLENSKCYLLDCGSEVFVWVGRATQLD  1010
             +   +  P LF  +  + N           S+ +L     ++LDC S++FVWVG+     
Sbjct  615   VREAENDPHLFSCNFSEGNVYLQVIEIHNFSQDDLMTEDIFILDCHSQIFVWVGQQVDPK  674

Query  1011  ERKAACQTAEEFL  1049
              R  A    E+FL
Sbjct  675   RRVQALPIGEKFL  687



>ref|XP_004507882.1| PREDICTED: villin-4-like isoform X3 [Cicer arietinum]
Length=955

 Score =   479 bits (1232),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 218/360 (61%), Positives = 286/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M V+++ L+PA + AGQK G+EIWRIENF PVP+P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MGVSMRDLDPALKGAGQKDGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAG AAIKTVELD +LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGVAAIKTVELDAVLGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K+VPFAR +LNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVNVKEVPFARSTLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+++SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVASIEDGKLMADSESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD      PPKL C+++G+  P++ + L+K  L+ +KCY+LDCG EVFVW GR T 
Sbjct  241   TVSDDDKPVASHPPKLLCVEDGKEKPIETDSLTKELLDTNKCYILDCGLEVFVWTGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A   ++E +    RPK ++I R+ +G ET+ F+ +FDSWP + + T  E+GRGK
Sbjct  301   LDERKSASGASDELVRSTNRPK-SQIIRVIEGFETVMFRSKFDSWPQTTNVTMSEDGRGK  359


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 77/311 (25%), Positives = 133/311 (43%), Gaps = 36/311 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L   D  KFYSGD Y+   +  G+       I  W+GK++ + E  +
Sbjct  394   LQVWRVNGQEKNLLAATDQSKFYSGDCYIFQYSYPGEDREEHL-IGTWIGKNSVEGERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK------  500
             A   A K VE    L       R  +  E  +F S  +  I+  +GG++  +K       
Sbjct  453   ALTLARKMVESMKFLPSMA---RIYEGSEPIQFHSILQSFIV-YKGGLSDAYKNYTAEKE  508

Query  501   -PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
              P+E   E    L+  +G     M+  QV     SLN    ++L ++  ++ ++G  +  
Sbjct  509   IPDETYSENSVALFRIQGSGPENMQAIQVDSIASSLNSSHCYILHSESTVFTWSGNLTTS  568

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDD  845
              ++     ++  +K       C          +  A+S +FWEL GG +    +  + D 
Sbjct  569   DDQELVERMLDLIKPDLQ---CKPQ-------REGAESEQFWELLGGKSEYPTQKIARDG  618

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                 +  P LF  +  + N    E+   S+ +L     ++LDC SE+FVWVG+      R
Sbjct  619   ----ENDPHLFSCNFSEGNLKVTEIHNFSQDDLMTEDIFVLDCHSEIFVWVGQQVDPKSR  674

Query  1017  KAACQTAEEFL  1049
               A    E+FL
Sbjct  675   MQALPIGEKFL  685



>ref|XP_004507880.1| PREDICTED: villin-4-like isoform X1 [Cicer arietinum]
 ref|XP_004507881.1| PREDICTED: villin-4-like isoform X2 [Cicer arietinum]
Length=958

 Score =   479 bits (1232),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 218/360 (61%), Positives = 286/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M V+++ L+PA + AGQK G+EIWRIENF PVP+P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MGVSMRDLDPALKGAGQKDGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAG AAIKTVELD +LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGVAAIKTVELDAVLGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK VV +K+VPFAR +LNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHVVNVKEVPFARSTLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+++SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVASIEDGKLMADSESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD      PPKL C+++G+  P++ + L+K  L+ +KCY+LDCG EVFVW GR T 
Sbjct  241   TVSDDDKPVASHPPKLLCVEDGKEKPIETDSLTKELLDTNKCYILDCGLEVFVWTGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A   ++E +    RPK ++I R+ +G ET+ F+ +FDSWP + + T  E+GRGK
Sbjct  301   LDERKSASGASDELVRSTNRPK-SQIIRVIEGFETVMFRSKFDSWPQTTNVTMSEDGRGK  359


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 77/311 (25%), Positives = 133/311 (43%), Gaps = 36/311 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L   D  KFYSGD Y+   +  G+       I  W+GK++ + E  +
Sbjct  394   LQVWRVNGQEKNLLAATDQSKFYSGDCYIFQYSYPGEDREEHL-IGTWIGKNSVEGERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK------  500
             A   A K VE    L       R  +  E  +F S  +  I+  +GG++  +K       
Sbjct  453   ALTLARKMVESMKFLPSMA---RIYEGSEPIQFHSILQSFIV-YKGGLSDAYKNYTAEKE  508

Query  501   -PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
              P+E   E    L+  +G     M+  QV     SLN    ++L ++  ++ ++G  +  
Sbjct  509   IPDETYSENSVALFRIQGSGPENMQAIQVDSIASSLNSSHCYILHSESTVFTWSGNLTTS  568

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDD  845
              ++     ++  +K       C          +  A+S +FWEL GG +    +  + D 
Sbjct  569   DDQELVERMLDLIKPDLQ---CKPQ-------REGAESEQFWELLGGKSEYPTQKIARDG  618

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                 +  P LF  +  + N    E+   S+ +L     ++LDC SE+FVWVG+      R
Sbjct  619   ----ENDPHLFSCNFSEGNLKVTEIHNFSQDDLMTEDIFVLDCHSEIFVWVGQQVDPKSR  674

Query  1017  KAACQTAEEFL  1049
               A    E+FL
Sbjct  675   MQALPIGEKFL  685



>gb|EMT05627.1| Villin-2 [Aegilops tauschii]
Length=646

 Score =   468 bits (1205),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 273/315 (87%), Gaps = 3/315 (1%)
 Frame = +3

Query  246   SYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHE  425
             S+ + +TTS KGG YL+D+HFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQ+RE+Q +E
Sbjct  104   SWGLERTTSPKGGAYLYDVHFWIGKDSSQDEAGTAAIKTVELDSVLGGRAVQYRELQGYE  163

Query  426   SDRFLSYFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDD  605
             SD+FLSYFKPCI+P+EGG ASGFK PEEE FETRLY+CKGKR +R+KQVPFAR SLNHDD
Sbjct  164   SDKFLSYFKPCIIPMEGGFASGFKTPEEETFETRLYICKGKRAIRIKQVPFARSSLNHDD  223

Query  606   VFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGE  785
             VF+LDT++KIYQFNGANSNIQERAK+LEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGE
Sbjct  224   VFILDTENKIYQFNGANSNIQERAKSLEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGE  283

Query  786   FWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDC  965
             FW LFGGFAP+G+K  SDDD++ E T PKL+ I++G++   D  L+K+ LEN++C+LLDC
Sbjct  284   FWVLFGGFAPIGKKTVSDDDVVLETTAPKLYSINDGELKFEDIPLTKAVLENTRCFLLDC  343

Query  966   GSEVFVWVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS  1145
             G+E+FVWVGR TQL++RKAA +  EEF++ QKRPK T++T++ QG+E+ +FK +F+SWP+
Sbjct  344   GAEMFVWVGRVTQLEDRKAATKAVEEFIINQKRPKTTRVTQVIQGYESHAFKSKFESWPA  403

Query  1146  ASAT---PPEEGRGK  1181
              +AT     E+GRGK
Sbjct  404   GTATGNSGAEDGRGK  418


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 103/202 (51%), Gaps = 15/202 (7%)
 Frame = +3

Query  135  PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
            P  +  G+   +E+W I+     PLPK D GKFYSGD Y+VL T         + +++W+
Sbjct  446  PLLEGGGR---LEVWCIDGNTRSPLPKEDNGKFYSGDCYIVLYTYHSGDKKEEYYLNYWI  502

Query  315  GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
            GK+++ D+    A     +   L G+ V  R  Q  E  +F++ F+P ++ L+GG++SG+
Sbjct  503  GKESTADDQVMGAELANTMWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGISSGY  561

Query  495  KKPEEEEFETR---------LYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQ  641
            KK  EE+             L+   G  +   K   V     SL+  D FVL T   ++ 
Sbjct  562  KKITEEKGAASGSYSPDGIALFRVSGTAIHNNKTLHVDALATSLSSTDCFVLQTGSAMFT  621

Query  642  FNGANSNIQERAKALEVIQFLK  707
            ++G +S  +++  A +V +FLK
Sbjct  622  WHGNSSTYEQQQWAAKVAEFLK  643



>ref|XP_004163020.1| PREDICTED: LOW QUALITY PROTEIN: villin-4-like [Cucumis sativus]
Length=968

 Score =   478 bits (1229),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK  YGKF++GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKPSYGKFFTGDSYIVLKTTSLKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLG+DT+QDEAGTAAIKT+ELD  LGG+ VQ+RE+Q HE+++FLS FKPCI+P
Sbjct  61    LRHDIHYWLGRDTTQDEAGTAAIKTIELDAALGGRAVQYREVQGHETEKFLSCFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGKRVV +K+VPF+R SLNHDD+FVLDTK KI+QFN
Sbjct  121   QEGGFASGFKHAEAEEHKTRLFVCKGKRVVHVKEVPFSRSSLNHDDIFVLDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+ ++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEIAAIEDGKLMADPETGEFWXLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TSD+D   +  P KLF I+ GQ+ P  DG L++  LE +KCY+LDCG EVF W+GR T 
Sbjct  241   TTSDEDRPVDSHPTKLFRIEKGQLEPHGDGSLTRDLLETNKCYILDCGFEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AE+ +    RPK ++IT + +G ET +F+ +FDSWP  A+    E+GRGK
Sbjct  301   LDDRKKATAAAEQLVHGPDRPK-SQITFVIEGFETATFRSKFDSWPQVANVVVSEDGRGK  359


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 147/337 (44%), Gaps = 45/337 (13%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + +P +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVSGNEKILIPASDQSKFYSGDCYIFQY  425

Query  264   TTSGKG-GPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             + SG     YL  I  W GK + ++E  +A     ++   L    VQ R  +  E  +F 
Sbjct  426   SYSGDDKDEYL--IGTWFGKQSVEEERASALSLVNKMVESLKFLPVQARIYEGSEPIQFY  483

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  ++  +GG++ G+K    E+E +   Y   G  + R++          QV     
Sbjct  484   SIFQSFVV-FKGGLSKGYKNYVAEKEIQDETYQEDGVALFRVQGSGPENMQAIQVDPVAS  542

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L++   ++ ++G+ +N   +     ++  +K            V+  + + 
Sbjct  543   SLNSSYCYILNSSSSVFTWSGSLTNSDNQELVERLLDLIKPN----------VQSRSQKE  592

Query  768   EADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLE  938
              ++S +FW L GG +    +  S D     ++ P LF      G +  V+     + +L 
Sbjct  593   GSESEQFWNLLGGKSEYPSQKISRD----AESDPHLFSCTFSRGNLKVVEVHNFDQDDLM  648

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL  1049
                 Y+LD  SE++VW+G+      R  A    E+FL
Sbjct  649   TEDIYILDNHSEIYVWIGQQVDAKSRLHALTIGEKFL  685



>ref|XP_009345234.1| PREDICTED: villin-4-like, partial [Pyrus x bretschneideri]
Length=728

 Score =   470 bits (1209),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQK G+EIWRIENF+P P+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKDGLEIWRIENFRPAPIPKSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                +IH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHEIHYWLGKDTSQDEAGAAAIKTVELDATLGGRAVQYREVQGHETAKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE +TRL+VC+GK VV +K+V FAR SL+HDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAEAEEHKTRLFVCQGKHVVHVKEVAFARSSLSHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KD YH G C +A +EDG L A+A+SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDAYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D   +  P KL C++ GQ  PV+G+ L++  L+ +KCYLLDCG EVFVW+GR T 
Sbjct  241   TATNEDKSFDSYPTKLLCVEKGQAEPVEGDALTRDLLDTNKCYLLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+R++A   AEE +    R K + I R+ +G ET+ F+ +FDSWP +A     E+GRGK
Sbjct  301   LDQRRSASGAAEELVRPPDRSK-SHIIRVIEGFETVMFRSKFDSWPQTADVAVSEDGRGK  359


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 96/382 (25%), Positives = 161/382 (42%), Gaps = 60/382 (16%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + L  +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTGN---LQVWRVNGQEKINLQSSDQSKFYSGDCYIFHY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
                G+       I  W GK + +DE  +A   A K VE    L     Q R  + +E  +
Sbjct  426   AYPGEDKEEHL-IGTWFGKQSVEDERVSAISLASKMVESMKFLAA---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFA  581
             F S F+  I+ L+GG++ G+K    E+E     Y   G  + R++          QV   
Sbjct  482   FHSIFQSIIV-LKGGLSDGYKNYVAEKEVPDETYQEDGVALFRVQGSGPDNMQAIQVDAV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L +   ++ ++G  +   +       +  +K                 +
Sbjct  541   ASSLNSSYCYILHSGSTVFTWSGGLTTSDDHELVERQLDLIKPDLQS-----------KM  589

Query  762   QAE-ADSGEFWELFGGFA--PMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELS  923
             Q E ++S +FWEL GG    P  + V S +      + P+LF     NG +  V+    +
Sbjct  590   QKENSESEQFWELLGGKTEYPSQKIVRSGE------SDPRLFSCTFSNGNLKVVEIYNFT  643

Query  924   KSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRL  1091
             + +L     ++LDC  ++FVWVG+     +R  A    E+FL      ++  +   I  +
Sbjct  644   QDDLMTEDIFILDCHVDIFVWVGQQVNFKDRMQALTIGEKFLEHDFFMEQLSREASIYII  703

Query  1092  AQGHETISFKCEFDSWPSASAT  1157
              +G E   F   F +W SA ++
Sbjct  704   MEGSEP-PFFTRFFTWDSAKSS  724



>gb|KGN61158.1| hypothetical protein Csa_2G060390 [Cucumis sativus]
Length=974

 Score =   477 bits (1227),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK  YGKF++GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKPSYGKFFTGDSYIVLKTTSLKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLG+DT+QDEAGTAAIKT+ELD  LGG+ VQ+RE+Q HE+++FLS FKPCI+P
Sbjct  61    LRHDIHYWLGRDTTQDEAGTAAIKTIELDAALGGRAVQYREVQGHETEKFLSCFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGKRVV +K+VPF+R SLNHDD+FVLDTK KI+QFN
Sbjct  121   QEGGFASGFKHAEAEEHKTRLFVCKGKRVVHVKEVPFSRSSLNHDDIFVLDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEIAAIEDGKLMADPETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TSD+D   +  P KLF I+ GQ+ P  DG L++  LE +KCY+LDCG EVF W+GR T 
Sbjct  241   TTSDEDRPVDSHPTKLFRIEKGQLEPHGDGSLTRDLLETNKCYILDCGFEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AE+ +    RPK ++IT + +G ET +F+ +FDSWP  A+    E+GRGK
Sbjct  301   LDDRKKATAAAEQLVHGPDRPK-SQITFVIEGFETATFRSKFDSWPQVANVVVSEDGRGK  359


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 147/337 (44%), Gaps = 45/337 (13%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + +P +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVSGNEKILIPASDQSKFYSGDCYIFQY  425

Query  264   TTSGKG-GPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             + SG     YL  I  W GK + ++E  +A     ++   L    VQ R  +  E  +F 
Sbjct  426   SYSGDDKDEYL--IGTWFGKQSVEEERASALSLVNKMVESLKFLPVQARIYEGSEPIQFY  483

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  ++  +GG++ G+K    E+E +   Y   G  + R++          QV     
Sbjct  484   SIFQSFVV-FKGGLSKGYKNYVAEKEIQDETYQEDGVALFRVQGSGPENMQAIQVDPVAS  542

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L++   ++ ++G+ +N   +     ++  +K            V+  + + 
Sbjct  543   SLNSSYCYILNSSSSVFTWSGSLTNSDNQELVERLLDLIKPN----------VQSRSQKE  592

Query  768   EADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLE  938
              ++S +FW L GG +    +  S D     ++ P LF      G +  V+     + +L 
Sbjct  593   GSESEQFWNLLGGKSEYPSQKISRD----AESDPHLFSCTFSRGNLKVVEVHNFDQDDLM  648

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL  1049
                 Y+LD  SE++VW+G+      R  A    E+FL
Sbjct  649   TEDIYILDNHSEIYVWIGQQVDAKSRLHALTIGEKFL  685



>ref|XP_008460295.1| PREDICTED: villin-4-like [Cucumis melo]
Length=915

 Score =   475 bits (1222),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKSSYGKFFTGDSYIVLKTTSLKSGT  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLG+DT+QDEAG AAIKT+ELD  LGG+ VQ+RE+Q HE+++FLS FKPCI+P
Sbjct  61    LRHDIHYWLGRDTTQDEAGAAAIKTIELDAALGGRAVQYREVQGHETEKFLSCFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGKRVV +K+VPF+R SLNHDD+FVLDTK KI+QFN
Sbjct  121   QEGGFASGFKHAEAEEHKTRLFVCKGKRVVHVKEVPFSRSSLNHDDIFVLDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEIAAIEDGKLMADPETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TSD+D   +  P KLF I+ GQ+ P  DG L++  LE +KCY+LDCG EVF W+GR T 
Sbjct  241   TTSDEDRPVDSHPTKLFRIEKGQLEPHGDGSLTRDLLETNKCYILDCGFEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AE+ +    RPK ++IT + +G ET +F+ +FDSWP  A+    E+GRGK
Sbjct  301   LDDRKKATAAAEQLVHGPDRPK-SQITCVIEGFETATFRSKFDSWPQIANVVVSEDGRGK  359


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +3

Query  114  VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
            VNVK L          +P     G    +++WR+   + + +P +D  KFYSGD Y+   
Sbjct  369  VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVSGNEKILIPASDQSKFYSGDCYIFQY  425

Query  264  TTSGKG-GPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
            + SG     YL  I  W GK + ++E  +A     ++   L    VQ R  + +E  +F 
Sbjct  426  SYSGDDKDEYL--IGTWFGKQSVEEERASALSLVNKMVESLKFLPVQARIYEGNEPIQFY  483

Query  441  SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK  566
            S F+  ++  +GG++ G+K    E+E +   Y   G  + R++
Sbjct  484  SIFQSFVV-FKGGLSKGYKNYIAEKEIQDETYQDDGVALFRVQ  525



>ref|XP_008801549.1| PREDICTED: villin-4-like [Phoenix dactylifera]
Length=959

 Score =   476 bits (1225),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 223/362 (62%), Positives = 287/362 (79%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF PV +PK+ +GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRELDPAFQGAGQKAGIEIWRIENFHPVAVPKSSHGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQAHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              +GGV SGF+  E  E E ETRLYVCKGK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QQGGVVSGFRHSEVNEHEHETRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAEAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RK  S+D    E    +L C++NGQ  P+D + L++  L+ +KCYLLDCG EV+VW+GR 
Sbjct  241   RKGASEDVKSAEVFSARLLCVENGQPVPIDADSLTREMLQTNKCYLLDCGIEVYVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK+A   AE+ + +  RP A  + R+ +G ET+ F+ +FD+WP +A+ T  E+GR
Sbjct  301   TSLEERKSASTAAEDLIREPDRPNA-HVIRVIEGFETVMFRSKFDTWPQTANVTVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 96/376 (26%), Positives = 165/376 (44%), Gaps = 49/376 (13%)
 Frame = +3

Query  114   VNVKAL---EPAFQAAGQ-----KAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTT  269
             +NVK L   +P   A  Q        +++WR+   + + L  +D  KFYSGD Y+   + 
Sbjct  371   LNVKGLMKTDPVKDAEPQPYIDCTGNLQVWRVNGQEKIALSSSDQSKFYSGDCYIFQYSY  430

Query  270   SGKGG-PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSY  446
              G+    YL  +  W GK + ++E  TA     ++   L  + VQ R  +  E  +FLS 
Sbjct  431   PGEDREEYL--VGTWFGKKSIKEERATAISLAKKMVESLKSQAVQARVYEGREPIQFLSI  488

Query  447   FKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSL  593
             F+  I+  +GGV+SG+K    E       Y   G  + R++          QV     SL
Sbjct  489   FQSFIV-YKGGVSSGYKNFIAENAIADETYSEDGLALFRVQGSGPDNMQAIQVDPVASSL  547

Query  594   NHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-  770
             N    ++L +   ++ ++G+ +  +++  A   +  +K                 LQ E 
Sbjct  548   NSSYCYILHSGSTVFTWSGSLTTSEDQELAERQLDEIKPNVQ-----------SKLQKEG  596

Query  771   ADSGEFWELFGGFAP-MGRKVTSDDDIIPEKTPPKLFCID--NGQVNPVD-GELSKSNLE  938
              ++ +FW+L GG +  + +KV  +    PE   P LF  D   G +   +    ++ +L 
Sbjct  597   TETEQFWDLLGGRSEYISQKVGKE----PEND-PHLFSCDFLKGDLKITEIYNFTQDDLM  651

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHE  1106
                 ++LDC S +FVWVG+      +  A    E+FL    + +K  + T I  + +  E
Sbjct  652   TEDIFILDCHSNIFVWVGQQVDSKSKLHALSIGEKFLEHDYLFEKLSQETPIFVVMEESE  711

Query  1107  TISFKCEFDSWPSASA  1154
                F   F +W SA +
Sbjct  712   P-PFFTRFFTWDSAKS  726



>ref|XP_004148322.1| PREDICTED: villin-4-like [Cucumis sativus]
Length=968

 Score =   476 bits (1226),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK  YGKF++GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKPSYGKFFTGDSYIVLKTTSLKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLG+DT+QDEAGTAAIKT+ELD  LGG+ VQ+RE+Q HE+++FLS FKPCI+P
Sbjct  61    LRHDIHYWLGRDTTQDEAGTAAIKTIELDAALGGRAVQYREVQGHETEKFLSCFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGKRVV +K+VPF+R SLNHDD+FVLDTK KI+QFN
Sbjct  121   QEGGFASGFKHAEAEEHKTRLFVCKGKRVVHVKEVPFSRSSLNHDDIFVLDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEIAAIEDGKLMADPETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TSD+D   +  P KLF I+ GQ+ P  DG L++  LE +KCY+LDCG EVF W+GR T 
Sbjct  241   TTSDEDRPVDSHPTKLFRIEKGQLEPHGDGSLTRDLLETNKCYILDCGFEVFAWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AE+ +    RPK ++IT + +G ET +F+ +FDSWP  A+    E+GRGK
Sbjct  301   LDDRKKATAAAEQLVHGPDRPK-SQITFVIEGFETATFRSKFDSWPQVANVVVSEDGRGK  359


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 147/337 (44%), Gaps = 45/337 (13%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + +P +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVSGNEKILIPASDQSKFYSGDCYIFQY  425

Query  264   TTSGKG-GPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             + SG     YL  I  W GK + ++E  +A     ++   L    VQ R  +  E  +F 
Sbjct  426   SYSGDDKDEYL--IGTWFGKQSVEEERASALSLVNKMVESLKFLPVQARIYEGSEPIQFY  483

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  ++  +GG++ G+K    E+E +   Y   G  + R++          QV     
Sbjct  484   SIFQSFVV-FKGGLSKGYKNYVAEKEIQDETYQEDGVALFRVQGSGPENMQAIQVDPVAS  542

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L++   ++ ++G+ +N   +     ++  +K            V+  + + 
Sbjct  543   SLNSSYCYILNSSSSVFTWSGSLTNSDNQELVERLLDLIKPN----------VQSRSQKE  592

Query  768   EADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLE  938
              ++S +FW L GG +    +  S D     ++ P LF      G +  V+     + +L 
Sbjct  593   GSESEQFWNLLGGKSEYPSQKISRD----AESDPHLFSCTFSRGNLKVVEVHNFDQDDLM  648

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL  1049
                 Y+LD  SE++VW+G+      R  A    E+FL
Sbjct  649   TEDIYILDNHSEIYVWIGQQVDAKSRLHALTIGEKFL  685



>ref|XP_010265407.1| PREDICTED: villin-4-like isoform X2 [Nelumbo nucifera]
Length=960

 Score =   476 bits (1225),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGMEIWRIENFHPVPVPKSSYGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLG DT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGTDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              +GGV+SGFK  E E+ +TRLYVCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QKGGVSSGFKHAEAEQHQTRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEVATIEDGKLMADAETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D   E  PPKL  I  GQ  PV  +  ++  L+ +KC+LLDCG EVFVW+GR T 
Sbjct  241   AASEEDKTIEAFPPKLLQIVKGQSEPVQADSFTRDLLDTNKCFLLDCGVEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK A   AEE     +RP  + I R  +G ET++F+ +FDSW   S  T  E+GRGK
Sbjct  301   LDERKTASAAAEELTHSPERPN-SHIIRAIEGFETVAFRSKFDSWSQTSDVTISEDGRGK  359


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/349 (25%), Positives = 157/349 (45%), Gaps = 37/349 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + V L  ++  KFYSGD Y+   +  G+       I  W GK + ++E  
Sbjct  393   NLQVWRVNEQEKVMLQSSELSKFYSGDCYIFQYSYPGEDKEEHL-IGTWFGKQSIEEERT  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A   + ++   L  +  Q R  + +E  +F S F+  I+  +GG +SG+K    E+E  
Sbjct  452   SALSLSSKMVESLKFQAAQARIFEGNEPIQFFSIFQTFIV-FKGGRSSGYKNYIAEKEIT  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L +   ++ ++G+ +  + 
Sbjct  511   NETYNEDGLALFRVQGSGPENMQAIQVEPVASSLNSSYCYILHSGSSVFTWSGSLTTSEN  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +    E+++ L D     V +    E        +S +FW+L GG     +    D  I+
Sbjct  571   Q----ELVERLLDHIRPNVQSKPQKEG------TESEQFWDLLGG-----KSEYPDQKIV  615

Query  852   -PEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
               E++ P LF     + N    E+   S+ +L     ++LDC S++FVW+G+  +   R 
Sbjct  616   RAEESDPHLFSCTFSKGNLKVTEIFNFSQDDLMTEDIFILDCHSDIFVWIGQQVEPKNRM  675

Query  1020  AACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
              A   AE+FL    + +     T I  + +G E   F   F SW S+ +
Sbjct  676   HALTIAEKFLEHDFLLENLSHETPIFIITEGSEP-PFFTRFFSWDSSKS  723



>ref|XP_010265408.1| PREDICTED: villin-4-like isoform X3 [Nelumbo nucifera]
Length=952

 Score =   476 bits (1224),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGMEIWRIENFHPVPVPKSSYGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLG DT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGTDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              +GGV+SGFK  E E+ +TRLYVCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QKGGVSSGFKHAEAEQHQTRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEVATIEDGKLMADAETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D   E  PPKL  I  GQ  PV  +  ++  L+ +KC+LLDCG EVFVW+GR T 
Sbjct  241   AASEEDKTIEAFPPKLLQIVKGQSEPVQADSFTRDLLDTNKCFLLDCGVEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK A   AEE     +RP  + I R  +G ET++F+ +FDSW   S  T  E+GRGK
Sbjct  301   LDERKTASAAAEELTHSPERPN-SHIIRAIEGFETVAFRSKFDSWSQTSDVTISEDGRGK  359


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 156/347 (45%), Gaps = 37/347 (11%)
 Frame = +3

Query  171   EIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTA  350
             ++WR+   + V L  ++  KFYSGD Y+   +  G+       I  W GK + ++E  +A
Sbjct  408   QVWRVNEQEKVMLQSSELSKFYSGDCYIFQYSYPGEDKEEHL-IGTWFGKQSIEEERTSA  466

Query  351   AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFETR  527
                + ++   L  +  Q R  + +E  +F S F+  I+  +GG +SG+K    E+E    
Sbjct  467   LSLSSKMVESLKFQAAQARIFEGNEPIQFFSIFQTFIV-FKGGRSSGYKNYIAEKEITNE  525

Query  528   LYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERA  677
              Y   G  + R++          QV     SLN    ++L +   ++ ++G+ +  + + 
Sbjct  526   TYNEDGLALFRVQGSGPENMQAIQVEPVASSLNSSYCYILHSGSSVFTWSGSLTTSENQ-  584

Query  678   KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII-P  854
                E+++ L D     V +    E        +S +FW+L GG     +    D  I+  
Sbjct  585   ---ELVERLLDHIRPNVQSKPQKEG------TESEQFWDLLGG-----KSEYPDQKIVRA  630

Query  855   EKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             E++ P LF     + N    E+   S+ +L     ++LDC S++FVW+G+  +   R  A
Sbjct  631   EESDPHLFSCTFSKGNLKVTEIFNFSQDDLMTEDIFILDCHSDIFVWIGQQVEPKNRMHA  690

Query  1026  CQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                AE+FL    + +     T I  + +G E   F   F SW S+ +
Sbjct  691   LTIAEKFLEHDFLLENLSHETPIFIITEGSEP-PFFTRFFSWDSSKS  736



>ref|XP_008372288.1| PREDICTED: villin-4-like [Malus domestica]
Length=620

 Score =   465 bits (1197),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF+P P+PK+ YGKF+ GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFRPAPVPKSSYGKFFMGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                +IH+WLGKDTSQDEAG AAIKTVELD  +GG+ VQHRE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHEIHYWLGKDTSQDEAGAAAIKTVELDATIGGRAVQHREVQGHETAKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE +TRL+VCKGK VV +K+V FAR SL+HDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAVAEEHKTRLFVCKGKHVVHVKEVAFARSSLSHDDIFILDTKCKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A+SGEFW LFGGFAP+ +K
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D   +  P KL C+  GQ  PV+G+ L++  L+ +KCYLLDCG EVFVW+GR T 
Sbjct  241   TATDEDKSFDSYPTKLLCVVKGQAEPVEGDALTRDLLDTNKCYLLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDER++A   AEE +    R K + I R+ +G ET+ F+ +F+SWP +A     E+GRGK
Sbjct  301   LDERRSASGAAEELVHGPDRSK-SHIIRVIEGFETVMFRSKFNSWPQTADVAVSEDGRGK  359



>ref|XP_010265402.1| PREDICTED: villin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010265403.1| PREDICTED: villin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010265404.1| PREDICTED: villin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010265405.1| PREDICTED: villin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010265406.1| PREDICTED: villin-4-like isoform X1 [Nelumbo nucifera]
Length=973

 Score =   476 bits (1225),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGMEIWRIENFHPVPVPKSSYGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLG DT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGTDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              +GGV+SGFK  E E+ +TRLYVCKGK VV +K+VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QKGGVSSGFKHAEAEQHQTRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYVKDTYHNGKCEVATIEDGKLMADAETGEFWSFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D   E  PPKL  I  GQ  PV  +  ++  L+ +KC+LLDCG EVFVW+GR T 
Sbjct  241   AASEEDKTIEAFPPKLLQIVKGQSEPVQADSFTRDLLDTNKCFLLDCGVEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK A   AEE     +RP  + I R  +G ET++F+ +FDSW   S  T  E+GRGK
Sbjct  301   LDERKTASAAAEELTHSPERPN-SHIIRAIEGFETVAFRSKFDSWSQTSDVTISEDGRGK  359


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 156/347 (45%), Gaps = 37/347 (11%)
 Frame = +3

Query  171   EIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTA  350
             ++WR+   + V L  ++  KFYSGD Y+   +  G+       I  W GK + ++E  +A
Sbjct  408   QVWRVNEQEKVMLQSSELSKFYSGDCYIFQYSYPGEDKEEHL-IGTWFGKQSIEEERTSA  466

Query  351   AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFETR  527
                + ++   L  +  Q R  + +E  +F S F+  I+  +GG +SG+K    E+E    
Sbjct  467   LSLSSKMVESLKFQAAQARIFEGNEPIQFFSIFQTFIV-FKGGRSSGYKNYIAEKEITNE  525

Query  528   LYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERA  677
              Y   G  + R++          QV     SLN    ++L +   ++ ++G+ +  + + 
Sbjct  526   TYNEDGLALFRVQGSGPENMQAIQVEPVASSLNSSYCYILHSGSSVFTWSGSLTTSENQ-  584

Query  678   KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII-P  854
                E+++ L D     V +    E        +S +FW+L GG     +    D  I+  
Sbjct  585   ---ELVERLLDHIRPNVQSKPQKEG------TESEQFWDLLGG-----KSEYPDQKIVRA  630

Query  855   EKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             E++ P LF     + N    E+   S+ +L     ++LDC S++FVW+G+  +   R  A
Sbjct  631   EESDPHLFSCTFSKGNLKVTEIFNFSQDDLMTEDIFILDCHSDIFVWIGQQVEPKNRMHA  690

Query  1026  CQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                AE+FL    + +     T I  + +G E   F   F SW S+ +
Sbjct  691   LTIAEKFLEHDFLLENLSHETPIFIITEGSEP-PFFTRFFSWDSSKS  736



>ref|XP_001781287.1| predicted protein [Physcomitrella patens]
 gb|EDQ53903.1| predicted protein [Physcomitrella patens]
Length=929

 Score =   474 bits (1221),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 276/359 (77%), Gaps = 4/359 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++ AFQ  GQK G+EIWRIE+FKP PLP   YGKFYSGDSY+VL+TT+ K G 
Sbjct  1     MAVSMKNVDIAFQGVGQKPGMEIWRIEDFKPTPLPTESYGKFYSGDSYIVLRTTALKTGG  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             + +DIHFWLGK+T+QDEAGTAAIKTVELD  LGG+ VQ+RE Q HE+D FLSYFKPCI+P
Sbjct  61    FHYDIHFWLGKNTTQDEAGTAAIKTVELDAALGGRAVQYRETQEHETDLFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGGVASGF K E E+ E RL++ KG+R VR+ QVPFAR SLNH+DVFVLDT+  I+QFN
Sbjct  121   LEGGVASGFNKVEVEKVEPRLFIVKGRRAVRVSQVPFARSSLNHNDVFVLDTESTIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             GA S+IQER KALEV+Q++KDTYH G C V I++DG L +EAD+G+FW LFGGFAP+ RK
Sbjct  181   GATSSIQERGKALEVVQYIKDTYHDGKCEVIIIDDGTLGSEADTGQFWVLFGGFAPLARK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
                 DD  P+ T PKLFCI       V  E+SK  L++SKCYLLDCG+E+++W GR T L
Sbjct  241   AAVADD-APKLTKPKLFCIIEASFKEV--EISKDILDSSKCYLLDCGNELYIWAGRNTSL  297

Query  1008  DERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             D RKAA  T E F+  +KRPK ++I R+ +G ET+ F+  FD+WP     P  EEGRGK
Sbjct  298   DARKAAVSTVENFITNEKRPKHSQIIRIIEGFETLEFRSHFDNWPLHEQYPISEEGRGK  356


 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 85/342 (25%), Positives = 146/342 (43%), Gaps = 30/342 (9%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E+WRI       +   + G+FY    Y+VL T  G+     + +  W G+ +  ++   
Sbjct  391   LEVWRIVCGMKKQIAAEEIGRFYENSCYIVLYTYQGEERKEEYLLCNWSGRHSPLEDKDA  450

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFK-PCIMPLEGGVASGFKKP----EEE  512
             +     ++   L G+ VQ    Q  E  +FL+ FK  CI+ +         +P    +++
Sbjct  451   SLKVMKDMSVALKGRAVQAYVAQGREPIQFLALFKCMCILKVGQLFCHQVHEPPSLGQKD  510

Query  513   EFETRLYVCK--GKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKAL  686
                  L   +  G ++V+  QV  +  SLN  D F+L T  K+Y ++G  S  + +  +L
Sbjct  511   NNAVMLVRVRAAGPKIVQAVQVEPSSASLNSSDCFLLQTNSKLYAWSGNLSTFESQKASL  570

Query  687   EVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTP  866
              V + LK     GV   A+ E        +   FW   GG     RK  S  +       
Sbjct  571   LVAEILKP----GVIARAMKEG------LEPPLFWSSLGG----KRKYASQREARDVPKD  616

Query  867   PKLFCIDNGQVNPVD----GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQT  1034
             P+L+     Q   V        ++ +L      +LDC + ++ W+G  T  D ++ +   
Sbjct  617   PRLYACSLSQAGIVQVIEVHNFTQDDLLTEDIMILDCHNIIYEWIGHNTSTDNKEHSLSI  676

Query  1035  AEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSA  1148
             A+ FL + ++       T I  LA+G+E I F   F SW S+
Sbjct  677   AKRFLERAEKLDGAQPDTPIFILAEGYEPIFF-TSFFSWDSS  717



>ref|XP_009358744.1| PREDICTED: villin-4 [Pyrus x bretschneideri]
Length=960

 Score =   473 bits (1217),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF+PVP+PK+ +GKF+ GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFRPVPVPKSSHGKFFMGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                +IH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+ +FLS+FKPCI+P
Sbjct  61    LRHEIHYWLGKDTSQDEAGAAAIKTVELDATLGGRAVQYREVQGHETAKFLSFFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE + RL+VCKGK VV +K+V FAR SL+HDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAVAEEHKIRLFVCKGKHVVHVKEVAFARSSLSHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A+SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              T+D+D   +  P KL C++ GQ  PV+G+ L++  L+ +KCYLLDCG EVFVW+GR T 
Sbjct  241   TTTDEDKSFDSYPTKLLCVEKGQAEPVEGDALTRDLLDTNKCYLLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDER++A   AEE +    R K + I R+ +G ET+ F+ +FDSWP +A     E+GRGK
Sbjct  301   LDERRSASGAAEELVHGPDRSK-SHIIRVIEGFETVMFRSKFDSWPQTADVAVSEDGRGK  359


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 94/376 (25%), Positives = 163/376 (43%), Gaps = 54/376 (14%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + L  +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVNGQEKISLQSSDQSKFYSGDCYLFHY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
                G+       I  W GK + ++E  +A   A K VE    L     Q R  + +E  +
Sbjct  426   AYPGEDKEEHL-IGTWFGKQSVEEERASAISLASKMVESMKFLAA---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-------PEE--EEFETRLYVCKGKRVVRMK--QVPFA  581
             F S F+  I+ L+GG++ G+K        P+E  +E    L+  +G     M+  QV   
Sbjct  482   FYSIFQSIIV-LKGGLSDGYKSYVVEKEVPDETYQEDGVALFRVQGSGPDNMQAIQVDAV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L +   ++ ++G+ +N  ++      +  +K            ++    
Sbjct  541   ASSLNSSYCYILHSGSTVFTWSGSLTNSDDQELVERQLDLIKPD----------LQSKTQ  590

Query  762   QAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSN  932
             +  ++S +FWEL GG      +  S   +   ++ P LF     NG +  V+    ++ +
Sbjct  591   KENSESEQFWELLGG----KTEYPSQKIVRSSESDPHLFSCTFSNGNLKVVEIYNFTQDD  646

Query  933   LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQG  1100
             L     ++LDC S++FVWVG+  +  +R  A    E+FL    + +K      +  + +G
Sbjct  647   LMTEDIFILDCHSDIFVWVGQQVKSKDRMQALTIGEKFLKHDFLMEKLSSEASVYIVMEG  706

Query  1101  HETISFKCEFDSWPSA  1148
              E   F   F  W SA
Sbjct  707   SEP-PFFTRFFIWDSA  721



>gb|KHN22680.1| Villin-4 [Glycine soja]
Length=910

 Score =   470 bits (1209),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 279/360 (78%), Gaps = 9/360 (3%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAF+ AGQKAG+EIWRIENF PV +P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFKGAGQKAGLEIWRIENFNPVAIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKG      K V FAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKG------KHVSFARSSLNHDDIFILDTESKIFQFN  174

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+++SGEFW  FGGFAP+ R+
Sbjct  175   GSNSSIQERAKALEVVQYIKDTYHDGKCEIASIEDGKLMADSESGEFWGCFGGFAPLPRR  234

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C+D G+  P++ + L+K  L+ +KCY+LDCG EVF W+GR T 
Sbjct  235   TVSDDDKPADSHPPKLLCVDKGKAEPIESDSLTKELLDTNKCYILDCGLEVFAWMGRNTS  294

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSA-SATPPEEGRGK  1181
             LDERK+A   A+E +    RPK + I R+ +G ET+ FK +FDSWP A  AT  EEGRGK
Sbjct  295   LDERKSASGAADELISGTGRPK-SHIIRVIEGFETVMFKSKFDSWPQACHATMSEEGRGK  353


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 74/312 (24%), Positives = 123/312 (39%), Gaps = 82/312 (26%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-PYLFDIHFWLGKDTSQDEAG  344
             +++W +   + + LP  D  KFY+GD Y+   +  G+    YL  I  W+GK++ ++E  
Sbjct  388   LQVWCVNGQEKILLPATDQSKFYNGDCYIFQYSYPGEDKEEYL--IGTWVGKNSVEEERA  445

Query  345   TA---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEE  512
             +A   A K VE    L     Q R  +  E  +F +  + CI+  +GG + G+K    E+
Sbjct  446   SALSLASKMVESMKFLPS---QARIYEGSEPIQFHAILQSCIV-FKGGRSDGYKNYIAEK  501

Query  513   EFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--AN  656
             E     Y   G  + R++          QV     SLN    F+L +   ++ ++G  A 
Sbjct  502   EIPDETYNEDGVALFRIQGTGPDNMQAIQVEPVASSLNSAYCFILHSGPTVFIWSGGLAT  561

Query  657   SNIQERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVT  833
             S+ QE   + L++I+ +                 NL+      E                
Sbjct  562   SDDQELVERMLDLIKCI-----------------NLKQCLQVKEIHNF------------  592

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
             S DD++ E     ++ +D                         C SE+FVWVG+      
Sbjct  593   SQDDLMTE----DIYTLD-------------------------CHSEIFVWVGQQVDSKS  623

Query  1014  RKAACQTAEEFL  1049
             R  A    E+FL
Sbjct  624   RMQALTIGEKFL  635



>gb|KHN17615.1| Villin-4 [Glycine soja]
Length=900

 Score =   469 bits (1208),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 278/360 (77%), Gaps = 10/360 (3%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MS++++ L+PAF+ AGQKAG+EIWRIENF PVP+P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSISMRDLDPAFKGAGQKAGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG  VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDASLGGWAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE +TRL+VCKGK         FAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGAASGFKHVEAEEHKTRLFVCKGKHT-------FARSSLNHDDIFILDTKSKIFQFN  173

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+++SGEFW  FGGFAP+ R+
Sbjct  174   GSNSSIQERAKALEVVQYVKDTYHDGKCEIASIEDGKLMADSESGEFWGCFGGFAPLPRR  233

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C+D G+  P++ + L+K  L+ +KCY+LDCG EVF W+GR T 
Sbjct  234   TVSDDDKPADSHPPKLLCVDKGKAEPIETDSLTKEFLDTNKCYILDCGLEVFAWMGRNTS  293

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             LDERK+A   A+E +    RPK + I R+ +G ET+ FK +FDSWP AS  P  EEGRGK
Sbjct  294   LDERKSASVAADELIRGTGRPK-SHIIRVIEGFETVMFKSKFDSWPQASDAPMSEEGRGK  352


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 137/336 (41%), Gaps = 66/336 (20%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP  D  KFY+GD Y+   +  G+       I  W+GK + ++E  +
Sbjct  387   LQVWRVNGQEKILLPATDQSKFYNGDCYIFQYSYPGEDKEGHL-IGTWIGKTSVEEERAS  445

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEF  518
             A   A K VE    L     Q R  +  E  +F +  + CI+  +GG++ G+K       
Sbjct  446   ALSLASKMVESMKFLPS---QARIYEGSEPIQFHAILQSCIV-FKGGLSDGYKN------  495

Query  519   ETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQ  698
                 Y+ +       K++P    + N D V        +++  G   +  +  +   V  
Sbjct  496   ----YIAE-------KEIP--DETYNEDGV-------ALFRIQGTGPDNMQAIQVEPVAS  535

Query  699   FLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF  878
              L  TY        I+  G       +   W   GG A      TSDD  + E+      
Sbjct  536   SLNSTY------CYILHSG------PTVFIWS--GGLA------TSDDQELVER------  569

Query  879   CIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL---  1049
              +D  +V  +    S+ +L     Y+LDC SEVFVWVG+      R  A    E+FL   
Sbjct  570   MLDLIKVKEIHN-FSQDDLMTEDIYILDCHSEVFVWVGQQVDSKNRMQALTIGEKFLEHD  628

Query  1050  -VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
              + +   +   I  + +G E   F   F  W SA +
Sbjct  629   FLLEALSREAPIYIVKEGSEP-PFLTRFFKWESAKS  663



>ref|XP_010545398.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545399.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545400.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545401.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545402.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545403.1| PREDICTED: villin-5 isoform X1 [Tarenaya hassleriana]
Length=962

 Score =   470 bits (1210),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+PA Q AGQK GIEIWRIE+FKPVP+PK  YGKF++GDSY+VL+TT+ K G 
Sbjct  1     MAFSMRNLDPALQGAGQKGGIEIWRIESFKPVPIPKDSYGKFFTGDSYIVLKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AA+ TVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDTSQDEAGAAAVMTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE++TRLYVCKGK VV +K+VPFAR +LNHDDVF+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEPEEYQTRLYVCKGKHVVHVKEVPFARSTLNHDDVFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A VEDG L A+A++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGKLMADAEAGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D        +L   + GQV PV+ E L +  L+ +KCY+LDCG E+FVW+GR+T 
Sbjct  241   TANNEDTADGSDEIQLSSAEKGQVEPVEAESLQRELLDTNKCYILDCGLELFVWMGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             +++RK+A ++AEE L    RP+ + I R+ +G ET+ F+ +FDSWP  S A P E+GRG+
Sbjct  301   VNQRKSASESAEELLRSSGRPQ-SHIIRVMEGFETVMFRSKFDSWPETSNAAPSEQGRGR  359


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 149/352 (42%), Gaps = 43/352 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEA  341
              I++W I   + + L  A+  KFYSGD Y+   +  G+    YL  +  W GK + +++ 
Sbjct  393   NIQVWHINGEEKILLQAAEQSKFYSGDCYIFQYSYPGEDREEYL--VGTWFGKQSVEEDR  450

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEF  518
               A     ++   +     Q R  +  E  +F    +  I  L+GG++  FKK   E E 
Sbjct  451   AVAVSMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-LKGGISDAFKKYIAENEI  509

Query  519   ETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
                 Y  +G  + R++          Q       LN    ++L +   ++ + G  ++  
Sbjct  510   PDNTYDEEGIALFRIQGSGPENMQAIQTDPVASGLNSSHCYILHSGSTVFTWCGNLTSSD  569

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPMGRKVTSDDD  845
             ++    E+++ + D     V          LQ E ++S +FWEL  G      K      
Sbjct  570   DQ----ELMERMLDLIKPNVPT-------KLQKEGSESEQFWELLSG------KTEYPSQ  612

Query  846   IIPEKTP--PKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLD  1010
             +I +K    P LF       N    E+   ++ +L     ++LDC +E+F+WVG+    +
Sbjct  613   MIKKKAENDPHLFSCTFSNENLKVTEIFNFTQDDLMTEDIFILDCHTEIFIWVGQQVDPE  672

Query  1011  ERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             ++  A    E+FL    + +K P    I  + +G+E   F   F +W S+ +
Sbjct  673   KKTQALAIGEKFLEHDFLLEKLPHEAPIYIVTEGNEP-PFFTRFFTWDSSKS  723



>ref|XP_010545405.1| PREDICTED: villin-5 isoform X2 [Tarenaya hassleriana]
Length=960

 Score =   470 bits (1210),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+PA Q AGQK GIEIWRIE+FKPVP+PK  YGKF++GDSY+VL+TT+ K G 
Sbjct  1     MAFSMRNLDPALQGAGQKGGIEIWRIESFKPVPIPKDSYGKFFTGDSYIVLKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AA+ TVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDTSQDEAGAAAVMTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG ASGFK  E EE++TRLYVCKGK VV +K+VPFAR +LNHDDVF+LDT+ KI+QFN
Sbjct  121   QEGGAASGFKHVEPEEYQTRLYVCKGKHVVHVKEVPFARSTLNHDDVFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A VEDG L A+A++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGKLMADAEAGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D        +L   + GQV PV+ E L +  L+ +KCY+LDCG E+FVW+GR+T 
Sbjct  241   TANNEDTADGSDEIQLSSAEKGQVEPVEAESLQRELLDTNKCYILDCGLELFVWMGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             +++RK+A ++AEE L    RP+ + I R+ +G ET+ F+ +FDSWP  S A P E+GRG+
Sbjct  301   VNQRKSASESAEELLRSSGRPQ-SHIIRVMEGFETVMFRSKFDSWPETSNAAPSEQGRGR  359


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 149/352 (42%), Gaps = 43/352 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEA  341
              I++W I   + + L  A+  KFYSGD Y+   +  G+    YL  +  W GK + +++ 
Sbjct  393   NIQVWHINGEEKILLQAAEQSKFYSGDCYIFQYSYPGEDREEYL--VGTWFGKQSVEEDR  450

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEF  518
               A     ++   +     Q R  +  E  +F    +  I  L+GG++  FKK   E E 
Sbjct  451   AVAVSMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-LKGGISDAFKKYIAENEI  509

Query  519   ETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
                 Y  +G  + R++          Q       LN    ++L +   ++ + G  ++  
Sbjct  510   PDNTYDEEGIALFRIQGSGPENMQAIQTDPVASGLNSSHCYILHSGSTVFTWCGNLTSSD  569

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPMGRKVTSDDD  845
             ++    E+++ + D     V          LQ E ++S +FWEL  G      K      
Sbjct  570   DQ----ELMERMLDLIKPNVPT-------KLQKEGSESEQFWELLSG------KTEYPSQ  612

Query  846   IIPEKTP--PKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLD  1010
             +I +K    P LF       N    E+   ++ +L     ++LDC +E+F+WVG+    +
Sbjct  613   MIKKKAENDPHLFSCTFSNENLKVTEIFNFTQDDLMTEDIFILDCHTEIFIWVGQQVDPE  672

Query  1011  ERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             ++  A    E+FL    + +K P    I  + +G+E   F   F +W S+ +
Sbjct  673   KKTQALAIGEKFLEHDFLLEKLPHEAPIYIVTEGNEP-PFFTRFFTWDSSKS  723



>ref|XP_004296465.1| PREDICTED: villin-4-like [Fragaria vesca subsp. vesca]
Length=954

 Score =   470 bits (1209),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 279/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAF  AGQKAG+EIWRIENF PV +P++ +GKF+ GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFHGAGQKAGLEIWRIENFCPVSVPQSSHGKFFMGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETAKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG+ASGFK  E EE  TRLYVCKGK VV +K+V FAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGIASGFKHAEAEEHTTRLYVCKGKHVVHVKEVSFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A +EDG L A+AD+GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGRCDIASIEDGKLMADADTGEFWALFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D I +     L  +D G+  PV  + L++  LE SKCYLLDCG EVFVW+GR T 
Sbjct  241   TANDEDKIFDSHTTTLLRVDKGKAEPVGADSLTRELLETSKCYLLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSA-SATPPEEGRGK  1181
             LDER++A + AEE +    R K+  I R+ +G ET+ FK +FD+WP A      E+GRGK
Sbjct  301   LDERRSASEAAEELVRGPDRSKSHMI-RVIEGFETVMFKSKFDTWPEAVEVAVSEDGRGK  359


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 92/382 (24%), Positives = 163/382 (43%), Gaps = 60/382 (16%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + LP +D  K YSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVNGQEKILLPASDQSKIYSGDCYIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLS  443
             +  G+       I  W GK + ++E  +A      +   +     Q R  +  E  +F S
Sbjct  426   SYPGEDKEEHL-IGTWFGKQSVEEERASAISLASNMVASMKFLPAQARIYEGKEPIQFYS  484

Query  444   YFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPS  590
              F+  I+ L+GG++ G+KK   E+E     Y   G  + R++          QV     S
Sbjct  485   IFQSLIV-LKGGLSDGYKKYVAEKEVPDDTYQEDGVALFRVQGSGPDNMQAIQVEAVASS  543

Query  591   LNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE  770
             LN    ++L +   ++ ++G+ +   ++      +  +K                NLQ +
Sbjct  544   LNSAYCYILHSGSTVFTWSGSLATTDDQELVERQLDLIKP---------------NLQTK  588

Query  771   -----ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLF-CI-DNGQVNPVD-GELS  923
                  ++S +FW+L G  A   G+K+  D +     + P+LF C+  N  +  V+    +
Sbjct  589   PQKENSESEQFWDLLGAKAEYSGQKIVRDAE-----SDPRLFSCVFSNENLKVVEIYNFT  643

Query  924   KSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRL  1091
             + +L     ++LDC S++FVWVG      ++  A    E+FL    + +K      I  +
Sbjct  644   QDDLMTEDIFILDCHSDIFVWVGEEVNSKDKMHALTIGEKFLERDFLMEKLSHEAPIYII  703

Query  1092  AQGHETISFKCEFDSWPSASAT  1157
              +G E   F   F +W SA + 
Sbjct  704   MEGSEP-PFFTRFFTWDSAKSN  724



>ref|XP_008340592.1| PREDICTED: villin-4 [Malus domestica]
Length=960

 Score =   470 bits (1209),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQK G+EIWRIENF+P P+PK+ YG F++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKDGLEIWRIENFRPAPIPKSSYGNFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                +IH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHEIHYWLGKDTSQDEAGAAAIKTVELDATLGGRAVQYREVQGHETAKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE +TRL+VC+GK VV +K+V FAR SL+HDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAEAEEHKTRLFVCQGKHVVHVKEVAFARSSLSHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A+SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D   +  P KL C++ GQ  PV+G+ L++  L+ +KCYLLDCG EVFVW+GR T 
Sbjct  241   TATNEDKSFDSYPTKLLCVEKGQAEPVEGDALTRDLLDTNKCYLLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
              D+R++A   AEE +    R K + I R+ +G ET+ F+ +FDSWP +A     E+GRGK
Sbjct  301   JDQRRSASGAAEELVRPPDRSK-SHIIRVIEGFETVMFRSKFDSWPQTADVAVSEDGRGK  359


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 96/382 (25%), Positives = 163/382 (43%), Gaps = 60/382 (16%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + L  +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKADPVKEEPQPYIDCTG---NLQVWRVNGQEKINLQSSDQSKFYSGDCYIFHY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
                G+       I  W GK + +DE  +A   A K VE    L     Q R  + +E  +
Sbjct  426   AYPGEDKEEHL-IGTWFGKQSVEDERVSAISLASKMVESMKFLAA---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFA  581
             F S F+  I+ L+GG++ G+K    E+E     Y   G  + R++          QV   
Sbjct  482   FYSIFQSIIV-LKGGLSDGYKNYVAEKEVXDETYQEDGVALFRVQGSGPDNMQAIQVDAV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L +   ++ ++G  +   ++      +  +K                 +
Sbjct  541   ASSLNSSYCYILHSGSTVFTWSGGLTTSDDQELVERQLDLIKPDLQS-----------KM  589

Query  762   QAE-ADSGEFWELFGGFA--PMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELS  923
             Q E ++S +FWEL GG    P  + V S +      + P+LF     NG +  V+    +
Sbjct  590   QKENSESEQFWELLGGKTEYPSQKIVRSGE------SDPRLFSCTFSNGNLKVVEIYNFT  643

Query  924   KSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRL  1091
             + +L     ++LDC +++FVWVG+     +R  A    E+FL      ++  +   I  +
Sbjct  644   QDDLMTEDIFILDCHADIFVWVGQQVNSKDRMQALTIGEKFLEHDFFMEQLSREASIYII  703

Query  1092  AQGHETISFKCEFDSWPSASAT  1157
              +G E   F   F +W SA ++
Sbjct  704   MEGSEP-PFFTRFFTWDSAKSS  724



>gb|AFW83946.1| hypothetical protein ZEAMMB73_866328 [Zea mays]
Length=932

 Score =   469 bits (1207),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 267/309 (86%), Gaps = 3/309 (1%)
 Frame = +3

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLS  443
             TT  KGG YL+DIHFW+GKD+SQDEAGTAAIKTVELD ILGG+ +QHRE+Q +ESD+FLS
Sbjct  2     TTCTKGGAYLYDIHFWIGKDSSQDEAGTAAIKTVELDAILGGRAIQHRELQGYESDKFLS  61

Query  444   YFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDT  623
             YFKPCI+PLEGG ASGFKKPEEE+FETRLY+C+GKR +R+K+VPFAR SLNHDDVFVLD 
Sbjct  62    YFKPCIIPLEGGFASGFKKPEEEKFETRLYICRGKRAIRVKEVPFARSSLNHDDVFVLDA  121

Query  624   KDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFG  803
             ++KIYQFNGANSNIQERAKALEVIQ LK+ YHGGVC+VAIV+DG LQAE+DSGEFW LFG
Sbjct  122   ENKIYQFNGANSNIQERAKALEVIQHLKEKYHGGVCDVAIVDDGKLQAESDSGEFWVLFG  181

Query  804   GFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFV  983
             GFAP+G+K  SDDD++ E T P+L+ I++GQ+   +  L+K+ LEN+KC+LLDCG+E++V
Sbjct  182   GFAPIGKKTVSDDDVVLETTAPRLYSINDGQLKLEETALTKAVLENTKCFLLDCGAEIYV  241

Query  984   WVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT--  1157
             WVGR TQ+++RK+A +  EEFL+ QKRPK T++T++ QG+E+ +FK +F+SWP  +AT  
Sbjct  242   WVGRVTQMEDRKSATKAVEEFLINQKRPKTTRVTQVIQGYESHAFKSKFESWPVGNATGS  301

Query  1158  -PPEEGRGK  1181
                EEGRGK
Sbjct  302   PGAEEGRGK  310


 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 168/352 (48%), Gaps = 34/352 (10%)
 Frame = +3

Query  135   PAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWL  314
             P  +  G+   +E+W ++      LPK D GKFYSGD Y++L T         + + +W+
Sbjct  338   PLLEGGGK---LEVWCVDGNAKTALPKEDIGKFYSGDCYIILYTYHSGDKKEEYYLSYWI  394

Query  315   GKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF  494
             GKD+  D+  +A+  T  +   L G+ V  R  Q  E  +F++ F+P I+ L+GG+ SG+
Sbjct  395   GKDSLVDDQVSASQITNTVWNSLKGRPVLGRIYQGKEPPQFVALFQPMII-LKGGIGSGY  453

Query  495   KKPEEEEFET-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             KK  EE+  T   Y  +G  ++R+           QV     SL+  + F+L + + ++ 
Sbjct  454   KKLIEEKGATGETYTTEGIALIRVSGTSIHNNKTLQVDTVATSLSSMECFILQSGNAMFT  513

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             + G +S  +++  A +V +FLK     GV  V   ++G      +S  FW   GG     
Sbjct  514   WFGNSSTYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----ESSGFWFALGGKQSYT  563

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRA  998
              K  +  DII  +     F   NG +   +    S+ +L      +LD   EVF+W+G+ 
Sbjct  564   NK-NAPQDIITREPHLYAFSFKNGLIQVTEIFNFSQDDLLTEDMMILDTHGEVFIWIGQC  622

Query  999   TQLDERKAACQTAEEFL-----VKQKRPKATKITRLAQGHETISFKCEFDSW  1139
              +  E++ A    ++++     +    P A  + ++ +G+E   FK  F SW
Sbjct  623   VESKEKQKAFDIGQKYVEHANSIDDLSPYA-PLYKVMEGNEPCFFKTYF-SW  672



>ref|XP_002979365.1| hypothetical protein SELMODRAFT_177604 [Selaginella moellendorffii]
 gb|EFJ19773.1| hypothetical protein SELMODRAFT_177604 [Selaginella moellendorffii]
Length=887

 Score =   467 bits (1201),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 227/362 (63%), Positives = 281/362 (78%), Gaps = 6/362 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++PAFQ  GQKAG+EIWRIENF PVPLPK+D+GKFY+GDSY++L+TT+ K G 
Sbjct  1     MAVSMKNVDPAFQGIGQKAGLEIWRIENFVPVPLPKSDHGKFYTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
               +DIHFWLGK TSQDEAGTAAIK+VELD  LGG+ VQ+RE+Q  ESD+FL+YFKPCI+P
Sbjct  61    LRYDIHFWLGKATSQDEAGTAAIKSVELDAALGGRAVQYREVQGSESDKFLTYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPE E+ E RL+ CKG+RVVR+K+VPF+R SLNHDDVF+LDT  KIYQFN
Sbjct  121   LEGGCASGFKKPEVEKIEPRLFCCKGRRVVRVKEVPFSRSSLNHDDVFILDTDVKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G NS+IQERAKALEV+QF+KD  H G C VAIVEDG + AEAD+GEFW LFGGFAP+G+K
Sbjct  181   GVNSSIQERAKALEVVQFIKDNDHDGKCAVAIVEDGKMAAEADAGEFWGLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLF-CIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
              +  ++   +    KLF C+ +G V  V    L +  LE  KCYLLD G  V+VW GRAT
Sbjct  241   ASIKENEDEDPGSGKLFICLVDGNVQEVSASPLPRELLETDKCYLLDGGPTVYVWTGRAT  300

Query  1002  QLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP--PEEGR  1175
              LDERK+A + AEE++   K+P+ T+ITR+ +G ET+ FK  F  W +A   P   EEGR
Sbjct  301   SLDERKSASKAAEEYIA--KKPETTRITRVIEGFETLPFKSYFGEWTTAGGAPVVSEEGR  358

Query  1176  GK  1181
             GK
Sbjct  359   GK  360


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 90/367 (25%), Positives = 159/367 (43%), Gaps = 39/367 (11%)
 Frame = +3

Query  114   VNVKALEPA-FQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPY  290
              +VK  EP+ F ++G+   +E+WR++     P+P   +G FYSGD +VV  T  G     
Sbjct  379   ASVKEDEPSLFNSSGK---LEVWRVDGKTKTPVPSEAHGHFYSGDCFVVRYTYQGDQKET  435

Query  291   LFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPL  470
                +  WLG  +++++  +A     E+ +   G+ VQ R  +  E  +F + F   ++  
Sbjct  436   ECFVCCWLGNQSTEEDQSSAFSHVEEISSSFKGRLVQARVFEGKEPSQFFALFSSLVI-F  494

Query  471   EGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVL  617
             +GG +SG+K    E   E   Y  +G  + R++          QV     SLN  D F+ 
Sbjct  495   KGGQSSGYKTLVSESASEDETYTEEGLALFRVRGTKPYNSLAVQVEPVSASLNSSDCFIF  554

Query  618   DTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWEL  797
              +      + G+ S ++E+  A  +   LK                +L+  ++   FW  
Sbjct  555   QSAKTYLLWFGSFSTLEEQQVAARIATSLKSESS----------PKSLKEGSEPPTFWNA  604

Query  798   FGGFAPMGRKV-TSDDDIIPEKTPPKLFCIDNGQVNPVDGE---LSKSNLENSKCYLLDC  965
              G     G+KV  S  +++     P+LF       N +  E    ++ +L +    +LD 
Sbjct  605   LG-----GKKVYPSQRELVDSDKDPRLFEYTRKPGNLLFEETFNFTQDDLLSDDIMILDT  659

Query  966   GSEVFVWVGRATQLDERKAACQTAEEFLVKQKR----PKATKITRLAQGHETISFKCEFD  1133
               E+ VW+G+     ++K     AE+++ +  R     K   I ++ +G E   F   F 
Sbjct  660   RCELSVWIGQNVSPKDKKQGLAIAEKYVERANRLDGLSKDIPIFKILEGSEPAFFTRHFA  719

Query  1134  SWPSASA  1154
               PS SA
Sbjct  720   WDPSKSA  726



>emb|CAB43851.1| putative villin, fragment [Arabidopsis thaliana]
Length=524

 Score =   454 bits (1169),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFIPTPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVVAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        +LFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDITRLFCVEKGQANPVEGDTLKREMLDTNKCYILDCGIEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A + AEE +   +RPK+  I R+ +G ET+ F+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASKAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFESWTQETNTTVSEDGRGR  359


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 64/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query  168  IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
            +++WR+       L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G+
Sbjct  394  LQVWRVNGQAKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERGS  452

Query  348  AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
            A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E + 
Sbjct  453  AVSMASKMVESMKFVPAQARIYEGKEPIQFFVIMQSFIV-FKGGISSGYKKYIAEKEVDD  511

Query  525  RLYVCKGKRVVRM  563
              Y   G  + R+
Sbjct  512  DTYNENGVALFRI  524



>gb|AFW87618.1| hypothetical protein ZEAMMB73_119984, partial [Zea mays]
Length=440

 Score =   451 bits (1159),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 277/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  YGKF++GDSY+VL+TT+ K G 
Sbjct  1     MAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESYGKFFTGDSYIVLKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+REIQ +E+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREIQGNETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGF+  E  E E +TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   EEGGVASGFRHTEVNEREHKTRLFVCRGKHTVHVKEVPFARASLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q LKDT H G C VA VEDG L A+AD+GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQHLKDTNHEGKCEVAAVEDGKLMADADAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSN-LENSKCYLLDCGSEVFVWVGRA  998
             RK  S+ +     +  KL C++ GQ  P+D E+ K   L+++KCYLLDCGSE++VW+GR 
Sbjct  241   RKTFSELNGKDSTSTSKLLCVNKGQFAPIDCEILKRELLDSTKCYLLDCGSEIYVWMGRE  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK     AEE L +  R K + I RL +G ET++FK +FD WP  A A   +E R
Sbjct  301   TTLEERKRGGSAAEELLREGNRQK-SHIIRLMEGFETVTFKSKFDKWPKKADAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361



>ref|XP_008659878.1| PREDICTED: villin-4-like isoform X2 [Zea mays]
Length=452

 Score =   451 bits (1159),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 277/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  YGKF++GDSY+VL+TT+ K G 
Sbjct  1     MAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESYGKFFTGDSYIVLKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+REIQ +E+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREIQGNETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGF+  E  E E +TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   EEGGVASGFRHTEVNEREHKTRLFVCRGKHTVHVKEVPFARASLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q LKDT H G C VA VEDG L A+AD+GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQHLKDTNHEGKCEVAAVEDGKLMADADAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSN-LENSKCYLLDCGSEVFVWVGRA  998
             RK  S+ +     +  KL C++ GQ  P+D E+ K   L+++KCYLLDCGSE++VW+GR 
Sbjct  241   RKTFSELNGKDSTSTSKLLCVNKGQFAPIDCEILKRELLDSTKCYLLDCGSEIYVWMGRE  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK     AEE L +  R K + I RL +G ET++FK +FD WP  A A   +E R
Sbjct  301   TTLEERKRGGSAAEELLREGNRQK-SHIIRLMEGFETVTFKSKFDKWPKKADAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361



>ref|XP_008659877.1| PREDICTED: villin-4-like isoform X1 [Zea mays]
Length=483

 Score =   451 bits (1161),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/363 (60%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             +M+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  YGKF++GDSY+VL+TT+ K G
Sbjct  31    SMAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESYGKFFTGDSYIVLKTTALKNG  90

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+REIQ +E+++FLSYFKPCI+
Sbjct  91    SFRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREIQGNETEKFLSYFKPCII  150

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGGVASGF+  E  E E +TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  151   PEEGGVASGFRHTEVNEREHKTRLFVCRGKHTVHVKEVPFARASLNHDDIFILDTKSKIF  210

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q LKDT H G C VA VEDG L A+AD+GEFW LFGGFAP+
Sbjct  211   QFNGSNSSIQERAKALEVVQHLKDTNHEGKCEVAAVEDGKLMADADAGEFWGLFGGFAPL  270

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSN-LENSKCYLLDCGSEVFVWVGR  995
              RK  S+ +     +  KL C++ GQ  P+D E+ K   L+++KCYLLDCGSE++VW+GR
Sbjct  271   PRKTFSELNGKDSTSTSKLLCVNKGQFAPIDCEILKRELLDSTKCYLLDCGSEIYVWMGR  330

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L+ERK     AEE L +  R K + I RL +G ET++FK +FD WP  A A   +E 
Sbjct  331   ETTLEERKRGGSAAEELLREGNRQK-SHIIRLMEGFETVTFKSKFDKWPKKADAVVSDES  389

Query  1173  RGK  1181
             RGK
Sbjct  390   RGK  392



>ref|XP_008453585.1| PREDICTED: LOW QUALITY PROTEIN: villin-4 [Cucumis melo]
Length=961

 Score =   466 bits (1199),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+E+WRIENF+PV +PK+ +GKF+ GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDQAFQGAGQKAGLEVWRIENFRPVLVPKSSHGKFFMGDSYIVLKTTSLKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGV+SGFK  E EE +T LYVCKGKRVV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVSSGFKHAEAEEHKTTLYVCKGKRVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+ ++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADVETGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             V  + D   +  P KL C++ G   PV+ + L++  LE +KCY+LD G+EVF+W+GR + 
Sbjct  241   VAGEGDKTVDSHPTKLLCVEKGNREPVEADSLARELLETNKCYILDSGTEVFIWMGRNSS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             L+ERK A + AEE +    RP+ + I R+ +G E I F+ +FDSWP +A+    E+GRGK
Sbjct  301   LEERKNASRAAEELVSVPDRPQ-SHIMRVIEGFEPIIFRAKFDSWPETAAVAVSEDGRGK  359


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/348 (25%), Positives = 153/348 (44%), Gaps = 37/348 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP +D  KFY+GD Y+   + SG+     F +  W GK + + E   
Sbjct  394   LQVWRVSGQEKLLLPVSDQSKFYTGDCYIFQYSYSGEDKEE-FLVGTWFGKQSVEGERAA  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-------PE  506
             A     ++   L    VQ R  + HE  +F S F+  I+  +GG++ G+K        P+
Sbjct  453   ALSLASKMVESLKFLPVQARLYEGHEPIQFYSIFQSFIV-FKGGLSDGYKNYITENEIPD  511

Query  507   EEEFE--TRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
                 E    L+  +G     M+  QV     SLN    ++L +   ++ + G+ +N  ++
Sbjct  512   VTNSEDGVALFRVQGSGPENMQAIQVDAVGSSLNSSYCYILHSGSTVFTWCGSLTNTDDQ  571

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDII  851
                   +  +K       C     ++G     A+S +FW+L GG      +K+  +++  
Sbjct  572   ELVERFLDVIKPN-----CQSKPHKEG-----AESEQFWDLLGGKVEYPSQKIARNNE--  619

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
                + P LF C    ++  V       + +L      +L C S++FVWVG+      +  
Sbjct  620   ---SDPHLFSCTFANEILKVAEIYNFGQDDLMTEDIDILSCHSDIFVWVGQQVDPKTKVH  676

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A +  E+FL      +K  + T I  + +G E   F   F SW SA +
Sbjct  677   ALKIGEKFLEIDXFLEKLSRETPIYIVMEGSEP-PFFTRFFSWDSAKS  723



>ref|XP_010451986.1| PREDICTED: villin-5 [Camelina sativa]
Length=959

 Score =   465 bits (1197),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 212/360 (59%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q AGQK+GIEIWRIENFKPV +P   +GKFY+GDSY+VL+TT+ K G 
Sbjct  1     MTFSMRDLDQALQGAGQKSGIEIWRIENFKPVTVPNESHGKFYTGDSYIVLKTTASKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                DDD   E    KLF ++ G+  PV+ E L K  L+ +KCY+LDCG E+FVW GR T 
Sbjct  241   AAVDDDATAESVGIKLFSVEKGKTEPVEAESLEKELLDTNKCYILDCGLEMFVWKGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +DERK A +TA+EF    +RPK+  ++ + +G+ET+ F+ +FDSWP++S  T P++GRGK
Sbjct  301   IDERKNASETADEFFRSSERPKSNLVS-VMEGYETVMFRSKFDSWPASSTMTEPQQGRGK  359


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 148/350 (42%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI + + + L  A+  KFYSGD Y+   +  G+       +  W GK + +D+  
Sbjct  395   NLQVWRINHEEKILLEAAEQTKFYSGDCYIFRYSYPGEDREEHL-VGTWFGKQSIEDDRA  453

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  454   SAISMASKMVESMKFMPAQARIYEGKEPVQFFVIMQSFIT-FKGGLSDAFKKYIAENEIP  512

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  513   DTTYDAEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  572

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +    E+++ + D         A  E       ++S +FWE+ GG +    +K+  D + 
Sbjct  573   Q----ELMERMLDLIKPNEPTKAHKEG------SESEQFWEILGGKSEYPSQKIKMDGE-  621

Query  849   IPEKTPPKLFCI----DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                 + P LF      D+ +V  +    ++ +L     ++LDC +E+F WVG+     ++
Sbjct  622   ----SDPHLFSCTFSNDDLKVTEI-FNFTQDDLMTEDIFILDCHTEIFAWVGQQVDPKKK  676

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                    E+F+    + +     T I  + +G+E   F   F +W S+ +
Sbjct  677   PQVLAIGEKFIKHDFLLENLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  725



>ref|XP_008223740.1| PREDICTED: villin-4 [Prunus mume]
 ref|XP_008223741.1| PREDICTED: villin-4 [Prunus mume]
Length=959

 Score =   465 bits (1196),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 280/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAF  AGQKAG+EIWRIENF+P P+PK+ YG F+ GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFTGAGQKAGLEIWRIENFRPAPVPKSSYGNFFMGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+ +FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETAKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE +TRL+VCKGK VV +K+VPFAR SL+HDD+F+LDT+ KI+QFN
Sbjct  121   QEGGVASGFKHVVAEEHKTRLFVCKGKHVVHVKEVPFARSSLSHDDIFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A+SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVLQYIKDTYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D   +  P KL C++ G+  PV+ + L++  L+ +KCYLLDCG E+FVW+GR T 
Sbjct  241   TATNEDKCFDSYPTKLLCVEKGKAEPVEADSLTRDLLDTNKCYLLDCGLEMFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDER++A   AEE +    R K   I R+ +G ET+ F+ +FDSWP  +     E+GRGK
Sbjct  301   LDERRSASGAAEELVRGPDRSKC-HIIRVIEGFETVMFRSKFDSWPQTTDVAVSEDGRGK  359


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 96/359 (27%), Positives = 166/359 (46%), Gaps = 57/359 (16%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP +D  KFYSGD Y+   +  G+       I  W GK + ++E  +
Sbjct  394   LQVWRVNGQEKILLPSSDQSKFYSGDCYIFHYSYPGEDKEEHL-IGTWFGKQSVEEERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK------  500
             A   A K VE    L     Q R  +  E  +F S F+  I+ L+GG++ G+K       
Sbjct  453   AISLASKVVESLKFLAA---QARIYEGSEPIQFYSIFQSIIV-LKGGLSDGYKNYVAEKQ  508

Query  501   -PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANS  659
              P+E  +E    L+  +G     M+  QV     SLN    ++L +   ++ ++G  ANS
Sbjct  509   VPDETYQEDGVALFRVQGTGPDNMQAIQVDAVASSLNSSYCYILHSGSTVFTWSGGLANS  568

Query  660   NIQERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPMG  821
             + QE   + L++I+                   NLQ++      +S +FW+L GG +   
Sbjct  569   DDQELVERQLDLIK------------------PNLQSKTQKENVESEQFWDLLGGKS---  607

Query  822   RKVTSDDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVG  992
              +  S   I   ++ P+LF     NG +  V+    ++ +L     ++LDC S++FVWVG
Sbjct  608   -EYPSQKIIRSAESDPRLFSCTFSNGNLKVVEIYNFTQDDLMTEDTFILDCHSDIFVWVG  666

Query  993   RATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             +     +R  A    E+F+    + +K  +   I  + +G E   F   F +W SA ++
Sbjct  667   QLVDSKDRMHALTIGEKFIEHDFLMEKLSREASIYIVMEGSEP-PFFMRFFNWDSAKSS  724



>ref|XP_002990339.1| hypothetical protein SELMODRAFT_235997 [Selaginella moellendorffii]
 gb|EFJ08608.1| hypothetical protein SELMODRAFT_235997 [Selaginella moellendorffii]
Length=919

 Score =   464 bits (1193),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/361 (63%), Positives = 279/361 (77%), Gaps = 6/361 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++PAFQ  GQKAG+EIWRIENF PVPLPK+D+GKFY+GDSY++L+TT+ K G 
Sbjct  1     MAVSMKNVDPAFQGIGQKAGLEIWRIENFVPVPLPKSDHGKFYTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
               +DIHFWLGK TSQDEAGTAAIK+VELD  LGG+ VQ+RE+Q  ESD+FL+YFKPCI+P
Sbjct  61    LRYDIHFWLGKATSQDEAGTAAIKSVELDAALGGRAVQYREVQGSESDKFLTYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             LEGG ASGFKKPE E+ E RL+ CKG+RVVR+K+VPF+R SLNHDDVF+LDT  KIYQFN
Sbjct  121   LEGGCASGFKKPEVEKIEPRLFCCKGRRVVRVKEVPFSRSSLNHDDVFILDTDVKIYQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G NS+IQERAKALEV+QF+KD  H G C VAIVEDG + AEAD+GEFW LFGGFAP+G+K
Sbjct  181   GVNSSIQERAKALEVVQFIKDNDHDGKCAVAIVEDGKMAAEADAGEFWGLFGGFAPIGKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              +  ++   +    KL  +D G V  V    L +  LE  KCYLLD G  V+VW GRAT 
Sbjct  241   ASIKENEDEDPGSGKLSLVD-GNVQEVSASSLPRELLETDKCYLLDGGPTVYVWTGRATS  299

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP--PEEGRG  1178
             LDERK+A + AEE++   K+P+ T+ITR+ +G ET+ FK  F  W +A   P   EEGRG
Sbjct  300   LDERKSASKAAEEYIA--KKPQTTRITRVIEGFETLPFKSYFGEWTTAGGAPVVSEEGRG  357

Query  1179  K  1181
             K
Sbjct  358   K  358


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 162/367 (44%), Gaps = 36/367 (10%)
 Frame = +3

Query  117   NVKALEPA-FQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYL  293
             +VK  EP+ F ++G+   +E+WR++     P+P   +G FYSGD +VV  T  G      
Sbjct  378   SVKEDEPSLFNSSGK---LEVWRVDGKTKTPVPSEAHGHFYSGDCFVVRYTYQGDQKETE  434

Query  294   FDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLE  473
               +  WLG  +++++  +A     E+ +   G+ VQ R  +  E  +F++ F   ++  +
Sbjct  435   CFVCCWLGNQSAEEDQSSAFSHVEEISSSFKGRLVQARVFEGKEPSQFIALFSSLVI-FK  493

Query  474   GGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLD  620
             GG +SG+K    E   E   Y   G  + R++          QV     SLN  D F+  
Sbjct  494   GGQSSGYKTLVSESASEDETYTEDGLALFRVRGTKPYNSLAVQVEPVSASLNSSDCFIFQ  553

Query  621   TKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELF  800
             +      + G+ S ++E+  A  +   LK T    V ++ ++ +       D   FW   
Sbjct  554   SAKTYLLWFGSFSTLEEQQVAARIATSLKVTPIFLVSSLMLILN-------DPPTFWNAL  606

Query  801   GGFAPMGRKV-TSDDDIIPEKTPPKLFCIDNGQVNPVDGE---LSKSNLENSKCYLLDCG  968
             G     G+KV  S  +++     P+LF       N +  E    ++ +L +    +LD  
Sbjct  607   G-----GKKVYPSQRELVDSDKDPRLFEYTRKPGNLLFEETFNFTQDDLLSDDIMILDTR  661

Query  969   SEVFVWVGRATQLDERKAACQTAEEFLVKQKR----PKATKITRLAQGHETISFKCEFDS  1136
              E+ VW+G+     ++K     AE+++ +  R     K   I ++ +G E   F   F  
Sbjct  662   CELSVWIGQNVSPKDKKQGFAIAEKYVERASRLDGLSKDIPIFKILEGSEPAFFTRHFAW  721

Query  1137  WPSASAT  1157
              PS SA 
Sbjct  722   DPSKSAV  728



>gb|EAZ26972.1| hypothetical protein OsJ_10899 [Oryza sativa Japonica Group]
Length=1003

 Score =   465 bits (1196),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 261/311 (84%), Gaps = 2/311 (1%)
 Frame = +3

Query  255   VLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDR  434
             +  T S  GG YLFDIHFW+GKD+SQDEAGTAAIKTVELDT+LGG+ VQHRE+Q +ESD+
Sbjct  54    ITTTCSKGGGAYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDK  113

Query  435   FLSYFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFV  614
             FLSYFKPCI+PLEGG ASGFK PEE++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+
Sbjct  114   FLSYFKPCIIPLEGGFASGFKTPEEDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFI  173

Query  615   LDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWE  794
             LDT+ KIYQFNGANSNIQERAKALE IQ LK+TYH GVC+VAIV+DG LQAE+DSGEFW 
Sbjct  174   LDTEKKIYQFNGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWV  233

Query  795   LFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSE  974
             LFGGFAP+G+K   DDD++ E T PKL+ I+NGQ+   D  L+KS LEN+KC+L+DCGS+
Sbjct  234   LFGGFAPIGKKAICDDDVVLETTAPKLYSINNGQLKLEDTVLTKSILENNKCFLVDCGSD  293

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SA  1148
             +F+WVGR TQ++ERKAA    EEF+  Q RPK T++TR+ QG+E  +FK +F+SWP  SA
Sbjct  294   LFIWVGRLTQVEERKAASAAVEEFIATQNRPKTTRVTRVIQGYENHTFKSKFESWPVNSA  353

Query  1149  SATPPEEGRGK  1181
              +   EEGRGK
Sbjct  354   GSAGAEEGRGK  364


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 91/369 (25%), Positives = 160/369 (43%), Gaps = 61/369 (17%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E++ +       LPK + GKFYSGD Y+VL T         F + +W+GKD+  ++   
Sbjct  400   LEVYCVNGSAKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFYLTYWIGKDSIPEDQEM  459

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A      +   L G+ +  R  Q  E  +F++ F+P ++ L+GG++SG++K  EE+  + 
Sbjct  460   AFQTANSIWNSLKGRPILGRIYQGKEPPQFIALFQPMVI-LKGGISSGYQKFVEEKGLKD  518

Query  525   RLYVCKGKRVVRMK---------------------------QVPFARP----------SL  593
               Y   G  + R+                            Q P   P          +L
Sbjct  519   ETYSGDGIALFRISGTSIHNNKVLQVDARHDRVDLGLPLGIQCPHPYPYPHYLGRVSSNL  578

Query  594   NHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA  773
             +  D FVL + + ++ + G  S+ +++  A +V +FLK     GV  V   ++G      
Sbjct  579   SPTDCFVLQSGNSMFTWIGNASSYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----  628

Query  774   DSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKL--FCIDNGQVNPVD-GELSKSNLENS  944
             +S  FW   GG      +  +  D++ E   P L  F + NG++   +    S+ +L   
Sbjct  629   ESSAFWFALGGKQNYTSR-NATHDVVRE---PHLYTFSLRNGKLEVTEIFNFSQDDLLTE  684

Query  945   KCYLLDCGSEVFVWVGRATQLDERKAACQT----AEEFLVKQKRPKATKITRLAQGHETI  1112
                +LD   EVFVW+G+     E++ A +     AE     +       + ++ +G+E  
Sbjct  685   DMMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQKYAEHAAAFESLSPDVPLYKVVEGNEPC  744

Query  1113  SFKCEFDSW  1139
              F+  F SW
Sbjct  745   FFRTYF-SW  752



>gb|EEC75286.1| hypothetical protein OsI_11627 [Oryza sativa Indica Group]
Length=999

 Score =   465 bits (1196),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 261/311 (84%), Gaps = 2/311 (1%)
 Frame = +3

Query  255   VLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDR  434
             +  T S  GG YLFDIHFW+GKD+SQDEAGTAAIKTVELDT+LGG+ VQHRE+Q +ESD+
Sbjct  54    ITTTCSKGGGAYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDK  113

Query  435   FLSYFKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFV  614
             FLSYFKPCI+PLEGG ASGFK PEE++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+
Sbjct  114   FLSYFKPCIIPLEGGFASGFKTPEEDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFI  173

Query  615   LDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWE  794
             LDT+ KIYQFNGANSNIQERAKALE IQ LK+TYH GVC+VAIV+DG LQAE+DSGEFW 
Sbjct  174   LDTEKKIYQFNGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWV  233

Query  795   LFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSE  974
             LFGGFAP+G+K   DDD++ E T PKL+ I+NGQ+   D  L+KS LEN+KC+L+DCGS+
Sbjct  234   LFGGFAPIGKKAICDDDVVLETTAPKLYSINNGQLKLEDTVLTKSILENNKCFLVDCGSD  293

Query  975   VFVWVGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP--SA  1148
             +F+WVGR TQ++ERKAA    EEF+  Q RPK T++TR+ QG+E  +FK +F+SWP  SA
Sbjct  294   LFIWVGRLTQVEERKAASAAVEEFIATQNRPKTTRVTRVIQGYENHTFKSKFESWPVNSA  353

Query  1149  SATPPEEGRGK  1181
              +   EEGRGK
Sbjct  354   GSAGAEEGRGK  364


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 90/366 (25%), Positives = 159/366 (43%), Gaps = 59/366 (16%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E++ +       LPK + GKFYSGD Y+VL T         F + +W+GKD+  ++   
Sbjct  400   LEVYCVNGSAKTALPKEELGKFYSGDCYIVLYTYHSGDKREEFYLTYWIGKDSIPEDQEM  459

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A      +   L G+ +  R  Q  E  +F++ F+P ++ L+GG++SG++K  EE+  + 
Sbjct  460   AFQTANSIWNSLKGRPILGRIYQGKEPPQFIALFQPMVI-LKGGISSGYQKCVEEKGLKD  518

Query  525   RLYVCKGKRVVRMK----------QV-------------------PFARP--------SL  593
               Y   G  + R+           QV                   P+  P        +L
Sbjct  519   ETYSGDGIALFRISGTSIHNNKVLQVDARHDRVDLGLPLGIRCPHPYPYPHYLGRVSSNL  578

Query  594   NHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA  773
             +  D FVL + + ++ + G  S+ +++  A +V +FLK     GV  V   ++G      
Sbjct  579   SPTDCFVLQSGNSMFTWIGNASSYEQQQWAAKVAEFLKP----GVA-VKHCKEGT-----  628

Query  774   DSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCY  953
             +S  FW   GG      +  +  D++ E   P L+     +V  +    S+ +L      
Sbjct  629   ESSAFWFALGGKQNYTSR-NATHDVVRE---PHLYTFSLRKVTEI-FNFSQDDLLTEDMM  683

Query  954   LLDCGSEVFVWVGRATQLDERKAACQT----AEEFLVKQKRPKATKITRLAQGHETISFK  1121
             +LD   EVFVW+G+     E++ A +     AE     +       + ++ +G+E   F+
Sbjct  684   VLDTHGEVFVWMGQCVDAKEKQKAFEIGQKYAEHAAAFESLSPDVPLYKVVEGNEPCFFR  743

Query  1122  CEFDSW  1139
               F SW
Sbjct  744   TYF-SW  748



>ref|XP_007225365.1| hypothetical protein PRUPE_ppa000861mg [Prunus persica]
 gb|EMJ26564.1| hypothetical protein PRUPE_ppa000861mg [Prunus persica]
Length=979

 Score =   464 bits (1194),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 280/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAF  AGQKAG+EIWRIENF+P P+PK+ YG F+ GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFTGAGQKAGLEIWRIENFRPAPVPKSSYGNFFMGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+ +FLS FKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETAKFLSNFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK+ E EE +TRL+VCKGK VV +K+VPFAR SL+HDD+F+LDT+ KI+QFN
Sbjct  121   QEGGVASGFKRAEAEEHKTRLFVCKGKHVVHVKEVPFARSSLSHDDIFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A+SGEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVLQYIKDTYHDGKCEIASIEDGKLMADAESGEFWGLFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +++D   +  P KL C++ G+  PV+ + L +  L+ +KCYLLDCG E+FVW+GR T 
Sbjct  241   TATNEDKCFDSYPTKLLCVEKGKAEPVEADSLMRDLLDTNKCYLLDCGLEMFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDER++A   AEE +    R K   I R+ +G ET+ F+ +FDSWP  +     E+GRGK
Sbjct  301   LDERRSASGAAEELVRGPDRSKC-HIIRVIEGFETVMFRSKFDSWPQTTDVAVSEDGRGK  359


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 165/379 (44%), Gaps = 77/379 (20%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP +D  KFYSGD Y+   +  G+       I  W GK + ++E  +
Sbjct  394   LQVWRVNGQEKILLPPSDQSKFYSGDCYIFHYSYPGEDKEEHL-IGTWFGKQSVEEERAS  452

Query  348   A---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK------  500
             A   A K VE    L     Q R  +  E  +F S F+  I+ L+GG++ G+K       
Sbjct  453   AISLASKVVESLKFLAA---QARIYEGSEPIQFYSIFQSIIV-LKGGLSDGYKNYVAEKQ  508

Query  501   -PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANS  659
              P+E  +E    L+  +G     M+  QV     SLN    ++L +   ++ ++G  ANS
Sbjct  509   VPDETYQEDGVALFRVQGTGPDNMQAIQVDAVASSLNSSYCYILHSGSTVFTWSGGLANS  568

Query  660   NIQERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPMG  821
             + QE   + L++I+                   NLQ++      +S +FW+L GG +   
Sbjct  569   DDQELVERQLDLIK------------------PNLQSKTQKENVESEQFWDLLGGKS---  607

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSK-----------------------SN  932
              +  S   +   ++ P+LF       + +  E++K                        +
Sbjct  608   -EYPSQKIVRSAESDPRLFSCTFSNDHELKNEMNKIFNLHGILMLSCIKVVEIYNFTQDD  666

Query  933   LENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQG  1100
             L     ++LDC S++FVWVG+     +R  A    E+F+    + +K  +   I  + +G
Sbjct  667   LMTEDIFILDCHSDIFVWVGQQVNSKDRMHALTIGEKFIEHDFLMEKLSREASIYIVMEG  726

Query  1101  HETISFKCEFDSWPSASAT  1157
              E   F   F SW SA ++
Sbjct  727   SEP-PFFTRFFSWDSAKSS  744



>ref|XP_004161789.1| PREDICTED: LOW QUALITY PROTEIN: villin-4-like [Cucumis sativus]
Length=959

 Score =   463 bits (1192),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+E+WRIENF+PV +PK+ +GKF+ GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDQAFQGAGQKAGLEVWRIENFRPVLVPKSSHGKFFMGDSYIVLKTTSLKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGV+SGFK  E EE +T LY+CKGKRVV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVSSGFKHAEAEEHKTILYICKGKRVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+ ++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADVETGEFWALFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             V  + D   E  P KL  ++ G   P++ + L++  LE +KCY+LD G+EVF+W+GR + 
Sbjct  241   VAGEGDKTVESHPTKLLRVEKGNREPIEADSLARELLETNKCYILDSGTEVFIWMGRNSS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK + + AEE +    RP+ + I R+ +G E I F+ +FDSWP +A+    E+GRGK
Sbjct  301   LDERKNSSRAAEELVTGPDRPQ-SHIMRVIEGFEPIIFRAKFDSWPETAAVAVSEDGRGK  359


 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 154/348 (44%), Gaps = 37/348 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP +D  KFY+GD Y+   + SG+     F +  W GK + + E   
Sbjct  394   LQVWRVSGQEKLLLPVSDQTKFYTGDCYIFQYSYSGEDKEE-FLVGTWFGKQSVEGERAA  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-------PE  506
             A     ++   L    VQ R  + HE  +F S F+  I+  +GG++ G+K        P+
Sbjct  453   ALSLASKMVESLKFLPVQARIYEGHEPIQFYSIFQSFIV-FKGGLSDGYKNYITENEIPD  511

Query  507   EEEFE--TRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               + E    L+  +G     M+  QV     SLN    ++L +   ++ + G+ +N  ++
Sbjct  512   VTDSEDGVALFRVQGSGPENMQAIQVEAVGSSLNSSYCYILHSGSTVFTWCGSLTNTDDQ  571

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDII  851
                   +  +K       C     ++G     A+S +FW+L GG      +K+  +++  
Sbjct  572   ELVERFLDVIKPN-----CQSKPHKEG-----AESEQFWDLLGGKVEYPSQKIARNNE--  619

Query  852   PEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
                + P LF     + N    E+    + +L      +L C S++FVWVG+      +  
Sbjct  620   ---SDPHLFSCTFAKENLKVAEIYNFGQDDLMTEDIDILSCHSDIFVWVGQQVDPKTKVH  676

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A +  E+FL      +K  + T +  + +G E   F   F SW SA +
Sbjct  677   ALKIGEKFLEIDFXLEKLSRETPVYIVMEGSEP-PFFTRFFSWDSAKS  723



>ref|XP_004146329.1| PREDICTED: villin-4-like [Cucumis sativus]
 gb|KGN65472.1| hypothetical protein Csa_1G423300 [Cucumis sativus]
Length=962

 Score =   463 bits (1191),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 215/360 (60%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+E+WRIENF+PV +PK+ +GKF+ GDSY+VL+TTS K G 
Sbjct  1     MAVSMRDLDQAFQGAGQKAGLEVWRIENFRPVLVPKSSHGKFFMGDSYIVLKTTSLKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGV+SGFK  E EE +T LY+CKGKRVV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVSSGFKHAEAEEHKTILYICKGKRVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+ ++GEFW LFGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADVETGEFWALFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             V  + D   E  P KL  ++ G   P++ + L++  LE +KCY+LD G+EVF+W+GR + 
Sbjct  241   VAGEGDKTVESHPTKLLRVEKGNREPIEADSLARELLETNKCYILDSGTEVFIWMGRNSS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK + + AEE +    RP+ + I R+ +G E I F+ +FDSWP +A+    E+GRGK
Sbjct  301   LDERKNSSRAAEELVTGPDRPQ-SHIMRVIEGFEPIIFRAKFDSWPETAAVAVSEDGRGK  359


 Score = 86.3 bits (212),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 154/348 (44%), Gaps = 37/348 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   + + LP +D  KFY+GD Y+   + SG+     F +  W GK + + E   
Sbjct  394   LQVWRVSGQEKLLLPVSDQTKFYTGDCYIFQYSYSGEDKEE-FLVGTWFGKQSVEGERAA  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-------PE  506
             A     ++   L    VQ R  + HE  +F S F+  I+  +GG++ G+K        P+
Sbjct  453   ALSLASKMVESLKFLPVQARIYEGHEPIQFYSIFQSFIV-FKGGLSDGYKNYITENEIPD  511

Query  507   EEEFE--TRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               + E    L+  +G     M+  QV     SLN    ++L +   ++ + G+ +N  ++
Sbjct  512   VTDSEDGVALFRVQGSGPENMQAIQVEAVGSSLNSSYCYILHSGSTVFTWCGSLTNTDDQ  571

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDII  851
                   +  +K       C     ++G     A+S +FW+L GG      +K+  +++  
Sbjct  572   ELVERFLDVIKPN-----CQSKPHKEG-----AESEQFWDLLGGKVEYPSQKIARNNE--  619

Query  852   PEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
                + P LF     + N    E+    + +L      +L C S++FVWVG+      +  
Sbjct  620   ---SDPHLFSCTFAKENLKVAEIYNFGQDDLMTEDIDILSCHSDIFVWVGQQVDPKTKVH  676

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A +  E+FL      +K  + T +  + +G E   F   F SW SA +
Sbjct  677   ALKIGEKFLEIDFFLEKLSRETPVYIVMEGSEP-PFFTRFFSWDSAKS  723



>ref|XP_008789645.1| PREDICTED: villin-4-like [Phoenix dactylifera]
Length=962

 Score =   462 bits (1189),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/362 (60%), Positives = 279/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQK G+EIWRIENF P+P+PK+ YGKF++GD+YV+L+TT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKDGLEIWRIENFVPIPVPKSSYGKFFTGDAYVILKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQAHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGF+  E  E E   RL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QEGGVASGFRHTEVNEREHIIRLFVCRGKHVVHVKEVPFARASLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNGANS+IQERAKALEV+Q++KDTYH G C VA+VEDG L A+A++GEFW  FGGFAP+ 
Sbjct  181   FNGANSSIQERAKALEVVQYIKDTYHDGKCEVAVVEDGKLMADAEAGEFWGSFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RKV S+DD   E    KL C+  GQ  P++ + L +  L+ +KCYLLDCG+E+++W+GR 
Sbjct  241   RKVASEDDRNGEAFSTKLLCVAKGQTVPIEADSLVRELLDTNKCYLLDCGAEIYMWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGR  1175
             T L ERK+A   AEE L+   R KA  + R+ +G ET+ F+ +FD WP  +     E+GR
Sbjct  301   TSLGERKSASAAAEELLLDSSRRKAY-VIRIIEGFETVKFRSKFDKWPQMTEVAVSEDGR  359

Query  1176  GK  1181
              K
Sbjct  360   SK  361


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 153/355 (43%), Gaps = 47/355 (13%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEA  341
              +++W +   + + +P  D  KFYSGD Y+   T +G+    YL  I  W G+ + ++E 
Sbjct  396   NLQVWHVNGKEKILIPSYDQSKFYSGDCYIFQYTYAGEDKEEYL--IGSWFGEKSIEEER  453

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFE  521
               A     ++   L  + VQ R  +  E   F S F+  I+  +GG +SG+KK   E   
Sbjct  454   TAAISLASKMVESLKLQAVQTRFYEGKEPVLFFSIFQSFIV-YKGGRSSGYKKYVTENAV  512

Query  522   T-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
             T   Y   G  + R++          QV     SLN    ++L + + ++ ++G+ +   
Sbjct  513   TDETYSEDGIALFRVQGSGPDNMQAIQVDPVASSLNSSYCYILHSGNTVFTWSGSLTTTV  572

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPMGRKVT  833
             ++      +  +K                N+Q++      ++ +FW L GG      +  
Sbjct  573   DQELLERQLDLIKP---------------NMQSKPQKEGTEAEQFWNLLGGKCEYPSQKI  617

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
             + +    +++ P LF     + N    E+   ++ +L     ++LDC S++FVWVGR   
Sbjct  618   AKE----QESDPHLFSCTYSKGNLKLTEIFNFTQDDLMTEDIFILDCHSDIFVWVGRQVD  673

Query  1005  LDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
                R  A    E+FL    + +   + T +  + +G E   F   F +W SA + 
Sbjct  674   SKSRSQALSIGEQFLEHDFLLENLFQETPVYVVTEGSEP-PFFTRFFNWDSAKSV  727



>ref|XP_010656852.1| PREDICTED: villin-4 [Vitis vinifera]
 ref|XP_010656853.1| PREDICTED: villin-4 [Vitis vinifera]
 ref|XP_010656854.1| PREDICTED: villin-4 [Vitis vinifera]
 emb|CBI17857.3| unnamed protein product [Vitis vinifera]
Length=961

 Score =   461 bits (1185),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 226/360 (63%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAGIEIWRIENF+P+P+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGIEIWRIENFRPMPVPKSSYGKFFTGDSYVILKTTALKNGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
               GGVASGFK  E EE +TRLYVCKGK VV +K+V FAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QPGGVASGFKHAEAEEHKTRLYVCKGKHVVHVKEVSFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVASIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               ++DD   +  P KLFCI  GQ  PV  + L++  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANEDDKAVDSLPAKLFCILKGQAEPVQADSLTRELLDTNKCYILDCGVEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             LDERK+A   AEE L    RPK + I R+ +G ET+ F+ +FD WP  +A T  E+GRGK
Sbjct  301   LDERKSASSAAEELLRSLDRPK-SHIIRVIEGFETVMFRSKFDMWPETTAVTVSEDGRGK  359


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 89/376 (24%), Positives = 159/376 (42%), Gaps = 50/376 (13%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   +   L  +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKAAPVKEEPQPYIDCTG---NLQVWRVNGQEKTLLSASDQSKFYSGDCYIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLS  443
             +  G+       I  W GK + ++E  +A     ++   L     Q R  + +E  +F S
Sbjct  426   SYPGEDKEEHL-IGTWFGKQSVEEERTSAISLATKMVESLKFLPAQARIYEGNEPIQFFS  484

Query  444   YFKPCIMPLEGGVASGFKK-------PEEEEFETRLYVCK----GKRVVRMKQVPFARPS  590
              F+  I+  +GGV+ G+KK       P++   E R+ + +    G   ++  QV     S
Sbjct  485   IFQSFIV-FKGGVSDGYKKYIAEKEVPDDTYTEDRVALFRVQGSGPDNMQAIQVEPVASS  543

Query  591   LNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE  770
             LN    ++L++   ++ ++G  +  +++      +  +K            V+    +  
Sbjct  544   LNSSYCYILNSGSSVFNWSGNLTTPEDQELVERQLDVIKPN----------VQSKPQKEG  593

Query  771   ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLE  938
             ++S +FWE  GG +    +K+  D +       P LF     + N    E+   ++ +L 
Sbjct  594   SESEQFWEFLGGKSEYPSQKIARDAE-----NDPHLFSCTFSKGNLKVTEIFNFTQDDLM  648

Query  939   NSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHE  1106
                 ++LDC SE+FVWVG+      R  A    E+FL +    +K      I  + +G E
Sbjct  649   TEDIFILDCHSEIFVWVGQQVDSKNRMHALTIGEKFLERDFLLEKLSHTAPIYIIMEGSE  708

Query  1107  TISFKCEFDSWPSASA  1154
                F   F +W S  +
Sbjct  709   P-PFFTRFFTWDSGKS  723



>ref|XP_006381776.1| hypothetical protein POPTR_0006s17890g [Populus trichocarpa]
 gb|ERP59573.1| hypothetical protein POPTR_0006s17890g [Populus trichocarpa]
Length=767

 Score =   453 bits (1166),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 286/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+EIWRIENF+PVP+PK+ +GKF+ GDSYV+LQTT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKAGLEIWRIENFRPVPVPKSSHGKFFMGDSYVILQTTALKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              +GGVASGFK PE EE +T L+VC GK VV + +VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QKGGVASGFKHPEAEEHQTCLFVCTGKHVVHVNEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SD+D        KLFC++ GQ  PV+ + L++  L+ +KCY+LDCG+EVFVW+GR T 
Sbjct  241   TASDEDKTDVSLSTKLFCVEKGQAEPVETDSLTREFLDTNKCYILDCGAEVFVWMGRNTP  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A   AEE +   +RPK +++ R+ +G ET+ F+ +F+SWP + + T  E+GRGK
Sbjct  301   LDERKSASVAAEELVRAVERPK-SRVVRVIEGFETVMFRSKFESWPQTTNVTVSEDGRGK  359


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 94/387 (24%), Positives = 164/387 (42%), Gaps = 72/387 (19%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++W +   + V +P AD  KFYSG  Y+   
Sbjct  369   VNVKGLLKTAPAKEEPQPYIDVTG---NLQVWSVNGQEKVLIPAADQSKFYSGGCYIFQY  425

Query  264   TTSGKGG-PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             +  G+    YL  I  W GK + ++E  +A     ++   L     Q R  + +E  +F 
Sbjct  426   SYPGEDREEYL--IGTWFGKKSVKEERASAISLVSKMVESLKFLPAQARIYEGNEPIQFF  483

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  ++  +GG +SG+K   EE E     Y  +G  + R++          QV     
Sbjct  484   SIFQSFLV-FKGGHSSGYKNYIEENELPDETYKEEGIALFRVQGSGPDNMQALQVEPVAS  542

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L     ++ ++G  ++ +++      +  +K                N+Q+
Sbjct  543   SLNSSYCYILHNDSSVFTWSGNLTSSEDQELIERQLDLIKP---------------NMQS  587

Query  768   E-----ADSGEFWELFGGFA-----PMGRKVTSDDDIIPEKTPPKLF-CI---DNGQVNP  905
             +     +++  FW+L GG +      + R+  SD         P LF CI    N +V+ 
Sbjct  588   KPQKEGSEAEHFWDLLGGKSEYPSQKLAREGESD---------PHLFSCIFSKGNLKVSE  638

Query  906   VDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKA  1073
             +    ++ +L     ++LD  SE+FVWVG+      +  A    E+FL    + +K    
Sbjct  639   IYN-FTQDDLMTEDIFILDSHSEIFVWVGQQVDSKSKLQALTIGEKFLEHDFLLEKLSSE  697

Query  1074  TKITRLAQGHETISFKCEFDSWPSASA  1154
             T I  + +G E   F   F +W SA +
Sbjct  698   TPIYIVMEGSEP-PFFTRFFTWDSAKS  723



>gb|AFW88338.1| hypothetical protein ZEAMMB73_487687 [Zea mays]
Length=1040

 Score =   459 bits (1181),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 261/308 (85%), Gaps = 3/308 (1%)
 Frame = +3

Query  267   TSGKGGPYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSY  446
             T+ KGG YLFDIHFW+GKD+SQDEAGTAAIKTVELD++LGG+ VQHRE Q +ESD+FLSY
Sbjct  467   TTCKGGAYLFDIHFWIGKDSSQDEAGTAAIKTVELDSMLGGRAVQHREPQCYESDKFLSY  526

Query  447   FKPCIMPLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTK  626
             FKPCI+P+EGG ASGFKKPE ++FETRLY+CKGKR +R+K+VPFAR SLNHDDVF+LDT+
Sbjct  527   FKPCIIPMEGGFASGFKKPEVDKFETRLYICKGKRAIRVKEVPFARSSLNHDDVFILDTE  586

Query  627   DKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG  806
             +KIYQFNGANSNIQERAKALEVIQ LK+ YH GVC VAIV+DG LQAE+DSGEFW +FGG
Sbjct  587   NKIYQFNGANSNIQERAKALEVIQHLKEKYHDGVCAVAIVDDGKLQAESDSGEFWVVFGG  646

Query  807   FAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVW  986
             FAP+G+K  SDDD++ E T P+LF I NGQ+   D  L+KS LEN+KC+LLDCG+E+FVW
Sbjct  647   FAPIGKKAVSDDDVVLETTSPRLFSISNGQLKLEDTVLTKSILENTKCFLLDCGAELFVW  706

Query  987   VGRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP---SASAT  1157
             VGR TQ+++RKAA    E+F++K+ RPK T+IT++ QG E  +FK +F+SWP   +A + 
Sbjct  707   VGRVTQVEDRKAASAAVEKFIIKENRPKTTRITQVIQGFENHTFKSKFESWPVSNTAGSA  766

Query  1158  PPEEGRGK  1181
               EEGRGK
Sbjct  767   STEEGRGK  774


 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 109/208 (52%), Gaps = 13/208 (6%)
 Frame = +3

Query  171   EIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGTA  350
             ++W I +   + LPK + GKFYSGD YVVL T         F + +W+GK++ Q++  +A
Sbjct  824   QVWCINDSVKIALPKEELGKFYSGDCYVVLYTYHSVDKKEEFYLTYWIGKNSVQEDQESA  883

Query  351   AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFETR  527
                       L G+ V  R  Q  E  +F++ F+P ++ L+GG +SG+KK  EE+  +  
Sbjct  884   FQIANTTWNSLKGRPVLGRIYQGKEPPQFVALFQPMVI-LKGGTSSGYKKYVEEKGLKDE  942

Query  528   LYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQERA  677
              Y   G  ++++           QV     SL+  D FVL +K+ I+ +NG +S+++++ 
Sbjct  943   TYCSDGVALIQISGTAVHSNKTIQVDAVPASLSSTDCFVLQSKNSIFVWNGTSSSVEQQQ  1002

Query  678   KALEVIQFLKDTYHGGVCNVAIVEDGNL  761
              A +V +FLK  ++ G         GNL
Sbjct  1003  WASKVAEFLK-VWNNGTKFDIFFTHGNL  1029



>ref|XP_001768101.1| predicted protein [Physcomitrella patens]
 gb|EDQ66974.1| predicted protein [Physcomitrella patens]
Length=929

 Score =   456 bits (1172),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/363 (60%), Positives = 274/363 (75%), Gaps = 8/363 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++PAF   GQKAG++IWR+ENFKPV LPK  +GKFYSGDSY+VL++T+ K G 
Sbjct  1     MAVSMKNVDPAFHGVGQKAGMDIWRMENFKPVLLPKESHGKFYSGDSYIVLRSTALKSGG  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
               +DIHFWLGKDTSQDEAG AAIK VELD  LGG+ VQ+RE Q HE++ FLSYFKPCI+P
Sbjct  61    LHYDIHFWLGKDTSQDEAGAAAIKAVELDAALGGRAVQYRETQEHETELFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
             +EGGVASGFKK E E+ E RL+V KG+R VR+ QVPF+R SLNHDDVFVLDT+  I+QFN
Sbjct  121   MEGGVASGFKKLEVEKVEPRLFVVKGRRSVRVAQVPFSRSSLNHDDVFVLDTESTIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G  S+IQER KALEV+Q++KDTYH G C++ IV+DG L +EAD+G+FW LFGGFAP+ +K
Sbjct  181   GETSSIQERGKALEVVQYIKDTYHDGKCDIIIVDDGTLGSEADTGQFWVLFGGFAPLTKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
              T  DD  PE   PKL CI  G    V  E+SK  L++SKCY+LDCG+E+++W GR T L
Sbjct  241   ATVADD-APELPKPKLLCIVEGSFKGV--EISKDALDSSKCYVLDCGTELYLWAGRNTSL  297

Query  1008  DERKAACQTAEE----FLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
             D RKAA  TAE      + +    K TKITR+ +G ET+ F+  F+ WP +   T  EEG
Sbjct  298   DARKAAISTAEANSQGLITEHNTAKYTKITRVIEGFETLEFRSYFEKWPLNGHHTVSEEG  357

Query  1173  RGK  1181
             RGK
Sbjct  358   RGK  360


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 86/347 (25%), Positives = 147/347 (42%), Gaps = 39/347 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +E+WR+       +   D GKFY    YVV+ T  G+     + ++ W G+ TS ++   
Sbjct  395   LEVWRLVGGVKKEVAAGDVGKFYDHSCYVVIYTVQGEEQKEEYHLYSWTGRYTSPEDKVA  454

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGF-----------  494
             A     E +  L G+GVQ   IQ  E  +FL+ F    +   G   + F           
Sbjct  455   ATRVMNEKNAELKGRGVQAYIIQGKEPTQFLALFNANHILSWGFFLAYFDVYLHFNLLQE  514

Query  495   -KKPEEEEFETRLYVCK--GKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFNGANSNI  665
                P  +E    L   +  G  +V   Q+     SLN  D F+L T  K+Y ++G  S  
Sbjct  515   HTHPGHKEHSIMLVRVRAAGPHIVVAVQLEPVSASLNSSDCFLLQTSSKLYAWSGNLSTA  574

Query  666   QERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDD  845
             + +   L V + LK     GV    + E        +   FW   GG     RK  S   
Sbjct  575   ESQRAVLRVAEILKP----GVIARPVKES------LEPPLFWSSLGG----KRKYAS--H  618

Query  846   IIPEKTP--PKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
               P++ P  P+L+ +   QV  V    ++ +L +    ++DC + ++ WVG+    +E++
Sbjct  619   CKPKENPKDPRLY-VGTVQVTEVHN-FTQDDLLSDDIMIMDCHNVLYEWVGQHASSEEKE  676

Query  1020  AACQTAEEFLVKQKRPKA----TKITRLAQGHETISFKCEFDSWPSA  1148
              +    ++++ +  R       T I  + +G+E  +F   F SW ++
Sbjct  677   HSLDVGKKYIERAARLDGMLPDTPIFIITEGNEP-TFFTSFFSWDTS  722



>ref|XP_010443416.1| PREDICTED: villin-5 isoform X4 [Camelina sativa]
Length=959

 Score =   456 bits (1174),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+   Q AGQK+GIEIWRIENFKPV +P   +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQTLQGAGQKSGIEIWRIENFKPVTVPNESHGKFFTGDSYIVLKTTALRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD   E    KLF ++ G+  PV+ E L K  L+ +KCY+LDCG E+FVW GR T 
Sbjct  241   AAVNDDATAESDGIKLFSVEKGKTEPVEAESLEKELLDTNKCYILDCGLEMFVWKGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +D+RK A +TA+EF    +RPK+  ++ + +G+ET+ F+ +FDSWP++S  T P++GRGK
Sbjct  301   IDQRKNASETADEFFRSSERPKSNLVS-VMEGYETVMFRSKFDSWPASSTMTEPQQGRGK  359


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/350 (22%), Positives = 150/350 (43%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI + + + L  A+  KFYSGD Y+   +  G+       +  W GK + +D+  
Sbjct  394   NLQVWRINHEEKILLEAAEQTKFYSGDCYIFRYSYPGEDREEHL-VGTWFGKQSIEDDRA  452

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  453   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAFKKYIAENEIP  511

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  512   DTTYDAEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  571

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +    E+++ + D         A  E       ++S +FWE+ GG +    +K+  D   
Sbjct  572   Q----ELMERMLDLIKPNEPTKAHKEG------SESEQFWEILGGKSEYPSQKIKMD---  618

Query  849   IPEKTPPKLFCI----DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
               E++ P LF      D+ +V  +    ++ +L     ++LDC +E+F WVG+     ++
Sbjct  619   --EESDPHLFSCTFSNDDLKVTEI-FNFTQDDLMTEDIFILDCHTEIFAWVGQQVDSKKK  675

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                    E+F+    + +K    T I  + +G+E   F   F +W S+ +
Sbjct  676   PQVLAIGEKFIKHDFLLEKLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  724



>ref|XP_010443415.1| PREDICTED: villin-5 isoform X3 [Camelina sativa]
Length=961

 Score =   456 bits (1174),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+   Q AGQK+GIEIWRIENFKPV +P   +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQTLQGAGQKSGIEIWRIENFKPVTVPNESHGKFFTGDSYIVLKTTALRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD   E    KLF ++ G+  PV+ E L K  L+ +KCY+LDCG E+FVW GR T 
Sbjct  241   AAVNDDATAESDGIKLFSVEKGKTEPVEAESLEKELLDTNKCYILDCGLEMFVWKGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +D+RK A +TA+EF    +RPK+  ++ + +G+ET+ F+ +FDSWP++S  T P++GRGK
Sbjct  301   IDQRKNASETADEFFRSSERPKSNLVS-VMEGYETVMFRSKFDSWPASSTMTEPQQGRGK  359


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/350 (22%), Positives = 150/350 (43%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI + + + L  A+  KFYSGD Y+   +  G+       +  W GK + +D+  
Sbjct  394   NLQVWRINHEEKILLEAAEQTKFYSGDCYIFRYSYPGEDREEHL-VGTWFGKQSIEDDRA  452

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  453   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAFKKYIAENEIP  511

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  512   DTTYDAEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  571

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +    E+++ + D         A  E       ++S +FWE+ GG +    +K+  D   
Sbjct  572   Q----ELMERMLDLIKPNEPTKAHKEG------SESEQFWEILGGKSEYPSQKIKMD---  618

Query  849   IPEKTPPKLFCI----DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
               E++ P LF      D+ +V  +    ++ +L     ++LDC +E+F WVG+     ++
Sbjct  619   --EESDPHLFSCTFSNDDLKVTEI-FNFTQDDLMTEDIFILDCHTEIFAWVGQQVDSKKK  675

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                    E+F+    + +K    T I  + +G+E   F   F +W S+ +
Sbjct  676   PQVLAIGEKFIKHDFLLEKLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  724



>ref|XP_010483241.1| PREDICTED: villin-5-like isoform X2 [Camelina sativa]
Length=956

 Score =   456 bits (1173),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q AGQK+GIEIWRIENFKPV +P   +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGAGQKSGIEIWRIENFKPVTVPNESHGKFFTGDSYIVLKTTASRNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE + RLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQIRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD   E    KLF ++ G+  PV+ E L K  L+ ++CY+LDCG E+FVW GR+T 
Sbjct  241   AAVNDDATAESDGIKLFSVEKGKTEPVEAESLEKELLDTNRCYILDCGREMFVWKGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +D+RK A +TA+EF    +RP +  ++ + +G+ET+ F+ +FDSWP++S  T P++GRGK
Sbjct  301   IDQRKNASETADEFFRSSERPNSNLVS-VMEGYETVMFRSKFDSWPASSTMTEPQQGRGK  359


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 144/350 (41%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI + + + L  A+  KFYSGD Y+   +  G+       +  W GK + +D+  
Sbjct  394   NLQVWRINHEEKILLEAAEQTKFYSGDCYIFRYSYPGEDREEHL-VGTWFGKQSIEDDRA  452

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  453   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAFKKYIAENEIP  511

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  512   DTTYDAQGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  571

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +     ++  +K             E      E ++S +FWE+ GG      +K+  D +
Sbjct  572   QELMERMLDLIKPN-----------EPTKAHKEGSESEQFWEILGGKTEYPSQKIKMDGE  620

Query  846   IIPEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                  + P LF C  + +   V      S+ +L     ++LDC +E+F WVG+     ++
Sbjct  621   -----SDPHLFSCTFSNEDLKVTEIFNFSQDDLMTEDIFILDCHTEIFAWVGQQVDPKKK  675

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                    E+F+    + +     T I  + +G+E   F   F +W S+ +
Sbjct  676   TQVLAIGEKFIKHDFLVENLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  724



>ref|XP_006412744.1| hypothetical protein EUTSA_v10024322mg [Eutrema salsugineum]
 gb|ESQ54197.1| hypothetical protein EUTSA_v10024322mg [Eutrema salsugineum]
Length=969

 Score =   456 bits (1174),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF+P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFRPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYHGG C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHGGTCEVATVEDGKLMADAESGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+ + L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TATDEDKTYNSDITKLFCVEKGQANPVECDSLKRELLDTNKCYILDCGFEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W    + T  E+GRG+
Sbjct  301   LDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWTQETNTTVSEDGRGR  359


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 153/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ + +   L  AD+ KFYSGD YV   +  G+    +  I  W G  + ++E  
Sbjct  393   NLQVWRVNDQEKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGNRSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GGV++GFKK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGVSTGFKKYIAEQEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ + G  A S  
Sbjct  511   DDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWTGNLATSTD  570

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAP-MGR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG A  + +
Sbjct  571   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKAEYLSQ  612

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  613   KLTKE----PESDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  668

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  669   VVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_006586987.1| PREDICTED: villin-4-like [Glycine max]
Length=963

 Score =   456 bits (1173),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 224/362 (62%), Positives = 286/362 (79%), Gaps = 7/362 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGV+SGFK PE E+ +TRL+VC+GK VV +K+VPFAR SLNHDD+FVLDT+ KI+QFN
Sbjct  121   QEGGVSSGFKHPEAEKHKTRLFVCRGKHVVHVKEVPFARASLNHDDIFVLDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHEGKCEVAAVEDGKLMADPETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C++ GQ  PV+ + L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TASDDDKPTDSRPPKLLCVEKGQAEPVETDSLKRELLDTNKCYILDCGFEVFVWLGRNTS  300

Query  1005  LDERKAACQTAEEFL--VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGR  1175
             LDERK+A   A+E +    Q +P   +I R+ +G ET+ F+ +FDSWP  +  T  E+GR
Sbjct  301   LDERKSASGVADEIVSGTDQLKP---QIIRVIEGFETVMFRSKFDSWPQTTDVTVSEDGR  357

Query  1176  GK  1181
             GK
Sbjct  358   GK  359


 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 162/383 (42%), Gaps = 64/383 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++W +   + + L  +D  KFYSGD ++   
Sbjct  369   VNVKGLLKADPVREEPQPHIDCTGH---LQVWHVNGQEKILLQASDQSKFYSGDCFIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
             T  G+       I  W+GK++ ++E  +A   A K VE    L     Q R  + +E  +
Sbjct  426   TYPGEDKEDCL-IGTWIGKNSVEEERASANSLASKMVESMKFLAS---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFA  581
             F S  +  I+  +GG++ G+K    ++E     Y   G  + R++          QV   
Sbjct  482   FHSILQSFIV-FKGGISEGYKTYIAQKEIPDDTYNENGVALFRIQGSGPDNMQAIQVEPV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L     ++ ++G +++ + +     ++  +K                NL
Sbjct  541   ASSLNSSYCYILHNGPAVFTWSGNSTSAENQELVERMLDLIKP---------------NL  585

Query  762   QAE-----ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GE  917
             Q++     ++S +FW+L GG +    +K+  +    PE  P    C    G +   +   
Sbjct  586   QSKPQREGSESEQFWDLLGGKSEYPSQKILRE----PESDPHLFSCHFSKGNLKVTEVYN  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              S+ +L     ++LDC SE+FVWVG+      R  A    E+FL    + +K  +   I 
Sbjct  642   FSQDDLMTEDIFVLDCHSEIFVWVGQQVDSKSRMQALSIGEKFLEHDFLLEKLSRVAPIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASA  1154
              + +G E   F   F  W SA A
Sbjct  702   VVMEGSEP-PFFTRFFKWDSAKA  723



>ref|XP_010483240.1| PREDICTED: villin-5-like isoform X1 [Camelina sativa]
Length=958

 Score =   456 bits (1173),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q AGQK+GIEIWRIENFKPV +P   +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGAGQKSGIEIWRIENFKPVTVPNESHGKFFTGDSYIVLKTTASRNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE + RLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQIRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD   E    KLF ++ G+  PV+ E L K  L+ ++CY+LDCG E+FVW GR+T 
Sbjct  241   AAVNDDATAESDGIKLFSVEKGKTEPVEAESLEKELLDTNRCYILDCGREMFVWKGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA-TPPEEGRGK  1181
             +D+RK A +TA+EF    +RP +  ++ + +G+ET+ F+ +FDSWP++S  T P++GRGK
Sbjct  301   IDQRKNASETADEFFRSSERPNSNLVS-VMEGYETVMFRSKFDSWPASSTMTEPQQGRGK  359


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 75/349 (21%), Positives = 146/349 (42%), Gaps = 37/349 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI + + + L  A+  KFYSGD Y+   +  G+       +  W GK + +D+  
Sbjct  394   NLQVWRINHEEKILLEAAEQTKFYSGDCYIFRYSYPGEDREEHL-VGTWFGKQSIEDDRA  452

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  453   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAFKKYIAENEIP  511

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  512   DTTYDAQGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  571

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +    E+++ + D         A  E       ++S +FWE+ GG      +K+  D + 
Sbjct  572   Q----ELMERMLDLIKPNEPTKAHKEG------SESEQFWEILGGKTEYPSQKIKMDGE-  620

Query  849   IPEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
                 + P LF C  + +   V      S+ +L     ++LDC +E+F WVG+     ++ 
Sbjct  621   ----SDPHLFSCTFSNEDLKVTEIFNFSQDDLMTEDIFILDCHTEIFAWVGQQVDPKKKT  676

Query  1020  AACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                   E+F+    + +     T I  + +G+E   F   F +W S+ +
Sbjct  677   QVLAIGEKFIKHDFLVENLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  724



>ref|XP_010447761.1| PREDICTED: villin-4-like [Camelina sativa]
Length=975

 Score =   456 bits (1174),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF+P  +PK+  GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFRPTLIPKSSIGKFFTGDSYIILKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHTTRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDTTKLFCVEKGQANPVEGDSLKREMLDTNKCYILDCGIEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+RK A    EE +   +RPK+  I R+ +G ET+SF+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASGATEEMIRSSERPKSQMI-RIIEGFETVSFRSKFESWTKETNTTVSEDGRGR  359


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 147/353 (42%), Gaps = 44/353 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  393   NLQVWRVNGQEKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERV  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMARKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKHIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGLALFRIQGSGPDNMQAIQVDPVASSLNSSYCYILHNDSSVFTWAGNLSTSTD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GRKVT  833
             +      +  +K                NLQ  A     +S +FWEL GG A    +K+T
Sbjct  571   QELVERQLDLIKP---------------NLQTRAQKEGSESEQFWELLGGKAEYSSQKLT  615

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
              +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG     
Sbjct  616   KE----PEHDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVGHEVAP  671

Query  1008  DERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               +  A    E+F+ K    +K      +  + +G E   F   F SW S+ +
Sbjct  672   KNKLLALTIGEKFIEKDSLLEKLSPEAPVYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_010438211.1| PREDICTED: villin-4 [Camelina sativa]
Length=975

 Score =   456 bits (1173),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF+P  +PK+  GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFRPTLIPKSSIGKFFTGDSYIILKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHTTRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDTTKLFCVEKGQANPVEGDSLKREMLDTNKCYILDCGIEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+RK A    EE +   +RPK+  I R+ +G ET+SF+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASGATEEMIRSSERPKSQMI-RIIEGFETVSFRSKFESWTKETNTTVSEDGRGR  359


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/353 (25%), Positives = 148/353 (42%), Gaps = 44/353 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G
Sbjct  393   NLQVWRVNGQEKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKHIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGLALFRIQGSGPDNMQAIQVDPVASSLNSSYCYILHNDSSVFTWAGNLSTSTD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GRKVT  833
             +      +  +K                NLQ  A     +S +FWEL GG A    +K+T
Sbjct  571   QELVERQLDLIKP---------------NLQTRAQREGSESEQFWELLGGKAEYSSQKLT  615

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
              +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG     
Sbjct  616   KE----PEHDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVGHEVAP  671

Query  1008  DERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               +  A    E+F+ K    +K      +  + +G E   F   F SW S+ +
Sbjct  672   KNKLLALTIGEKFIEKDSLLEKLSPEAPVYVIMEGGEPSFFTRFFTSWDSSKS  724



>gb|KDP35406.1| hypothetical protein JCGZ_10390 [Jatropha curcas]
Length=968

 Score =   456 bits (1172),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+EIWRIENF+PVP+PK+ YGKF  GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKAGLEIWRIENFRPVPVPKSSYGKFLMGDSYVILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+REIQ HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREIQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG+ASGFK  E EE +TRL+VCKGK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGIASGFKHAEAEEHQTRLFVCKGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              T+D+D   +  P KLF ++  Q  PV+ + L++  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TTTDEDKTVDSHPTKLFSVEKDQAQPVEADSLTRELLDTNKCYILDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK+A   AEE +   +RPK + I R+ +G ET+ F+ +F+SWP  +  T  E+GRGK
Sbjct  301   LDERKSASGVAEELVRGAERPK-SHIIRVIEGFETVMFRSKFESWPQTTDVTVSEDGRGK  359


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 162/374 (43%), Gaps = 46/374 (12%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQ-------KAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTS  272
             VNVK L  A  A  +          +++WR++  + V L  +D+ K YSGD Y+   +  
Sbjct  369   VNVKGLLKAAPAKEEPQPYIDVTGNLQVWRVDGQEKVLLQASDHSKLYSGDCYIFQYSYP  428

Query  273   GKGGP-YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYF  449
             G+    YL  I  W GK + ++E  +A      +   L     Q R  + +E  +F + F
Sbjct  429   GEDKEEYL--IGTWFGKKSVEEERASAISLVSMMVESLKFVPAQARIYEGNEPIQFSTIF  486

Query  450   KPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLN  596
             +  I+  +GG+++G+K    E E     Y   G  + R++          QV     SLN
Sbjct  487   QSFIV-FKGGLSTGYKNYIAENELPDETYQEDGLALFRVQGSGPDNMQAIQVEPVASSLN  545

Query  597   HDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEAD  776
                 ++L     ++ ++G  +   ++      +  +K            V+    +  ++
Sbjct  546   SSYCYILQNDSSVFTWSGNLTTSDDQELMERQLDLIKPN----------VQSKTQKEGSE  595

Query  777   SGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLF-CI---DNGQVNPVDGELSKSNLENS  944
             S +FW L GG +    +  S   +   ++ P LF CI    N +V+ +    ++ +L   
Sbjct  596   SEQFWNLLGGKS----EYPSQKIVREAESDPHLFSCIFSKGNLKVSEIYN-FTQDDLMTE  650

Query  945   KCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETI  1112
               ++LDC SE+FVWVG+      +  A    E+FL    + +K  +   I  + +G+E  
Sbjct  651   DIFILDCHSEIFVWVGQQVDSKSKMLAFSIGEKFLENDFMLEKLSREAPIFIVMEGNEP-  709

Query  1113  SFKCEFDSWPSASA  1154
              F   F +W SA +
Sbjct  710   PFFTRFFAWDSAKS  723



>ref|XP_010525718.1| PREDICTED: villin-4 [Tarenaya hassleriana]
Length=964

 Score =   455 bits (1171),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAGIE+WRIENF+PV +PK  +GKF++GDSY+VL+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGIEVWRIENFRPVSVPKTSHGKFFTGDSYIVLKTTALKNGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE + RL+VC+GK VV + +VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHKIRLFVCRGKHVVHVNEVPFARTSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAESGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S+++   +    KLFC++ GQ NPV+GE L ++ LE +KCY+LDCG EVFVW+GR T 
Sbjct  241   TASEEEKTYDSDSAKLFCVEKGQANPVEGESLKRATLETNKCYILDCGREVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LDERK+A   AEE +    RP+ ++I R  +G ET+ F+ +FDSW    +    E+GRG+
Sbjct  301   LDERKSASGVAEEMIRSSDRPR-SQIIRTIEGFETVPFRSKFDSWTQETNVAVSEDGRGR  359


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 153/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++W +   + + L   D  KFYSGD Y+   + SG+    +  I  W GK + ++E  +
Sbjct  394   LQVWHVNGQEKILLKGVDQTKFYSGDCYIFQYSYSGEEKEEVL-IGTWFGKQSVEEERAS  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFET  524
             A     ++   +    VQ    +  E  +F    +  I+  +GG++SG+K    E+E   
Sbjct  453   AVSMASKMIESMKFTPVQACIYEGKEPIQFFVIMQSFIV-FKGGLSSGYKTHVTEKEIPD  511

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNIQ  668
               Y   G  + R++          QV     SLN    ++L     ++ ++G  A+S  Q
Sbjct  512   DTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNGSTVFTWSGNLASSVDQ  571

Query  669   E-RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPMG-RK  827
             E   + L++I+                   NLQ  A     +S +FWEL GG +  G +K
Sbjct  572   ELMERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKSEYGSQK  613

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
             +T +    PE  P    C  +  +  V      ++ +L     ++LDC SE+FVWVG+  
Sbjct  614   ITRE----PESDPHLFSCTFSKGILKVTEIYNFTQDDLMTEDIFILDCHSEIFVWVGQEV  669

Query  1002  QLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
                 +  A     +F+ K    +K  +   I  + +G E   F   F SW S+ +T
Sbjct  670   DTKTKLQALTIGVKFIEKDFLLEKLSREAPIFIVMEGSEPPFFTRSFASWDSSKST  725



>emb|CDY42253.1| BnaC02g11620D [Brassica napus]
Length=476

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 271/360 (75%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q  GQK+GIEIWRIENFKPV +PK   GKF++GDSY+VL+T + + G 
Sbjct  1     MTFSMRDLDEALQGCGQKSGIEIWRIENFKPVTVPKESRGKFFTGDSYIVLKTAASRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  AI TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAIMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + E+ +TRLY+CKGK VVR   VPFAR +LNHDDVF+LDT+ KI+QF+
Sbjct  121   QEGGVASGFNHVKPEKHQTRLYICKGKHVVR---VPFARSTLNHDDVFILDTESKIFQFS  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A VEDG L A+A++GEFW LFGGFAP+ +K
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRLMADAEAGEFWGLFGGFAPLPKK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                 D    E    KL  ++ GQ  P++ E L K  L+ +KCY+LDCG E+FVW GR T 
Sbjct  238   SALRDHQTAESDGLKLSSVEKGQTKPIEAESLQKELLDTNKCYILDCGLELFVWKGRQTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK+A + AEE      RPK+  ++ + +G ET+ F+ +FDSWP+ SA   P+ GRGK
Sbjct  298   IDQRKSASKAAEELFRSSVRPKSNLVS-VMEGFETVMFRSKFDSWPATSAVAEPQHGRGK  356



>ref|XP_007138797.1| hypothetical protein PHAVU_009G238200g [Phaseolus vulgaris]
 gb|ESW10791.1| hypothetical protein PHAVU_009G238200g [Phaseolus vulgaris]
Length=962

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    MRHDIHYWLGKDTSQDEAGVAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK PE E+ +TRL+VC+GK VV +K+VPFAR SLNHDD+FVLDT+ K++QFN
Sbjct  121   QEGGVASGFKHPEAEKHKTRLFVCRGKHVVHVKEVPFARASLNHDDIFVLDTESKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C+VA VEDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCDVAAVEDGKLMADPETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                DDD   +  P KL CI+ GQ  PV+ + L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TAGDDDKATDSRPLKLLCIEKGQAEPVEADSLKRELLDTNKCYILDCGFEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A   A+E      + K  +I R+ +G ET+ F+ +FDSWP +A  T  E+GRGK
Sbjct  301   LDERKSASGVADELACGIDKLKP-QIIRVIEGFETVMFRSKFDSWPQTADVTVSEDGRGK  359


 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 95/384 (25%), Positives = 166/384 (43%), Gaps = 64/384 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR++  + + L  +D  KFYSGD Y+   
Sbjct  369   VNVKGLLKAVPVREEPQPHIDCTGH---LQVWRVKGQEKIILQASDQSKFYSGDCYIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
             T  G+       I  W+GK++ ++E  +A   A K VE    L     Q R  + +E  +
Sbjct  426   TYPGEDKEDCL-IGTWIGKNSVEEEQASANSLASKMVESMKFLA---CQARIYEGNEPVQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-------PEE--EEFETRLYVCKGKRVVRMK--QVPFA  581
             F S  +  I+  +GG+  G+K        P+E  +E    L+  +G     M+  QV   
Sbjct  482   FYSILQSLIV-FKGGLGEGYKTYIAGKEIPDETYDENGVALFRIQGSGPDNMQAIQVEPV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L     ++ ++G ++  +++     ++  +K                NL
Sbjct  541   ASSLNSSYCYILHNGPAVFTWSGNSTTAEDQELVERMLDLIKP---------------NL  585

Query  762   QAE-----ADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGEL--  920
             Q++     ++S +FW+L GG +    +  S   +   ++ P LF     + N    E+  
Sbjct  586   QSKPQREGSESEQFWDLLGGKS----EYPSQKILREAESDPHLFSCHFSKGNLKVTEVYN  641

Query  921   -SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              S+ +L     ++LDC  E+FVWVG+      R  A    E+FL    + +K  +   I 
Sbjct  642   FSQDDLMTEDIFILDCHLEIFVWVGQQVDSKSRMQALTIGEKFLEHDFLLEKLSRVAPIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASAT  1157
              + +G E   F   F  W SA ++
Sbjct  702   VIMEGSEP-PFFTRFFKWDSAKSS  724



>ref|XP_009109002.1| PREDICTED: villin-4-like [Brassica rapa]
Length=978

 Score =   455 bits (1171),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHD +++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDGIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADAESGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ SKCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDITKLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET++F+ +FD+W    + T  E+GRG+
Sbjct  301   LDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVTFRSKFDTWTQETNTTVSEDGRGR  359


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 151/356 (42%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + V L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  393   NLQVWRVNGQEKVLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPLQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF--NGANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ +  N A S  
Sbjct  511   EDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWIGNLATSTD  570

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  571   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYRSQ  612

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C     +  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  613   KLTKE----PESDPHLFSCSFTKDILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  668

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  669   VAPKNKLQALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_003546420.1| PREDICTED: villin-4-like isoform 1 [Glycine max]
Length=963

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/362 (62%), Positives = 284/362 (78%), Gaps = 7/362 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK PE E+ +TRL+VC+GK VV +K+VPFAR SLNHDD+FVLDT+ KI+QFN
Sbjct  121   QEGGVASGFKHPEAEKHKTRLFVCRGKHVVHVKEVPFARASLNHDDIFVLDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHEGKCEVAAVEDGKLMADPETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SDDD   +  PPKL C + GQ  PV+ + L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TASDDDKPTDSRPPKLLCFEKGQAEPVETDSLKRELLDTNKCYILDCGFEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFL--VKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGR  1175
             LDERK A   A+E +    Q +P   +I R+ +G ET+ F+ +FDSWP  +  T  E+GR
Sbjct  301   LDERKIASGVADELVSGTDQLKP---QIIRVIEGFETVMFRSKFDSWPQITDVTVSEDGR  357

Query  1176  GK  1181
             GK
Sbjct  358   GK  359


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 91/384 (24%), Positives = 162/384 (42%), Gaps = 64/384 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + L  +D  KFYSGD ++   
Sbjct  369   VNVKGLLKADPVREEPQPHIDCTGH---LQVWRVNGQEKILLQASDQSKFYSGDCFIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
             T  G+       I  W+GK++ ++E  +A   A K VE    L     Q R  + +E  +
Sbjct  426   TYPGEDKEDCL-IGTWIGKNSVEEERASANSLASKMVESMKFLAS---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFA  581
             F S  +  I+  +GG++ G+K    ++E     Y   G  + R++          QV   
Sbjct  482   FHSILQSFIV-FKGGLSEGYKTYIAQKEIPDDTYNENGVALFRIQGSGPDNMQAIQVEPV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L     ++ ++G +++ + +     ++  +K                NL
Sbjct  541   ASSLNSSYCYILHNGPAVFTWSGNSTSAENQELVERMLDLIKP---------------NL  585

Query  762   QAE-----ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GE  917
             Q++     ++S +FW+  GG +    +K+  +    PE  P    C    G +   +   
Sbjct  586   QSKPQREGSESEQFWDFLGGKSEYPSQKILRE----PESDPHLFSCHFSKGNLKVTEVYN  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              S+ +L     ++LDC SE+FVWVG+      R  A    E+FL    + +K      + 
Sbjct  642   FSQDDLMTEDIFILDCHSEIFVWVGQQVDSKSRMQALTIGEKFLEHDFLLEKLSHVAPVY  701

Query  1086  RLAQGHETISFKCEFDSWPSASAT  1157
              + +G E   F   F  W SA ++
Sbjct  702   VVMEGSEP-PFFTRFFKWDSAKSS  724



>gb|EPS57833.1| hypothetical protein M569_16984, partial [Genlisea aurea]
Length=473

 Score =   439 bits (1129),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/361 (58%), Positives = 280/361 (78%), Gaps = 3/361 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             TMS+++K L+PAFQ AGQK GIEIWRIENF P+P+ K+ YGKF+SGDSYV+L+T++ K G
Sbjct  3     TMSISLKNLDPAFQGAGQKDGIEIWRIENFNPIPVSKSSYGKFFSGDSYVILKTSALKNG  62

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                 D+H+WLG DTSQDEAGTAAIK+VELD  LGG+ VQ+RE+Q HES++FLSYFKPCI+
Sbjct  63    SLHHDVHYWLGSDTSQDEAGTAAIKSVELDAALGGRAVQYREVQGHESEKFLSYFKPCII  122

Query  465   PLEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQF  644
             P +GG ASGFK  E   ++TRLYVC+GK VV + +VPF+R SLNHDD+F+LDT  KI+QF
Sbjct  123   PQKGGFASGFKHVEAAVYQTRLYVCRGKHVVNVTEVPFSRSSLNHDDIFILDTALKIFQF  182

Query  645   NGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGR  824
             NG+NS+IQERAKALEV+Q++KDT+H G C +A +EDG L A+AD+GEFW  FGGFAP+ R
Sbjct  183   NGSNSSIQERAKALEVLQYIKDTFHDGKCEIASIEDGRLMADADTGEFWGFFGGFAPLPR  242

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG-ELSKSNLENSKCYLLDCGSEVFVWVGRAT  1001
             K  +++    +  P KLF ++ G+  P++   L++  ++  +CY+LDCGSEVFVW+GR+T
Sbjct  243   KTVNEETESADILPHKLFRVEKGEATPIEAVSLTRELIDTYRCYILDCGSEVFVWMGRST  302

Query  1002  QLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRG  1178
              LD+RK A   A+E L    R K T++TR+ +G ET+ F+ +FDSWP S +    EEGRG
Sbjct  303   SLDQRKGASSAADEMLRSLNRYK-TRVTRVIEGFETVEFRSKFDSWPESPNVVVSEEGRG  361

Query  1179  K  1181
             K
Sbjct  362   K  362



>ref|XP_002438788.1| hypothetical protein SORBIDRAFT_10g026230 [Sorghum bicolor]
 gb|EER90155.1| hypothetical protein SORBIDRAFT_10g026230 [Sorghum bicolor]
Length=947

 Score =   454 bits (1169),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 278/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  YGKF++GDSY+VL+TT+ K G 
Sbjct  1     MAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESYGKFFTGDSYIVLKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+REIQ +E+++FLSYFKPCI+P
Sbjct  61    FRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREIQGNETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGF+  E  E E +TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   EEGGVASGFRHAEVNEREHKTRLFVCRGKHTVHVKEVPFARASLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q LKDT H G C VA VEDG L A+AD+GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQHLKDTNHDGKCEVAAVEDGKLMADADAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSN-LENSKCYLLDCGSEVFVWVGRA  998
             RK  S+ +     +  KL C++ GQ  P+D E+ K   L+++KCYLLDCGSE++VW+GR 
Sbjct  241   RKTFSELNGKDFTSTSKLLCVNKGQSAPIDCEILKRELLDSTKCYLLDCGSEIYVWMGRE  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK     AEE L +  RPK + I RL +G ET++FK +FD WP  A A   +E R
Sbjct  301   TTLEERKRGGSAAEELLREGNRPK-SHIIRLMEGFETVTFKSKFDKWPKKADAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 89/352 (25%), Positives = 151/352 (43%), Gaps = 37/352 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+       L  ++  KFYSGD Y+   T  G  G     I  W GK + Q+E  +
Sbjct  396   LQVWRVNGSDKTFLSFSEQCKFYSGDCYIFQYTYPGDNGDECL-IGTWFGKKSVQEERSS  454

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   E 
Sbjct  455   AISLADKMIESLKFQAVLVRVYEGKEPIEFFPIFQNLVI-YKGGTSTGYKKFVSESGIED  513

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y  KG  + R++          QV  A  SLN    ++L   D ++ + G  S+  ++
Sbjct  514   DTYSEKGVALFRVQGSGPENMQAIQVDTAASSLNSSYCYILHDGDTVFTWIGNLSSSMDQ  573

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG-RKVTSDDDII  851
               A   +  +K      +          L+  ++  +FW+L G  +  G +K+  D    
Sbjct  574   ELAERQLDVIKPNLQSRM----------LKEGSEYDQFWKLLGVKSEYGSQKIVRD----  619

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++ P LF C     V  V      ++ +L     ++LDC S VFVWVG+      R  
Sbjct  620   -QESDPHLFACTFIKGVLKVREIFNFTQDDLMTEDIFILDCHSCVFVWVGQRVDTKIRAQ  678

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASATPPE  1166
             A    E+FL    + +   + T +  + +G E   F   F SW SA ++ P+
Sbjct  679   ALNIGEKFLELDILMENVSRETPLYVITEGSEPQYF-TRFFSWDSAKSSKPK  729



>dbj|BAK02464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1002

 Score =   456 bits (1172),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/363 (60%), Positives = 285/363 (79%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             TM+++++ ++PAFQ AGQK G+EIWRIE  + VP+P+  +GKF++GDSY++L+T++ K G
Sbjct  33    TMAISMRDVDPAFQGAGQKDGLEIWRIEKLQAVPVPRESHGKFFTGDSYIILKTSARKNG  92

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDE+GTAAIKTVELD  LGG+GVQ+RE+Q +E+++FLSYFKPCI+
Sbjct  93    SFQHDIHYWLGKDTSQDESGTAAIKTVELDVALGGRGVQYREVQGNETEKFLSYFKPCII  152

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGGVASGF+  E  E E  TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  153   PEEGGVASGFRHAEINEREHVTRLFVCRGKHTVHVKEVPFARSSLNHDDIFILDTKSKIF  212

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKDT H G C+VA VEDG L A+AD+GEFW LFGGFAP+
Sbjct  213   QFNGSNSSIQERAKALEVVQYLKDTNHEGKCDVAAVEDGKLMADADAGEFWGLFGGFAPL  272

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  S+ +     +PPKL  ++ GQ  PVD E L+K+ L+++KCYLLDCGSE++VW+GR
Sbjct  273   PRKTFSEPNGKDTASPPKLLWVNKGQTVPVDYEVLTKALLDSTKCYLLDCGSEIYVWMGR  332

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L++RK A   AEE L +  RPK + I RL +G ET+ F+ +F+ WP  A A   +E 
Sbjct  333   ETALEDRKQAGLAAEELLREGDRPK-SHIVRLMEGFETVIFRSKFNKWPKKAEAVVSDES  391

Query  1173  RGK  1181
             RGK
Sbjct  392   RGK  394


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 145/348 (42%), Gaps = 35/348 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ + +   L  ++  KFYSGD Y+   +  G  G     I  W GK + ++E  
Sbjct  428   NLQVWRVNDSEKTFLSFSEQCKFYSGDCYIFQYSYPGDDGEECL-IGTWFGKKSIEEERA  486

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   +
Sbjct  487   AATSLANKMVESLKFQAVLVRLYEGKEPIEFFPIFQNLVI-FKGGASTGYKKFVSENGIQ  545

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV    PSLN    ++L   D ++ + G  S+  +
Sbjct  546   DDTYSENGVALFRVQGSGPDNMQAIQVDAVAPSLNSSYCYILHDGDTVFTWIGNLSSTMD  605

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
                A   +  +K      +          L+  ++  +FW++ G  +    +  + D   
Sbjct  606   HELAERQLDVIKPNLQSRM----------LKEGSEYDQFWKILGIKSEYSSQKIARD---  652

Query  852   PEKTPPKLFCID--NGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++ P LFC     G +   +    ++ ++     ++LDC S VF+WVG+      R  
Sbjct  653   -QESDPHLFCCTFLKGVLKVREIFNFTQDDMMTEDIFILDCRSCVFIWVGQNVDTKIRAQ  711

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A    E+FL      +   + T +  + +G E   F   F +W SA +
Sbjct  712   ALSIGEKFLELDIPMENLSRETPVYVINEGSEP-QFFTRFFTWDSAKS  758



>ref|NP_194745.1| villin 4 [Arabidopsis thaliana]
 sp|O65570.1|VILI4_ARATH RecName: Full=Villin-4 [Arabidopsis thaliana]
 emb|CAA73320.1| putative villin [Arabidopsis thaliana]
 emb|CAB52460.1| putative villin [Arabidopsis thaliana]
 emb|CAB81009.1| putative villin [Arabidopsis thaliana]
 dbj|BAC41968.1| putative villin [Arabidopsis thaliana]
 gb|AAO64915.1| At4g30160 [Arabidopsis thaliana]
 gb|AEE85727.1| villin 4 [Arabidopsis thaliana]
Length=974

 Score =   454 bits (1169),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFIPTPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVVAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        +LFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDITRLFCVEKGQANPVEGDTLKREMLDTNKCYILDCGIEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A + AEE +   +RPK+  I R+ +G ET+ F+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASKAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFESWTQETNTTVSEDGRGR  359


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 88/349 (25%), Positives = 150/349 (43%), Gaps = 36/349 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+       L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G
Sbjct  393   NLQVWRVNGQAKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPIQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGVALFRIQGSGPENMQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +  A   +  +K             +    Q E ++S +FWEL GG A    +K+T +  
Sbjct  571   QELAERQLDLIKPN-----------QQSRAQKEGSESEQFWELLGGKAEYSSQKLTKE--  617

Query  846   IIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
               PE+ P    C    +V  V      ++ +L     +++DC SE+FVWVG+      + 
Sbjct  618   --PERDPHLFSCTFTKEVLKVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVGQEVVPKNKL  675

Query  1020  AACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
              A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  676   LALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_009137891.1| PREDICTED: villin-4-like [Brassica rapa]
Length=976

 Score =   454 bits (1169),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 281/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPTPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              E GVASGFK  E EE  TRL+VC+GK VV +K+V FAR SL HDD+++LDTK KI+QFN
Sbjct  121   QESGVASGFKHVEAEEHITRLFVCRGKHVVHVKEVTFARSSLTHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ SKCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTHTSDIKKLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET++F+ +FD+W   +  T  E+GRG+
Sbjct  301   LDDRKTASGAAEEMIRSSERPKSQMI-RIIEGFETVTFRSKFDTWAQVTNTTVSEDGRGR  359


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 152/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ + + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  393   NLQVWRVNDQQKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG+ SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPIQFFVIMQSFIV-FKGGIGSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SL+    ++L     ++ + G  A S  
Sbjct  511   DDTYNENGLALFRIQGPGPENMQAIQVDPVASSLSSSYCYILHNDTSVFTWTGNLATSTD  570

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  571   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYSSQ  612

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  613   KLTKE----PESDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  668

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  669   VVPKNKLQALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_010927065.1| PREDICTED: villin-4-like [Elaeis guineensis]
Length=958

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/362 (62%), Positives = 287/362 (79%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF PV +PK+ +GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFHPVAVPKSSHGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              +GGVASGF+  E  E E ETRLYVCKGK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QQGGVASGFRHAEVNEHEHETRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q++KDTYH G C VA V+DG L A A++GEFW  FGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVDDGKLMANAEAGEFWGFFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             R+  S+D    E    KL C++NGQ  P+D + L++  L+ +KCYLLDCG EV+VW+GR 
Sbjct  241   RRAASEDGKNAEVFSAKLLCVENGQPVPIDADTLTREMLQTNKCYLLDCGIEVYVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK+A   AE+ L +  RPKA  + R+ +G ET+ F+ +FD+WP +A+ T  E+GR
Sbjct  301   TSLEERKSASTVAEDLLHEPDRPKA-HVIRVIEGFETVMFRSKFDTWPQTANVTVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 157/350 (45%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-PYLFDIHFWLGKDTSQDEA  341
              +++WR+   +  PL  +D  KFYSGD Y+   +  G+    YL  +  W GK + ++E 
Sbjct  396   NLQVWRVNGQEKTPLSSSDQSKFYSGDCYIFQYSYPGEDREEYL--VGTWFGKKSVEEER  453

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEF  518
               A     ++   L  + VQ R  +  E  +FLS F+  I+  +GGV+SG++    E + 
Sbjct  454   AAAISLAKKMVESLKSQAVQARVYEGKEPIQFLSIFQSFIV-YKGGVSSGYRNFITENDI  512

Query  519   ETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
                 Y   G  + R++          QV     SLN    ++L   + ++ ++G+ +  +
Sbjct  513   ADETYSEDGLALFRVQGSGPDNMQAIQVDPVASSLNSSYCYILHCGNTVFTWSGSLTTSE  572

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAP-MGRKVTSDDD  845
             ++      +  +K            V+    +   ++ +FW+L GG +  + +KV  +  
Sbjct  573   DQELVERQLDIIKPN----------VQSKPQKEGTETEQFWDLLGGKSEYLSQKVGKE--  620

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                 ++ P LF  D  + +    E+   ++ +L     ++LDC S +FVWVG+      +
Sbjct  621   ---RESDPHLFSCDFSKGDLKITEIYSFTQDDLMTEDIFILDCHSNIFVWVGQQADSKSK  677

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               A    E+FL    + +K  + T I  + +G E   F   F +W SA +
Sbjct  678   LQALSIGEKFLEHDFLLEKLSQETPIFVVMEGSEP-PFFTHFFTWDSAKS  726



>ref|XP_010913698.1| PREDICTED: villin-4-like [Elaeis guineensis]
Length=962

 Score =   454 bits (1167),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/362 (62%), Positives = 285/362 (79%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K L+ AFQ AGQKAG+EIWR+ENF+PVP+PK+ YGKF++GD+YV+L+TT+ K G 
Sbjct  1     MAVSMKDLDSAFQGAGQKAGLEIWRVENFRPVPVPKSSYGKFFTGDAYVILKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGFK  E  E E   RL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QEGGVASGFKHTEVNEREHVIRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNGANS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW  FGGFAP+ 
Sbjct  181   FNGANSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAEAGEFWGFFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RKV SDDD        KLFC+D GQ+ P++ + L++  L+ +KCYLLDCG+E+++W+GR 
Sbjct  241   RKVASDDDRNGVAFSTKLFCVDKGQMVPIEADSLARDLLDTNKCYLLDCGAEIYIWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGR  1175
             T L+ERK+A   AEE L    RPKA  I R+ +G ET+ F+ +FD WP  +     E+GR
Sbjct  301   TSLEERKSASAAAEELLHDPSRPKA-HIIRIIEGFETVMFRSKFDKWPQTTDVAVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/353 (23%), Positives = 153/353 (43%), Gaps = 45/353 (13%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ + + + +P +D  KFYSGD Y+   T  G+     + I  W GK + ++E  
Sbjct  396   NLQVWRVNSKEKILIPSSDQSKFYSGDCYIFQYTYPGEDKEE-YIIGTWFGKKSIEEEKA  454

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A +   ++   L  + VQ R  +  E  +F S F+  ++  +GG++SG+KK   E    
Sbjct  455   AAILLASKMVESLKSQAVQARFYEGKEPIQFFSIFQSFVV-YKGGLSSGYKKYVAENAIT  513

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L + + ++ ++G+ +   +
Sbjct  514   DETYSEDGIALFRVQGSGPDNMQAIQVDPVASSLNSCYCYILHSGNTVFTWSGSLTTTVD  573

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPMGRKVTS  836
             +      +  +K                N+Q+       ++ +FW L GG      +  S
Sbjct  574   QELLERQLDLIKP---------------NMQSRPQKEGTETEQFWNLLGGKC----EYPS  614

Query  837   DDDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
                +  ++  P LF     + N    E+   ++ +L     ++LDC S++FVWVG+    
Sbjct  615   QKIVKEQENDPHLFSCTYSKGNLKLTEIFNFTQDDLMTEDIFILDCHSDIFVWVGQEVDS  674

Query  1008  DERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               R  A    E+FL    + +   + T    + +G E   F   F +W SA +
Sbjct  675   KSRSQALSIGEKFLERDFLMENLSQETPAYIVTEGSEP-PFFTRFFNWDSAKS  726



>ref|XP_006401217.1| hypothetical protein EUTSA_v10012571mg [Eutrema salsugineum]
 gb|ESQ42670.1| hypothetical protein EUTSA_v10012571mg [Eutrema salsugineum]
Length=984

 Score =   454 bits (1168),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 208/360 (58%), Positives = 278/360 (77%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q  GQK+GIEIWRIE FKPV +PK  +GKF++GD Y+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGCGQKSGIEIWRIEGFKPVTVPKESHGKFFTGDCYIVLKTTASRNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  A+KTVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAVKTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPFAR +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFARSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                 DD   E    KLF ++ GQ  PV+ E L K  L+  KCY+LDCG E+FVW GR T 
Sbjct  241   PAVSDDKTAESDGIKLFSVEKGQTEPVEAESLEKELLKTDKCYILDCGLELFVWKGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK+A + AEEF    +RPK+  ++ + +G ET+ F+ +FDSWP+ S    P++GRGK
Sbjct  301   IDQRKSASEAAEEFFRSSERPKSNLVS-VMEGFETVMFRSKFDSWPATSTVAEPQQGRGK  359


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 78/372 (21%), Positives = 144/372 (39%), Gaps = 62/372 (17%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI   + + L  A+  KFYSGD Y+   +  G+       +  WLGK + +++  
Sbjct  394   NLQVWRINREEKILLEAAEQSKFYSGDCYIFHYSYPGEDREEHL-VGTWLGKQSVEEDRA  452

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  453   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAFKKYIAENEVP  511

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  512   DTTYDAEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGNSTVFTWCGNLTSSDD  571

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGE-FWELFGGFAPM-GRKVTSDDD  845
             +     ++  +K   H              Q E    E FWEL GG      +K+  D +
Sbjct  572   QELMERMLDLIKPNEHTKA-----------QKEGSECEQFWELLGGKTEYPSQKIKKDGE  620

Query  846   IIPEKTPPKLF--CIDNGQ-----------------------VNPVDGELSKSNLENSKC  950
                  + P LF     NG+                       V  +    ++ +L     
Sbjct  621   -----SDPHLFSCTFSNGKTICQYRVVFIFICHVFVMIIYLGVTEI-FNFTQDDLMTEDI  674

Query  951   YLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISF  1118
             ++LDC +E+FVWVG+     ++       E+FL    + +     T I  + +G+E   F
Sbjct  675   FILDCHTEIFVWVGQQVDKKKKPQVLAIGEKFLKHDFLLENLSSETPIYIVTEGNEP-PF  733

Query  1119  KCEFDSWPSASA  1154
                F +W S+ +
Sbjct  734   FTRFFTWDSSKS  745



>ref|XP_006285670.1| hypothetical protein CARUB_v10007127mg [Capsella rubella]
 gb|EOA18568.1| hypothetical protein CARUB_v10007127mg [Capsella rubella]
Length=969

 Score =   454 bits (1167),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFLPTPVPKSSIGKFFTGDSYIILKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q +E+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGNETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTFNSDITKLFCVEKGQANPVEGDSLKREMLDTNKCYILDCGVEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKVASGAAEELIRSSERPKSQMI-RIIEGFETVPFRSKFESWTQETNTTVSEDGRGR  359


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 152/352 (43%), Gaps = 48/352 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G
Sbjct  393   NLQVWRVNGQEKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPLQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGLALFRIQGSGPENMQAIQVEPVASSLNSSYCYILHNDSSVFTWAGNLSTSTD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GRKVT  833
             +      +  +K                NLQ  A     +S +FWEL GG A    +K+T
Sbjct  571   QELVERQLDLIKP---------------NLQTRAQKEGSESEQFWELLGGKAEYSSQKLT  615

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDE  1013
              +    PE+ P    C    ++       ++ +L     +++DC SE+FVWVG+      
Sbjct  616   KE----PERDPHLFSCTFTKEIY----NFTQDDLMTEDIFIVDCHSEIFVWVGQEVAPKN  667

Query  1014  RKAACQTAEEF-----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             +  A    E+F     L+++  P+A  I  + +G E   F   F SW S+ +
Sbjct  668   KLLALTIGEKFIEKDSLLEKLSPEAL-IYVIMEGGEPSFFTRFFTSWDSSKS  718



>ref|NP_001190869.1| villin 4 [Arabidopsis thaliana]
 gb|AEE85728.1| villin 4 [Arabidopsis thaliana]
Length=983

 Score =   454 bits (1168),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFIPTPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK    EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVVAEEHITRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        +LFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANDEDKTYNSDITRLFCVEKGQANPVEGDTLKREMLDTNKCYILDCGIEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A + AEE +   +RPK+  I R+ +G ET+ F+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASKAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFESWTQETNTTVSEDGRGR  359


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 89/358 (25%), Positives = 151/358 (42%), Gaps = 45/358 (13%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+       L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G
Sbjct  393   NLQVWRVNGQAKTLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPIQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGVALFRIQGSGPENMQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +  A   +  +K             +    Q E ++S +FWEL GG A    +K+T +  
Sbjct  571   QELAERQLDLIKPN-----------QQSRAQKEGSESEQFWELLGGKAEYSSQKLTKE--  617

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL-----------SKSNLENSKCYLLDCGSEVFVWVG  992
               PE+ P    C    +V  V   L           ++ +L     +++DC SE+FVWVG
Sbjct  618   --PERDPHLFSCTFTKEVLKVRILLKSFFVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVG  675

Query  993   RATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             +      +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  676   QEVVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  733



>ref|XP_009418552.1| PREDICTED: villin-4-like [Musa acuminata subsp. malaccensis]
 ref|XP_009418553.1| PREDICTED: villin-4-like [Musa acuminata subsp. malaccensis]
Length=961

 Score =   453 bits (1166),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 278/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++  FQ AGQKAG+EIWRIENF PVP+P + +GKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMKNVDSVFQGAGQKAGLEIWRIENFCPVPVPSSSHGKFFTGDSYIILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LG + VQ+REIQ HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGSRAVQYREIQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              +GGV+SGFK  E  E+E  TRL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QQGGVSSGFKHTEINEQEHTTRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q LKDTYH G   VA VEDG L A+A++GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQHLKDTYHEGKSEVAAVEDGKLMADAEAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RK  S++D   E +  KL C+  GQ  PV+ + L++  L+ +KCYLLDCG EV++W+GR 
Sbjct  241   RKAASEEDKKFEPSSTKLLCVVKGQALPVEADSLTRDLLDTNKCYLLDCGIEVYIWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGR  1175
             T L+ERK A   AEE L +  RP A  I R+ +G ET+SF+ +FD W   +     E+GR
Sbjct  301   TSLEERKNATSAAEELLREPARPHAHFI-RIIEGFETVSFRSKFDKWTQKTEVAVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 98/382 (26%), Positives = 164/382 (43%), Gaps = 62/382 (16%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQ-------KAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTS  272
             +NVK L  A  A  +          +++WR+   +   LP ++  KFYSGD Y+   T  
Sbjct  371   LNVKGLTKAAPAREEPQPYIDCTGNLQVWRVNGKEKTLLPPSEQSKFYSGDCYIFQYTYP  430

Query  273   GKGG-PYLFDIHFWLGKDTSQDEAGTAAI----KTVELDTILGGKGVQHREIQTHESDRF  437
             G+    YL  I  W GK  S +E  TAAI    KTVE    L  + VQ R  +  E  +F
Sbjct  431   GEDKEEYL--IGTWFGKK-SIEEDRTAAISLAGKTVE---SLKSQAVQARLYEGKEPIQF  484

Query  438   LSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFAR  584
              S F+   +  +GG++SG+K    E       Y   G  + R++          QV    
Sbjct  485   FSIFQ-SFLACKGGLSSGYKNFVAENTIADETYSKDGVALFRVQGSGPENMQAIQVEPVA  543

Query  585   PSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQ  764
              SLN    ++L + D ++ + G+ +   ++  A  ++  +K            ++   L+
Sbjct  544   SSLNSSYCYILHSADTVFTWFGSLATSVDQELAERLLDLIKPN----------IQTKPLK  593

Query  765   AEADSGEFWELFGGFA-----PMGRKVTSDDDIIPEKTPPKLF--CIDNGQVNPVDG-EL  920
                ++ +FW L GG +      +G++  SD         P LF      G +   +    
Sbjct  594   EGTETEQFWSLLGGKSEYPSQKIGKEQESD---------PHLFSCTFSKGTLKVTEVFNF  644

Query  921   SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITR  1088
             ++ +L     ++LDC S++FVWVG+      R  A    E+F+    + Q   + T +  
Sbjct  645   TQDDLMTEDIFVLDCSSDIFVWVGQQVDSKTRLQALNIGEKFIEQDFLMQNLSRETPLFI  704

Query  1089  LAQGHETISFKCEFDSWPSASA  1154
             + +G E   F   F+ W SA +
Sbjct  705   IMEGSEPTFFTRIFN-WDSAKS  725



>ref|XP_009414812.1| PREDICTED: villin-4-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=993

 Score =   454 bits (1168),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 282/363 (78%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             +M+V++K ++ AFQ AGQKAG+EIWRIENF PVP+P + YGKF++GDSYV+L+TT+ K G
Sbjct  28    SMAVSMKDVDSAFQGAGQKAGLEIWRIENFHPVPVPSSSYGKFFTGDSYVILKTTALKSG  87

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
                 DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+
Sbjct  88    SLQHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCII  147

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P +GG++SGFK  E  E E  TRL+VC+GK VV +K+VPFAR SLNHDD+F+LD++ KI+
Sbjct  148   PQDGGISSGFKHTETNEREHVTRLFVCRGKHVVNVKEVPFARSSLNHDDIFILDSESKIF  207

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QF+G+NS+IQERAKALEV+Q++K+TYH G C VA VEDG L A+AD+GEFW  FGGFAP+
Sbjct  208   QFSGSNSSIQERAKALEVVQYIKETYHEGKCEVAAVEDGKLMADADAGEFWGCFGGFAPL  267

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK+ S+ D   E    KL C+D GQ  PV+ + L++  L+  KCYLLDC +E++VW+GR
Sbjct  268   PRKIASEGDRKAETFSAKLLCVDKGQAVPVEADSLTRKLLDTYKCYLLDCDTEIYVWMGR  327

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEG  1172
              + L +RKAA   AEE L++  RP+A  + R+ +G ET+ F+ +F+ WP  + A   +E 
Sbjct  328   NSSLAQRKAASSAAEESLLEPGRPQA-HVIRIIEGFETVMFRSKFEQWPQKNDAVVSDES  386

Query  1173  RGK  1181
             RGK
Sbjct  387   RGK  389


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/350 (23%), Positives = 150/350 (43%), Gaps = 37/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSG-KGGPYLFDIHFWLGKDTSQDEA  341
              +++W I     + LP +D  KFYSGD Y+      G +   YL  I  W GK + ++E 
Sbjct  423   NLQVWHINGKNKILLPPSDQSKFYSGDCYIFQYAYPGEEKEEYL--IGTWFGKMSVEEER  480

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFE  521
               A     ++   L  + V  R  +  E  +  S F+  ++  +GGV+SG+KK  +E   
Sbjct  481   TAAISLANKMVENLKSQAVLARFYEGKEPIQLFSIFQSFLV-FKGGVSSGYKKFVKENST  539

Query  522   T-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
             T   Y  +G  + R++          QV     SLN    ++L +   ++ ++G+ +   
Sbjct  540   TDETYSEEGAALFRIQGSGPENMQAIQVEPVASSLNSSYCYILHSGSIVFTWSGSLTTSV  599

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDI  848
             ++      +  +K            V+    +   ++ +FW L GG +    +    +  
Sbjct  600   DQELVERQLDLIKPN----------VQPKTQKEGTETEQFWSLLGGKSEHPSQKIGKE--  647

Query  849   IPEKTPPKLFCI---DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
              PE  P    C     N +V  +    ++ +L     ++LDC S+++VWVG+      R 
Sbjct  648   -PEHDPHLFSCTFSKGNLKVTEI-FNFTQDDLMTEDLFILDCHSDIYVWVGQQLDPKIRL  705

Query  1020  AACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
              A   AE+++    + +   + T +  + +G E   F   F +W SA ++
Sbjct  706   QAFSIAEKYIEQDFLMENLSRETPLYIIMEGSEP-PFFTRFFNWDSAKSS  754



>ref|XP_006282227.1| hypothetical protein CARUB_v10028500mg [Capsella rubella]
 gb|EOA15125.1| hypothetical protein CARUB_v10028500mg [Capsella rubella]
Length=982

 Score =   454 bits (1167),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 279/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+  ++ L+ A Q AGQK+GIEIWRIE+FKPVP+PK  +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFCMRDLDQALQGAGQKSGIEIWRIESFKPVPVPKESHGKFFTGDSYIVLKTTASRNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  A+ TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    VHHDIHYWLGKDSSQDEAGAVAVMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF     EE++TRLY+CKGK VVR+K+VPFAR +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVTPEEYQTRLYICKGKHVVRVKEVPFARSTLNHEDVFILDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G  S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GTKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               ++DD   E    KLF ++ G+  PV+ E L K  L+ + CY+LDCG E+FVW GR T 
Sbjct  241   PAANDDATAESDGIKLFSVEKGKTEPVEAESLEKELLDTNICYILDCGLEMFVWKGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK   + AEEF    +RPK   ++ + +G+ET+ F+ +FDSWP++S    P++GRGK
Sbjct  301   IDQRKNTSEAAEEFFRSSERPKLNLVS-VMEGYETVMFRSKFDSWPASSTIAEPQQGRGK  359


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 72/369 (20%), Positives = 142/369 (38%), Gaps = 58/369 (16%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI N + + L  A+  KFYSGD Y+   +  G+       +  W GK + +++  
Sbjct  395   NLQVWRINNEEKILLEAAEQTKFYSGDCYIFQYSYPGEDREEHL-VGTWFGKQSVEEDRA  453

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  +KK   E E  
Sbjct  454   SAISMASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSDAYKKYIAENEIP  512

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  KG  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  513   DTTYDEKGVALFRVQGSGPEDMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  572

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +     ++  +K             E      E ++S +FWEL GG      +K+  D +
Sbjct  573   QELMERMLDLIKPN-----------EPTKAHKEGSESEQFWELLGGKTEYPSQKIKKDGE  621

Query  846   IIPEKTPPKLFCIDNGQVNPVDG----------------------ELSKSNLENSKCYLL  959
                  +   LF       +   G                        ++ +L     ++L
Sbjct  622   -----SDSHLFSCTFSNEDLKVGYGFHFYMACSCDDLKLWVTEIFNFTQDDLMTEDIFIL  676

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCE  1127
             +C +E+FVWVG+     ++       E+F+    + +     T I  + +G+E   F   
Sbjct  677   NCHTEIFVWVGQQVDPKKKPQVLAIGEKFIKHDFLLENLASETPIYIVTEGNEP-PFFTR  735

Query  1128  FDSWPSASA  1154
             F +W S+ +
Sbjct  736   FFTWDSSKS  744



>gb|ABK35296.1| actin-binding protein ABP29 [Lilium longiflorum]
Length=263

 Score =   429 bits (1103),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 196/257 (76%), Positives = 227/257 (88%), Gaps = 0/257 (0%)
 Frame = +3

Query  108  MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
            M+ + K L+PAFQ  GQ+ G EIWRIENF+PV LPK+D+GKFYSGDSY+VLQTT+GKGG 
Sbjct  1    MANSSKNLDPAFQGVGQRLGTEIWRIENFQPVSLPKSDHGKFYSGDSYIVLQTTAGKGGA  60

Query  288  YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
            +L+DIHFW+GKDTSQDEAGTAAIKTVELD +LGG+ VQHRE+Q HESD+FLSYF+PCI+P
Sbjct  61   HLYDIHFWIGKDTSQDEAGTAAIKTVELDAVLGGRAVQHRELQGHESDKFLSYFRPCIIP  120

Query  468  LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
            LEGGV SGFK PEEE FETRLYVC+GKRVVR+KQVPFAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121  LEGGVVSGFKTPEEETFETRLYVCRGKRVVRLKQVPFARTSLNHDDVFILDTEKKIYQFN  180

Query  648  GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
            GANSNIQERAKALEVIQFLKD YH G C+VAI++DG L AE+ SGEFW LFGGFAP+G++
Sbjct  181  GANSNIQERAKALEVIQFLKDKYHEGTCDVAIIDDGRLAAESGSGEFWVLFGGFAPIGKR  240

Query  828  VTSDDDIIPEKTPPKLF  878
            V  DDD+  E TP KL+
Sbjct  241  VVGDDDVTLETTPGKLY  257



>ref|XP_009414821.1| PREDICTED: villin-4-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=965

 Score =   452 bits (1164),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 281/362 (78%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K ++ AFQ AGQKAG+EIWRIENF PVP+P + YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMKDVDSAFQGAGQKAGLEIWRIENFHPVPVPSSSYGKFFTGDSYVILKTTALKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LQHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              +GG++SGFK  E  E E  TRL+VC+GK VV +K+VPFAR SLNHDD+F+LD++ KI+Q
Sbjct  121   QDGGISSGFKHTETNEREHVTRLFVCRGKHVVNVKEVPFARSSLNHDDIFILDSESKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             F+G+NS+IQERAKALEV+Q++K+TYH G C VA VEDG L A+AD+GEFW  FGGFAP+ 
Sbjct  181   FSGSNSSIQERAKALEVVQYIKETYHEGKCEVAAVEDGKLMADADAGEFWGCFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RK+ S+ D   E    KL C+D GQ  PV+ + L++  L+  KCYLLDC +E++VW+GR 
Sbjct  241   RKIASEGDRKAETFSAKLLCVDKGQAVPVEADSLTRKLLDTYKCYLLDCDTEIYVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGR  1175
             + L +RKAA   AEE L++  RP+A  + R+ +G ET+ F+ +F+ WP  + A   +E R
Sbjct  301   SSLAQRKAASSAAEESLLEPGRPQA-HVIRIIEGFETVMFRSKFEQWPQKNDAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/350 (23%), Positives = 150/350 (43%), Gaps = 37/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSG-KGGPYLFDIHFWLGKDTSQDEA  341
              +++W I     + LP +D  KFYSGD Y+      G +   YL  I  W GK + ++E 
Sbjct  395   NLQVWHINGKNKILLPPSDQSKFYSGDCYIFQYAYPGEEKEEYL--IGTWFGKMSVEEER  452

Query  342   GTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKPEEEEFE  521
               A     ++   L  + V  R  +  E  +  S F+  ++  +GGV+SG+KK  +E   
Sbjct  453   TAAISLANKMVENLKSQAVLARFYEGKEPIQLFSIFQSFLV-FKGGVSSGYKKFVKENST  511

Query  522   T-RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQ  668
             T   Y  +G  + R++          QV     SLN    ++L +   ++ ++G+ +   
Sbjct  512   TDETYSEEGAALFRIQGSGPENMQAIQVEPVASSLNSSYCYILHSGSIVFTWSGSLTTSV  571

Query  669   ERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDI  848
             ++      +  +K            V+    +   ++ +FW L GG +    +    +  
Sbjct  572   DQELVERQLDLIKPN----------VQPKTQKEGTETEQFWSLLGGKSEHPSQKIGKE--  619

Query  849   IPEKTPPKLFCI---DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
              PE  P    C     N +V  +    ++ +L     ++LDC S+++VWVG+      R 
Sbjct  620   -PEHDPHLFSCTFSKGNLKVTEI-FNFTQDDLMTEDLFILDCHSDIYVWVGQQLDPKIRL  677

Query  1020  AACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
              A   AE+++    + +   + T +  + +G E   F   F +W SA ++
Sbjct  678   QAFSIAEKYIEQDFLMENLSRETPLYIIMEGSEP-PFFTRFFNWDSAKSS  726



>ref|XP_010433022.1| PREDICTED: villin-4-like [Camelina sativa]
Length=975

 Score =   452 bits (1164),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF+P  +P++  GKF++GDSY++L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFRPTLIPQSSIGKFFTGDSYIILKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHTTRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGKLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ +KCY+LDCG E FVW+GR T 
Sbjct  241   TANDEDKTYNSDTTKLFCVEKGQANPVEGDSLKREMLDTNKCYILDCGIEFFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+RK A    EE +   +RPK+  I R+ +G ET+SF+ +F+SW    + T  E+GRG+
Sbjct  301   LDDRKIASGATEEMIRSSERPKSQMI-RIIEGFETVSFRSKFESWTKETNTTVSEDGRGR  359


 Score = 89.0 bits (219),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 147/353 (42%), Gaps = 44/353 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E G
Sbjct  393   NLQVWRVNGQEKALLQTADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKKP-EEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKHIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  S   +
Sbjct  511   DDTYNENGLALFRIQGSGPDDMQAIQVDPVASSLNSSYCYILHNDSSVFTWAGNLSTSTD  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GRKVT  833
             +      +  +K                NLQ  A     +S +FWEL GG      +K+T
Sbjct  571   QELVERQLDLIKP---------------NLQTRAQKEGSESEQFWELLGGKVEYSSQKLT  615

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
              +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG     
Sbjct  616   KE----PEHDPHVFSCTFTKEILKVTEIYNFTQDDLMTEDIFIIDCHSEIFVWVGHEVAP  671

Query  1008  DERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               +  A    E+F+ K    +K      +  + +G E   F   F SW S+ +
Sbjct  672   KTKLLALTIGEKFIEKDSLLEKLSPEAPVYVIMEGGEPSFFTRFFTSWDSSKS  724



>ref|XP_006845710.1| hypothetical protein AMTR_s00019p00240770 [Amborella trichopoda]
 gb|ERN07385.1| hypothetical protein AMTR_s00019p00240770 [Amborella trichopoda]
Length=961

 Score =   452 bits (1163),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+EIWRIENF+PVP+PK+ YGKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKAGLEIWRIENFRPVPVPKSSYGKFFTGDSYIILKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             + +DIH+WLGKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    FRYDIHYWLGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE +TR++VCKGK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAEVEEHKTRMFVCKGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIAAIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TS++D      P KL  +  GQ  P +   L +  L+ + CY+LDCG EVFVW+GR T 
Sbjct  241   TTSEEDNSAATIPTKLLRVVKGQAVPFETNALKRELLDTNSCYVLDCGLEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK+A   AEE +    RPKA  I R+ +G ET+ F+ +FDSWPS +  T  E+GRGK
Sbjct  301   LDERKSASAAAEELVAGPSRPKA-HIIRVIEGFETVMFRSKFDSWPSTTDVTVSEDGRGK  359


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 152/354 (43%), Gaps = 47/354 (13%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEAG  344
             +++WRI+      +P  +  KFYSGD Y+   T  G+    YL  I  W G+ + +DE G
Sbjct  394   LQVWRIDGQDKTLIPPNEQSKFYSGDCYMFQYTYPGEDKEEYL--IGTWFGRQSIEDERG  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L G+ VQ R  +  E  +F S F+  I+  +GG++SG+KK   E    
Sbjct  452   AAITLVNKMAESLKGQAVQARIYEGKEPIQFFSIFQSFIV-FKGGISSGYKKYISENGIA  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L +   ++ ++G  +  ++
Sbjct  511   DDTYTEDGLALFRVQGSGPDNMQAIQVDPVGTSLNSSYCYILLSGTTVFTWSGNLTTSED  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGG-----FAPMGRKVTS  836
                    +  +K            V+    +  ++S +FW L GG        + ++  S
Sbjct  571   HELIERQLDLIKPN----------VQSKPQKEGSESEQFWNLLGGKCEYPSHKLAKEAES  620

Query  837   DDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             D         P LF      G +   +    S+ +L     ++LDC SE+FVW+G+    
Sbjct  621   D---------PHLFSCAFSKGSLKLTEIFNFSQDDLMTEDIFVLDCHSEIFVWIGQQVDS  671

Query  1008  DERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
               +  A    E+FL    + +K  + T I  + +G E  SF   F  W SA +T
Sbjct  672   KSKMQALTIGEKFLEQDFLLEKLSRETPIYVVMEGTEP-SFLTRFFIWDSAKST  724



>ref|XP_009120257.1| PREDICTED: villin-4-like [Brassica rapa]
Length=964

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 280/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q  GQK+GIEIWRIE+FKPV +PK  +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGCGQKSGIEIWRIESFKPVAVPKESHGKFFTGDSYIVLKTTASRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG+ A+ TVELD+ LGG+ VQ+RE+Q  E+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGSVAVMTVELDSALGGRAVQYREVQGQETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPFAR +LNHDDVF+LDT+ KI+QF+
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFARSTLNHDDVFILDTESKIFQFS  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C +A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCEIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S+DD   E    KLF ++ G+  P++ E L K  L+ +KCY+LDCG E+FVW GR+T 
Sbjct  241   PASNDDQTAESDGIKLFSVEKGKTEPIEVESLQKDLLDTNKCYILDCGLELFVWKGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK+A Q AEEF    +RPK   ++ + +G ET+ F+ +FDSWP+ S    P++GRGK
Sbjct  301   IDQRKSASQAAEEFFRSSERPKLNLVS-VMEGFETVMFRSKFDSWPATSTVAEPQQGRGK  359


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 79/360 (22%), Positives = 146/360 (41%), Gaps = 41/360 (11%)
 Frame = +3

Query  132   EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFW  311
             +P   A G    +++WR+   + + L  A+  KFYSGD Y+   +  G+       +  W
Sbjct  387   KPYIDATG---NLQVWRMNGEEKISLEAAEQSKFYSGDCYIFQYSYPGEDREEHL-VGTW  442

Query  312   LGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASG  491
             LGK + +++  TA     ++   +     Q R  +  E  +F    +  I   +GGV+  
Sbjct  443   LGKQSVEEDRETAISIASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGVSDA  501

Query  492   FKKPEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQ  641
             FKK   +     +   KG  + R++          Q+      LN    ++L     ++ 
Sbjct  502   FKKYIADNEVPDITYDKGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFT  561

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGE-FWELFGGFAPM  818
             + G  ++  ++     ++  +K   H              Q E    E FWEL GG +  
Sbjct  562   WCGNLTSSDDKELMERMLDLIKPNEHTKA-----------QKEGSECEQFWELLGGKSEY  610

Query  819   -GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVW  986
               +K+  D +     + P LF       N    E+   ++ +L     ++LDC +E+FVW
Sbjct  611   PSQKIKKDGE-----SDPHLFSCTISNENLKVTEIFSFTQDDLMTEDIFILDCHTEIFVW  665

Query  987   VGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             VG+     ++       E+FL    + +     T I  + +G+E   F   F +W S+ +
Sbjct  666   VGQQVDPKKKPQVLTIGEKFLKHDFLLENLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  724



>ref|XP_008781818.1| PREDICTED: villin-4-like [Phoenix dactylifera]
Length=962

 Score =   451 bits (1161),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 224/362 (62%), Positives = 283/362 (78%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V++K L+ AFQ AGQKAG+EIWRIENF+PVP+PK+ YGKF++GD+YV+L+TT+ K G 
Sbjct  1     MAVSMKDLDSAFQGAGQKAGLEIWRIENFRPVPVPKSSYGKFFTGDAYVILKTTASKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGFK  E  E E   RL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QEGGVASGFKHTEVNEREHVIRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNGANS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW  FGGFAP+ 
Sbjct  181   FNGANSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAEAGEFWGFFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RKV S+DD        KLFC+D GQ  P++ + L +  L+ +KCYLLDCG+E++VW+GR 
Sbjct  241   RKVASEDDRNGVAFSTKLFCVDKGQTVPIEADSLIRELLDTNKCYLLDCGAEIYVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGR  1175
             T L+ERK+A   AEE L    RPKA  I R+ +G ET+ F+ +FD WP  +     E+GR
Sbjct  301   TPLEERKSASAAAEELLHDPSRPKA-HIIRIIEGFETVMFRSKFDKWPQTTDVAVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 136/309 (44%), Gaps = 30/309 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   +P +D  KFYSGD Y+   T  G+     + I  W GK + ++E  
Sbjct  396   NLQVWRVNGKEKTLIPSSDQSKFYSGDCYIFQYTYPGEDKEE-YIIGTWFGKKSIEEERT  454

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A +   ++   L  + VQ R  +  E  +F S F+  ++  +GG++SG+KK   E    
Sbjct  455   AAILLASKMVESLKSQAVQARFYEGKEPIQFFSIFQSFLV-YKGGLSSGYKKYVTENAIN  513

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L + + ++ ++G+ +   +
Sbjct  514   DETYSEDGIALFRVQGSGPDNMQAIQVDPVASSLNSSYCYILHSGNTVFTWSGSLTTTVD  573

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +      +  +K            V+    +   ++ +FW L GG      +  S   + 
Sbjct  574   QELLERQLDLIKPN----------VQSKPQKEGTETEQFWILLGGKC----EYPSQKIVK  619

Query  852   PEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++ P LF     + N    E+   ++ +L     ++LDC S++FVWVG+      R  
Sbjct  620   EQESDPHLFSCTYSKGNLKLTEIFNFTQDDLMTEDIFILDCHSDIFVWVGQQVDSKSRSE  679

Query  1023  ACQTAEEFL  1049
             A    E+FL
Sbjct  680   ALSIVEKFL  688



>ref|XP_010046961.1| PREDICTED: villin-4 [Eucalyptus grandis]
 gb|KCW78681.1| hypothetical protein EUGRSUZ_C00137 [Eucalyptus grandis]
Length=960

 Score =   451 bits (1161),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 288/360 (80%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF+PV +P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFRPVLVPQSSYGKFFTGDSYVILKTTALKNGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDE+GTAAIKTVELD  LGG+ VQ+RE+Q HE++RFLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDESGTAAIKTVELDAALGGRAVQYREVQGHETERFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVA+GFK  EEEE +TRL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVATGFKHAEEEEHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A +EDG L A++++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHHGKCDIAAIEDGKLMADSETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D      P KL  ++ GQ  P+ D  L++  L+ +KCYLLDCG+EVFVW+GR+T 
Sbjct  241   TASEEDKNVGIYPTKLLRVEKGQSEPIGDESLTRDLLDTNKCYLLDCGTEVFVWMGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+RK+A   AEE +    RP+ ++I RL +G ET+ F+ +FDSWP +      E+GRGK
Sbjct  301   LDDRKSASSAAEELIHGPDRPQ-SQIIRLIEGFETVVFRSKFDSWPQTEDVAVTEDGRGK  359


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 89/350 (25%), Positives = 152/350 (43%), Gaps = 41/350 (12%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-PYLFDIHFWLGKDTSQDEAG  344
             +++WR+   + + L  AD  KFYSGD Y+   +  G     YL  I  W GK + ++E  
Sbjct  394   LQVWRVNGQEKILLQSADQSKFYSGDCYIFQYSYPGDDREEYL--IGTWFGKKSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A  +  ++   L    VQ R  + +E  +F S F+  I+  +GG++ G+K    E+E  
Sbjct  452   SALSQVSKMVESLKFLPVQARLYEGNEPIQFFSIFQSFIV-FKGGLSEGYKSYIAEKEIP  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L +   +  + G  +  ++
Sbjct  511   DETYKEDGLALFRVQGSGPDNMQAIQVEPVASSLNSSYCYILHSGSSVLTWYGNLTTSED  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +      +  +K       C          +  A+S  FWEL GG +    +K+  D + 
Sbjct  571   QELVERQLDLIKPNAQ---CKTQ-------KEGAESEHFWELLGGKSEYPSQKIAQDSE-  619

Query  849   IPEKTPPKLF-CI---DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                 + P LF CI    N +V  +    S+ +L     ++LDC S +FVWVG+      +
Sbjct  620   ----SDPHLFSCIFSKGNLKVTEIHN-FSQDDLMTEDMFILDCHSAIFVWVGQQVDSKMK  674

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               A    E+FL    + +K  +   +  + +G E   F   F SW SA +
Sbjct  675   MHALTIGEKFLEHDFLLEKLSREAPVYVIMEGSEP-PFFTRFFSWDSAKS  723



>gb|KCW78680.1| hypothetical protein EUGRSUZ_C00137 [Eucalyptus grandis]
Length=960

 Score =   451 bits (1161),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 288/360 (80%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIEIWRIENF+PV +P++ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEIWRIENFRPVLVPQSSYGKFFTGDSYVILKTTALKNGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDE+GTAAIKTVELD  LGG+ VQ+RE+Q HE++RFLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTTQDESGTAAIKTVELDAALGGRAVQYREVQGHETERFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVA+GFK  EEEE +TRL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVATGFKHAEEEEHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C++A +EDG L A++++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHHGKCDIAAIEDGKLMADSETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D      P KL  ++ GQ  P+ D  L++  L+ +KCYLLDCG+EVFVW+GR+T 
Sbjct  241   TASEEDKNVGIYPTKLLRVEKGQSEPIGDESLTRDLLDTNKCYLLDCGTEVFVWMGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LD+RK+A   AEE +    RP+ ++I RL +G ET+ F+ +FDSWP +      E+GRGK
Sbjct  301   LDDRKSASSAAEELIHGPDRPQ-SQIIRLIEGFETVVFRSKFDSWPQTEDVAVTEDGRGK  359


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 88/349 (25%), Positives = 152/349 (44%), Gaps = 39/349 (11%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG-PYLFDIHFWLGKDTSQDEAG  344
             +++WR+   + + L  AD  KFYSGD Y+   +  G     YL  I  W GK + ++E  
Sbjct  394   LQVWRVNGQEKILLQSADQSKFYSGDCYIFQYSYPGDDREEYL--IGTWFGKKSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A  +  ++   L    VQ R  + +E  +F S F+  I+  +GG++ G+K    E+E  
Sbjct  452   SALSQVSKMVESLKFLPVQARLYEGNEPIQFFSIFQSFIV-FKGGLSEGYKSYIAEKEIP  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L +   +  + G  +  ++
Sbjct  511   DETYKEDGLALFRVQGSGPDNMQAIQVEPVASSLNSSYCYILHSGSSVLTWYGNLTTSED  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM-GRKVTSDDDI  848
             +      +  +K       C          +  A+S  FWEL GG +    +K+  D + 
Sbjct  571   QELVERQLDLIKPNAQ---CKTQ-------KEGAESEHFWELLGGKSEYPSQKIAQDSE-  619

Query  849   IPEKTPPKLF-CIDNGQVNPVD--GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERK  1019
                 + P LF CI +  ++ V      S+ +L     ++LDC S +FVWVG+      + 
Sbjct  620   ----SDPHLFSCIFSKGIHKVTEIHNFSQDDLMTEDMFILDCHSAIFVWVGQQVDSKMKM  675

Query  1020  AACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
              A    E+FL    + +K  +   +  + +G E   F   F SW SA +
Sbjct  676   HALTIGEKFLEHDFLLEKLSREAPVYVIMEGSEP-PFFTRFFSWDSAKS  723



>ref|XP_011012988.1| PREDICTED: villin-4-like [Populus euphratica]
 ref|XP_011012989.1| PREDICTED: villin-4-like [Populus euphratica]
Length=960

 Score =   451 bits (1160),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 285/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+EIWRIENF+PVP+ K+ +GKF+ GDSYV+LQTT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKAGLEIWRIENFRPVPVLKSSHGKFFMGDSYVILQTTALKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDT+QDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDTTQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              +GGVASGFK PE EE +TRL+VC GK VV + +VPFAR SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QKGGVASGFKHPEAEEHQTRLFVCTGKHVVHVNEVPFARSSLNHDDIFILDTRSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SD+D        KLFC++ GQ  PV+ + L++  L+ +KCY+LDCG+EVFVW+GR T 
Sbjct  241   TASDEDKTGVSLSTKLFCVEKGQAEPVETDSLTREFLDTNKCYILDCGAEVFVWMGRNTP  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LDERK+A   AEE +   +RPK +++ R+ +G ET+ F+ +F+SWP  +  T  E+GRGK
Sbjct  301   LDERKSASVAAEELVRAVERPK-SRVVRVIEGFETVMFRSKFESWPQMTNVTVSEDGRGK  359


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 95/383 (25%), Positives = 158/383 (41%), Gaps = 64/383 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++W +   + V +P AD  KFYSG  Y+   
Sbjct  369   VNVKGLLKTAPAKEEPQPYIDVTG---NLQVWSVNGQEKVLIPAADQSKFYSGGCYIFQY  425

Query  264   TTSGKGG-PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             +  G+    YL  I  W GK + ++E  +A     ++   L     Q R  + +E  +F 
Sbjct  426   SYPGEDREEYL--IGTWFGKKSVKEERASAISLVSKMVESLKFLPAQARIYEGNEPIQFF  483

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  I+  +GG +SG+K   EE E     Y  +G  + R++          QV     
Sbjct  484   SIFQSFIV-FKGGHSSGYKNYIEENELPDETYKEEGIALFRVQGSGPDNMQALQVEPVAS  542

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L     ++ ++G  ++ +++      +  +K                  Q 
Sbjct  543   SLNSSYCYILHNDSSVFTWSGNLTSSEDQELIERQLDLIKPNMQ-----------SKPQK  591

Query  768   EADSGE-FWELFGGFA-----PMGRKVTSDDDIIPEKTPPKLF-CI---DNGQVNPVDGE  917
             E    E FW+L  G +      + R+  SD         P LF CI    N +V+ +   
Sbjct  592   EGSEAELFWDLLRGKSEYPSQKLAREGESD---------PHLFTCIFSKGNLKVSEIYN-  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              ++ +L     ++LD  SE+FVWVG+      +  A    E+FL    + +K    T I 
Sbjct  642   FTQDDLMTEDIFILDSHSEIFVWVGQQVDSKSKLQALTIGEKFLEHDFLLEKLSSETPIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASA  1154
              + +G E   F   F +W SA +
Sbjct  702   IVMEGSEP-PFFTRFFTWDSAKS  723



>emb|CDY03547.1| BnaC03g68060D [Brassica napus]
Length=973

 Score =   451 bits (1160),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 281/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPTPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQAHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV    VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVV---HVPFARSSLNHDDIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADAESGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        +LFC++ GQ NPV+G+ L +  L+ SKCY+LDCG EVFVW+GR T 
Sbjct  238   TANDEDKTYTSDITQLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEVFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET++F+ +FD+W    + T  E+GRG+
Sbjct  298   LDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVTFRSKFDTWTQETNTTVSEDGRGR  356


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 152/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  390   NLQVWRVNGQEKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSMASKMVETMKFVPAQARIYEGKEPLQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF--NGANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ +  N A S  
Sbjct  508   DDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWIGNLATSTD  567

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG +    +
Sbjct  568   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKSEYRSQ  609

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C     +  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  610   KLTKE----PESDPHLFSCSFTKDILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  665

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  666   VAPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  721



>emb|CDM87042.1| unnamed protein product [Triticum aestivum]
Length=1002

 Score =   452 bits (1162),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 283/363 (78%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             TM+++++ ++PAFQ AGQK G+EIWRIE  + VP+P+  +GKF++GDSY++L+TT+ K G
Sbjct  33    TMAISMRDVDPAFQGAGQKDGLEIWRIEKLQAVPVPRESHGKFFAGDSYIILKTTARKNG  92

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDE+GTAAIKTVELD  LGG+GVQ+RE+Q +E+++FLSYFKPCI+
Sbjct  93    SFQHDIHYWLGKDTSQDESGTAAIKTVELDVALGGRGVQYREVQGNETEKFLSYFKPCII  152

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGG+ASGF+  E  E E  TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  153   PEEGGIASGFRHTEINEREHVTRLFVCRGKHTVHVKEVPFARSSLNHDDIFILDTKSKIF  212

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKDT H G C+VA VEDG L A+AD+GEFW LFGGFAP+
Sbjct  213   QFNGSNSSIQERAKALEVVQYLKDTNHEGKCDVAAVEDGKLMADADAGEFWGLFGGFAPL  272

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  S+ +      PPKL  ++ GQ   VD E L+K+ L+++KCYLLDCGSE++VW+GR
Sbjct  273   PRKTFSEPNGKDTAFPPKLLWVNKGQTVSVDCEVLTKALLDSTKCYLLDCGSEIYVWMGR  332

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L++RK A   AEE L +  RPK + I RL +G ET+ F+ +F+ WP  A A   +E 
Sbjct  333   ETALEDRKQAGLAAEELLREGDRPK-SHIIRLMEGFETVIFRSKFNKWPKKAEAVVSDES  391

Query  1173  RGK  1181
             RGK
Sbjct  392   RGK  394


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 77/346 (22%), Positives = 144/346 (42%), Gaps = 35/346 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ + +   L  ++  KFYSGD Y+   +  G  G     +  W GK + ++E  
Sbjct  428   NLQVWRVNDSEKTFLSFSEQCKFYSGDCYIFQYSYPGDDGEECL-VGTWFGKKSIEEERA  486

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   +
Sbjct  487   AATSLANKMVESLKFQAVLVRLYEGKEPIEFFPIFQNLVI-FKGGASTGYKKFVSENGIQ  545

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV    PSLN    ++L   D ++ + G  S+  +
Sbjct  546   DDSYSENGVALFRVQGSGPDNMQAIQVDAVAPSLNSSYCYILHDGDTVFTWIGNLSSSMD  605

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A   +  +K      +          L+  ++  +FW++ G  +    +  + D   
Sbjct  606   QELAERQLDVIKPNLQSRM----------LKEGSEYDQFWKILGIKSEYSSQKIARD---  652

Query  852   PEKTPPKLFCID--NGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
             PE +   LFC     G +   +    ++ ++     ++LDC S VF+WVG+      R  
Sbjct  653   PE-SDAHLFCCTFLKGVLKVREIFNFTQDDMMTEDIFILDCHSCVFIWVGQNVDTKIRAQ  711

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             A    E+FL      +   + T +  + +G E   F   F +W SA
Sbjct  712   ALSIGEKFLELDIPMENLSRETPLYVINEGSEP-QFFTRFFTWDSA  756



>ref|XP_009128035.1| PREDICTED: villin-4 [Brassica rapa]
Length=975

 Score =   450 bits (1158),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 280/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV +K+VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHVTRLFVCRGKHVVHVKEVPFARSSLNHDDIYILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               + +D        KLFC++ G+ NPV D  L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TANAEDKTVTFDIKKLFCVEKGKANPVEDDTLKREMLDTNKCYILDCGLEVFVWMGRTTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W    + T  E+GRG+
Sbjct  301   LDDRKIASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWTQETNTTVSEDGRGR  359


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 152/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  393   NLQVWRVNGQEKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  452   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  510

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ + G  A S  
Sbjct  511   DDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWMGNLATSTD  570

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  571   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYSSQ  612

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C    +V  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  613   KLTKE----PESDPHLFSCTFTKEVLKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  668

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  669   VVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  724



>gb|KFK29570.1| villin 4 [Arabis alpina]
Length=971

 Score =   449 bits (1156),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 282/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF+P PLPKA  GKF+SGDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFRPTPLPKASIGKFFSGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDE+GTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDESGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG+A+GFK  E EE  TRL+VC+GK VV    VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGIATGFKHVEAEEHITRLFVCRGKHVV---HVPFARSSLNHDDIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYHGG+C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHGGMCEVATVEDGKLMADAESGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               + +D        KLFC++ GQ NPV+G+ L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  238   TANVEDKTYNSDITKLFCVEKGQANPVEGDSLKREMLDTNKCYILDCGFEVFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W    + T  E+GRGK
Sbjct  298   LDDRKIASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWTQETNTTVSEDGRGK  356


 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 147/354 (42%), Gaps = 44/354 (12%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  A + KFYSGD Y+   +  G+    +  I  W GK + +DE  
Sbjct  390   NLQVWRVNGQEKTLLQAAGHSKFYSGDCYIFQYSYPGEEKEEVL-IGTWFGKQSVEDERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSMASKMVESMKFVPAQARIFEGKEPIQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV     SLN    ++L     ++ + G  +   +
Sbjct  508   DDTYTESGLALFRIQGSGPENMQAIQVDPIASSLNSSYCYILHNDSSVFTWIGNLATTTD  567

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPMG-RKVT  833
             +      +  +K                NLQ  A     +S +FWEL GG      +K+T
Sbjct  568   QELVERQLDLIKP---------------NLQTRAQKEGSESEQFWELLGGKTEYSSQKLT  612

Query  834   SDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
              +    PE+ P    C    ++  V      ++ +L     +++DC SE++VWVG+    
Sbjct  613   KE----PERDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIVDCHSEIYVWVGQEVVP  668

Query  1008  DERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
               +  A    E+F+ K    +K      I  + +G E   F   F  W S+ ++
Sbjct  669   KNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTPWDSSKSS  722



>ref|XP_004487964.1| PREDICTED: villin-4-like [Cicer arietinum]
Length=961

 Score =   449 bits (1156),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 285/362 (79%), Gaps = 7/362 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF P+P+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPIPVPKSSYGKFFTGDSYVILKTTTSKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+W+GKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWIGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E E  +TRL+VC+GK VV +K+VPFAR SLNHDD+FVLDT+ K++QFN
Sbjct  121   QEGGVASGFKHAEAENHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFVLDTESKVFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHEGKCEVAAIEDGKLMADPETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +DDD   +  PPKL C++ GQ +PV+ + L +  L  +KCY+LDCG E+FVW+GR T 
Sbjct  241   AATDDDKSADSRPPKLLCVEKGQADPVETDSLKREFLYTNKCYILDCGLEMFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFL--VKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             LDERK+A   A+E +  + + +P   +I R+ +G ET+ FK +FDSWP +   T  E+GR
Sbjct  301   LDERKSASGVADELVSGIDKLKP---QIIRVIEGFETVLFKSKFDSWPQTPDVTVSEDGR  357

Query  1176  GK  1181
             GK
Sbjct  358   GK  359


 Score = 95.5 bits (236),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 169/384 (44%), Gaps = 66/384 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + LP +D  KFYSGD ++   
Sbjct  369   VNVKGLLKADAVKEEPQPYIDCTGH---LQVWRVNGQEKILLPASDQSKFYSGDCFIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
             +  G+       I  W+GK++ ++E  +A   A K VE    L       R  + +E  +
Sbjct  426   SYPGEDKDDCL-IGTWIGKNSVEEERASANSLASKIVESMKFLASLA---RIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKKP-EEEEFETRLYVCKGKRVVRMK----------QVPFA  581
             F S  +  I+  +GG++ G+K    E+E     Y   G  + R++          QV   
Sbjct  482   FHSILQTIIV-FKGGLSDGYKTNIAEKEIPDETYNEDGVALFRIQGSGPENMQAIQVEPV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L     ++ ++G+N++ +++     ++  +K                NL
Sbjct  541   ASSLNSSYCYILHNGPAVFTWSGSNTSAEDQELVERMLDLIKP---------------NL  585

Query  762   QAE-----ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGEL-  920
             Q +      +S +FW+L GG +    +K+T + +     + P LFC +  + N    E+ 
Sbjct  586   QTKPQREGTESEQFWDLLGGKSEYPSQKITREAE-----SDPHLFCCNFSKGNLKVTEIY  640

Query  921   --SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKI  1082
               S+ +L     ++LDC SE+FVWVG+      R  A    E+FL    + +K  +   I
Sbjct  641   NFSQDDLMTEDIFILDCYSEIFVWVGQQVDPKSRMQALTIGEKFLEHDFLLEKLSRVAPI  700

Query  1083  TRLAQGHETISFKCEFDSWPSASA  1154
               + +G E   F   F +W SA +
Sbjct  701   YVVMEGSEP-PFFTRFFNWESAKS  723



>ref|NP_200542.1| putative villin [Arabidopsis thaliana]
 sp|Q9LVC6.1|VILI5_ARATH RecName: Full=Villin-5 [Arabidopsis thaliana]
 dbj|BAA96955.1| villin [Arabidopsis thaliana]
 gb|AED96884.1| putative villin [Arabidopsis thaliana]
Length=962

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q AGQK+GIEIWRIENFKPV +P+  +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGAGQKSGIEIWRIENFKPVTVPQESHGKFFTGDSYIVLKTTASRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  A+ TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAVMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR+K+VPF R +LNH+DVF+LDT+ KI+QF+
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVRVKEVPFVRSTLNHEDVFILDTESKIFQFS  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  181   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD        KLF ++ GQ + V+ E L+K  L+ +KCY+LDCG E+FVW GR+T 
Sbjct  241   PAVNDDETAASDGIKLFSVEKGQTDAVEAECLTKELLDTNKCYILDCGLELFVWKGRSTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK+A + AEEF    + PK+  ++ + +G+ET+ F+ +FDSWP++S    P++GRGK
Sbjct  301   IDQRKSATEAAEEFFRSSEPPKSNLVS-VMEGYETVMFRSKFDSWPASSTIAEPQQGRGK  359


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 148/350 (42%), Gaps = 39/350 (11%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI   + + L  A+  KFYSGD Y++  +  G+       +  W GK + +++  
Sbjct  395   NLQVWRINCEEKILLEAAEQSKFYSGDCYILQYSYPGEDREEHL-VGTWFGKQSVEEDRA  453

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GGV+  FKK   E +  
Sbjct  454   SAISLANKMVESMKFVPAQARINEGKEPIQFFVIMQSFIT-FKGGVSDAFKKYIAENDIP  512

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+  A   LN    ++L     ++ + G  ++ ++
Sbjct  513   DTTYEAEGVALFRVQGSGPENMQAIQIEAASAGLNSSHCYILHGDSTVFTWCGNLTSSED  572

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +     ++  +K             E    Q E ++S +FWEL GG +    +K+  D +
Sbjct  573   QELMERMLDLIKPN-----------EPTKAQKEGSESEQFWELLGGKSEYPSQKIKRDGE  621

Query  846   IIPEKTPPKLFCIDNGQVNPVDGEL---SKSNLENSKCYLLDCGSEVFVWVGRATQLDER  1016
                  + P LF       +    E+   ++ +L     ++LDC +EVFVWVG+     ++
Sbjct  622   -----SDPHLFSCTYTNESLKATEIFNFTQDDLMTEDIFILDCHTEVFVWVGQQVDPKKK  676

Query  1017  KAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               A    E FL    + +     T I  + +G+E   F   F +W S+ +
Sbjct  677   PQALDIGENFLKHDFLLENLASETPIYIVTEGNEP-PFFTRFFTWDSSKS  725



>gb|KDO61844.1| hypothetical protein CISIN_1g037000mg [Citrus sinensis]
Length=969

 Score =   448 bits (1153),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/362 (61%), Positives = 287/362 (79%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+ AFQ AGQKAGIEIWRIENFKPV +PK+ +GKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDSAFQGAGQKAGIEIWRIENFKPVLVPKSSHGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG+ASGFK+ E EE +TRL+VC+GK V+ +K+VPF+R SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGIASGFKRAEAEEHKTRLFVCRGKHVIHVKEVPFSRSSLNHDDIFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA+VEDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAVVEDGKLMADAEAGEFWGFFGGFAPLPRK  240

Query  828   VT--SDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             +T   +++ +      KL+ +D GQ  PV+G+ L++  LE +KCY+LDCG EVFVW+GR 
Sbjct  241   MTISEENNNVVHSHSTKLYSVDKGQAVPVEGDSLTRDLLETNKCYILDCGIEVFVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGR  1175
             T LDERK+A   AEE L    R K+  I R+ +G ET+ FK +FD WP   + T  E+GR
Sbjct  301   TSLDERKSASGAAEELLKGSDRSKSHMI-RVIEGFETVMFKSKFDCWPQETNVTVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 95/357 (27%), Positives = 158/357 (44%), Gaps = 51/357 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + V L  AD  K YSGD Y+   +  G     +  I  W GK + +D+  
Sbjct  395   NLQVWRVNGQEKVLLSGADQTKLYSGDCYIFQYSYPGDEKEEIL-IGTWFGKQSVEDDRA  453

Query  345   TA---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-----  500
             +A   A K VE    L    VQ R  + HE  +F S F+  I+ L+GG++ G+K      
Sbjct  454   SAISLASKMVESMKFLP---VQARIYEGHEPIQFFSIFQSFIV-LKGGLSDGYKTYIAEK  509

Query  501   --PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNG---A  653
               P+E  +E    L+  +G     M+  QV     SLN    ++L     ++ ++G   +
Sbjct  510   GIPDETYKEDGVALFRIQGSGPDNMQAIQVEPVAASLNSSYCYILHNDSTVFTWSGNLTS  569

Query  654   NSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPM  818
             + N +   + L++I+ L D               NLQ++     A+S +FWEL  G +  
Sbjct  570   SENQELVERQLDLIK-LNDFVQP-----------NLQSKSQKEGAESEQFWELLEGKSEY  617

Query  819   -GRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWV  989
               +K+  +    PE  P    C    G +   +    ++ +L     ++LDC SE+FVWV
Sbjct  618   PSQKIARE----PESDPHLFSCTFSKGHLKVSEIYNFTQDDLMTEDIFILDCHSEIFVWV  673

Query  990   GRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             G+      +  A    E+F+    + +  P    I  + +G E   F   F +W SA
Sbjct  674   GQQVDSKSKMHALTIGEKFIGHDFLLENLPHEVPIYIVLEGSEP-PFFTRFFTWDSA  729



>ref|XP_006656321.1| PREDICTED: villin-4-like isoform X1 [Oryza brachyantha]
 ref|XP_006656322.1| PREDICTED: villin-4-like isoform X2 [Oryza brachyantha]
Length=970

 Score =   447 bits (1151),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 280/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+++++ ++P FQ AGQK G+EIWRIE  + VP+PK  +G+F++GDSYV+L+T++ K G 
Sbjct  1     MAISMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESHGRFFTGDSYVILKTSALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E++RFLSYFKPCI+P
Sbjct  61    FRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETERFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
             +EGG+ASGF+  E  ++E  TRL+VC+G+  V +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   VEGGIASGFRHTEINKQEHVTRLFVCRGRHTVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q+LKDT H G C+V  VEDG L A+AD+GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQYLKDTNHEGKCDVGAVEDGKLMADADAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RK  SD +        KL CI+ G+  PVD + L++  L+++KCYLLDCGSE++VW+GR 
Sbjct  241   RKTFSDLNGKDPAFSSKLICINKGKTVPVDCDVLTRELLDSTKCYLLDCGSEIYVWMGRE  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L+ERK A   AEE L + KRPK + I RL +G ET+ F+ +F  WP  A A   +E R
Sbjct  301   TPLEERKQAGSAAEELLREGKRPK-SHIVRLMEGFETVIFRSKFSKWPKKADAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 148/348 (43%), Gaps = 35/348 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   +   L  ++  KFYSGD Y+   +  G+ G     I  W GK + Q+E  
Sbjct  395   NLQVWRVNGSEKTFLSFSEQCKFYSGDCYIFQYSYPGEEGEECL-IGTWFGKKSVQEERT  453

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             TA      +   L  + V  R  +  E   F S F+  ++  +GGV++G+K    E   E
Sbjct  454   TATSVASNMIESLKFQAVMVRLYEGKEPAEFFSIFQNLVI-FKGGVSTGYKNFVSENSIE  512

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV  A  SLN    ++L   D ++ + G  S+  +
Sbjct  513   DDTYSENGVALFRVQGSGPENMQAIQVDTAASSLNSSYCYLLHDGDTLFTWIGNLSSSMD  572

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A   +  +K      +          L+  ++  +FW+L G  +    +  + D   
Sbjct  573   QELAERQLDVIKPNLQSRI----------LKEGSEYDQFWKLLGVKSEYASQKIAKD---  619

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++ P LF C  +  V  V      ++ +L     ++LDC S VFVWVG+      R  
Sbjct  620   -QESDPHLFSCTFSKGVLKVKEIFNFTQDDLMTEDIFILDCHSCVFVWVGQRVDTKTRAQ  678

Query  1023  ACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A    E+FL    + +   + T +  + +G E   F   F +W SA +
Sbjct  679   ALSIGEKFLELDILMENSSQETPVYVITEGSEP-QFFTRFFTWDSAKS  725



>emb|CDY51644.1| BnaAnng10840D [Brassica napus]
Length=973

 Score =   447 bits (1151),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 279/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV    V FAR SL HDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVV---HVTFARSSLTHDDIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ SKCY+LDCG E+FVW+GR T 
Sbjct  238   TANDEDKTHTSDIKKLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEMFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET++F+ +FD+W   +  T  E+GRG+
Sbjct  298   LDDRKTASGAAEEMIRSSERPKSQMI-RIIEGFETVTFRSKFDTWAQVTNTTVSEDGRGR  356


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 153/356 (43%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  390   NLQVWRVNGQQKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ + G  A S  
Sbjct  508   DDTYNENGLALFRIQGSGPENMQAIQVEPVASSLNSSYCYILHNDTSVFTWTGNLATSTD  567

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  568   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYSSQ  609

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C  + ++  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  610   KLTKE----PESDPHLFSCTFSKEILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  665

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  666   VVPKNKLQALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  721



>emb|CDY14188.1| BnaA08g13190D [Brassica napus]
Length=975

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 280/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPVPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV    VPFAR SLNHD +++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVV---HVPFARSSLNHDGIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A+SGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADAESGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               +D+D        KLFC++ GQ NPV+G+ L +  L+ SKCY+LDCG EVFVW+GR T 
Sbjct  238   TANDEDKTYNSDITKLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEVFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET++F+ +FD+W    + T  E+GRG+
Sbjct  298   LDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVTFRSKFDTWTQETNTTVSEDGRGR  356


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 151/356 (42%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + V L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  390   NLQVWRVNGQEKVLLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSMASKMVESMKFVPAQARIYEGKEPLQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF--NGANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ +  N A S  
Sbjct  508   EDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWIGNLATSTD  567

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  568   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYRSQ  609

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C     +  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  610   KLTKE----PESDPHLFSCSFTKDILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  665

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  666   VAPKNKLQALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  721



>ref|XP_007014318.1| Villin 4 isoform 4 [Theobroma cacao]
 gb|EOY31937.1| Villin 4 isoform 4 [Theobroma cacao]
Length=937

 Score =   446 bits (1147),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+ AFQ AGQKAGIEIWRIENF PVP+PK+ YGKF+ GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDSAFQGAGQKAGIEIWRIENFLPVPVPKSSYGKFFMGDSYVILKTTTLKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGK+T+QDEAG AA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKNTTQDEAGAAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  EEEE +TRL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEEEEHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKAKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D      P KL  ++ GQ  PV+ + L++  LE +KCY+LDCG EVFVW+GR+T 
Sbjct  241   TASEEDKTVGSHPTKLLSVEKGQAVPVEADSLTRELLETNKCYILDCGLEVFVWMGRSTP  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             LDERK+A   AEE +    R K + I R+ +G ET+ F+ +F+SWP A+     E+GRGK
Sbjct  301   LDERKSASGAAEELIRASDRVK-SHIIRVIEGFETVMFRSKFESWPLATNVAVSEDGRGK  359


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 97/384 (25%), Positives = 160/384 (42%), Gaps = 64/384 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++W +   + V LP AD  KFYSGD Y+   
Sbjct  369   VNVKGLLKAAPVKEEPQPYIDCTG---NLQVWLVNGQEKVLLPAADQSKFYSGDCYIFQY  425

Query  264   TTSGKGG-PYLFDIHFWLGKDTSQDE---AGTAAIKTVELDTILGGKGVQHREIQTHESD  431
             +  G+    YL  I  W GK + ++E   A + A K VE    L  +   H   +  E  
Sbjct  426   SYPGEDKEEYL--IGTWFGKQSVEEERVSAVSLASKMVESMKFLAAQACIH---EGSEPI  480

Query  432   RFLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPF  578
             +F S F+  I+  +GG + G+K    E+E     Y   G  + R++          QV  
Sbjct  481   QFFSIFQSFIV-FKGGHSDGYKNYIAEKEIPNGTYTEDGVALFRVQGSGPENMQAIQVEA  539

Query  579   ARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGN  758
                SLN    ++L +   ++ + G  ++  ++      +  +K                N
Sbjct  540   VGSSLNSSYCYILHSASTVFTWAGNLTSPDDQELVERQLDLIKP---------------N  584

Query  759   LQAE-----ADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GE  917
             LQ++     ++S  FWEL GG +    +  S +   PE  P    C    G +  ++   
Sbjct  585   LQSKPQKEGSESELFWELLGGKSEYPSQKISRE---PEGDPHLFSCTFAKGNLKVMEIYN  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              ++ +L     ++LDC S++FVWVG+      +  A    E+FL    + +   + T I 
Sbjct  642   FTQDDLMTEDIFILDCHSDIFVWVGQQVDTKTKLQALTIGEKFLEQDFLLENLSRETPIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASAT  1157
              + +G E   F   F +W SA  T
Sbjct  702   IVMEGSEPPFFTRLF-TWDSAKFT  724



>ref|XP_007014316.1| Villin 4 isoform 2 [Theobroma cacao]
 ref|XP_007014317.1| Villin 4 isoform 2 [Theobroma cacao]
 gb|EOY31935.1| Villin 4 isoform 2 [Theobroma cacao]
 gb|EOY31936.1| Villin 4 isoform 2 [Theobroma cacao]
Length=960

 Score =   446 bits (1147),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+ AFQ AGQKAGIEIWRIENF PVP+PK+ YGKF+ GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDSAFQGAGQKAGIEIWRIENFLPVPVPKSSYGKFFMGDSYVILKTTTLKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGK+T+QDEAG AA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKNTTQDEAGAAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  EEEE +TRL+VC+GK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEEEEHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFILDTKAKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S++D      P KL  ++ GQ  PV+ + L++  LE +KCY+LDCG EVFVW+GR+T 
Sbjct  241   TASEEDKTVGSHPTKLLSVEKGQAVPVEADSLTRELLETNKCYILDCGLEVFVWMGRSTP  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             LDERK+A   AEE +    R K + I R+ +G ET+ F+ +F+SWP A+     E+GRGK
Sbjct  301   LDERKSASGAAEELIRASDRVK-SHIIRVIEGFETVMFRSKFESWPLATNVAVSEDGRGK  359


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 97/384 (25%), Positives = 160/384 (42%), Gaps = 64/384 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++W +   + V LP AD  KFYSGD Y+   
Sbjct  369   VNVKGLLKAAPVKEEPQPYIDCTG---NLQVWLVNGQEKVLLPAADQSKFYSGDCYIFQY  425

Query  264   TTSGKGG-PYLFDIHFWLGKDTSQDE---AGTAAIKTVELDTILGGKGVQHREIQTHESD  431
             +  G+    YL  I  W GK + ++E   A + A K VE    L  +   H   +  E  
Sbjct  426   SYPGEDKEEYL--IGTWFGKQSVEEERVSAVSLASKMVESMKFLAAQACIH---EGSEPI  480

Query  432   RFLSYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPF  578
             +F S F+  I+  +GG + G+K    E+E     Y   G  + R++          QV  
Sbjct  481   QFFSIFQSFIV-FKGGHSDGYKNYIAEKEIPNGTYTEDGVALFRVQGSGPENMQAIQVEA  539

Query  579   ARPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGN  758
                SLN    ++L +   ++ + G  ++  ++      +  +K                N
Sbjct  540   VGSSLNSSYCYILHSASTVFTWAGNLTSPDDQELVERQLDLIKP---------------N  584

Query  759   LQAE-----ADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GE  917
             LQ++     ++S  FWEL GG +    +  S +   PE  P    C    G +  ++   
Sbjct  585   LQSKPQKEGSESELFWELLGGKSEYPSQKISRE---PEGDPHLFSCTFAKGNLKVMEIYN  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              ++ +L     ++LDC S++FVWVG+      +  A    E+FL    + +   + T I 
Sbjct  642   FTQDDLMTEDIFILDCHSDIFVWVGQQVDTKTKLQALTIGEKFLEQDFLLENLSRETPIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASAT  1157
              + +G E   F   F +W SA  T
Sbjct  702   IVMEGSEPPFFTRLF-TWDSAKFT  724



>ref|XP_011079274.1| PREDICTED: villin-4-like [Sesamum indicum]
 ref|XP_011079275.1| PREDICTED: villin-4-like [Sesamum indicum]
Length=962

 Score =   446 bits (1147),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ ++PAFQ AGQKAGIEIWRIENF+PVP+ ++ +GKF++GDSYVVL+TT+ K G 
Sbjct  1     MAVSMRDVDPAFQGAGQKAGIEIWRIENFRPVPVAQSSHGKFFTGDSYVVLKTTASKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE +TRLYVCKGK VV +K+VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHAETEEHQTRLYVCKGKHVVHVKEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEIAAIEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              T D+    +  P KL+C++ G+  PV+   L++  L+  KCY+LDCG EVFVW+GR++ 
Sbjct  241   TTIDEPKSDDVGPSKLYCVEKGEAVPVEVDSLTRQLLDTHKCYILDCGKEVFVWMGRSSS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             L++RKAA    +E L    R  +  + R+ +G ET+ F+ +FDSWP   +    E+GRGK
Sbjct  301   LNQRKAATSAVDELLRSSDRSNSY-VIRVIEGFETVIFRSKFDSWPQLTNVAVTEDGRGK  359


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 156/353 (44%), Gaps = 47/353 (13%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR++  +   L  +D  KFYSGD Y+   +  G+       I  W GK + +++  +
Sbjct  394   LQVWRVDGQQKTLLLASDQSKFYSGDCYIFQYSYPGEEKDETL-IGTWFGKQSVEEDRVS  452

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A  +  ++   L     Q R  +  E  +F + F+  I+  +GG++ G+KK   E+E   
Sbjct  453   ATSQASKMVESLKFLPAQARIHEGSEPIQFFAIFQSFIV-FKGGLSKGYKKYITEKELPD  511

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  + R++          QV     SLN    ++L +   ++ ++G  ++    
Sbjct  512   DTYSEDGLALFRVQGSGPDNMQAIQVEPVASSLNSSYCYILHSGSSVFTWSGNLTS----  567

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAP-----MGRKVTS  836
             ++A EV++   D     +          LQ E A+S +FWEL GG +      + R   S
Sbjct  568   SEAQEVVERQLDLIKPNM-------QSKLQKEGAESEQFWELLGGKSEYPSQRIARVAES  620

Query  837   DDDIIPEKTPPKLF--CIDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRATQL  1007
             D         P LF   +  G +   +    ++ +L     Y+LDC S+++VWVG+  + 
Sbjct  621   D---------PHLFSCTLTKGDLKVTEIYNFNQDDLMTEDIYVLDCQSDIYVWVGQQVES  671

Query  1008  DERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
               +       E+FL    + +K    T I  + +G+E  S+   F SW S  +
Sbjct  672   KNKMNTLNIGEKFLERDFLHEKLSPHTPIYIIMEGNEP-SYFTRFFSWDSTKS  723



>emb|CDY62397.1| BnaC07g50870D [Brassica napus]
Length=981

 Score =   446 bits (1148),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 222/365 (61%), Positives = 282/365 (77%), Gaps = 8/365 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMK---QVP--FARPSLNHDDVFVLDTKDK  632
              EGGVASGFK  E EE  TRL+VC+GK VV +K   Q+P  FAR SL HDD+++LDTK K
Sbjct  121   QEGGVASGFKHVEAEEHITRLFVCRGKHVVHVKEASQIPVAFARSSLTHDDIYILDTKSK  180

Query  633   IYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFA  812
             I+QFNG+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFA
Sbjct  181   IFQFNGSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFA  240

Query  813   PMGRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWV  989
             P+ RK  +++D        KLFC++ GQ NPV+G+ L +  L+ SKCY+LDCG EVFVW+
Sbjct  241   PLPRKTANEEDKTYTSDIKKLFCVEKGQANPVEGDSLKREMLDTSKCYILDCGLEVFVWM  300

Query  990   GRATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS-ATPPE  1166
             GR T LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W   +  T  E
Sbjct  301   GRTTSLDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWDQVTNTTVSE  359

Query  1167  EGRGK  1181
             +GRG+
Sbjct  360   DGRGR  364


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 151/356 (42%), Gaps = 50/356 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  398   NLQVWRVNGQQKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  456

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG+ SG+KK   E+E +
Sbjct  457   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGIGSGYKKYIAEKEVD  515

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ + G  A S  
Sbjct  516   DDTYNENGLALFRIQGSGPENMQAIQVEPVASSLNSSYCYILHNDTSVFTWTGNLATSTD  575

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  576   QELVERQLDLIK------------------PNLQTRAQKEGSESDQFWELLGGKTEYSSQ  617

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C    ++  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  618   KLTKE----PESDPHLFSCTFTKEILKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  673

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ +
Sbjct  674   VVPKNKLQALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKS  729



>ref|XP_006453314.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
 ref|XP_006453315.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
 ref|XP_006453316.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
 ref|XP_006474218.1| PREDICTED: villin-4-like isoform X1 [Citrus sinensis]
 ref|XP_006474219.1| PREDICTED: villin-4-like isoform X2 [Citrus sinensis]
 ref|XP_006474220.1| PREDICTED: villin-4-like isoform X3 [Citrus sinensis]
 gb|ESR66554.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
 gb|ESR66555.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
 gb|ESR66556.1| hypothetical protein CICLE_v10007360mg [Citrus clementina]
Length=963

 Score =   445 bits (1145),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/362 (61%), Positives = 285/362 (79%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+ AFQ AGQKAGIEIWRIENFKPV +PK+ +GKF++GDSYV+L+TT+ K G 
Sbjct  1     MSVSMRDLDSAFQGAGQKAGIEIWRIENFKPVLVPKSSHGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGG+ASGFK+ E EE + RL+VC+GK V+ +K+VPF+R SLNHDD+F+LDT+ KI+QFN
Sbjct  121   QEGGIASGFKRAEAEEHKIRLFVCRGKHVIHVKEVPFSRSSLNHDDIFILDTQSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA+VEDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAVVEDGKLMADAEAGEFWGFFGGFAPLPRK  240

Query  828   VT--SDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             +T   +++ I      KL+ +D GQ  PV G+ L++  LE +KCY+LDCG EVFVW+GR 
Sbjct  241   MTISEENNNIVHSHSTKLYSVDKGQAVPVGGDSLTRDLLETNKCYILDCGIEVFVWMGRN  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGR  1175
             T LDERK+A   AEE L    R K+  I R+ +G ET+ FK +FD WP   + T  E+GR
Sbjct  301   TSLDERKSASGAAEELLKGSDRSKSHMI-RVIEGFETVMFKSKFDCWPQETNVTVSEDGR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 91/354 (26%), Positives = 153/354 (43%), Gaps = 51/354 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + V L  AD  K YSGD Y+   +  G     +  I  W GK + +D+  
Sbjct  395   NLQVWRVNGQEKVLLSGADQTKLYSGDCYIFQYSYPGDEKEEIL-IGTWFGKQSVEDDRA  453

Query  345   TA---AIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-----  500
             +A   A K VE    L    VQ R  + HE  +F S F+  I+ L+GG++ G+K      
Sbjct  454   SAISLASKMVESMKFLP---VQARIYEGHEPIQFFSIFQSFIV-LKGGLSDGYKTYIAEK  509

Query  501   --PEE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSN  662
               P+E  +E    L+  +G     M+  QV     SLN    ++L     ++ ++G  ++
Sbjct  510   GIPDETYKEDGVALFRIQGSGPDNMQAIQVEPVAASLNSSYCYILHNDSTVFTWSGNLTS  569

Query  663   IQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFAPM-GR  824
              + +      +  +K                NLQ++     A+S +FWEL  G +    +
Sbjct  570   SENQELVERQLDLIKP---------------NLQSKSQKEGAESEQFWELLEGKSEYPSQ  614

Query  825   KVTSDDDIIPEKTPPKLFC-IDNGQVNPVD-GELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+  +    PE  P    C    G +   +    ++ +L     ++LDC SE+FVWVG+ 
Sbjct  615   KIARE----PESDPHLFSCTFSKGHLKVSEIYNFTQDDLMTEDIFILDCHSEIFVWVGQQ  670

Query  999   TQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
                  +  A    E+F+    + +  P    I  + +G E   F   F +W SA
Sbjct  671   VDSKSKMHALTIGEKFIGHDFLLENLPHEVPIYIVLEGSEP-PFFTRFFTWDSA  723



>gb|KHG28533.1| Villin-4 -like protein [Gossypium arboreum]
Length=958

 Score =   445 bits (1144),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 281/360 (78%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAGIEIWRIENF+PVP+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGIEIWRIENFRPVPVPKSSYGKFFTGDSYVILKTTALKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGAAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  +EEE + R++VC+GK VV    VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVQEEEHKIRMFVCRGKHVV---HVPFARSSLNHDDIFILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA +EDG L A+A++GEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAIEDGKLMADAETGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SD+D   +    KL  ++ GQ  PVD + L++  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  238   TASDEDRTVQSHTAKLLSVEKGQAKPVDADSLTRELLDTNKCYILDCGLEVFVWMGRNTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK A   AEE +    RPK ++I R+ +G ET+ FK +F+SWP + +    E+GR K
Sbjct  298   LDERKTASGAAEELIRGSDRPK-SQIIRVIEGFETVVFKSKFESWPQTTNVAVTEDGRSK  356


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 164/383 (43%), Gaps = 62/383 (16%)
 Frame = +3

Query  114   VNVKALEPAFQAAGQ-------KAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTS  272
             +NVK L  A  A  +          +++WR+   + V LP +D  KFYSGD Y+   +  
Sbjct  366   LNVKGLAKAAPAKEEPQPYIDCTGNLQVWRVNGQEKVLLPASDQSKFYSGDCYIFQYSYP  425

Query  273   GKGG-PYLFDIHFWLGKDTSQDE---AGTAAIKTVELDTILGGKGVQHREIQTHESDRFL  440
             G+    YL  I  W+GK + +D+   A + A K VE       +   H   +  E  +F 
Sbjct  426   GEDKEEYL--IGTWIGKQSVEDDRVSAVSLATKMVESMKFQATQACIH---EGSEPIQFF  480

Query  441   SYFKPCIMPLEGGVASGFKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARP  587
             S F+  I+  +GG++ G+K    E+E     Y   G  + R++          QV     
Sbjct  481   SIFQSFIV-FKGGLSDGYKNYIAEKEIPEGTYTEDGLALFRVQGSGPDNMQAIQVEAVAS  539

Query  588   SLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQA  767
             SLN    ++L +   ++ + G  ++  +       +  +K                NLQ+
Sbjct  540   SLNSSYCYILHSGSTVFTWAGNLTSPDDHELVERQLDIIKP---------------NLQS  584

Query  768   E-----ADSGEFWELFGGFAPM-GRKVTSDDDIIPEKTPPKLFCI---DNGQVNPVDGEL  920
             +     ++S +FWEL GG +    +K+  +    PE  P    C     N +V  +    
Sbjct  585   KPQKEGSESEQFWELLGGKSEYPSQKIARE----PEGDPHLFSCTFSKGNLKVTEIYN-F  639

Query  921   SKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITR  1088
             S+ +L     ++LDC S++FVWVG+      +  A    ++FL    + +K  +   I  
Sbjct  640   SQDDLMTEDIFILDCHSDIFVWVGQQVDTKNKLQALTIGQKFLEHDFLLEKLSREAPIYI  699

Query  1089  LAQGHETISFKCEFDSWPSASAT  1157
             + +G E   F   F SW SA ++
Sbjct  700   VMEGSEP-PFFTRFFSWDSAKSS  721



>gb|EEE66162.1| hypothetical protein OsJ_22231 [Oryza sativa Japonica Group]
Length=1002

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/363 (59%), Positives = 277/363 (76%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             +M+V+++ ++  FQ AGQK G+EIWRIE  + VP+PK  +G+F++GDSYV+L+TT+ K G
Sbjct  32    SMAVSMREVDAVFQGAGQKDGLEIWRIEKLQAVPVPKESHGRFFTGDSYVILKTTALKNG  91

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E++RFLSYFKPCI+
Sbjct  92    SFRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETERFLSYFKPCII  151

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGG+ASGF+  E  E E  TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  152   PEEGGIASGFRHTEINEREHVTRLFVCRGKHTVHVKEVPFARSSLNHDDIFILDTKSKIF  211

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKD+ H G C+V  VEDG L A+AD+GEFW LFGGFAP+
Sbjct  212   QFNGSNSSIQERAKALEVVQYLKDSNHEGKCDVGSVEDGKLMADADAGEFWGLFGGFAPL  271

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  SD +        KL C++ GQ  PVD + L++  L+++KCYLLDCGSE++VW+GR
Sbjct  272   PRKTFSDLNGKDSAFSSKLICLNKGQTVPVDFDVLTRELLDSTKCYLLDCGSEIYVWMGR  331

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L+ERK A   AEE L +  RPK + I RL +G ET+ F+ +F  WP  A A   +E 
Sbjct  332   ETPLEERKRAGSAAEELLREVNRPK-SHIVRLMEGFETVIFRSKFSKWPKKADAVVSDES  390

Query  1173  RGK  1181
             RGK
Sbjct  391   RGK  393


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 88/347 (25%), Positives = 150/347 (43%), Gaps = 35/347 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L  ++  KFYSGD Y+   +  G+ G     I  W GK + QDE  T
Sbjct  428   LQVWRVNGTEKTFLSFSEQCKFYSGDCYIFQYSYPGEEGEECL-IGTWFGKKSVQDEKTT  486

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A     ++   L  + V  R  +  E   F S F+  ++  +GGV++G+KK   E   E 
Sbjct  487   AISVASKMVESLKFQAVMVRLYEGKEPAEFFSIFQNLVI-FKGGVSTGYKKFVSENGIED  545

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  + R++          QV  A  SLN    +VL   D ++ + G  S+  ++
Sbjct  546   DTYSENGVALFRVQGSGPENMQAIQVDTAATSLNSSYCYVLHDGDTLFTWIGNLSSSMDQ  605

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A   +  +K      +          L+  ++  +FW+L G  +    +  + D    
Sbjct  606   ELAERQLDVIKPNLQSRM----------LKEGSEYDQFWKLLGVKSEYPSQKIAKD----  651

Query  855   EKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             +++ P LF C  +  V  V      ++ +L     ++LDC S VFVWVG+      R  A
Sbjct  652   QESDPHLFSCTFSKGVLKVREIFNFTQDDLMTEDVFILDCHSCVFVWVGQRVDTKMRAQA  711

Query  1026  CQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 E+FL    + +   + T +  + +G E   F   F +W SA +
Sbjct  712   LSVGEKFLELDILMENSSQETPVYVITEGSEP-QFFTRFFTWDSAKS  757



>gb|KCW48016.1| hypothetical protein EUGRSUZ_K017494, partial [Eucalyptus grandis]
 gb|KCW48017.1| hypothetical protein EUGRSUZ_K017494, partial [Eucalyptus grandis]
Length=257

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 228/257 (89%), Gaps = 0/257 (0%)
 Frame = +3

Query  108  MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
            MS   K L+PAFQ AGQ+ G EIWRIE+F+PVPLPK+++GKFY GDSY+VLQTT GKGG 
Sbjct  1    MSSTAKVLDPAFQGAGQRIGTEIWRIEDFQPVPLPKSEHGKFYMGDSYIVLQTTPGKGGA  60

Query  288  YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
            YL+DIHFW+GKDTSQDEAGTAAIKTVELD  LGG+ VQHRE+Q HESD+FLSYFKPCI+P
Sbjct  61   YLYDIHFWIGKDTSQDEAGTAAIKTVELDAALGGRAVQHRELQGHESDKFLSYFKPCIIP  120

Query  468  LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
            LEGGVASGFKKPEEEEFETRLYVC+GKRVVR+KQV FAR SLNHDDVF+LDT+ KIYQFN
Sbjct  121  LEGGVASGFKKPEEEEFETRLYVCRGKRVVRLKQVLFARSSLNHDDVFILDTQQKIYQFN  180

Query  648  GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
            GANSNIQERAKALEVIQFLK+ YH G C+VAIV+DG L  E+DSGEFW L GGFAP+G+K
Sbjct  181  GANSNIQERAKALEVIQFLKEKYHEGTCDVAIVDDGKLDTESDSGEFWVLLGGFAPIGKK  240

Query  828  VTSDDDIIPEKTPPKLF  878
            V+S+DD I E TP KL+
Sbjct  241  VSSEDDAILEATPAKLY  257



>ref|XP_011043930.1| PREDICTED: villin-4-like [Populus euphratica]
 ref|XP_011043931.1| PREDICTED: villin-4-like [Populus euphratica]
 ref|XP_011043932.1| PREDICTED: villin-4-like [Populus euphratica]
Length=960

 Score =   443 bits (1140),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/360 (60%), Positives = 283/360 (79%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+ AFQ AGQKAG+EIWRIENF+PVP+PK+ +G F++GDSYV+LQTT+ K G 
Sbjct  1     MAVSMRDLDSAFQGAGQKAGLEIWRIENFRPVPVPKSSHGNFFTGDSYVILQTTALKSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAG AAIKTV LD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGVAAIKTVVLDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK+ +  E +T L+VC+GK VV + +VPFAR SLNHDD+F+LDTK KI+QFN
Sbjct  121   QEGGVASGFKQAKAMEHQTHLFVCRGKHVVHVNEVPFARSSLNHDDIFILDTKSKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+A++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHDGKCEVAAVEDGKLMADAETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
              TSD+D        KLF ++ GQ  PV+ + L++  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  241   TTSDEDKTDVSFSTKLFHVEKGQAEPVEADSLTRELLDTNKCYILDCGVEVFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGRGK  1181
             LDERK+A   AEE +   +RP  ++I R+ +G ET+ F+ +F+SWP + + T  E+GRGK
Sbjct  301   LDERKSASGAAEELVRAAERPN-SRIARVIEGFETVMFRSKFESWPQTTNVTVSEDGRGK  359


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 86/360 (24%), Positives = 156/360 (43%), Gaps = 59/360 (16%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP-YLFDIHFWLGKDTSQDEAG  344
             +++W + + + + +P A+  KFY G  Y+   +  G+    YL  I  W GK + ++E  
Sbjct  394   LQVWSVNDQEKILIPAANQSKFYGGGCYIFQYSYPGEDREEYL--IGTWFGKKSVEEERA  451

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-------P  503
             +A     ++   L     Q R  + +E   F S F+  I+  +GG +SG+KK       P
Sbjct  452   SAISLASKMVESLKFLPAQARIFEGNEPILFFSIFQSFIV-FKGGHSSGYKKYIAENELP  510

Query  504   EE--EEFETRLYVCKGKRVVRMK--QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
             +E  +E    L+  +G     M+  QV     SLN    ++L     ++ ++G  +  ++
Sbjct  511   DETCKEDGVALFRVQGSGPDNMQAIQVEPVASSLNSSYCYILHNDSSVFTWSGNLTTSED  570

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-----ADSGEFWELFGGFA-----PMG  821
                    +  +K                N+Q++     ++S +FW+L GG +      + 
Sbjct  571   HELIERQLDLIKP---------------NMQSKPQKEGSESEQFWDLLGGKSEYPSQKLA  615

Query  822   RKVTSDDDIIPEKTPPKLF-CI---DNGQVNPVDGELSKSNLENSKCYLLDCGSEVFVWV  989
             R+  SD         P LF CI    N +V+ +    ++ +L     ++LD  SE+FVWV
Sbjct  616   REAESD---------PHLFSCIFSKGNLKVSEIYN-FTQDDLMTEDIFILDTHSEIFVWV  665

Query  990   GRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
             G+      +  A    E+FL    + +K      I  + +G E   F   F +W SA ++
Sbjct  666   GQQVDSKSKLQALSIGEKFLEHDFLLKKSSGEAPIYIVMEGSEP-PFFTRFFTWDSAKSS  724



>ref|XP_010240180.1| PREDICTED: villin-4-like isoform X2 [Brachypodium distachyon]
Length=979

 Score =   444 bits (1141),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             TM+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  +GKF++GDSY++L+TT+ K G
Sbjct  32    TMAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESHGKFFTGDSYIILKTTALKNG  91

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E+++FLSYF+PCI+
Sbjct  92    SFRNDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETEKFLSYFRPCII  151

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGGVASGF+  E  E E  TRL+VC+G+  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  152   PEEGGVASGFRHTEINEREHVTRLFVCRGRHTVHVKEVPFARSSLNHDDIFILDTKSKIF  211

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKDT H G C+VA VEDG L A+AD+GEFW LFGGFAP+
Sbjct  212   QFNGSNSSIQERAKALEVVQYLKDTNHEGKCDVAAVEDGKLMADADAGEFWGLFGGFAPL  271

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  S+ +        KL C++ GQ   VD E L+++ L+ +KCYLLDCGSE++ W+GR
Sbjct  272   PRKTFSELNGKDTAFASKLLCVNKGQTVSVDCEVLTRALLDTTKCYLLDCGSEIYAWMGR  331

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L++RK A   AEE L +  RPK + I RL +G ET+ F+ +F+ WP  A A   +E 
Sbjct  332   ETALEDRKRAGLAAEELLREGNRPK-SHIIRLMEGFETVIFRSKFNKWPKKAEAVVSDES  390

Query  1173  RGK  1181
             RGK
Sbjct  391   RGK  393


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 148/348 (43%), Gaps = 35/348 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ +     L  ++  KFYSGD Y+   + +G  G     +  W GK + Q+E  
Sbjct  427   NLQVWRVNDSDKTFLSFSEQCKFYSGDCYIFQYSYTGDEGEECL-VGTWFGKRSIQEERT  485

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   E
Sbjct  486   AAISLADKMVESLKFQAVLVRLYEGKEPIEFFPIFQNLVI-FKGGASTGYKKFVSENGIE  544

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV  A PSLN    ++L   D ++ + G  S+  +
Sbjct  545   DDTYSENGVALFRIQGSGPDNMQAIQVDTAAPSLNSSYCYILHDGDTVFTWVGNLSSSMD  604

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A   +  +K      +          L+  ++  +FW+L G    +  +  S   + 
Sbjct  605   QELAERQLDVIKPNLQSRL----------LKEGSEYDQFWKLLG----VKSEYPSQKIVR  650

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++   LF C  +  V  V      ++ ++     ++LDC S VFVWVG+      R  
Sbjct  651   DQESDAHLFSCTFSKGVLKVREIFNFAQDDMMAEDIFILDCHSSVFVWVGQHVDTKIRAQ  710

Query  1023  ACQTAEEF----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A    E+F    ++ +   + T +  +A+G E   F   F +W SA +
Sbjct  711   ALSIGEKFIEFDILMEDLSRETPLYVIAEGSEP-QFFTRFFTWDSAKS  757



>ref|XP_002864511.1| hypothetical protein ARALYDRAFT_495830 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40770.1| hypothetical protein ARALYDRAFT_495830 [Arabidopsis lyrata subsp. 
lyrata]
Length=978

 Score =   444 bits (1141),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 277/360 (77%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q AGQK+GIEIWRIENFKPV +PK  +G+F++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGAGQKSGIEIWRIENFKPVTVPKESHGRFFTGDSYIVLKTTASRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG  A+ TVELD+ LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGAVAVMTVELDSALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR   VPF R +LNH+DVF+LDT+ KI+QFN
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVR---VPFVRSTLNHEDVFILDTESKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C++A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  178   GSKSSIQERAKALEVVQYIKDTYHDGKCDIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
                +DD   E    KLF +D G+ + V+ E L+K  L+ +KCY+LDCG E+FVW GR T 
Sbjct  238   PAVNDDETAESDGIKLFSVDKGKTDAVEAESLTKELLDTNKCYILDCGLELFVWKGRNTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK A + AEEF  +   P+ + +  + +G+ET+ F+ +FDSWP++S    P++GRGK
Sbjct  298   IDQRKNATEAAEEFF-RSSEPQKSNLVSVMEGYETVMFRSKFDSWPASSTIAEPQQGRGK  356


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 75/369 (20%), Positives = 142/369 (38%), Gaps = 58/369 (16%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WRI   + + L  A+  KFYSGD Y+   +  G+       +  W GK + +++  
Sbjct  391   NLQVWRINCEEKILLEAAEQSKFYSGDCYIFQYSYPGEDREEHL-VGTWFGKQSVEEDRT  449

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I   +GG++  FKK   E E  
Sbjct  450   SALSMANKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGLSEAFKKYIAENEIP  508

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y  +G  + R++          Q+      LN    ++L     ++ + G  ++  +
Sbjct  509   DTTYEAEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVFTWCGNLTSSDD  568

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAE-ADSGEFWELFGGFAPM-GRKVTSDDD  845
             +     ++  ++             E    Q E ++S  FWEL GG +    +K+  D +
Sbjct  569   QELMERMLDLIRPN-----------EPTKAQKEGSESEHFWELLGGKSEYPSQKIKKDGE  617

Query  846   IIPEKTPPKLF----------------------CIDNGQVNPVDGELSKSNLENSKCYLL  959
                  + P LF                      C D           ++ +L     ++L
Sbjct  618   -----SDPHLFSCTFTNENLKVGYGINCHKPHSCYDPTSRVTEIFSFTQDDLMTEDIFIL  672

Query  960   DCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCE  1127
             DC +E+FVWVG+     ++       E FL    + +     T I  + +G+E   F   
Sbjct  673   DCHTEIFVWVGQQVDPKKKPQVLAIGENFLKHDFLLENLASETPIYIVTEGNEP-PFFTR  731

Query  1128  FDSWPSASA  1154
             F +W S+ +
Sbjct  732   FFTWDSSKS  740



>ref|XP_003560396.1| PREDICTED: villin-4-like isoform X1 [Brachypodium distachyon]
Length=1000

 Score =   444 bits (1142),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             TM+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  +GKF++GDSY++L+TT+ K G
Sbjct  32    TMAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESHGKFFTGDSYIILKTTALKNG  91

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E+++FLSYF+PCI+
Sbjct  92    SFRNDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETEKFLSYFRPCII  151

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGGVASGF+  E  E E  TRL+VC+G+  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  152   PEEGGVASGFRHTEINEREHVTRLFVCRGRHTVHVKEVPFARSSLNHDDIFILDTKSKIF  211

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKDT H G C+VA VEDG L A+AD+GEFW LFGGFAP+
Sbjct  212   QFNGSNSSIQERAKALEVVQYLKDTNHEGKCDVAAVEDGKLMADADAGEFWGLFGGFAPL  271

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  S+ +        KL C++ GQ   VD E L+++ L+ +KCYLLDCGSE++ W+GR
Sbjct  272   PRKTFSELNGKDTAFASKLLCVNKGQTVSVDCEVLTRALLDTTKCYLLDCGSEIYAWMGR  331

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L++RK A   AEE L +  RPK + I RL +G ET+ F+ +F+ WP  A A   +E 
Sbjct  332   ETALEDRKRAGLAAEELLREGNRPK-SHIIRLMEGFETVIFRSKFNKWPKKAEAVVSDES  390

Query  1173  RGK  1181
             RGK
Sbjct  391   RGK  393


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 148/348 (43%), Gaps = 35/348 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ +     L  ++  KFYSGD Y+   + +G  G     +  W GK + Q+E  
Sbjct  427   NLQVWRVNDSDKTFLSFSEQCKFYSGDCYIFQYSYTGDEGEECL-VGTWFGKRSIQEERT  485

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   E
Sbjct  486   AAISLADKMVESLKFQAVLVRLYEGKEPIEFFPIFQNLVI-FKGGASTGYKKFVSENGIE  544

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV  A PSLN    ++L   D ++ + G  S+  +
Sbjct  545   DDTYSENGVALFRIQGSGPDNMQAIQVDTAAPSLNSSYCYILHDGDTVFTWVGNLSSSMD  604

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A   +  +K      +          L+  ++  +FW+L G    +  +  S   + 
Sbjct  605   QELAERQLDVIKPNLQSRL----------LKEGSEYDQFWKLLG----VKSEYPSQKIVR  650

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++   LF C  +  V  V      ++ ++     ++LDC S VFVWVG+      R  
Sbjct  651   DQESDAHLFSCTFSKGVLKVREIFNFAQDDMMAEDIFILDCHSSVFVWVGQHVDTKIRAQ  710

Query  1023  ACQTAEEF----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A    E+F    ++ +   + T +  +A+G E   F   F +W SA +
Sbjct  711   ALSIGEKFIEFDILMEDLSRETPLYVIAEGSEP-QFFTRFFTWDSAKS  757



>gb|AES65225.2| actin filament bundling protein P-115-ABP [Medicago truncatula]
Length=962

 Score =   443 bits (1140),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 283/362 (78%), Gaps = 7/362 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ L+PAFQ AGQKAG+EIWRIENF PVP+PK+ YGKF++GDSYV+L+TT+ K G 
Sbjct  1     MAVSMRDLDPAFQGAGQKAGLEIWRIENFNPVPVPKSSYGKFFTGDSYVILKTTASKSGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+W+GKDTSQDEAG AAIKTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWIGKDTSQDEAGAAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E E+ +TRL+VC+GK VV +K+VPFAR SLNHDD+FVLDT+ KI+QFN
Sbjct  121   QEGGVASGFKHAEAEKHKTRLFVCRGKHVVHVKEVPFARSSLNHDDIFVLDTESKIFQFN  180

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C +A +EDG L A+ ++GEFW  FGGFAP+ RK
Sbjct  181   GSNSSIQERAKALEVVQYIKDTYHEGKCEIAAIEDGKLMADPETGEFWGFFGGFAPLPRK  240

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               SD+D   +    KL  ++ GQ  PV+ + L +  L+ +KCY+LDCG E+FVW+GR T 
Sbjct  241   AASDNDKSADSHSTKLLSVEKGQAEPVEADSLKREFLDTNKCYILDCGLEIFVWMGRNTS  300

Query  1005  LDERKAACQTAEEFL--VKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             LDERK+A   A+E +  + Q +P   +I R+ +G ET+ FK +FDSWP +   T  E+GR
Sbjct  301   LDERKSASGVADELVSGIDQLKP---QIVRVIEGFETVLFKSKFDSWPQTPDVTVSEDGR  357

Query  1176  GK  1181
             GK
Sbjct  358   GK  359


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 168/383 (44%), Gaps = 64/383 (17%)
 Frame = +3

Query  114   VNVKAL----------EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQ  263
             VNVK L          +P     G    +++WR+   + + LP +D  KFYSGD ++   
Sbjct  369   VNVKGLLKADAVKEEPQPYIDCTGH---LQVWRVNGQEKILLPASDQSKFYSGDCFIFQY  425

Query  264   TTSGKGGPYLFDIHFWLGKDTSQDEAGTA---AIKTVELDTILGGKGVQHREIQTHESDR  434
             +  G+       I  W+GK++ ++E  +A   A K VE    L     Q R  + +E  +
Sbjct  426   SYPGEDKDDCL-IGTWIGKNSVEEERASANSLASKMVESMKFLAS---QARIYEGNEPIQ  481

Query  435   FLSYFKPCIMPLEGGVASGFKK-------PEE--EEFETRLYVCKGKRVVRMK--QVPFA  581
             F S  +  I+  +GG++ G+K        P+E   E    L+  +G     M+  QV   
Sbjct  482   FHSILQTFIV-FKGGLSDGYKTYIAEKEIPDETYNEDSVALFRIQGTGPDNMQAIQVEPV  540

Query  582   RPSLNHDDVFVLDTKDKIYQFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNL  761
               SLN    ++L     I+ ++G+N+  +++     ++  +K                NL
Sbjct  541   ASSLNSSYCYILHNGPAIFTWSGSNTTAEDQELIERMLDLIKP---------------NL  585

Query  762   QAE-----ADSGEFWELFGGFAPMGRKVTSDDDIIPEKTPPKLFC--IDNGQVNPVD-GE  917
             Q++      +S +FW+L GG +    +  S +     ++ P LFC    NG +   +   
Sbjct  586   QSKPQREGTESEQFWDLLGGKSEYPSQKISRE----AESDPHLFCCSFSNGNLKVTEIYN  641

Query  918   LSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAACQTAEEFL----VKQKRPKATKIT  1085
              S+ +L     ++LDC S++FVWVG+      R  A    E+FL    + +K  +   I 
Sbjct  642   FSQDDLMTEDIFILDCYSDIFVWVGQEVDSKSRMQALTIGEKFLENDFLLEKLSRVATIY  701

Query  1086  RLAQGHETISFKCEFDSWPSASA  1154
              + +G E   F   F +W SA +
Sbjct  702   VVMEGSEP-PFFTRFFNWESAKS  723



>emb|CDY38289.1| BnaA10g11370D [Brassica napus]
Length=962

 Score =   443 bits (1140),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 277/360 (77%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+ +++ L+ A Q  GQK+GIEIWRIE+FKPV +PK  +GKF++GDSY+VL+TT+ + G 
Sbjct  1     MTFSMRDLDQALQGCGQKSGIEIWRIESFKPVAVPKESHGKFFTGDSYIVLKTTASRSGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKD+SQDEAG+ A+ TVELD+ LGG+ VQ+RE+Q  E+++FLSYFKPCI+P
Sbjct  61    LHHDIHYWLGKDSSQDEAGSVAVMTVELDSALGGRAVQYREVQGQETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGF   + EE +TRLY+CKGK VVR   VPFAR +LNHDDVF+LDT+ KI+QF+
Sbjct  121   QEGGVASGFNHVKPEEHQTRLYICKGKHVVR---VPFARSTLNHDDVFILDTESKIFQFS  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+ S+IQERAKALEV+Q++KDTYH G C +A VEDG + A+A++GEFW LFGGFAP+ +K
Sbjct  178   GSKSSIQERAKALEVVQYIKDTYHDGKCEIAAVEDGRMMADAEAGEFWGLFGGFAPLPKK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               S+DD   E    KLF ++ G+  P++ E L K  L+ +KCY+LDCG E+FVW GR+T 
Sbjct  238   PASNDDQTAESDGIKLFSVEKGKTEPIEVESLQKDLLDTNKCYILDCGLELFVWKGRSTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSASATP-PEEGRGK  1181
             +D+RK+A Q AEEF    +RPK   ++ + +G ET+ F+ +FDSWP+ S    P++GRGK
Sbjct  298   IDQRKSASQAAEEFFRSSERPKLNLVS-VMEGFETVMFRSKFDSWPATSTVAEPQQGRGK  356


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 82/362 (23%), Positives = 149/362 (41%), Gaps = 44/362 (12%)
 Frame = +3

Query  132   EPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFW  311
             +P   A G    +++WRI   + + L  A+  KFYSGD Y+   +  G+       +  W
Sbjct  384   KPYIDATG---NLQVWRINGEEKISLEAAEQSKFYSGDCYIFQYSYPGEDREEHL-VGTW  439

Query  312   LGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASG  491
             LGK + +++  +A     ++   +     Q R  +  E  +F    +  I   +GGV+  
Sbjct  440   LGKQSVEEDRESAISIASKMVESMKFMPAQARIYEGKEPIQFFVIMQSFIT-FKGGVSDA  498

Query  492   FKK-PEEEEFETRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIY  638
             FKK   E E     Y  +G  + R++          Q+      LN    ++L     ++
Sbjct  499   FKKYIAENEVPDNTYDKEGVALFRVQGSGPENMQAIQIEAVSTGLNSSHCYILHGDSTVF  558

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGE-FWELFGGFAP  815
              + G  ++  ++     ++  +K   H              Q E    E FWEL GG + 
Sbjct  559   TWCGNLTSSDDKELMERMLDLIKPNEHTKA-----------QKEGSECEQFWELLGGKSE  607

Query  816   M-GRKVTSDDDIIPEKTPPKLFCI----DNGQVNPVDGELSKSNLENSKCYLLDCGSEVF  980
                +K+  D +     + P LF      DN +V  +    ++ +L     ++LDC +E+F
Sbjct  608   YPSQKIKKDGE-----SDPHLFSCTFSNDNLKVTEI-FSFTQDDLMTEDIFILDCHTEIF  661

Query  981   VWVGRATQLDERKAACQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSA  1148
             VWVG+     ++       E+FL    + +     T I  + +G+E   F   F +W S+
Sbjct  662   VWVGQQVDPKKKPQVLTIGEKFLKDDFLLENLASETPIYIVTEGNEP-PFFTRFFTWDSS  720

Query  1149  SA  1154
              +
Sbjct  721   KS  722



>ref|NP_001058263.1| Os06g0659300 [Oryza sativa Japonica Group]
 dbj|BAD38345.1| putative villin 2 [Oryza sativa Japonica Group]
 dbj|BAD46401.1| putative villin 2 [Oryza sativa Japonica Group]
 dbj|BAF20177.1| Os06g0659300 [Oryza sativa Japonica Group]
Length=1016

 Score =   444 bits (1143),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 213/363 (59%), Positives = 277/363 (76%), Gaps = 5/363 (1%)
 Frame = +3

Query  105   TMSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGG  284
             +M+V+++ ++  FQ AGQK G+EIWRIE  + VP+PK  +G+F++GDSYV+L+TT+ K G
Sbjct  46    SMAVSMREVDAVFQGAGQKDGLEIWRIEKLQAVPVPKESHGRFFTGDSYVILKTTALKNG  105

Query  285   PYLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIM  464
              +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E++RFLSYFKPCI+
Sbjct  106   SFRHDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETERFLSYFKPCII  165

Query  465   PLEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIY  638
             P EGG+ASGF+  E  E E  TRL+VC+GK  V +K+VPFAR SLNHDD+F+LDTK KI+
Sbjct  166   PEEGGIASGFRHTEINEREHVTRLFVCRGKHTVHVKEVPFARSSLNHDDIFILDTKSKIF  225

Query  639   QFNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPM  818
             QFNG+NS+IQERAKALEV+Q+LKD+ H G C+V  VEDG L A+AD+GEFW LFGGFAP+
Sbjct  226   QFNGSNSSIQERAKALEVVQYLKDSNHEGKCDVGSVEDGKLMADADAGEFWGLFGGFAPL  285

Query  819   GRKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGR  995
              RK  SD +        KL C++ GQ  PVD + L++  L+++KCYLLDCGSE++VW+GR
Sbjct  286   PRKTFSDLNGKDSAFSSKLICLNKGQTVPVDFDVLTRELLDSTKCYLLDCGSEIYVWMGR  345

Query  996   ATQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEG  1172
              T L+ERK A   AEE L +  RPK + I RL +G ET+ F+ +F  WP  A A   +E 
Sbjct  346   ETPLEERKRAGSAAEELLREVNRPK-SHIVRLMEGFETVIFRSKFSKWPKKADAVVSDES  404

Query  1173  RGK  1181
             RGK
Sbjct  405   RGK  407


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 88/347 (25%), Positives = 150/347 (43%), Gaps = 35/347 (10%)
 Frame = +3

Query  168   IEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAGT  347
             +++WR+   +   L  ++  KFYSGD Y+   +  G+ G     I  W GK + QDE  T
Sbjct  442   LQVWRVNGTEKTFLSFSEQCKFYSGDCYIFQYSYPGEEGEECL-IGTWFGKKSVQDEKTT  500

Query  348   AAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFET  524
             A     ++   L  + V  R  +  E   F S F+  ++  +GGV++G+KK   E   E 
Sbjct  501   AISVASKMVESLKFQAVMVRLYEGKEPAEFFSIFQNLVI-FKGGVSTGYKKFVSENGIED  559

Query  525   RLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQER  674
               Y   G  + R++          QV  A  SLN    +VL   D ++ + G  S+  ++
Sbjct  560   DTYSENGVALFRVQGSGPENMQAIQVDTAATSLNSSYCYVLHDGDTLFTWIGNLSSSMDQ  619

Query  675   AKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDIIP  854
               A   +  +K      +          L+  ++  +FW+L G  +    +  + D    
Sbjct  620   ELAERQLDVIKPNLQSRM----------LKEGSEYDQFWKLLGVKSEYPSQKIAKD----  665

Query  855   EKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKAA  1025
             +++ P LF C  +  V  V      ++ +L     ++LDC S VFVWVG+      R  A
Sbjct  666   QESDPHLFSCTFSKGVLKVREIFNFTQDDLMTEDVFILDCHSCVFVWVGQRVDTKMRAQA  725

Query  1026  CQTAEEFL----VKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
                 E+FL    + +   + T +  + +G E   F   F +W SA +
Sbjct  726   LSVGEKFLELDILMENSSQETPVYVITEGSEP-QFFTRFFTWDSAKS  771



>ref|XP_002460813.1| hypothetical protein SORBIDRAFT_02g035390 [Sorghum bicolor]
 gb|EER97334.1| hypothetical protein SORBIDRAFT_02g035390 [Sorghum bicolor]
Length=926

 Score =   441 bits (1135),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 275/363 (76%), Gaps = 6/363 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV++K L+PAF+ +GQK G+EIWRIENFKPVP+P + YGKF+ GDSY++L+TT+ K G 
Sbjct  1     MSVSMKDLDPAFRGSGQKDGLEIWRIENFKPVPVPASSYGKFFMGDSYIILKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+W+GKDTSQDEAGTAAI TVELD  LGG+ VQ+REIQ +E+++FLSYF+PCIMP
Sbjct  61    LRHDIHYWIGKDTSQDEAGTAAILTVELDAALGGRAVQYREIQGNETEKFLSYFRPCIMP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
               GGVASGF   E  E++ ETRLYVC GK VV +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   QPGGVASGFNHVEVNEQDHETRLYVCHGKHVVHVKEVPFARSSLNHDDIFILDTKFKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             F+G+NS+IQERAKALEV+Q++KDT+H G C +A VEDG + A+A++GEFW  FGGFAP+ 
Sbjct  181   FSGSNSSIQERAKALEVVQYIKDTFHEGKCEIASVEDGRMMADAEAGEFWSFFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             R+  ++ +   E+T  KL C D G++ P+D + L+   LE +KCY LD GSE++VW+GR 
Sbjct  241   RRAPAEGNEKHEETAFKLLCFDQGKLVPIDCQSLAHELLETNKCYFLDSGSELYVWMGRI  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPSAS--ATPPEEG  1172
             T L ERK A + AE+ L    R + T I ++ +G ET++FK +F  WP         E+G
Sbjct  301   TSLQERKGASEAAEKLLSDSNRTR-THIIKVIEGFETVTFKSKFKEWPQTPELKLSSEDG  359

Query  1173  RGK  1181
             RGK
Sbjct  360   RGK  362



>emb|CDY28164.1| BnaA01g06850D [Brassica napus]
Length=980

 Score =   442 bits (1137),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 277/360 (77%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRIENF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIENFSPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV    VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHVTRLFVCRGKHVV---HVPFARSSLNHDDIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPV-DGELSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               + +D        KLFC++ G+ NPV D  L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  238   TANAEDKTVTFDIKKLFCVEKGKANPVEDDTLKREMLDTNKCYILDCGLEVFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W    + T  E+GRG+
Sbjct  298   LDDRKIASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWTQETNTTVSEDGRGR  356


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 152/364 (42%), Gaps = 58/364 (16%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  390   NLQVWRVNGQEKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSIASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQF--NGANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ +  N A S  
Sbjct  508   DDTYNENGLALFRIQGSGPENMQAIQVDPVASSLNSSYCYILHNDSSVFTWIGNLATSTD  567

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  568   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYSSQ  609

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPV----------DGELSKSNLENSKCYLLDCGSE  974
             K+T +    PE  P    C    +V  V              ++ +L     +++DC SE
Sbjct  610   KLTKE----PESDPHLFSCTFTKEVLKVLFVMFWQVTEIYNFTQDDLMTEDIFIVDCHSE  665

Query  975   VFVWVGRATQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWP  1142
             +FVWVG+      +  A    E+F+ K    +K      I  + +G E   F   F SW 
Sbjct  666   IFVWVGQEVVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWD  725

Query  1143  SASA  1154
             S+ +
Sbjct  726   SSKS  729



>emb|CDX68632.1| BnaC01g08210D [Brassica napus]
Length=972

 Score =   442 bits (1136),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/360 (61%), Positives = 278/360 (77%), Gaps = 6/360 (2%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             MSV+++ L+PAFQ AGQKAGIE+WRI+NF P P+PK+  GKF++GDSY+VL+TT+ K G 
Sbjct  1     MSVSMRDLDPAFQGAGQKAGIEVWRIQNFTPAPIPKSSIGKFFTGDSYIVLKTTALKTGA  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
                DIH+WLGKDTSQDEAGTAA+KTVELD  LGG+ VQ+RE+Q HE+++FLSYFKPCI+P
Sbjct  61    LRHDIHYWLGKDTSQDEAGTAAVKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIP  120

Query  468   LEGGVASGFKKPEEEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQFN  647
              EGGVASGFK  E EE  TRL+VC+GK VV    VPFAR SLNHDD+++LDTK KI+QFN
Sbjct  121   QEGGVASGFKHVEAEEHVTRLFVCRGKHVV---HVPFARSSLNHDDIYILDTKSKIFQFN  177

Query  648   GANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRK  827
             G+NS+IQERAKALEV+Q++KDTYH G C VA VEDG L A+ADSGEFW  FGGFAP+ RK
Sbjct  178   GSNSSIQERAKALEVVQYIKDTYHDGTCEVATVEDGRLMADADSGEFWGFFGGFAPLPRK  237

Query  828   VTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRATQ  1004
               + +D        KLFC++ G+ NPV+ + L +  L+ +KCY+LDCG EVFVW+GR T 
Sbjct  238   TANAEDKTVTFDIKKLFCVEKGKANPVEADTLEREMLDTNKCYILDCGLEVFVWMGRTTS  297

Query  1005  LDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWPS-ASATPPEEGRGK  1181
             LD+RK A   AEE +   +RPK+  I R+ +G ET+ F+ +FD+W    + T  E+GRG+
Sbjct  298   LDDRKVASGAAEEMIRSSERPKSQMI-RIIEGFETVPFRSKFDTWTQETNTTVSEDGRGR  356


 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 152/357 (43%), Gaps = 50/357 (14%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+   + + L  AD+ KFYSGD YV   +  G+    +  I  W GK + ++E  
Sbjct  390   NLQVWRVNGQEKILLQAADHSKFYSGDCYVFQYSYPGEEKEEVL-IGTWFGKQSVEEERA  448

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
             +A     ++   +     Q R  +  E  +F    +  I+  +GG++SG+KK   E+E +
Sbjct  449   SAVSMASKMVESMKFVPAQARIYEGKEPVQFFVIMQSFIV-FKGGISSGYKKYIAEKEVD  507

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNG--ANSNI  665
                Y   G  + R++          QV     SLN    ++L     ++ + G  A S  
Sbjct  508   DDTYNENGLALFRIQGSGPDNMQAIQVDPVASSLNSSYCYILHNDSSVFTWMGNLATSTD  567

Query  666   QERA-KALEVIQFLKDTYHGGVCNVAIVEDGNLQAEA-----DSGEFWELFGGFAPM-GR  824
             QE   + L++I+                   NLQ  A     +S +FWEL GG      +
Sbjct  568   QELVERQLDLIK------------------PNLQTRAQKEGSESEQFWELLGGKTEYSSQ  609

Query  825   KVTSDDDIIPEKTPPKLFCIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRA  998
             K+T +    PE  P    C     V  V      ++ +L     +++DC SE+FVWVG+ 
Sbjct  610   KLTKE----PESDPHLFSCTFTKDVLKVTEIYNFTQDDLMTEDIFIVDCHSEIFVWVGQE  665

Query  999   TQLDERKAACQTAEEFLVK----QKRPKATKITRLAQGHETISFKCEFDSWPSASAT  1157
                  +  A    E+F+ K    +K      I  + +G E   F   F SW S+ ++
Sbjct  666   VVPKNKLLALTIGEKFIEKDSLLEKLSPEAPIYVIMEGGEPSFFTRFFTSWDSSKSS  722



>ref|XP_010240183.1| PREDICTED: villin-4-like isoform X3 [Brachypodium distachyon]
Length=968

 Score =   442 bits (1136),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 277/362 (77%), Gaps = 5/362 (1%)
 Frame = +3

Query  108   MSVNVKALEPAFQAAGQKAGIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGP  287
             M+V+++ ++P FQ AGQK G+EIWRIE  + VP+PK  +GKF++GDSY++L+TT+ K G 
Sbjct  1     MAVSMREVDPVFQGAGQKDGLEIWRIEKLQAVPVPKESHGKFFTGDSYIILKTTALKNGS  60

Query  288   YLFDIHFWLGKDTSQDEAGTAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMP  467
             +  DIH+WLGKDTSQDEAGTAAIKTVELD  LGG+ VQ+RE+Q +E+++FLSYF+PCI+P
Sbjct  61    FRNDIHYWLGKDTSQDEAGTAAIKTVELDAALGGRAVQYREVQGNETEKFLSYFRPCIIP  120

Query  468   LEGGVASGFKKPE--EEEFETRLYVCKGKRVVRMKQVPFARPSLNHDDVFVLDTKDKIYQ  641
              EGGVASGF+  E  E E  TRL+VC+G+  V +K+VPFAR SLNHDD+F+LDTK KI+Q
Sbjct  121   EEGGVASGFRHTEINEREHVTRLFVCRGRHTVHVKEVPFARSSLNHDDIFILDTKSKIFQ  180

Query  642   FNGANSNIQERAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMG  821
             FNG+NS+IQERAKALEV+Q+LKDT H G C+VA VEDG L A+AD+GEFW LFGGFAP+ 
Sbjct  181   FNGSNSSIQERAKALEVVQYLKDTNHEGKCDVAAVEDGKLMADADAGEFWGLFGGFAPLP  240

Query  822   RKVTSDDDIIPEKTPPKLFCIDNGQVNPVDGE-LSKSNLENSKCYLLDCGSEVFVWVGRA  998
             RK  S+ +        KL C++ GQ   VD E L+++ L+ +KCYLLDCGSE++ W+GR 
Sbjct  241   RKTFSELNGKDTAFASKLLCVNKGQTVSVDCEVLTRALLDTTKCYLLDCGSEIYAWMGRE  300

Query  999   TQLDERKAACQTAEEFLVKQKRPKATKITRLAQGHETISFKCEFDSWP-SASATPPEEGR  1175
             T L++RK A   AEE L +  RPK + I RL +G ET+ F+ +F+ WP  A A   +E R
Sbjct  301   TALEDRKRAGLAAEELLREGNRPK-SHIIRLMEGFETVIFRSKFNKWPKKAEAVVSDESR  359

Query  1176  GK  1181
             GK
Sbjct  360   GK  361


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 148/348 (43%), Gaps = 35/348 (10%)
 Frame = +3

Query  165   GIEIWRIENFKPVPLPKADYGKFYSGDSYVVLQTTSGKGGPYLFDIHFWLGKDTSQDEAG  344
              +++WR+ +     L  ++  KFYSGD Y+   + +G  G     +  W GK + Q+E  
Sbjct  395   NLQVWRVNDSDKTFLSFSEQCKFYSGDCYIFQYSYTGDEGEECL-VGTWFGKRSIQEERT  453

Query  345   TAAIKTVELDTILGGKGVQHREIQTHESDRFLSYFKPCIMPLEGGVASGFKK-PEEEEFE  521
              A     ++   L  + V  R  +  E   F   F+  ++  +GG ++G+KK   E   E
Sbjct  454   AAISLADKMVESLKFQAVLVRLYEGKEPIEFFPIFQNLVI-FKGGASTGYKKFVSENGIE  512

Query  522   TRLYVCKGKRVVRMK----------QVPFARPSLNHDDVFVLDTKDKIYQFNGANSNIQE  671
                Y   G  + R++          QV  A PSLN    ++L   D ++ + G  S+  +
Sbjct  513   DDTYSENGVALFRIQGSGPDNMQAIQVDTAAPSLNSSYCYILHDGDTVFTWVGNLSSSMD  572

Query  672   RAKALEVIQFLKDTYHGGVCNVAIVEDGNLQAEADSGEFWELFGGFAPMGRKVTSDDDII  851
             +  A   +  +K      +          L+  ++  +FW+L G    +  +  S   + 
Sbjct  573   QELAERQLDVIKPNLQSRL----------LKEGSEYDQFWKLLG----VKSEYPSQKIVR  618

Query  852   PEKTPPKLF-CIDNGQVNPVDG--ELSKSNLENSKCYLLDCGSEVFVWVGRATQLDERKA  1022
              +++   LF C  +  V  V      ++ ++     ++LDC S VFVWVG+      R  
Sbjct  619   DQESDAHLFSCTFSKGVLKVREIFNFAQDDMMAEDIFILDCHSSVFVWVGQHVDTKIRAQ  678

Query  1023  ACQTAEEF----LVKQKRPKATKITRLAQGHETISFKCEFDSWPSASA  1154
             A    E+F    ++ +   + T +  +A+G E   F   F +W SA +
Sbjct  679   ALSIGEKFIEFDILMEDLSRETPLYVIAEGSEP-QFFTRFFTWDSAKS  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2917093240962