BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22537_g1_i1 len=747 path=[3829:0-252 4082:253-292 4122:293-403
4233:404-439 4269:440-746]

Length=747
                                                                      Score     E

ref|XP_009776712.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    474   2e-161   
ref|XP_009776714.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    474   2e-161   
ref|XP_009776715.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    473   2e-161   
ref|XP_009776713.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    473   3e-161   
ref|XP_009594277.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    473   5e-161   
ref|XP_009594278.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    473   5e-161   
ref|XP_009594275.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    473   5e-161   
ref|XP_009594279.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    472   6e-161   
ref|XP_010312475.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    470   4e-160   
ref|XP_004249893.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    470   5e-160   
gb|KDO58344.1|  hypothetical protein CISIN_1g006648mg                   469   2e-159   
ref|XP_006427798.1|  hypothetical protein CICLE_v10025272mg             466   2e-159   
ref|XP_006350977.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    469   2e-159   
ref|XP_006350978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    468   2e-159   
ref|XP_006464622.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    468   6e-159   
ref|XP_011097062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    467   6e-159   
emb|CDP04731.1|  unnamed protein product                                468   9e-159   
ref|XP_011097058.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    467   1e-158   
ref|XP_010090867.1|  hypothetical protein L484_020727                   466   2e-158   
gb|AAX33316.1|  secondary cell wall-related glycosyltransferase f...    466   3e-158   Populus tremula x Populus tremuloides
ref|XP_002307022.2|  hypothetical protein POPTR_0005s06280g             465   6e-158   Populus trichocarpa [western balsam poplar]
ref|XP_011022956.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    463   3e-157   
ref|XP_011022954.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    463   3e-157   
ref|XP_011022957.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    463   3e-157   
ref|XP_011022958.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    463   3e-157   
ref|XP_011022955.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    463   4e-157   
gb|KHG14645.1|  Glycogenin-2                                            463   4e-157   
gb|EYU18058.1|  hypothetical protein MIMGU_mgv1a018384mg                462   4e-157   
gb|AAX33317.1|  secondary cell wall-related glycosyltransferase f...    462   5e-157   Populus tremula x Populus tremuloides
ref|XP_010649390.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    460   5e-157   
ref|XP_010244025.1|  PREDICTED: putative UDP-glucuronate:xylan al...    461   7e-157   
ref|XP_002275240.2|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    461   2e-156   Vitis vinifera
ref|XP_010244020.1|  PREDICTED: putative UDP-glucuronate:xylan al...    462   2e-156   
ref|XP_011007557.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    461   2e-156   
ref|XP_011007559.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    461   2e-156   
ref|XP_011007558.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    461   2e-156   
ref|XP_002310513.2|  hypothetical protein POPTR_0007s04030g             460   3e-156   Populus trichocarpa [western balsam poplar]
ref|XP_007048327.1|  Plant glycogenin-like starch initiation prot...    460   3e-156   
ref|XP_006581757.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    461   4e-156   
gb|KHN09596.1|  Glycogenin-1                                            460   4e-156   
emb|CDP18299.1|  unnamed protein product                                461   4e-156   
gb|KHN34064.1|  Glycogenin-2                                            457   8e-156   
ref|XP_007048326.1|  Plant glycogenin-like starch initiation prot...    460   1e-155   
ref|XP_007048325.1|  Plant glycogenin-like starch initiation prot...    459   1e-155   
gb|KCW62287.1|  hypothetical protein EUGRSUZ_H04942                     459   2e-155   
ref|XP_006578795.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    459   2e-155   
gb|KDP24792.1|  hypothetical protein JCGZ_25413                         458   2e-155   
ref|XP_010025567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    458   3e-155   
gb|KHN31133.1|  Glycogenin-2                                            458   3e-155   
ref|XP_003525117.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    458   4e-155   
ref|XP_010245814.1|  PREDICTED: putative UDP-glucuronate:xylan al...    458   5e-155   
ref|XP_003602583.1|  Secondary cell wall-related glycosyltransfer...    457   9e-155   
ref|XP_002517237.1|  glycogenin, putative                               456   2e-154   Ricinus communis
ref|XP_007137705.1|  hypothetical protein PHAVU_009G148800g             455   6e-154   
ref|XP_004502919.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    457   6e-154   
gb|KHG15344.1|  Glycogenin-2                                            454   1e-153   
ref|XP_006297149.1|  hypothetical protein CARUB_v10013152mg             455   2e-153   
ref|XP_006383614.1|  hypothetical protein POPTR_0005s21030g             449   2e-153   
ref|XP_008441030.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    453   3e-153   
ref|XP_002885270.1|  hypothetical protein ARALYDRAFT_479372             453   4e-153   
gb|KHG05573.1|  Glycogenin-2                                            452   5e-153   
ref|XP_002526157.1|  glycogenin, putative                               453   6e-153   Ricinus communis
gb|KHG03827.1|  Glycogenin-2                                            452   6e-153   
gb|KDP43041.1|  hypothetical protein JCGZ_25227                         452   7e-153   
gb|KGN48367.1|  hypothetical protein Csa_6G483470                       452   7e-153   
ref|NP_001189927.1|  plant glycogenin-like starch initiation prot...    452   7e-153   
ref|NP_566615.1|  plant glycogenin-like starch initiation protein 1     452   7e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073953.1|  PREDICTED: putative UDP-glucuronate:xylan al...    452   7e-153   
ref|XP_004148647.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   8e-153   
ref|XP_006406580.1|  hypothetical protein EUTSA_v10020243mg             452   8e-153   
ref|XP_009348499.1|  PREDICTED: putative UDP-glucuronate:xylan al...    452   9e-153   
ref|XP_010487789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   1e-152   
ref|XP_010465976.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   1e-152   
ref|XP_010507061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   1e-152   
ref|XP_004163053.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    453   1e-152   
emb|CDY18535.1|  BnaA01g26600D                                          452   2e-152   
gb|KDO83632.1|  hypothetical protein CISIN_1g043696mg                   447   2e-152   
ref|XP_009112560.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   2e-152   
ref|XP_009112567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    452   2e-152   
gb|EYU36701.1|  hypothetical protein MIMGU_mgv1a005329mg                446   2e-152   
ref|XP_010680250.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    451   2e-152   
ref|XP_009145872.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    451   3e-152   
ref|XP_009360737.1|  PREDICTED: putative UDP-glucuronate:xylan al...    451   3e-152   
ref|NP_001030722.1|  plant glycogenin-like starch initiation prot...    451   3e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062154.1|  PREDICTED: putative UDP-glucuronate:xylan al...    451   3e-152   
ref|XP_010062155.1|  PREDICTED: putative UDP-glucuronate:xylan al...    451   4e-152   
gb|KHG12057.1|  Glycogenin-2                                            451   4e-152   
gb|KCW69223.1|  hypothetical protein EUGRSUZ_F02737                     450   4e-152   
ref|XP_008373921.1|  PREDICTED: putative UDP-glucuronate:xylan al...    447   5e-152   
ref|XP_007019401.1|  Plant glycogenin-like starch initiation prot...    450   6e-152   
ref|XP_008798993.1|  PREDICTED: putative UDP-glucuronate:xylan al...    450   6e-152   
ref|XP_006472929.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   7e-152   
ref|XP_010664886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   8e-152   
ref|XP_002307480.2|  hypothetical protein POPTR_0005s21030g             450   8e-152   Populus trichocarpa [western balsam poplar]
ref|XP_010664887.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   9e-152   
ref|XP_006485174.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   1e-151   
gb|EPS63087.1|  hypothetical protein M569_11696                         438   1e-151   
emb|CDY53768.1|  BnaC01g43920D                                          449   1e-151   
ref|XP_008373924.1|  PREDICTED: putative UDP-glucuronate:xylan al...    448   1e-151   
ref|XP_008798991.1|  PREDICTED: putative UDP-glucuronate:xylan al...    450   1e-151   
ref|XP_010539696.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   1e-151   
ref|XP_004148815.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   1e-151   
ref|XP_006434392.1|  hypothetical protein CICLE_v10003328mg             449   2e-151   
ref|XP_010539695.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   2e-151   
ref|XP_008441557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    448   2e-151   
ref|XP_010999819.1|  PREDICTED: putative UDP-glucuronate:xylan al...    449   2e-151   
dbj|BAJ87020.1|  predicted protein                                      438   3e-151   
ref|XP_008373923.1|  PREDICTED: putative UDP-glucuronate:xylan al...    448   3e-151   
ref|XP_008373920.1|  PREDICTED: putative UDP-glucuronate:xylan al...    448   3e-151   
ref|XP_008373922.1|  PREDICTED: putative UDP-glucuronate:xylan al...    448   4e-151   
ref|XP_007199740.1|  hypothetical protein PRUPE_ppa002697mg             448   4e-151   
ref|XP_009348497.1|  PREDICTED: putative UDP-glucuronate:xylan al...    447   5e-151   
ref|XP_010550282.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    447   8e-151   
ref|XP_010550280.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    447   8e-151   
ref|XP_004166220.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    446   1e-150   
ref|XP_010911800.1|  PREDICTED: putative UDP-glucuronate:xylan al...    446   2e-150   
ref|XP_008237654.1|  PREDICTED: putative UDP-glucuronate:xylan al...    445   4e-150   
ref|XP_010911799.1|  PREDICTED: putative UDP-glucuronate:xylan al...    446   6e-150   
emb|CDY04633.1|  BnaC05g16710D                                          444   8e-150   
gb|KCW71171.1|  hypothetical protein EUGRSUZ_F04263                     435   2e-149   
ref|XP_009149666.1|  PREDICTED: putative UDP-glucuronate:xylan al...    444   2e-149   
ref|XP_006645120.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    443   2e-149   
ref|XP_009149665.1|  PREDICTED: putative UDP-glucuronate:xylan al...    444   2e-149   
ref|XP_003544084.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   2e-149   
ref|XP_009360735.1|  PREDICTED: putative UDP-glucuronate:xylan al...    443   2e-149   
ref|XP_009360736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    443   2e-149   
ref|XP_004288348.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    443   3e-149   
ref|XP_009763873.1|  PREDICTED: putative UDP-glucuronate:xylan al...    443   3e-149   
ref|XP_007199738.1|  hypothetical protein PRUPE_ppa002694mg             442   4e-149   
ref|XP_006416296.1|  hypothetical protein EUTSA_v10007050mg             442   6e-149   
ref|XP_010110482.1|  hypothetical protein L484_003528                   442   7e-149   
gb|KEH40452.1|  UDP-glucuronate:xylan alpha-glucuronosyltransferase     441   8e-149   
ref|XP_008237655.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    442   1e-148   
ref|XP_008647982.1|  PREDICTED: LOC100286027 isoform X2                 438   1e-148   
dbj|BAJ87861.1|  predicted protein                                      431   1e-148   
gb|KFK44245.1|  hypothetical protein AALP_AA1G233800                    441   1e-148   
gb|KFK44246.1|  hypothetical protein AALP_AA1G233800                    441   2e-148   
ref|XP_009629284.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   2e-148   
ref|XP_003518352.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   2e-148   
ref|XP_004237736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   2e-148   
ref|XP_008654538.1|  PREDICTED: uncharacterized protein LOC100272...    441   3e-148   
ref|XP_004290562.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   3e-148   
gb|KHN41007.1|  Glycogenin-2                                            441   3e-148   
dbj|BAJ87677.1|  predicted protein                                      440   3e-148   
ref|XP_010680014.1|  PREDICTED: putative UDP-glucuronate:xylan al...    441   3e-148   
gb|EMS55920.1|  Glycogenin-1                                            439   4e-148   
emb|CDM85463.1|  unnamed protein product                                440   4e-148   
ref|XP_006356283.1|  PREDICTED: putative UDP-glucuronate:xylan al...    440   5e-148   
gb|EEC79261.1|  hypothetical protein OsI_20036                          441   5e-148   Oryza sativa Indica Group [Indian rice]
ref|NP_001152387.1|  LOC100286027                                       439   5e-148   Zea mays [maize]
gb|KHN04164.1|  Glycogenin-2                                            440   5e-148   
ref|XP_006607044.1|  PREDICTED: putative UDP-glucuronate:xylan al...    439   5e-148   
ref|XP_008647980.1|  PREDICTED: LOC100286027 isoform X1                 439   5e-148   
ref|XP_006356282.1|  PREDICTED: putative UDP-glucuronate:xylan al...    440   6e-148   
ref|XP_004498382.1|  PREDICTED: putative UDP-glucuronate:xylan al...    440   6e-148   
gb|AAS90653.1|  putative glycogenin                                     441   6e-148   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG90458.1|  unnamed protein product                                437   7e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71899.1|  hypothetical protein OsI_04661                          439   7e-148   Oryza sativa Indica Group [Indian rice]
gb|EMT19434.1|  Glycogenin-1                                            439   9e-148   
ref|NP_001044991.1|  Os01g0880200                                       439   1e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392550.1|  PREDICTED: putative UDP-glucuronate:xylan al...    439   1e-147   
gb|EEE63788.1|  hypothetical protein OsJ_18611                          440   1e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564767.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    438   1e-147   
ref|XP_008674740.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    438   2e-147   
gb|EAZ14371.1|  hypothetical protein OsJ_04291                          439   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456736.1|  hypothetical protein SORBIDRAFT_03g041660          438   2e-147   Sorghum bicolor [broomcorn]
ref|XP_009392557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    438   2e-147   
ref|XP_006858468.1|  hypothetical protein AMTR_s00071p00107830          438   2e-147   
tpg|DAA56540.1|  TPA: hypothetical protein ZEAMMB73_374443              438   2e-147   
gb|AGT16755.1|  glycogenin                                              437   3e-147   
ref|XP_009414973.1|  PREDICTED: putative UDP-glucuronate:xylan al...    438   3e-147   
ref|XP_010063886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    437   4e-147   
gb|KFK39187.1|  hypothetical protein AALP_AA3G211300                    454   5e-147   
ref|XP_002441128.1|  hypothetical protein SORBIDRAFT_09g020930          436   7e-147   Sorghum bicolor [broomcorn]
ref|XP_008237675.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    441   3e-146   
ref|XP_006654430.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    434   5e-146   
emb|CDY50243.1|  BnaA06g15200D                                          446   6e-146   
ref|XP_008786543.1|  PREDICTED: putative UDP-glucuronate:xylan al...    434   6e-146   
ref|XP_003568405.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    434   8e-146   
ref|XP_007161486.1|  hypothetical protein PHAVU_001G073100g             434   9e-146   
gb|EPS62267.1|  hypothetical protein M569_12523                         429   1e-145   
dbj|BAJ85213.1|  predicted protein                                      431   7e-145   
ref|XP_006302009.1|  hypothetical protein CARUB_v10019986mg             431   1e-144   
ref|XP_011099766.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    429   2e-144   
ref|XP_011099765.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    429   3e-144   
ref|XP_010416641.1|  PREDICTED: putative UDP-glucuronate:xylan al...    429   4e-144   
ref|XP_010930628.1|  PREDICTED: putative UDP-glucuronate:xylan al...    430   4e-144   
ref|XP_010471900.1|  PREDICTED: putative UDP-glucuronate:xylan al...    429   4e-144   
ref|XP_010428781.1|  PREDICTED: putative UDP-glucuronate:xylan al...    429   4e-144   
gb|ADC84479.1|  glycosyltransferase family 8B                           414   6e-144   Salix miyabeana
gb|ADC84480.1|  glycosyltransferase family 8B                           413   1e-143   Salix sachalinensis
ref|XP_002889125.1|  hypothetical protein ARALYDRAFT_476876             427   1e-143   
ref|NP_177838.2|  putative UDP-glucuronate:xylan alpha-glucuronos...    427   4e-143   Arabidopsis thaliana [mouse-ear cress]
gb|ADC84478.1|  glycosyltransferase family 8C                           412   5e-143   Salix sachalinensis
gb|EPS59757.1|  hypothetical protein M569_15049                         422   6e-143   
ref|XP_009396821.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    424   3e-142   
gb|EMT13493.1|  Glycogenin-1                                            426   5e-142   
gb|ADC84477.1|  glycosyltransferase family 8C                           405   2e-140   Salix miyabeana
ref|XP_009384289.1|  PREDICTED: putative UDP-glucuronate:xylan al...    417   2e-139   
ref|XP_009414600.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    414   5e-138   
emb|CDP04730.1|  unnamed protein product                                414   5e-138   
ref|XP_009408314.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    412   2e-137   
gb|AAC34345.1|  Unknown protein                                         426   6e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921631.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    411   8e-137   
ref|XP_009420264.1|  PREDICTED: putative UDP-glucuronate:xylan al...    411   1e-136   
ref|XP_010921630.1|  PREDICTED: putative UDP-glucuronate:xylan al...    410   2e-136   
ref|XP_008803691.1|  PREDICTED: putative UDP-glucuronate:xylan al...    412   5e-136   
ref|XP_009404956.1|  PREDICTED: putative UDP-glucuronate:xylan al...    407   3e-135   
ref|XP_009411206.1|  PREDICTED: putative UDP-glucuronate:xylan al...    404   4e-135   
ref|XP_009404954.1|  PREDICTED: putative UDP-glucuronate:xylan al...    407   4e-135   
emb|CDY38364.1|  BnaA02g18570D                                          399   4e-133   
ref|XP_010110483.1|  hypothetical protein L484_003529                   394   2e-131   
emb|CDX92257.1|  BnaA05g21500D                                          391   4e-129   
ref|XP_002992480.1|  hypothetical protein SELMODRAFT_135481             386   1e-128   
ref|XP_002990211.1|  hypothetical protein SELMODRAFT_131094             386   1e-128   
gb|EPS60482.1|  hypothetical protein M569_14321                         373   2e-126   
gb|EMS63875.1|  Glycogenin-2                                            374   1e-123   
emb|CDX96589.1|  BnaA08g21320D                                          373   2e-122   
emb|CDY38807.1|  BnaC08g19810D                                          373   3e-122   
ref|XP_004952800.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    372   1e-121   
dbj|BAJ97980.1|  predicted protein                                      372   1e-121   
gb|ABK25357.1|  unknown                                                 370   4e-121   Picea sitchensis
ref|XP_002453984.1|  hypothetical protein SORBIDRAFT_04g022700          370   5e-121   Sorghum bicolor [broomcorn]
ref|XP_008645791.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    367   2e-120   
ref|XP_002969246.1|  hypothetical protein SELMODRAFT_91619              359   3e-118   
ref|XP_002960604.1|  hypothetical protein SELMODRAFT_73856              358   4e-118   
gb|KHN44079.1|  Glycogenin-2                                            354   2e-116   
ref|XP_003575141.1|  PREDICTED: putative UDP-glucuronate:xylan al...    355   6e-115   
ref|XP_001756144.1|  predicted protein                                  352   7e-115   
gb|KHG15663.1|  Glycogenin-1                                            348   5e-113   
ref|XP_006828387.1|  hypothetical protein AMTR_s00060p00013040          348   1e-112   
ref|XP_010263572.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    345   3e-112   
ref|XP_010263571.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    345   8e-112   
ref|XP_008444626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    343   1e-111   
ref|XP_002510223.1|  glycogenin, putative                               345   1e-111   Ricinus communis
ref|XP_004168320.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    345   1e-111   
gb|KGN62510.1|  hypothetical protein Csa_2G357330                       344   1e-111   
ref|XP_004150886.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    345   2e-111   
ref|XP_006374946.1|  hypothetical protein POPTR_0014s02980g             342   2e-111   
ref|XP_011030050.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    342   2e-111   
ref|XP_008444625.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    343   3e-111   
ref|XP_008220218.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    341   7e-111   
ref|XP_011030042.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    343   7e-111   
emb|CAB38791.1|  putative protein                                       334   7e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010320335.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    340   1e-110   
ref|XP_007221825.1|  hypothetical protein PRUPE_ppa003165mg             342   2e-110   
ref|XP_008220217.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    342   2e-110   
ref|XP_011074444.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    340   2e-110   
gb|KDP38342.1|  hypothetical protein JCGZ_04267                         339   2e-110   
ref|XP_004238159.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    340   4e-110   
ref|XP_011074443.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    340   5e-110   
ref|XP_006473886.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    340   6e-110   
ref|XP_010320334.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    339   1e-109   
gb|KDO84195.1|  hypothetical protein CISIN_1g007705mg                   339   2e-109   
ref|XP_006434785.1|  hypothetical protein CICLE_v10000658mg             339   2e-109   
ref|XP_010274299.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    339   2e-109   
ref|XP_009791926.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    338   2e-109   
ref|NP_001047126.2|  Os02g0556000                                       341   3e-109   Oryza sativa Japonica Group [Japonica rice]
emb|CDP01355.1|  unnamed protein product                                338   4e-109   
ref|XP_010692787.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    336   4e-109   
ref|XP_007017252.1|  Glycogenin, putative isoform 2                     336   6e-109   
ref|XP_006354952.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    337   9e-109   
ref|XP_007017251.1|  Glycogenin, putative isoform 1                     337   1e-108   
ref|XP_004499062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    336   1e-108   
ref|XP_004291114.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    337   2e-108   
ref|XP_010692786.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    337   2e-108   
ref|XP_002969245.1|  hypothetical protein SELMODRAFT_1169               332   2e-108   
ref|XP_004499061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    336   4e-108   
ref|XP_006354951.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    335   7e-108   
ref|XP_010437777.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   7e-108   
ref|XP_008375994.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   8e-108   
ref|XP_006283368.1|  hypothetical protein CARUB_v10004410mg             335   1e-107   
ref|XP_002960603.1|  hypothetical protein SELMODRAFT_1168               330   1e-107   
ref|XP_010059946.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   1e-107   
ref|XP_008805263.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   2e-107   
ref|XP_009791925.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   2e-107   
ref|XP_010437776.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    334   2e-107   
ref|XP_010108604.1|  hypothetical protein L484_006335                   334   3e-107   
ref|XP_008375992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   3e-107   
gb|KFK29946.1|  hypothetical protein AALP_AA7G198500                    333   3e-107   
emb|CDX68968.1|  BnaC01g04850D                                          333   5e-107   
ref|NP_195059.3|  UDP-glucuronate:xylan alpha-glucuronosyltransfe...    333   5e-107   
ref|XP_008361006.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   5e-107   
ref|XP_004972256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   5e-107   
ref|XP_010447257.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    331   6e-107   
ref|XP_009791924.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   6e-107   
ref|XP_009123409.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    331   6e-107   
ref|XP_006578023.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    331   6e-107   
gb|KCW66431.1|  hypothetical protein EUGRSUZ_F00232                     333   7e-107   
ref|XP_008361004.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   7e-107   
gb|KCW66432.1|  hypothetical protein EUGRSUZ_F00232                     333   7e-107   
ref|NP_001154284.1|  UDP-glucuronate:xylan alpha-glucuronosyltran...    333   7e-107   
ref|XP_010059943.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   8e-107   
ref|XP_010059944.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    333   8e-107   
ref|XP_002867186.1|  hypothetical protein ARALYDRAFT_328405             332   1e-106   
ref|XP_010447256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   1e-106   
tpg|DAA56781.1|  TPA: hypothetical protein ZEAMMB73_553946              333   1e-106   
emb|CDX75345.1|  BnaA01g03570D                                          332   2e-106   
ref|XP_009627542.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    329   2e-106   
ref|XP_008676217.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   2e-106   
ref|XP_009123351.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    332   2e-106   
ref|XP_003523601.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    331   2e-106   
ref|XP_002282762.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    330   6e-106   
ref|XP_002458785.1|  hypothetical protein SORBIDRAFT_03g040240          331   7e-106   
ref|XP_003589198.1|  Glycogenin glucosyltransferase                     328   8e-106   
ref|XP_009627541.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    330   8e-106   
ref|XP_003589197.1|  Glycogenin glucosyltransferase                     329   2e-105   
ref|XP_009613940.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    327   2e-105   
ref|XP_010525992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    327   2e-105   
ref|XP_009390259.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    330   3e-105   
ref|XP_009390902.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    325   3e-105   
ref|XP_010432579.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    326   3e-105   
ref|XP_011083928.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    328   3e-105   
ref|XP_006412369.1|  hypothetical protein EUTSA_v10024741mg             328   4e-105   
ref|XP_010525991.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    328   5e-105   
ref|XP_009390901.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    327   8e-105   
ref|XP_009613939.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    327   8e-105   
ref|XP_010432577.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    328   8e-105   
ref|XP_010926388.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    327   9e-105   
ref|XP_010916627.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    323   2e-104   
ref|XP_003544459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    326   2e-104   
emb|CDY45037.1|  BnaA08g11820D                                          326   2e-104   
ref|XP_007160847.1|  hypothetical protein PHAVU_001G021800g             326   2e-104   
ref|XP_009108807.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    324   4e-104   
ref|XP_010916626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    325   4e-104   
ref|XP_009404013.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    323   5e-104   
ref|XP_006601291.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    323   5e-104   
ref|XP_009108806.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    325   8e-104   
ref|XP_009404011.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    324   1e-103   
gb|KHN12781.1|  Glycogenin-1                                            324   1e-103   
ref|XP_003549400.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    324   2e-103   
gb|EYU25418.1|  hypothetical protein MIMGU_mgv1a003570mg                322   4e-103   
tpg|DAA44094.1|  TPA: hypothetical protein ZEAMMB73_670696              319   9e-103   
ref|NP_001049188.2|  Os03g0184300                                       316   1e-101   
gb|EAY88814.1|  hypothetical protein OsI_10286                          318   7e-101   
ref|XP_007136678.1|  hypothetical protein PHAVU_009G064700g             317   8e-101   
gb|AAK92624.1|AC079633_4  Putative glycogenin                           318   8e-101   
gb|ACE97053.1|  glycogenin glucosyltransferase                          301   1e-99    
gb|ACE97075.1|  glycogenin glucosyltransferase                          300   2e-99    
gb|ACE97051.1|  glycogenin glucosyltransferase                          300   2e-99    
gb|ACE97077.1|  glycogenin glucosyltransferase                          300   3e-99    
ref|XP_008673893.1|  PREDICTED: hypothetical protein isoform X1         310   3e-99    
tpg|DAA43741.1|  TPA: hypothetical protein ZEAMMB73_319049              310   3e-99    
ref|NP_001130837.1|  hypothetical protein                               312   7e-99    
ref|XP_004985459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    308   1e-98    
ref|XP_009350664.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    307   4e-98    
gb|ACE97052.1|  glycogenin glucosyltransferase                          296   7e-98    
ref|XP_003589196.1|  Glycogenin glucosyltransferase                     309   8e-98    
ref|XP_004985458.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    310   9e-98    
gb|ACE97067.1|  glycogenin glucosyltransferase                          296   9e-98    
ref|XP_008782340.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    308   1e-97    
ref|XP_009350662.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    309   1e-97    
emb|CDM85169.1|  unnamed protein product                                308   2e-97    
ref|XP_002468380.1|  hypothetical protein SORBIDRAFT_01g044930          307   6e-97    
ref|XP_008347148.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    306   7e-97    
ref|XP_009758677.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    306   1e-96    
ref|XP_009348718.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    305   3e-96    
gb|EPS57865.1|  hypothetical protein M569_16951                         303   8e-96    
ref|XP_006851097.1|  hypothetical protein AMTR_s00025p00246110          295   1e-95    
ref|XP_006851095.1|  hypothetical protein AMTR_s00025p00245930          301   1e-95    
ref|XP_001783069.1|  predicted protein                                  299   2e-94    
ref|XP_009596978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    298   3e-94    
ref|XP_010255960.1|  PREDICTED: putative UDP-glucuronate:xylan al...    298   6e-94    
ref|XP_008345680.1|  PREDICTED: putative UDP-glucuronate:xylan al...    298   7e-94    
ref|XP_010040839.1|  PREDICTED: putative UDP-glucuronate:xylan al...    299   8e-94    
ref|XP_010475720.1|  PREDICTED: putative UDP-glucuronate:xylan al...    297   2e-93    
gb|KCW44877.1|  hypothetical protein EUGRSUZ_L01540                     294   3e-93    
ref|XP_001777541.1|  predicted protein                                  295   3e-93    
ref|XP_007208594.1|  hypothetical protein PRUPE_ppa022628mg             294   5e-93    
emb|CDY06343.1|  BnaA09g48600D                                          295   1e-92    
ref|XP_010312667.1|  PREDICTED: putative UDP-glucuronate:xylan al...    295   1e-92    
ref|XP_002280832.1|  PREDICTED: putative UDP-glucuronate:xylan al...    295   1e-92    
ref|XP_010040835.1|  PREDICTED: putative UDP-glucuronate:xylan al...    295   2e-92    
ref|XP_010040834.1|  PREDICTED: putative UDP-glucuronate:xylan al...    295   2e-92    
emb|CAN81983.1|  hypothetical protein VITISV_042631                     293   3e-92    
ref|XP_006361899.1|  PREDICTED: putative UDP-glucuronate:xylan al...    291   5e-92    
emb|CDP15517.1|  unnamed protein product                                292   1e-91    
ref|XP_009118330.1|  PREDICTED: putative UDP-glucuronate:xylan al...    293   1e-91    
emb|CDY22652.1|  BnaC08g42860D                                          292   2e-91    
gb|KDP23521.1|  hypothetical protein JCGZ_23354                         284   3e-91    
ref|XP_010458168.1|  PREDICTED: putative UDP-glucuronate:xylan al...    291   3e-91    
emb|CDY41730.1|  BnaA09g15580D                                          291   3e-91    
ref|XP_006301397.1|  hypothetical protein CARUB_v10021810mg             291   4e-91    
emb|CDX95254.1|  BnaC09g16160D                                          291   4e-91    
ref|XP_009770796.1|  PREDICTED: putative UDP-glucuronate:xylan al...    289   6e-91    
ref|XP_010489606.1|  PREDICTED: putative UDP-glucuronate:xylan al...    291   6e-91    
ref|XP_006306168.1|  hypothetical protein CARUB_v10011725mg             290   9e-91    
ref|XP_006417624.1|  hypothetical protein EUTSA_v10007230mg             290   1e-90    
ref|XP_009600657.1|  PREDICTED: putative UDP-glucuronate:xylan al...    290   1e-90    
ref|XP_002891920.1|  hypothetical protein ARALYDRAFT_337776             289   3e-90    
ref|XP_009113408.1|  PREDICTED: putative UDP-glucuronate:xylan al...    289   3e-90    
ref|XP_008388964.1|  PREDICTED: putative UDP-glucuronate:xylan al...    288   9e-90    
ref|XP_010549836.1|  PREDICTED: putative UDP-glucuronate:xylan al...    287   1e-89    
ref|XP_010414934.1|  PREDICTED: putative UDP-glucuronate:xylan al...    286   1e-89    
ref|XP_010511229.1|  PREDICTED: putative UDP-glucuronate:xylan al...    286   2e-89    
ref|XP_008218203.1|  PREDICTED: putative UDP-glucuronate:xylan al...    286   3e-89    
ref|XP_006361898.1|  PREDICTED: putative UDP-glucuronate:xylan al...    286   3e-89    
ref|XP_010511230.1|  PREDICTED: putative UDP-glucuronate:xylan al...    286   4e-89    
ref|XP_006392474.1|  hypothetical protein EUTSA_v10024070mg             285   1e-88    
ref|XP_006604824.1|  PREDICTED: putative UDP-glucuronate:xylan al...    284   1e-88    
ref|XP_003561978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    286   1e-88    
gb|EYU29759.1|  hypothetical protein MIMGU_mgv1a017852mg                281   2e-88    
emb|CDY32144.1|  BnaCnng06530D                                          284   2e-88    
ref|NP_175891.1|  putative UDP-glucuronate:xylan alpha-glucuronos...    283   4e-88    
ref|NP_172373.3|  plant glycogenin-like starch initiation protein 5     283   5e-88    
ref|XP_009770795.1|  PREDICTED: putative UDP-glucuronate:xylan al...    282   6e-88    
ref|XP_002889728.1|  hypothetical protein ARALYDRAFT_470978             281   6e-88    
ref|XP_011077916.1|  PREDICTED: putative UDP-glucuronate:xylan al...    280   7e-88    
ref|XP_010480209.1|  PREDICTED: putative UDP-glucuronate:xylan al...    282   8e-88    
ref|XP_007030849.1|  Plant glycogenin-like starch initiation prot...    282   9e-88    
ref|XP_006433308.1|  hypothetical protein CICLE_v10004021mg             283   9e-88    
ref|XP_006471960.1|  PREDICTED: putative UDP-glucuronate:xylan al...    283   9e-88    
ref|XP_006471968.1|  PREDICTED: putative UDP-glucuronate:xylan al...    282   1e-87    
ref|XP_004231270.1|  PREDICTED: putative UDP-glucuronate:xylan al...    281   1e-87    
ref|XP_006433306.1|  hypothetical protein CICLE_v10000664mg             283   1e-87    
ref|XP_008454693.1|  PREDICTED: putative UDP-glucuronate:xylan al...    283   2e-87    
gb|EYU38698.1|  hypothetical protein MIMGU_mgv1a006109mg                278   3e-87    
dbj|BAG89254.1|  unnamed protein product                                270   3e-87    
gb|KFK35602.1|  hypothetical protein AALP_AA4G012800                    280   9e-87    
ref|XP_004494957.1|  PREDICTED: putative UDP-glucuronate:xylan al...    280   9e-87    
emb|CDY32143.1|  BnaCnng06520D                                          280   1e-86    
ref|XP_004139358.1|  PREDICTED: putative UDP-glucuronate:xylan al...    280   1e-86    
gb|KHN16126.1|  Glycogenin-1                                            275   1e-86    
ref|XP_009110860.1|  PREDICTED: putative UDP-glucuronate:xylan al...    279   1e-86    
ref|XP_010040896.1|  PREDICTED: putative UDP-glucuronate:xylan al...    275   2e-86    
emb|CDY31118.1|  BnaA08g26680D                                          279   2e-86    
emb|CDY13574.1|  BnaC02g23850D                                          276   2e-86    
ref|XP_004304997.1|  PREDICTED: putative UDP-glucuronate:xylan al...    279   2e-86    
ref|XP_008454698.1|  PREDICTED: putative UDP-glucuronate:xylan al...    280   2e-86    
ref|XP_010674823.1|  PREDICTED: putative UDP-glucuronate:xylan al...    277   2e-86    
ref|XP_007147053.1|  hypothetical protein PHAVU_006G092200g             278   4e-86    
ref|XP_009625849.1|  PREDICTED: putative UDP-glucuronate:xylan al...    277   8e-86    
ref|XP_011036785.1|  PREDICTED: putative UDP-glucuronate:xylan al...    277   9e-86    
ref|XP_003591107.1|  Glycogenin-1                                       277   1e-85    
emb|CBI19971.3|  unnamed protein product                                276   2e-85    
ref|XP_010227353.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    277   2e-85    
ref|XP_003626298.1|  Glycogenin-1                                       276   3e-85    
ref|XP_002319544.2|  hypothetical protein POPTR_0013s02380g             274   4e-85    
ref|XP_003535341.1|  PREDICTED: putative UDP-glucuronate:xylan al...    275   1e-84    
ref|XP_006382602.1|  hypothetical protein POPTR_0005s03650g             273   4e-84    
ref|XP_011023601.1|  PREDICTED: putative UDP-glucuronate:xylan al...    271   1e-83    
emb|CAK29728.1|  putative glycogenin                                    259   1e-83    
emb|CAK29742.1|  putative glycogenin                                    258   2e-83    
emb|CAK29724.1|  putative glycogenin                                    256   2e-82    
ref|XP_011078977.1|  PREDICTED: putative UDP-glucuronate:xylan al...    268   2e-82    
emb|CAK29726.1|  putative glycogenin                                    256   2e-82    
ref|XP_007030850.1|  Plant glycogenin-like starch initiation prot...    267   7e-82    
emb|CAK29721.1|  putative glycogenin                                    254   8e-82    
emb|CAK29753.1|  putative glycogenin                                    254   9e-82    
gb|EPS73755.1|  hypothetical protein M569_01001                         265   1e-81    
emb|CAK29743.1|  putative glycogenin                                    253   1e-81    
ref|XP_010674757.1|  PREDICTED: putative UDP-glucuronate:xylan al...    265   5e-81    
emb|CAK29746.1|  putative glycogenin                                    252   7e-81    
emb|CAK29736.1|  putative glycogenin                                    250   4e-80    
emb|CDP18101.1|  unnamed protein product                                257   6e-78    
ref|XP_011075618.1|  PREDICTED: putative UDP-glucuronate:xylan al...    255   4e-77    
gb|EYU18652.1|  hypothetical protein MIMGU_mgv1a024363mg                253   3e-76    
emb|CAK29764.1|  putative glycogenin                                    240   3e-76    
gb|KHN43281.1|  Glycogenin-1                                            250   9e-76    
emb|CAK29722.1|  putative glycogenin                                    236   6e-75    
gb|EEE58453.1|  hypothetical protein OsJ_09685                          246   7e-74    
emb|CAK29727.1|  putative glycogenin                                    232   4e-73    
gb|EEC73397.1|  hypothetical protein OsI_07648                          244   4e-73    
emb|CAK29723.1|  putative glycogenin                                    231   7e-73    
gb|KDO38832.1|  hypothetical protein CISIN_1g0374631mg                  232   3e-72    
ref|XP_006651104.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    241   1e-71    
ref|XP_007159826.1|  hypothetical protein PHAVU_002G270800g             226   3e-70    
ref|XP_002441125.1|  hypothetical protein SORBIDRAFT_09g020910          222   5e-69    
gb|EPS69985.1|  plant glycogenin-like starch initiation protein 3       233   5e-69    
emb|CAK29751.1|  putative glycogenin                                    221   7e-69    
gb|EMT12992.1|  Glycogenin-1                                            213   8e-65    
gb|AAB70408.1|  F7G19.14                                                221   1e-64    
emb|CBI37563.3|  unnamed protein product                                220   7e-64    
gb|KHN04505.1|  Hypothetical protein glysoja_019592                     219   9e-64    
ref|XP_010272326.1|  PREDICTED: putative UDP-glucuronate:xylan al...    201   4e-60    
gb|EEE57188.1|  hypothetical protein OsJ_07131                          197   4e-55    
ref|XP_002512375.1|  glycogenin, putative                               191   4e-54    
emb|CDY28292.1|  BnaC03g66670D                                          190   6e-52    
gb|KDO37923.1|  hypothetical protein CISIN_1g041855mg                   172   2e-49    
tpg|DAA43742.1|  TPA: hypothetical protein ZEAMMB73_319049              165   4e-47    
ref|NP_001131921.1|  uncharacterized protein LOC100193311               152   2e-42    
ref|NP_001140733.1|  uncharacterized protein LOC100272808               145   2e-39    
emb|CDY28291.1|  BnaC03g66680D                                          146   4e-39    
ref|XP_009384656.1|  PREDICTED: LOW QUALITY PROTEIN: putative glu...    120   8e-28    
ref|XP_011101631.1|  PREDICTED: inositol phosphorylceramide glucu...    120   6e-27    
ref|XP_008441775.1|  PREDICTED: putative glucuronosyltransferase ...    118   6e-27    
ref|XP_010463911.1|  PREDICTED: inositol phosphorylceramide glucu...    118   6e-27    
gb|KHN31485.1|  Glycogenin-1                                            118   6e-27    
ref|XP_010485804.1|  PREDICTED: inositol phosphorylceramide glucu...    118   7e-27    
emb|CDX99331.1|  BnaC05g34460D                                          110   7e-27    
ref|XP_010235727.1|  PREDICTED: LOW QUALITY PROTEIN: inositol pho...    118   1e-26    
ref|XP_006648850.1|  PREDICTED: putative glucuronosyltransferase ...    117   1e-26    
ref|XP_010922963.1|  PREDICTED: inositol phosphorylceramide glucu...    117   1e-26    
ref|NP_197349.2|  plant glycogenin-like starch initiation protein 6     117   2e-26    
emb|CDY58112.1|  BnaA02g35140D                                          117   2e-26    
ref|XP_004152810.1|  PREDICTED: putative glucuronosyltransferase ...    117   2e-26    
ref|XP_010413938.1|  PREDICTED: inositol phosphorylceramide glucu...    117   2e-26    
emb|CDY02625.1|  BnaC02g08100D                                          117   2e-26    
ref|XP_009126256.1|  PREDICTED: putative glucuronosyltransferase ...    117   2e-26    
ref|XP_006604858.1|  PREDICTED: putative glucuronosyltransferase ...    117   2e-26    



>ref|XP_009776712.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana sylvestris]
Length=633

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  312  AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  371

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  372  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  431

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  432  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  491

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  492  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  551

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  552  RSKQKAQL  559



>ref|XP_009776714.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X3 [Nicotiana sylvestris]
Length=627

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  306  AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  365

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  366  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  425

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  426  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  485

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  486  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  545

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  546  RSKQKAQL  553



>ref|XP_009776715.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X4 [Nicotiana sylvestris]
Length=626

 Score =   473 bits (1218),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  305  AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  364

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  365  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  424

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  425  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  484

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  485  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  544

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  545  RSKQKAQL  552



>ref|XP_009776713.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Nicotiana sylvestris]
Length=632

 Score =   473 bits (1218),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  311  AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  370

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  371  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  430

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  431  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  490

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  491  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  550

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  551  RSKQKAQL  558



>ref|XP_009594277.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Nicotiana tomentosiformis]
Length=632

 Score =   473 bits (1217),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 235/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGS RDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  311  AIAAAQSIRMAGSRRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  370

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  371  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  430

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  431  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  490

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  EL++FCLL
Sbjct  491  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLL  550

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  551  RSKQKAQL  558



>ref|XP_009594278.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X3 [Nicotiana tomentosiformis]
Length=627

 Score =   473 bits (1216),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 235/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGS RDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  306  AIAAAQSIRMAGSRRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  365

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  366  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  425

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  426  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  485

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  EL++FCLL
Sbjct  486  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLL  545

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  546  RSKQKAQL  553



>ref|XP_009594275.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009594276.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana tomentosiformis]
Length=633

 Score =   473 bits (1216),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 235/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGS RDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  312  AIAAAQSIRMAGSRRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  371

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  372  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  431

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  432  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  491

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  EL++FCLL
Sbjct  492  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLL  551

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  552  RSKQKAQL  559



>ref|XP_009594279.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X4 [Nicotiana tomentosiformis]
Length=626

 Score =   472 bits (1215),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 235/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGS RDLVILVDDSIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  305  AIAAAQSIRMAGSRRDLVILVDDSIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  364

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  365  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  424

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  425  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  484

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  EL++FCLL
Sbjct  485  EPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLL  544

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  545  RSKQKAQL  552



>ref|XP_010312475.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Solanum lycopersicum]
Length=627

 Score =   470 bits (1210),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 217/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD+SIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  308  AIAAAQSIRMSGSTRDLVILVDESIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  367

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  368  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  427

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  428  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTNLFGA  487

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWWRVHD+M  +L++FCLL
Sbjct  488  DPPVLYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWRVHDAMPEQLQDFCLL  547

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  548  RSKQKAQL  555



>ref|XP_004249893.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Solanum lycopersicum]
Length=633

 Score =   470 bits (1210),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 217/248 (88%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD+SIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRMSGSTRDLVILVDESIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  434  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTNLFGA  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWWRVHD+M  +L++FCLL
Sbjct  494  DPPVLYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWRVHDAMPEQLQDFCLL  553

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  554  RSKQKAQL  561



>gb|KDO58344.1| hypothetical protein CISIN_1g006648mg [Citrus sinensis]
Length=637

 Score =   469 bits (1207),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 215/248 (87%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  321  AIAAAQSIRMSGSTRDLVILVDETISAYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  380

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGT+FNSGVMVIEPS+CT
Sbjct  381  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTMFNSGVMVIEPSSCT  440

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  VKQ+KT LF A
Sbjct  441  FQLLMDHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWFGDEEEVKQKKTRLFGA  500

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH KWWRVHD+M  +L++FCLL
Sbjct  501  DPPILYVLHYLGMKPWLCFRDYDCNWNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLL  560

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  561  RSKQKAQL  568



>ref|XP_006427798.1| hypothetical protein CICLE_v10025272mg [Citrus clementina]
 gb|ESR41038.1| hypothetical protein CICLE_v10025272mg [Citrus clementina]
Length=570

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  254  AIAAAQSIRMSGSTRDLVILVDETISAYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  313

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLW+LTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGT+FNSGVMVIEPS+CT
Sbjct  314  YSKFRLWELTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTMFNSGVMVIEPSSCT  373

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  VKQ+KT LF A
Sbjct  374  FQLLMDHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWFGDEEEVKQKKTRLFGA  433

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH KWWRVHD+M  +L++FCLL
Sbjct  434  DPPILYVLHYLGMKPWLCFRDYDCNWNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLL  493

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  494  RSKQKAQL  501



>ref|XP_006350977.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Solanum tuberosum]
Length=636

 Score =   469 bits (1206),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD+SIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRMSGSTRDLVILVDESIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  434  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  494  DPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  553

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  554  RSKQKAQL  561



>ref|XP_006350978.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Solanum tuberosum]
Length=630

 Score =   468 bits (1205),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD+SIGEYHRSGLEAAGW++RTIQRIRNPKAEKDAYNEWN
Sbjct  308  AIAAAQSIRMSGSTRDLVILVDESIGEYHRSGLEAAGWQVRTIQRIRNPKAEKDAYNEWN  367

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNID LF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  368  YSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNGTLFNSGVMVIEPSNCT  427

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VK +KT LF A
Sbjct  428  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKAKKTHLFGA  487

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L++FCLL
Sbjct  488  DPPILYVLHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLL  547

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  548  RSKQKAQL  555



>ref|XP_006464622.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Citrus sinensis]
Length=642

 Score =   468 bits (1203),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  326  AIAAAQSIRMSGSTRDLVILVDETISAYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  385

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLW+LTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGT+FNSGVMVIEPS+CT
Sbjct  386  YSKFRLWELTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTMFNSGVMVIEPSSCT  445

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  VKQ+KT LF A
Sbjct  446  FQLLMDHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWFGDEEEVKQKKTRLFGA  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH KWWRVHD+M  +L++FCLL
Sbjct  506  DPPILYVLHYLGMKPWLCFRDYDCNWNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLL  565

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  566  RSKQKAQL  573



>ref|XP_011097062.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Sesamum indicum]
Length=621

 Score =   467 bits (1201),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 234/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHRSGLE AGWK+RTI+RIRNPKAEKDAYNEWN
Sbjct  306  AIAAAQSIRMAGSTRDLVILVDETISEYHRSGLELAGWKVRTIKRIRNPKAEKDAYNEWN  365

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  366  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  425

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VKQ+K  LF A
Sbjct  426  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKQKKIRLFEA  485

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L+EFCLL
Sbjct  486  EPPILYVLHYLGNKPWMCFRDYDCNWNVDILQEFASDVAHRKWWKVHDAMPEKLQEFCLL  545

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  546  ISKQKAQL  553



>emb|CDP04731.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   468 bits (1203),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDD+I EYHRSGLE AGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  333  AIAAAQSIRMAGSTRDLVILVDDTISEYHRSGLEVAGWKIRTIQRIRNPKAEKDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  393  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFKMPQISATGNNGTLFNSGVMVIEPSNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GD+ AVKQ+K  LF A
Sbjct  453  FHLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDDEAVKQKKIRLFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPWLCYRDYDCNWNVDILQEFA+D  H  WW+VHD+M   L++FCLL
Sbjct  513  EPPILYVLHYLGYKPWLCYRDYDCNWNVDILQEFATDVGHRSWWKVHDAMPERLQDFCLL  572

Query  722  RSKQKAQL  745
             S+QKAQL
Sbjct  573  SSRQKAQL  580



>ref|XP_011097058.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097059.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097060.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
Length=627

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 234/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHRSGLE AGWK+RTI+RIRNPKAEKDAYNEWN
Sbjct  312  AIAAAQSIRMAGSTRDLVILVDETISEYHRSGLELAGWKVRTIKRIRNPKAEKDAYNEWN  371

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  372  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  431

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VKQ+K  LF A
Sbjct  432  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEVVKQKKIRLFEA  491

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH KWW+VHD+M  +L+EFCLL
Sbjct  492  EPPILYVLHYLGNKPWMCFRDYDCNWNVDILQEFASDVAHRKWWKVHDAMPEKLQEFCLL  551

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  552  ISKQKAQL  559



>ref|XP_010090867.1| hypothetical protein L484_020727 [Morus notabilis]
 gb|EXB40992.1| hypothetical protein L484_020727 [Morus notabilis]
Length=636

 Score =   466 bits (1200),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 235/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I  YH+SGLEAAGWKI+TIQRIRNPKAEKDAYNEWN
Sbjct  320  AIAAAQSIRMLGSTRDLVILVDETISRYHQSGLEAAGWKIKTIQRIRNPKAEKDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLL+LRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTEYDKIIFIDADLLLLRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLK+FW+GD+  VKQ+KT LF A
Sbjct  440  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKNFWIGDDEEVKQKKTRLFGA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH++WWRVHD+M   L++FCLL
Sbjct  500  DPPILYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHERWWRVHDAMPGLLQQFCLL  559

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  560  RSKQKAQL  567



>gb|AAX33316.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=649

 Score =   466 bits (1199),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 215/248 (87%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  333  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  393  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  453  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTSLFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  513  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDTAHEKWWRVYDAMPEQLHQFCSL  572

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  573  KSKQKAQL  580



>ref|XP_002307022.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
 gb|EEE94018.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
Length=631

 Score =   465 bits (1196),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  315  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  435  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTSLFGA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LYA+HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  495  EPPILYALHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  554

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  555  KSKQKAQL  562



>ref|XP_011022956.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=631

 Score =   463 bits (1192),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS+RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  315  AIAAAQSIRLSGSSRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  435  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  495  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  554

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  555  KSKQKAQL  562



>ref|XP_011022954.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=637

 Score =   463 bits (1192),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS+RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  321  AIAAAQSIRLSGSSRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  380

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  381  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  440

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  441  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  500

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  501  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  560

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  561  KSKQKAQL  568



>ref|XP_011022957.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X4 [Populus euphratica]
Length=631

 Score =   463 bits (1191),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS+RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  315  AIAAAQSIRLSGSSRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  435  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  495  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  554

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  555  KSKQKAQL  562



>ref|XP_011022958.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X5 [Populus euphratica]
Length=630

 Score =   463 bits (1191),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS+RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRLSGSSRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  434  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  494  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  553

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  554  KSKQKAQL  561



>ref|XP_011022955.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=636

 Score =   463 bits (1191),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS+RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  320  AIAAAQSIRLSGSSRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  440  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  500  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  559

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  560  KSKQKAQL  567



>gb|KHG14645.1| Glycogenin-2 [Gossypium arboreum]
Length=643

 Score =   463 bits (1192),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  327  AIAAAQSIRMSGSTRDLVILVDETISVYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHID  ESYNGGDQGYLNE+FTWWHRIP++MNFLKHFW+GDE  VKQ+KT LF A
Sbjct  447  FQLLMDHIDVFESYNGGDQGYLNEVFTWWHRIPRYMNFLKHFWIGDEEEVKQKKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCY+DYDCNWNVDI+ EFASD AH++WW+VHD+M  +L +FC+L
Sbjct  507  EPPILYVLHYLGIKPWLCYKDYDCNWNVDIMLEFASDVAHERWWKVHDAMPEKLHQFCML  566

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  567  RSKQKAQL  574



>gb|EYU18058.1| hypothetical protein MIMGU_mgv1a018384mg, partial [Erythranthe 
guttata]
Length=627

 Score =   462 bits (1190),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 236/248 (95%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD+SIG++HRSGL+++GWK+RTI+RIRNPKAEKDAYNEWN
Sbjct  310  AIAAAQSIRMSGSTRDLVILVDESIGDHHRSGLQSSGWKVRTIKRIRNPKAEKDAYNEWN  369

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIF+DADLLILRNIDFLF MP+ISATGNNGTLFNSGVMVIEPSNCT
Sbjct  370  YSKFRLWQLTDYDKIIFVDADLLILRNIDFLFKMPQISATGNNGTLFNSGVMVIEPSNCT  429

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH+DEIESYNGGDQGYLNEIFT+WHRIPKHMNFLK+FW+GD+   +++KT LFAA
Sbjct  430  FKLLMDHVDEIESYNGGDQGYLNEIFTYWHRIPKHMNFLKNFWIGDDELAREKKTRLFAA  489

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPW+C+RDYDCNWNVDIL+EFASD AH KWWRVHDSM  ELREFCLL
Sbjct  490  EPPVLYVLHYLGNKPWMCFRDYDCNWNVDILREFASDVAHGKWWRVHDSMPEELREFCLL  549

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  550  ESKQKAQL  557



>gb|AAX33317.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=636

 Score =   462 bits (1190),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  320  AIAAAQSIRLSGSNRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LFAA
Sbjct  440  FNLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFAA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI QEFASD AH+KWWRVHD+M  +L +FC L
Sbjct  500  EPPILYVLHYLGVKPWLCFRDYDCNWNADIFQEFASDVAHEKWWRVHDAMPEQLHQFCSL  559

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  560  KSKQKAQL  567



>ref|XP_010649390.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Vitis vinifera]
Length=555

 Score =   460 bits (1183),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  240  AIAAAQSIRLAGSTRDLVILVDETISDYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  299

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLL+LRNIDFLFGMPEISATGNNG+LFNSGVMV+EPSNCT
Sbjct  300  YSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFGMPEISATGNNGSLFNSGVMVVEPSNCT  359

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  360  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTHLFGA  419

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCNWN DI QEFASD AH +WWRVHD+M  +L++FC+L
Sbjct  420  EPPILYVLHYLGLKPWLCYRDYDCNWNSDIFQEFASDVAHTRWWRVHDAMPEQLQQFCML  479

Query  722  RSKQKAQL  745
             SKQKA L
Sbjct  480  GSKQKAGL  487



>ref|XP_010244025.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
 ref|XP_010244026.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
Length=589

 Score =   461 bits (1185),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKIRTIQRIRNPKAE+DAYNEWN
Sbjct  273  AIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKIRTIQRIRNPKAERDAYNEWN  332

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  333  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVIEPSNCT  392

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE  +K+ KT LF A
Sbjct  393  FQLLMDHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEEEIKEMKTRLFGA  452

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  453  DPPILYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHKQWWKVHDAMPENLQKFCLL  512

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  513  RSKQKAAL  520



>ref|XP_002275240.2| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Vitis vinifera]
Length=640

 Score =   461 bits (1187),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  325  AIAAAQSIRLAGSTRDLVILVDETISDYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  384

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLL+LRNIDFLFGMPEISATGNNG+LFNSGVMV+EPSNCT
Sbjct  385  YSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFGMPEISATGNNGSLFNSGVMVVEPSNCT  444

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  445  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTHLFGA  504

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCNWN DI QEFASD AH +WWRVHD+M  +L++FC+L
Sbjct  505  EPPILYVLHYLGLKPWLCYRDYDCNWNSDIFQEFASDVAHTRWWRVHDAMPEQLQQFCML  564

Query  722  RSKQKAQL  745
             SKQKA L
Sbjct  565  GSKQKAGL  572



>ref|XP_010244020.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244021.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244022.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244023.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244024.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
Length=648

 Score =   462 bits (1188),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKIRTIQRIRNPKAE+DAYNEWN
Sbjct  332  AIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKIRTIQRIRNPKAERDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVIEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE  +K+ KT LF A
Sbjct  452  FQLLMDHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEEEIKEMKTRLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  512  DPPILYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHKQWWKVHDAMPENLQKFCLL  571

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  572  RSKQKAAL  579



>ref|XP_011007557.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=636

 Score =   461 bits (1187),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  320  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQ TDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  440  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTSLFGA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  500  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  559

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  560  KSKQKAQL  567



>ref|XP_011007559.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=630

 Score =   461 bits (1186),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQ TDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  434  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTSLFGA  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  494  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  553

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  554  KSKQKAQL  561



>ref|XP_011007558.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=631

 Score =   461 bits (1185),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  315  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQ TDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  435  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTSLFGA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVDI QEFASD AH+KWWRV+D+M  +L +FC L
Sbjct  495  EPPILYVLHYLGVKPWLCFRDYDCNWNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSL  554

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  555  KSKQKAQL  562



>ref|XP_002310513.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
 gb|EEE90963.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
Length=630

 Score =   460 bits (1184),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 230/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GS RDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRLSGSNRDLVILVDETISVYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN +LFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNASLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE  VKQ+KT LF A
Sbjct  434  FNLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEEEVKQKKTRLFGA  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI QEFASD AH+KWWRVHD+M  +L +FC L
Sbjct  494  EPPILYVLHYLGVKPWLCFRDYDCNWNADIFQEFASDIAHEKWWRVHDAMPEQLHQFCSL  553

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  554  KSKQKAQL  561



>ref|XP_007048327.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
 gb|EOX92484.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
Length=621

 Score =   460 bits (1184),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HID  ESYNGGDQGYLNE+FTWWHRIP+HMNFLKHFW+GD+  VKQ+KT LF A
Sbjct  457  FQLLMEHIDVFESYNGGDQGYLNEVFTWWHRIPRHMNFLKHFWIGDDEDVKQKKTRLFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCY+DYDCNWNVDI+ EFASD AH++WW+VHD+M  ++ +FC+L
Sbjct  517  EPPILYVLHYLGIKPWLCYKDYDCNWNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCML  576

Query  722  RSKQKAQL  745
            RS QKAQL
Sbjct  577  RSTQKAQL  584



>ref|XP_006581757.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=639

 Score =   461 bits (1185),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  323  AIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  383  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  443  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTLLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  503  EPPILYVLHYLGVKPWLCFRDYDCNWNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  562

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  563  KSKQKAQL  570



>gb|KHN09596.1| Glycogenin-1 [Glycine soja]
Length=639

 Score =   460 bits (1184),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  323  AIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  383  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  443  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTLLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  503  EPPILYVLHYLGVKPWLCFRDYDCNWNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  562

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  563  KSKQKAQL  570



>emb|CDP18299.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   461 bits (1185),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHR GLEAAGWKIRTIQRIRNPKAE+DAYNEWN
Sbjct  331  AIAAAQSIRMAGSTRDLVILVDETISEYHRGGLEAAGWKIRTIQRIRNPKAERDAYNEWN  390

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMV+EPSNCT
Sbjct  391  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISATGNNGTLFNSGVMVVEPSNCT  450

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  +K+ KT LF A
Sbjct  451  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWMGDEEEIKEMKTRLFGA  510

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L  +CLL
Sbjct  511  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHRTWWKVHDAMPENLHRYCLL  570

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  571  RSKQKAAL  578



>gb|KHN34064.1| Glycogenin-2 [Glycine soja]
Length=580

 Score =   457 bits (1177),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 230/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  264  AIAAAQSIRMSGSTRDLVILVDETISEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  323

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLFGMPEI+ATGNNGTLFNSGVMV+EPSNCT
Sbjct  324  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFGMPEITATGNNGTLFNSGVMVVEPSNCT  383

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+E ESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFWVGDE   KQ KT LF A
Sbjct  384  FKLLMDHINEFESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWVGDEEEKKQMKTLLFGA  443

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH +WW+VHD+M   L++FC+L
Sbjct  444  DPPILYVLHYLGMKPWLCFRDYDCNWNSDIFHEFASDVAHGRWWKVHDAMPELLQQFCML  503

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  504  KSKQKAQL  511



>ref|XP_007048326.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
 gb|EOX92483.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
Length=653

 Score =   460 bits (1183),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HID  ESYNGGDQGYLNE+FTWWHRIP+HMNFLKHFW+GD+  VKQ+KT LF A
Sbjct  457  FQLLMEHIDVFESYNGGDQGYLNEVFTWWHRIPRHMNFLKHFWIGDDEDVKQKKTRLFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCY+DYDCNWNVDI+ EFASD AH++WW+VHD+M  ++ +FC+L
Sbjct  517  EPPILYVLHYLGIKPWLCYKDYDCNWNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCML  576

Query  722  RSKQKAQL  745
            RS QKAQL
Sbjct  577  RSTQKAQL  584



>ref|XP_007048325.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOX92482.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
Length=648

 Score =   459 bits (1182),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  332  AIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HID  ESYNGGDQGYLNE+FTWWHRIP+HMNFLKHFW+GD+  VKQ+KT LF A
Sbjct  452  FQLLMEHIDVFESYNGGDQGYLNEVFTWWHRIPRHMNFLKHFWIGDDEDVKQKKTRLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCY+DYDCNWNVDI+ EFASD AH++WW+VHD+M  ++ +FC+L
Sbjct  512  EPPILYVLHYLGIKPWLCYKDYDCNWNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCML  571

Query  722  RSKQKAQL  745
            RS QKAQL
Sbjct  572  RSTQKAQL  579



>gb|KCW62287.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=633

 Score =   459 bits (1180),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSI  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  317  AIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  376

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  377  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEISATGNNATLFNSGVMVIEPSNCT  436

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  437  FNLLMKHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTRLFGA  496

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD  QEFAS+ AH++WWRVHD+M   L++FC+L
Sbjct  497  DPPILYVLHYLGVKPWLCFRDYDCNWNVDFFQEFASNVAHERWWRVHDAMPEVLKQFCML  556

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  557  GSKQKAQL  564



>ref|XP_006578795.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Glycine max]
 ref|XP_006578796.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Glycine max]
Length=639

 Score =   459 bits (1180),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  323  AIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  383  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  443  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTLLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  503  EPPILYVLHYLGVKPWLCFRDYDCNWNDDIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  562

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  563  KSKQKAQL  570



>gb|KDP24792.1| hypothetical protein JCGZ_25413 [Jatropha curcas]
Length=630

 Score =   458 bits (1179),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDLVILVD+SI  YH+SGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  314  AIAAAQSIRLSGSTRDLVILVDESISLYHKSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  373

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  374  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNATLFNSGVMVIEPSNCT  433

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDE  VK +K  LF +
Sbjct  434  FKLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEEQVKNKKIRLFGS  493

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD  QEFASD AH++WW+VHD+M  +L +FCLL
Sbjct  494  DPPVLYVLHYLGVKPWLCFRDYDCNWNVDFFQEFASDIAHERWWKVHDAMPQQLHQFCLL  553

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  554  KSKQKAQL  561



>ref|XP_010025567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 ref|XP_010025568.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 gb|KCW62286.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=639

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVDDSI  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  323  AIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  383  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEISATGNNATLFNSGVMVIEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  443  FNLLMKHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTRLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD  QEFAS+ AH++WWRVHD+M   L++FC+L
Sbjct  503  DPPILYVLHYLGVKPWLCFRDYDCNWNVDFFQEFASNVAHERWWRVHDAMPEVLKQFCML  562

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  563  GSKQKAQL  570



>gb|KHN31133.1| Glycogenin-2 [Glycine soja]
Length=633

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  317  AIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  376

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  377  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  436

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  437  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTLLFGA  496

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  497  EPPILYVLHYLGVKPWLCFRDYDCNWNDDIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  556

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  557  KSKQKAQL  564



>ref|XP_003525117.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=640

 Score =   458 bits (1178),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 230/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  324  AIAAAQSIRMSGSTRDLVILVDETISEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  383

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLFGMPEI+ATGNNGTLFNSGVMV+EPSNCT
Sbjct  384  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFGMPEITATGNNGTLFNSGVMVVEPSNCT  443

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+E ESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFWVGDE   KQ KT LF A
Sbjct  444  FKLLMDHINEFESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWVGDEEEKKQMKTLLFGA  503

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH +WW+VHD+M   L++FC+L
Sbjct  504  DPPILYVLHYLGMKPWLCFRDYDCNWNSDIFHEFASDVAHGRWWKVHDAMPELLQQFCML  563

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  564  KSKQKAQL  571



>ref|XP_010245814.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245816.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245817.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245818.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245820.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
Length=646

 Score =   458 bits (1178),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKIRTIQRIRNPKAE+DAYNEWN
Sbjct  330  AIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKIRTIQRIRNPKAERDAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE   K  KT LF A
Sbjct  450  FQLLMDHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWMGDEEEKKVMKTHLFGA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  510  DPPILYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHKRWWKVHDAMPENLQKFCLL  569

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  570  RSKQKAAL  577



>ref|XP_003602583.1| Secondary cell wall-related glycosyltransferase family [Medicago 
truncatula]
 gb|AES72834.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=637

 Score =   457 bits (1175),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTI+RIRNPKAEKDAYNEWN
Sbjct  321  AIAAAQSIRMSGSTRDLVILVDETISGYHRSGLEAAGWKVRTIKRIRNPKAEKDAYNEWN  380

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGN+ TLFNSGVMV+EPSNCT
Sbjct  381  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNDATLFNSGVMVVEPSNCT  440

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFWVGDE   KQ KT LF A
Sbjct  441  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWVGDEEEKKQMKTMLFGA  500

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  501  EPPILYVLHYLGLKPWLCFRDYDCNWNADIFHEFASDVAHAKWWKVHDAMPKLLQQFCLL  560

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  561  QSKQKAQL  568



>ref|XP_002517237.1| glycogenin, putative [Ricinus communis]
 gb|EEF45137.1| glycogenin, putative [Ricinus communis]
Length=630

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR++GSTRDL+ILVD+SI  YH+SGLEAAGWKIR IQRIRNPKAEKDAYNEWN
Sbjct  313  AIAAAQSIRLSGSTRDLIILVDESISVYHKSGLEAAGWKIRIIQRIRNPKAEKDAYNEWN  372

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDY+KIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  373  YSKFRLWQLTDYEKIIFIDADLLILRNIDFLFSMPEISATGNNATLFNSGVMVIEPSNCT  432

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE  VKQ+K  LF +
Sbjct  433  FNLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEVKQKKIRLFGS  492

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD  QEFASD AH++WWRVHD+M  +L +FCLL
Sbjct  493  EPPILYVLHYLGVKPWLCFRDYDCNWNVDFFQEFASDIAHERWWRVHDAMPQQLHQFCLL  552

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  553  KSKQKAQL  560



>ref|XP_007137705.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
 gb|ESW09699.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
Length=636

 Score =   455 bits (1170),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRD VILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  320  AIAAAQSIRMSGSTRDFVILVDETISGYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  440  FQLLMNHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTLLFGA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  500  EPPILYVLHYLGVKPWLCFRDYDCNWNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  559

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  560  KSKQKAQL  567



>ref|XP_004502919.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cicer arietinum]
Length=695

 Score =   457 bits (1175),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YHRSGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  379  AIAAAQSIRMSGSTRDLVILVDETISGYHRSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  438

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  439  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATGNNATLFNSGVMVVEPSNCT  498

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE   KQ KT LF A
Sbjct  499  FLLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEKKQMKTMLFGA  558

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI  EFASD AH KWW+VHD+M   L++FCLL
Sbjct  559  EPPILYVLHYLGLKPWLCFRDYDCNWNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLL  618

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  619  PSKQKAQL  626



>gb|KHG15344.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 231/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA A+SIR++GSTRDLVILVD+ I  YH+SGLEAAGWK+RTIQRIRNPKAEKDAYNEWN
Sbjct  324  AIAVARSIRLSGSTRDLVILVDEMITAYHKSGLEAAGWKVRTIQRIRNPKAEKDAYNEWN  383

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEPSNCT
Sbjct  384  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEISATGNNGTLFNSGVMVIEPSNCT  443

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HID  ESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GDE  VKQ+KT LF +
Sbjct  444  FQLLMEHIDVFESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDEEEVKQKKTRLFGS  503

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC++DYDCNWNVDI+ EFASD AH++WW+VHD+M  EL+EFC+L
Sbjct  504  DPPILYVLHYLGIKPWLCFKDYDCNWNVDIMVEFASDVAHERWWKVHDAMPEELQEFCML  563

Query  722  RSKQKAQL  745
            RS+QKAQL
Sbjct  564  RSRQKAQL  571



>ref|XP_006297149.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
 gb|EOA30047.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
Length=664

 Score =   455 bits (1170),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  342  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  401

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  402  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  461

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  VK++KTELF A
Sbjct  462  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVKRKKTELFGA  521

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  522  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYL  581

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  582  RSKQKAQL  589



>ref|XP_006383614.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|ERP61411.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=495

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  179  AIAAAQSIRMAGSTRDLVILVDETITDYHREGLAAAGWKIHTIQRIRNPKAERDAYNEWN  238

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  239  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  298

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT+LF A
Sbjct  299  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTQLFGA  358

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  359  DPPILYVLHYLGNKPWICFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLL  418

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  419  RSKQKAAL  426



>ref|XP_008441030.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
 ref|XP_008441032.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
Length=628

 Score =   453 bits (1165),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YH+SGLEAAGWKIR IQRIRNPKAEKDAYNEWN
Sbjct  313  AIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQRIRNPKAEKDAYNEWN  372

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI RNIDFLFGMPEISATGNNGTLFNSGVM+IEPSNCT
Sbjct  373  YSKFRLWQLTDYDKIIFIDADLLIFRNIDFLFGMPEISATGNNGTLFNSGVMLIEPSNCT  432

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLK+FW+GD+   KQ KT LF A
Sbjct  433  FQLLMEHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKNFWMGDDEETKQMKTRLFGA  492

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDI+QEFASD AH +WW+VHD M   L++FCLL
Sbjct  493  DPPILYVLHYLGTKPWMCFRDYDCNWNVDIMQEFASDVAHQRWWQVHDQMPELLQQFCLL  552

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  553  RSKQKAQL  560



>ref|XP_002885270.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61529.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
Length=659

 Score =   453 bits (1166),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  338  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  458  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  518  EPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPEELHQFCYL  577

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  578  RSKQKAQL  585



>gb|KHG05573.1| Glycogenin-2 [Gossypium arboreum]
Length=644

 Score =   452 bits (1164),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVDDSIG+YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDDSIGDYHRGGLEAAGWKIYTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVIEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI+SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  448  FQLLMDHINEIKSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTRLFGA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  508  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLL  567

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  568  RSKQKAQL  575



>ref|XP_002526157.1| glycogenin, putative [Ricinus communis]
 gb|EEF36233.1| glycogenin, putative [Ricinus communis]
Length=656

 Score =   453 bits (1165),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGS RDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  337  AITAAQSIRMAGSIRDLVILVDETISEYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMVIEPSNCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVIEPSNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  457  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTRLFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  517  DPPILYVIHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLL  576

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  577  RSKQKAAL  584



>gb|KHG03827.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score =   452 bits (1163),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVDDSIG+YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  324  AITAAQSIRMSGSTRDLVILVDDSIGDYHRGGLEAAGWKIYTIQRIRNPKAEPEAYNEWN  383

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  384  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVIEPSNCT  443

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI+SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  444  FQLLMDHINEIKSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTRLFGA  503

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  504  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLL  563

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  564  RSKQKAQL  571



>gb|KDP43041.1| hypothetical protein JCGZ_25227 [Jatropha curcas]
Length=647

 Score =   452 bits (1164),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD++IGEYHR GLEAAGWK+ TI+RIRNPKAE+DAYNEWN
Sbjct  329  AIVAAQSIRMAGSTRDLVILVDETIGEYHRGGLEAAGWKVHTIKRIRNPKAEQDAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  389  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ K  LF A
Sbjct  449  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKIRLFGA  508

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLGYKPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  509  DPPVLYVIHYLGYKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLL  568

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  569  RSKQKAAL  576



>gb|KGN48367.1| hypothetical protein Csa_6G483470 [Cucumis sativus]
Length=630

 Score =   452 bits (1162),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YH+SGLEAAGWKIR IQRIRNPKAEKDAYNEWN
Sbjct  313  AIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQRIRNPKAEKDAYNEWN  372

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI RNIDFLFGMPEISATGNNGTLFNSGVM+IEPSNCT
Sbjct  373  YSKFRLWQLTDYDKIIFIDADLLIFRNIDFLFGMPEISATGNNGTLFNSGVMLIEPSNCT  432

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLK+FW+GD+   KQ KT LF A
Sbjct  433  FQLLMEHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKNFWMGDDEETKQMKTRLFGA  492

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDI+QEFASD AH +WW VHD M   L++FCLL
Sbjct  493  DPPILYVLHYLGTKPWMCFRDYDCNWNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLL  552

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  553  RSKQKAQL  560



>ref|NP_001189927.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AEE76129.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=654

 Score =   452 bits (1164),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  333  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  393  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE   K++KTELF A
Sbjct  453  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  513  EPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYL  572

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  573  RSKQKAQL  580



>ref|NP_566615.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AAL07212.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13228.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76127.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=655

 Score =   452 bits (1164),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  334  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  393

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  394  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  453

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE   K++KTELF A
Sbjct  454  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGA  513

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  514  EPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYL  573

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  574  RSKQKAQL  581



>ref|XP_011073953.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
Length=644

 Score =   452 bits (1163),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  328  AIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLL+LRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW+GDE   K+ KT LF A
Sbjct  448  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEKKEMKTRLFGA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  508  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHRTWWKVHDAMPDNLQKYCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>ref|XP_004148647.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=630

 Score =   452 bits (1162),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YH+SGLEAAGWKIR IQRIRNPKAEKDAYNEWN
Sbjct  313  AIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQRIRNPKAEKDAYNEWN  372

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI RNIDFLFGMPEISATGNNGTLFNSGVM+IEPSNCT
Sbjct  373  YSKFRLWQLTDYDKIIFIDADLLIFRNIDFLFGMPEISATGNNGTLFNSGVMLIEPSNCT  432

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLK+FW+GD+   KQ KT LF A
Sbjct  433  FQLLMEHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKNFWMGDDEETKQMKTRLFGA  492

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDI+QEFASD AH +WW VHD M   L++FCLL
Sbjct  493  DPPILYVLHYLGTKPWMCFRDYDCNWNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLL  552

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  553  RSKQKAQL  560



>ref|XP_006406580.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
 gb|ESQ48033.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
Length=658

 Score =   452 bits (1164),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  457  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  517  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYL  576

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  577  RSKQKAQL  584



>ref|XP_009348499.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348515.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=631

 Score =   452 bits (1162),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWK+ TIQRIRNPKAE +AYNEWN
Sbjct  315  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLAAAGWKVHTIQRIRNPKAEPEAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LFAA
Sbjct  435  FQLLMDHIDEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFAA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD LQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  495  EPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASNVAHRRWWKVHDAMPQNLQKFCLL  554

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  555  RSKQKAAL  562



>ref|XP_010487789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=660

 Score =   452 bits (1164),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  338  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  458  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  518  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHL  577

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  578  RSKQKAQL  585



>ref|XP_010465976.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=661

 Score =   452 bits (1164),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  339  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  398

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  399  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  458

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  459  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  518

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  519  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHL  578

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  579  RSKQKAQL  586



>ref|XP_010507061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Camelina sativa]
Length=660

 Score =   452 bits (1164),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  338  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  458  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  518  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHL  577

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  578  RSKQKAQL  585



>ref|XP_004163053.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=681

 Score =   453 bits (1165),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I  YH+SGLEAAGWKIR IQRIRNPKAEKDAYNEWN
Sbjct  319  AIAAAQSIRMSGSTRDLVILVDETISSYHKSGLEAAGWKIRIIQRIRNPKAEKDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI RNIDFLFGMPEISATGNNGTLFNSGVM+IEPSNCT
Sbjct  379  YSKFRLWQLTDYDKIIFIDADLLIFRNIDFLFGMPEISATGNNGTLFNSGVMLIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+E ESYNGGDQGYLNE+FTWWHRIPKHMNFLK+FW+GD+   KQ KT LF A
Sbjct  439  FQLLMEHINEFESYNGGDQGYLNEVFTWWHRIPKHMNFLKNFWMGDDEETKQMKTRLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDI+QEFASD AH +WW VHD M   L++FCLL
Sbjct  499  DPPILYVLHYLGTKPWMCFRDYDCNWNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLL  558

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  559  RSKQKAQL  566



>emb|CDY18535.1| BnaA01g26600D [Brassica napus]
Length=660

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  457  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  517  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYL  576

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  577  RSKQKAQL  584



>gb|KDO83632.1| hypothetical protein CISIN_1g043696mg, partial [Citrus sinensis]
Length=521

 Score =   447 bits (1150),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  205  AIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  264

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  265  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITATGNNATLFNSGVMVVEPSNCT  324

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  K  LF A
Sbjct  325  FQLLMDHIYEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKHMKIRLFGA  384

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  385  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLL  444

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  445  RSKQKAAL  452



>ref|XP_009112560.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Brassica rapa]
Length=661

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  338  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  458  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  518  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYL  577

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  578  RSKQKAQL  585



>ref|XP_009112567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Brassica rapa]
Length=660

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  457  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  517  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYL  576

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  577  RSKQKAQL  584



>gb|EYU36701.1| hypothetical protein MIMGU_mgv1a005329mg [Erythranthe guttata]
Length=488

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDD+I ++HR GL AAGWKI TI+RIRNPKAEKDAYNEWN
Sbjct  171  AITAAQSIRMAGSTRDLVILVDDTISDHHRGGLVAAGWKIHTIERIRNPKAEKDAYNEWN  230

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLL+LRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  231  YSKFRLWQLTEYDKIIFIDADLLVLRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  290

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNE+FT WHRIPKHMNFLKHFWVGDE   K+RKT LF A
Sbjct  291  FQLLMDHINEIESYNGGDQGYLNEVFTRWHRIPKHMNFLKHFWVGDEEEKKERKTSLFGA  350

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  351  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLL  410

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  411  RSKQKAAL  418



>ref|XP_010680250.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680251.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=644

 Score =   451 bits (1160),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD+SI  Y+RSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  327  AIAAAQSIRMVGSTRDLVILVDESISAYYRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEISATGN+ TLFNSGVMVIEPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNMDFLFSMPEISATGNDATLFNSGVMVIEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFWVGD+   K+ KT LF A
Sbjct  447  FNLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWVGDQEDKKKMKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC++DYDCNWN D LQEFASD AH +WW+VHD+M  +L+ FCLL
Sbjct  507  EPPILYVLHYLGIKPWLCHKDYDCNWNTDFLQEFASDVAHARWWKVHDAMPEKLQGFCLL  566

Query  722  RSKQKAQL  745
            R+KQKAQ+
Sbjct  567  RTKQKAQI  574



>ref|XP_009145872.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Brassica rapa]
Length=656

 Score =   451 bits (1161),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 228/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVD++I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  335  AIAAAQSIRQSGSTRDLVILVDENISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  394

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDY+KIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  395  YSKFRLWQLTDYNKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  454

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  455  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  514

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  515  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYL  574

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  575  RSKQKAQL  582



>ref|XP_009360737.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=644

 Score =   451 bits (1159),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLAAAGWKIHTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH+DEI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LFAA
Sbjct  448  FQLLMDHVDEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFAA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD LQEFAS+ AH +WW+VHD+M   L+ FCLL
Sbjct  508  EPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASNVAHRRWWKVHDAMPENLQNFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>ref|NP_001030722.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 sp|Q9LSB1.1|GUX1_ARATH RecName: Full=UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1; Short=UDP-GlcA:xylan glucuronyltransferase 1; AltName: 
Full=Glycogenin-like protein 1; AltName: Full=Plant glycogenin-like 
starch initiation protein 1; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 1; Short=AtGUX1 [Arabidopsis 
thaliana]
 dbj|BAB01792.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU93699.1| glycogenin-like starch initiation protein [Arabidopsis thaliana]
 gb|AEE76128.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AHL38759.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=659

 Score =   451 bits (1161),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  338  AIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW+GDE   K++KTELF A
Sbjct  458  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH KWW VHD+M  EL +FC L
Sbjct  518  EPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYL  577

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  578  RSKQKAQL  585



>ref|XP_010062154.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Eucalyptus grandis]
Length=646

 Score =   451 bits (1159),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD +I +YHR GLE AGWKI TIQRIRNPKAEKDAYNEWN
Sbjct  330  AIAAAQSIRMAGSTRDLVILVDKTISDYHRKGLEEAGWKIHTIQRIRNPKAEKDAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  450  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEVEKKEMKTRLFGA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L +FCLL
Sbjct  510  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLL  569

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  570  RSKQKAGL  577



>ref|XP_010062155.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 ref|XP_010062156.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 gb|KCW69222.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=645

 Score =   451 bits (1159),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD +I +YHR GLE AGWKI TIQRIRNPKAEKDAYNEWN
Sbjct  329  AIAAAQSIRMAGSTRDLVILVDKTISDYHRKGLEEAGWKIHTIQRIRNPKAEKDAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  389  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  449  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEVEKKEMKTRLFGA  508

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L +FCLL
Sbjct  509  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLL  568

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  569  RSKQKAGL  576



>gb|KHG12057.1| Glycogenin-2 [Gossypium arboreum]
Length=646

 Score =   451 bits (1159),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVDDSI +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  330  AITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKIYTIQRIRNPKAEPEAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MP+ISA GNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPQISAIGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  450  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEVEKKQMKTRLFGA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L+++CLL
Sbjct  510  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLL  569

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  570  RSKQKAQL  577



>gb|KCW69223.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=637

 Score =   450 bits (1158),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD +I +YHR GLE AGWKI TIQRIRNPKAEKDAYNEWN
Sbjct  321  AIAAAQSIRMAGSTRDLVILVDKTISDYHRKGLEEAGWKIHTIQRIRNPKAEKDAYNEWN  380

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  381  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  440

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  441  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEVEKKEMKTRLFGA  500

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L +FCLL
Sbjct  501  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLL  560

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  561  RSKQKAGL  568



>ref|XP_008373921.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=548

 Score =   447 bits (1149),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  232  AIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  291

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  292  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNATLFNSGVMVVEPSNCT  351

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  352  FQLLMDHINEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTHLFQA  411

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP++Y +HYLG KPWLC+RDYDCNWNVD +QEFASD AH+ WWRVHD+M   L++FCLL
Sbjct  412  DPPIIYVLHYLGKKPWLCFRDYDCNWNVDFMQEFASDVAHNTWWRVHDTMPGNLQKFCLL  471

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  472  RTQQKAGL  479



>ref|XP_007019401.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOY16626.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
Length=644

 Score =   450 bits (1157),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVDDSI +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKIYTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  448  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTRLFGA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  508  NPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLL  567

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  568  RSKQKAQL  575



>ref|XP_008798993.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
 ref|XP_008798994.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
Length=639

 Score =   450 bits (1157),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 230/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+AGSTRDLVILVD++I E+HRSGLEAAGWK+RTIQRIRNPKAE+DAYNEWN
Sbjct  327  AITAAQSIRLAGSTRDLVILVDETISEHHRSGLEAAGWKVRTIQRIRNPKAERDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEITATGNNATLFNSGVMVVEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKH+NFLKHFW GDE ++K +KT+LFAA
Sbjct  447  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHINFLKHFWEGDEESMKVKKTQLFAA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  ILQEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  507  DPPVLYVLHYLGLKPWLCFRDYDCNWNEGILQEFASDVAHARWWKVHDTMPENLQHFCLL  566

Query  722  RSKQKAQL  745
            +SKQKA L
Sbjct  567  KSKQKAAL  574



>ref|XP_006472929.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score =   449 bits (1156),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  322  AIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  382  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITATGNNATLFNSGVMVVEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  K  LF A
Sbjct  442  FQLLMDHIYEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEGEKKHMKNRLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  502  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLL  561

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  562  RSKQKAAL  569



>ref|XP_010664886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Vitis vinifera]
Length=643

 Score =   449 bits (1156),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD +I EYHR GLEAAGWKI TI+RIRNPKAE+DAYNEWN
Sbjct  327  AIAAAQSIRMAGSTRDLVILVDKTISEYHRGGLEAAGWKIHTIERIRNPKAERDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVIEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  447  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKEMKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW++HD+M   L++FCLL
Sbjct  507  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDILQEFASNVAHKRWWKIHDAMPENLQKFCLL  566

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  567  RSKQKAAL  574



>ref|XP_002307480.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|EEE94476.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=651

 Score =   450 bits (1157),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  335  AIAAAQSIRMAGSTRDLVILVDETITDYHREGLAAAGWKIHTIQRIRNPKAERDAYNEWN  394

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  395  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  454

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT+LF A
Sbjct  455  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTQLFGA  514

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  515  DPPILYVLHYLGNKPWICFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLL  574

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  575  RSKQKAAL  582



>ref|XP_010664887.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Vitis vinifera]
Length=642

 Score =   449 bits (1156),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD +I EYHR GLEAAGWKI TI+RIRNPKAE+DAYNEWN
Sbjct  326  AIAAAQSIRMAGSTRDLVILVDKTISEYHRGGLEAAGWKIHTIERIRNPKAERDAYNEWN  385

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  386  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVIEPSNCT  445

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  446  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKEMKTRLFGA  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW++HD+M   L++FCLL
Sbjct  506  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDILQEFASNVAHKRWWKIHDAMPENLQKFCLL  565

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  566  RSKQKAAL  573



>ref|XP_006485174.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score =   449 bits (1155),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  322  AIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  382  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITATGNNATLFNSGVMVVEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  K  LF A
Sbjct  442  FQLLMDHIYEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEGEKKHMKNRLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  502  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLL  561

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  562  RSKQKAAL  569



>gb|EPS63087.1| hypothetical protein M569_11696, partial [Genlisea aurea]
Length=329

 Score =   438 bits (1126),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM GSTRDLVILVD +I E+HRSGL AAGWKI TI+RI+NP+AEKDAYNEWN
Sbjct  22   AIVAAQSIRMTGSTRDLVILVDSTISEHHRSGLRAAGWKIHTIERIKNPRAEKDAYNEWN  81

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  82   YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFRMPEISAIGNNATLFNSGVMVIEPSNCT  141

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHID+IESYNGGDQGYLN++FTWWHRIPK MNFLKHFW+GDE  VK+ KT LF A
Sbjct  142  FRLLMDHIDDIESYNGGDQGYLNQVFTWWHRIPKRMNFLKHFWIGDEPQVKELKTHLFGA  201

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD L+EFASD AH  WW+VHD M   L+ +CLL
Sbjct  202  DPPVLYVIHYLGLKPWLCFRDYDCNWNVDELREFASDVAHRTWWKVHDGMPENLQNYCLL  261

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  262  RSKQKAAL  269



>emb|CDY53768.1| BnaC01g43920D [Brassica napus]
Length=660

 Score =   449 bits (1156),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GST DLVILVDD+I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  337  AIAAAQSIRQSGSTSDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  V+++KTELF A
Sbjct  457  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVRRKKTELFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  517  EPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYL  576

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  577  RSKQKAQL  584



>ref|XP_008373924.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X3 [Malus domestica]
Length=625

 Score =   448 bits (1153),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWK+ TIQRIRNPKAE +AYNEWN
Sbjct  309  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLAAAGWKVHTIQRIRNPKAEPEAYNEWN  368

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRL QLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  369  YSKFRLLQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  428

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LFAA
Sbjct  429  FQLLMDHIDEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFAA  488

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD LQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  489  EPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLL  548

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  549  RSKQKAAL  556



>ref|XP_008798991.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Phoenix dactylifera]
Length=665

 Score =   450 bits (1157),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 230/248 (93%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+AGSTRDLVILVD++I E+HRSGLEAAGWK+RTIQRIRNPKAE+DAYNEWN
Sbjct  353  AITAAQSIRLAGSTRDLVILVDETISEHHRSGLEAAGWKVRTIQRIRNPKAERDAYNEWN  412

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  413  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEITATGNNATLFNSGVMVVEPSNCT  472

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKH+NFLKHFW GDE ++K +KT+LFAA
Sbjct  473  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHINFLKHFWEGDEESMKVKKTQLFAA  532

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  ILQEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  533  DPPVLYVLHYLGLKPWLCFRDYDCNWNEGILQEFASDVAHARWWKVHDTMPENLQHFCLL  592

Query  722  RSKQKAQL  745
            +SKQKA L
Sbjct  593  KSKQKAAL  600



>ref|XP_010539696.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Tarenaya hassleriana]
Length=640

 Score =   449 bits (1154),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD+SI +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  323  AITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  383  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  443  FQLLMDHIDEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEKKQAKTRLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  503  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPENLQKFCLL  562

Query  722  RSKQKAQL  745
            RSKQKAQ+
Sbjct  563  RSKQKAQI  570



>ref|XP_004148815.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cucumis sativus]
 gb|KGN47482.1| hypothetical protein Csa_6G338140 [Cucumis sativus]
Length=634

 Score =   449 bits (1154),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  317  AIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKILTIQRIRNPKAERDAYNEWN  376

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  377  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEITATGNNATLFNSGVMVIEPSNCT  436

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  437  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKEMKTRLFGA  496

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVD+L EFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  497  DPPILYVLHYLGNKPWICFRDYDCNWNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLL  556

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  557  RSKQKAQL  564



>ref|XP_006434392.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
 gb|ESR47632.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
Length=638

 Score =   449 bits (1154),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  322  AIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAERDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  382  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITATGNNATLFNSGVMVVEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  K  LF A
Sbjct  442  FQLLMDHIYEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKHMKIRLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  502  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLL  561

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  562  RSKQKAAL  569



>ref|XP_010539695.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Tarenaya hassleriana]
Length=644

 Score =   449 bits (1154),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD+SI +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  327  AITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  447  FQLLMDHIDEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEKKQAKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  507  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDIAHKTWWKVHDAMPENLQKFCLL  566

Query  722  RSKQKAQL  745
            RSKQKAQ+
Sbjct  567  RSKQKAQI  574



>ref|XP_008441557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis melo]
Length=634

 Score =   448 bits (1153),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 227/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  317  AIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKIFTIQRIRNPKAERDAYNEWN  376

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  377  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEITATGNNATLFNSGVMVIEPSNCT  436

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  437  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKEMKTRLFGA  496

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVD+L EFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  497  DPPILYVLHYLGNKPWICFRDYDCNWNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLL  556

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  557  RSKQKAQL  564



>ref|XP_010999819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Populus euphratica]
Length=649

 Score =   449 bits (1154),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  333  AIAAAQSIRMAGSTRDLVILVDETITDYHREGLTAAGWKIHTIQRIRNPKAERDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  393  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   KQ KT LF A
Sbjct  453  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKQMKTRLFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  513  DPPILYVLHYLGNKPWICFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPGNLHKYCLL  572

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  573  RSKQKAAL  580



>dbj|BAJ87020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   438 bits (1127),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR AGSTRD VILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  51   AIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  110

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  111  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNATLFNSGVMVIEPSNCT  170

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT+LF A
Sbjct  171  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTQLFGA  230

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  231  NPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  290

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  291  RSRLKAGL  298



>ref|XP_008373923.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=631

 Score =   448 bits (1152),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWK+ TIQRIRNPKAE +AYNEWN
Sbjct  315  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLAAAGWKVHTIQRIRNPKAEPEAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRL QLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  375  YSKFRLLQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LFAA
Sbjct  435  FQLLMDHIDEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFAA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD LQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  495  EPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLL  554

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  555  RSKQKAAL  562



>ref|XP_008373920.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score =   448 bits (1153),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  330  AIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  450  FQLLMDHINEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTHLFQA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP++Y +HYLG KPWLC+RDYDCNWNVD +QEFASD AH+ WWRVHD+M   L++FCLL
Sbjct  510  DPPIIYVLHYLGKKPWLCFRDYDCNWNVDFMQEFASDVAHNTWWRVHDTMPGNLQKFCLL  569

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  570  RTQQKAGL  577



>ref|XP_008373922.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score =   448 bits (1152),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWK+ TIQRIRNPKAE +AYNEWN
Sbjct  330  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLAAAGWKVHTIQRIRNPKAEPEAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRL QLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  390  YSKFRLLQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LFAA
Sbjct  450  FQLLMDHIDEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFAA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWNVD LQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  510  EPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLL  569

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  570  RSKQKAAL  577



>ref|XP_007199740.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
 gb|EMJ00939.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
Length=644

 Score =   448 bits (1152),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHR GL AAGWKI  I+RIRNPKAE +AYNEWN
Sbjct  328  AIAAAQSIRMAGSTRDLVILVDETISEYHRGGLAAAGWKIHPIERIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH++EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  448  FQLLMDHVNEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFKA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD LQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  508  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>ref|XP_009348497.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348516.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=646

 Score =   447 bits (1151),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  330  AIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  450  FQLLMDHINEIVSYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTHLFQA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP++Y +HYLG KPWLC+RDYDCNWNVD +QEFASD AH+ WWRVHD+M   L +FCLL
Sbjct  510  DPPIIYVLHYLGKKPWLCFRDYDCNWNVDFMQEFASDVAHNTWWRVHDAMPRNLHKFCLL  569

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  570  RTQQKAGL  577



>ref|XP_010550282.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Tarenaya hassleriana]
Length=653

 Score =   447 bits (1151),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR +GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  335  AIAAAESIRQSGSTRDLVILVDENISPYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  394

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI+RNID LF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  395  YSKFRLWQLTDYDKIIFIDADLLIMRNIDLLFSMPEISATGNNGTLFNSGVMVIEPCNCT  454

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMD I+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD+  VK++KT LF  
Sbjct  455  FRLLMDRINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDDDDVKRKKTRLFGH  514

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFASD AH +WWRVHD+M   L +FC L
Sbjct  515  EPPVLYVLHYLGMKPWLCYRDYDCNFNADIFLEFASDVAHQRWWRVHDAMPQVLHQFCYL  574

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  575  RSKQKAQL  582



>ref|XP_010550280.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Tarenaya hassleriana]
Length=654

 Score =   447 bits (1150),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR +GSTRDLVILVD++I  YHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  336  AIAAAESIRQSGSTRDLVILVDENISPYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  395

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLI+RNID LF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  396  YSKFRLWQLTDYDKIIFIDADLLIMRNIDLLFSMPEISATGNNGTLFNSGVMVIEPCNCT  455

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMD I+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD+  VK++KT LF  
Sbjct  456  FRLLMDRINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDDDDVKRKKTRLFGH  515

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFASD AH +WWRVHD+M   L +FC L
Sbjct  516  EPPVLYVLHYLGMKPWLCYRDYDCNFNADIFLEFASDVAHQRWWRVHDAMPQVLHQFCYL  575

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  576  RSKQKAQL  583



>ref|XP_004166220.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3-like [Cucumis sativus]
Length=634

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE+DAYNEWN
Sbjct  317  AIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWKILTIQRIRNPKAERDAYNEWN  376

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKI FIDAD+LILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  377  YSKFRLWQLTDYDKIXFIDADMLILRNIDFLFEMPEITATGNNATLFNSGVMVIEPSNCT  436

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  437  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKEMKTRLFGA  496

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWNVD+L EFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  497  DPPILYVLHYLGNKPWICFRDYDCNWNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLL  556

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  557  RSKQKAQL  564



>ref|XP_010911800.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
 ref|XP_010911801.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
Length=639

 Score =   446 bits (1147),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+ GSTRDLVILVD++I ++HRSGLEAAGWK++TIQRIRNPKAE+DAYNEWN
Sbjct  327  AITAAQSIRLTGSTRDLVILVDETISDHHRSGLEAAGWKVKTIQRIRNPKAERDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPEITATGNNATLFNSGVMVVEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE +VK  KT+LF A
Sbjct  447  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEESVKAHKTDLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN DIL+EFASD AH +WW+VHD+M  +L+ FCLL
Sbjct  507  DPPVLYVLHYLGLKPWLCFRDYDCNWNEDILREFASDVAHARWWKVHDTMPEKLQHFCLL  566

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  567  RSKQKAAL  574



>ref|XP_008237654.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Prunus mume]
Length=644

 Score =   445 bits (1145),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHR GL AAGWKI  I+RIRNPKAE  AYNEWN
Sbjct  328  AIAAAQSIRMAGSTRDLVILVDETISEYHRGGLAAAGWKIHPIERIRNPKAEPKAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH++EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  448  FQLLMDHVNEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFEA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+L+ +HYLG KPWLC+RDYDCNWNVD LQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  508  DPPILFVLHYLGNKPWLCFRDYDCNWNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>ref|XP_010911799.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=665

 Score =   446 bits (1146),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 229/248 (92%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+ GSTRDLVILVD++I ++HRSGLEAAGWK++TIQRIRNPKAE+DAYNEWN
Sbjct  353  AITAAQSIRLTGSTRDLVILVDETISDHHRSGLEAAGWKVKTIQRIRNPKAERDAYNEWN  412

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  413  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPEITATGNNATLFNSGVMVVEPSNCT  472

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE +VK  KT+LF A
Sbjct  473  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEESVKAHKTDLFGA  532

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN DIL+EFASD AH +WW+VHD+M  +L+ FCLL
Sbjct  533  DPPVLYVLHYLGLKPWLCFRDYDCNWNEDILREFASDVAHARWWKVHDTMPEKLQHFCLL  592

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  593  RSKQKAAL  600



>emb|CDY04633.1| BnaC05g16710D [Brassica napus]
Length=639

 Score =   444 bits (1143),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI E+HRSGL AAGWKI +IQRIRNPKAE +AYNEWN
Sbjct  323  AITAAQSIRMAGSTRDLVILVDDSITEHHRSGLAAAGWKIYSIQRIRNPKAEAEAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  383  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  443  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WWRVHD+M   L++FCLL
Sbjct  503  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLL  562

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  563  RSKQKAQL  570



>gb|KCW71171.1| hypothetical protein EUGRSUZ_F04263 [Eucalyptus grandis]
Length=396

 Score =   435 bits (1118),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD++I E+HR+GLEAAGWK+ TIQRIRNPKA+ DAYNEWN
Sbjct  80   AITAAQSIRMAGSTRDLVILVDETISEHHRTGLEAAGWKVHTIQRIRNPKAQPDAYNEWN  139

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD L+LRNIDFLFGMPE+SATGNN +LFNSGVMVIEPSNCT
Sbjct  140  YSKFRLWQLTDYDKIIFIDADQLVLRNIDFLFGMPELSATGNNASLFNSGVMVIEPSNCT  199

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GD+   K  KT LF+A
Sbjct  200  FKLLMNHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWEGDDEETKLMKTRLFSA  259

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWNVD  +EFASDAAH  WW++HD+M   L +FCLL
Sbjct  260  DPPTLYVLHYLGLKPWLCFRDYDCNWNVDYYREFASDAAHGTWWKLHDAMPEHLHKFCLL  319

Query  722  RSKQKAQL  745
             SKQKA L
Sbjct  320  SSKQKAAL  327



>ref|XP_009149666.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Brassica rapa]
Length=639

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI E+HRSGL AAGWKI +IQRIRNPKAE +AYNEWN
Sbjct  323  AITAAQSIRMAGSTRDLVILVDDSITEHHRSGLAAAGWKIYSIQRIRNPKAEAEAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  383  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  443  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WWRVHD+M   L++FCLL
Sbjct  503  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLL  562

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  563  RSKQKAQL  570



>ref|XP_006645120.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=636

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVDD+I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  323  AITAAQSIRQAGSTRDFVILVDDTISDHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  383  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  443  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV+IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  503  DPPILYVLHYLGLKPWLCFRDYDCNWNVEILREFASDVAHARWWKVHDKMPKKLQHYCLL  562

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  563  RSRQKAGL  570



>ref|XP_009149665.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Brassica rapa]
Length=643

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI E+HRSGL AAGWKI +IQRIRNPKAE +AYNEWN
Sbjct  327  AITAAQSIRMAGSTRDLVILVDDSITEHHRSGLAAAGWKIYSIQRIRNPKAEAEAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  387  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  447  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WWRVHD+M   L++FCLL
Sbjct  507  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLL  566

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  567  RSKQKAQL  574



>ref|XP_003544084.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Glycine max]
Length=574

 Score =   441 bits (1134),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  327  AITAAQSIRMSGSTRDLVILVDETISEYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF M EISA GNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMSEISAIGNNATLFNSGVMVVEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  447  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEERKAMKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M  +L+ FCLL
Sbjct  507  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPEKLQNFCLL  566

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  567  RSKQKAAL  574



>ref|XP_009360735.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Pyrus x bretschneideri]
Length=640

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  330  AIAAAQSIRMAGSTRDLVILVDETITQYHRGGLAAAGWKIHTIQRIRNPKAEAEAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNATLFNSGVMVVEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  450  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTHLFQA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD +QEFASD AH  WW+VHD+M   L++FCLL
Sbjct  510  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFMQEFASDVAHKTWWKVHDAMPGNLQKFCLL  569

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  570  RTEQKAGL  577



>ref|XP_009360736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Pyrus x bretschneideri]
Length=639

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  329  AIAAAQSIRMAGSTRDLVILVDETITQYHRGGLAAAGWKIHTIQRIRNPKAEAEAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSNCT
Sbjct  389  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNATLFNSGVMVVEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  449  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTHLFQA  508

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD +QEFASD AH  WW+VHD+M   L++FCLL
Sbjct  509  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFMQEFASDVAHKTWWKVHDAMPGNLQKFCLL  568

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  569  RTEQKAGL  576



>ref|XP_004288348.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Fragaria vesca subsp. vesca]
Length=639

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIRMAGSTRDLVILVD++I  YHRSGL+AAGW ++TIQRIRNPKAEKDAYNEWN
Sbjct  322  AISAAQSIRMAGSTRDLVILVDETISGYHRSGLQAAGWIVKTIQRIRNPKAEKDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLIL+NID LF MPEISATGN+ TLFNSGVMVIEPSNCT
Sbjct  382  YSKFRLWQLTEYDKIIFIDADLLILKNIDILFSMPEISATGNDATLFNSGVMVIEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GDE  +KQ+KT LF A
Sbjct  442  FHLLMDHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWQGDEEEMKQKKTWLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN DI QEFASD AH  WW++HD+M   L++FC L
Sbjct  502  EPPVLYVLHYLGMKPWLCFRDYDCNWNSDIFQEFASDVAHASWWKIHDAMPELLQQFCFL  561

Query  722  RSKQKAQL  745
            R+KQKAQL
Sbjct  562  RTKQKAQL  569



>ref|XP_009763873.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana sylvestris]
Length=648

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAEKDAYNEWN
Sbjct  332  AIAAAQSIRLAGSTRDLVILVDETISDYHREGLAAAGWKIHTIQRIRNPKAEKDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKH+W GDE   K+ KT LF A
Sbjct  452  FQLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHYWEGDEEEKKEMKTRLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV+ LQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  512  DPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLQEFASDVAHRTWWKVHDAMPENLHKYCLL  571

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  572  RSKQKAAL  579



>ref|XP_007199738.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
 gb|EMJ00937.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
Length=644

 Score =   442 bits (1138),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRMAGSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AIAAAQSIRMAGSTRDLVILVDETITEYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN +LFNSGVMV+EPSN T
Sbjct  388  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNNASLFNSGVMVVEPSNGT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH++EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  448  FQLLMDHVNEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDELEIKQMKTRLFEA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD +QEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  508  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLL  567

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  568  RTEQKAGL  575



>ref|XP_006416296.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
 gb|ESQ34649.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
Length=634

 Score =   442 bits (1136),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI EYHR GL AAGWKI  IQRIRNPKAE +AYNEWN
Sbjct  318  AITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWKIYPIQRIRNPKAEAEAYNEWN  377

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  378  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  437

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  438  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  497

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  498  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLL  557

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  558  RSKQKAQL  565



>ref|XP_010110482.1| hypothetical protein L484_003528 [Morus notabilis]
 gb|EXC26583.1| hypothetical protein L484_003528 [Morus notabilis]
Length=660

 Score =   442 bits (1138),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TI+RIRNPKAE +AYNEWN
Sbjct  345  AIVAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIKRIRNPKAEPEAYNEWN  404

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  405  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEISATGNNATLFNSGVMVIEPSNCT  464

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K+ KT LF A
Sbjct  465  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEKKEMKTRLFGA  524

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPW+C+RDYDCNWNVDILQEFASD AH +WW+VHD+M   L ++CLL
Sbjct  525  NPPILYVLHYLGNKPWICFRDYDCNWNVDILQEFASDVAHKRWWKVHDAMPENLHKYCLL  584

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  585  RSKQKAAL  592



>gb|KEH40452.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=627

 Score =   441 bits (1135),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I +YHRSGL AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  310  AITAAQSIRMSGSTRDLVILVDETISDYHRSGLAAAGWKIHTIQRIRNPKAEPEAYNEWN  369

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMV+EPSNCT
Sbjct  370  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVVEPSNCT  429

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  430  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEDQKKAMKTRLFGA  489

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  490  DPPILYVIHYLGTKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPENLQKFCLL  549

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  550  RSKQKAAL  557



>ref|XP_008237655.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3 [Prunus mume]
Length=644

 Score =   442 bits (1136),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAA QSIRMAGSTRDLVILVD++I EYHR GLEAAGWKI TIQRIR PKAE +AYNEWN
Sbjct  328  AIAATQSIRMAGSTRDLVILVDETITEYHRGGLEAAGWKIHTIQRIRKPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGN+ +LFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNDASLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH++EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  448  FQLLMDHVNEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFEA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD +QEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  508  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLL  567

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  568  RTEQKAGL  575



>ref|XP_008647982.1| PREDICTED: LOC100286027 isoform X2 [Zea mays]
 gb|ACR37754.1| unknown [Zea mays]
Length=546

 Score =   438 bits (1127),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  237  AISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQRIRNPKAERDAYNEWN  296

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  297  YSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNATLFNSGVMVVEPSNCT  356

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHIDEI SYNGGDQGYLNEIFTWWHR+P+HMNFLKHFW GD  A+K +KT+LF A
Sbjct  357  FRLLMDHIDEITSYNGGDQGYLNEIFTWWHRVPRHMNFLKHFWEGDSEAMKAKKTQLFGA  416

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN   ++EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  417  DPPVLYVLHYLGLKPWLCFRDYDCNWNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLL  476

Query  722  RSKQKAQL  745
            RS+QKA+L
Sbjct  477  RSRQKARL  484



>dbj|BAJ87861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   431 bits (1108),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  35   AITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIERIRNPKAERDAYNEWN  94

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  95   YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  154

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD  A K +KT+LF A
Sbjct  155  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDSEAAKAKKTQLFGA  214

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWN  I++EFASD AH++WW+VHD M  +L+ +CLL
Sbjct  215  DPPNLYVLHYLGLKPWLCFRDYDCNWNNFIMREFASDVAHNRWWKVHDKMPRKLQSYCLL  274

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  275  RTRQKAGL  282



>gb|KFK44245.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=639

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI EYHR GL AAGWKI +I+RIRNPKAE +AYNEWN
Sbjct  322  AITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWKIYSIERIRNPKAEAEAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  382  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  442  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGK  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  502  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLL  561

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  562  RSKQKAQL  569



>gb|KFK44246.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=643

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI EYHR GL AAGWKI +I+RIRNPKAE +AYNEWN
Sbjct  326  AITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWKIYSIERIRNPKAEAEAYNEWN  385

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  386  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  445

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  446  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGK  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WW+VHD+M   L++FCLL
Sbjct  506  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLL  565

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  566  RSKQKAQL  573



>ref|XP_009629284.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana tomentosiformis]
Length=648

 Score =   441 bits (1135),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHR GL AAGWKI TIQRIRNPKAEKDAYNEWN
Sbjct  332  AIAAAQSIRLAGSTRDLVILVDETISDYHREGLAAAGWKIHTIQRIRNPKAEKDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKH+W GDE   K+ KT LF A
Sbjct  452  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHYWEGDEEEKKEMKTRLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV+ LQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  512  DPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLQEFASDVAHRTWWKVHDAMPENLHKYCLL  571

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  572  RSKQKAAL  579



>ref|XP_003518352.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Glycine max]
Length=644

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I EYHR GL+AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDETISEYHRGGLKAAGWKIHTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  448  FQLLMDHINEIVSYNGGDQGYLNELFTWWHRIPKHMNFLKHFWEGDEEEKKAMKTRLFRA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  508  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPENLQKFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>ref|XP_004237736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Solanum lycopersicum]
Length=648

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD+SI +YHR GLEAAGWKI TI+RIRNPKAE+DAYNEWN
Sbjct  332  AIAAAQSIRLAGSTRDLVILVDESISDYHRGGLEAAGWKIHTIKRIRNPKAEQDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKH+W GDE   KQ KT LF A
Sbjct  452  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHYWEGDEEEKKQMKTSLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV  LQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  512  DPPVLYVLHYLGLKPWLCFRDYDCNWNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLL  571

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  572  RSKQKAAL  579



>ref|XP_008654538.1| PREDICTED: uncharacterized protein LOC100272808 isoform X1 [Zea 
mays]
 gb|AFW84389.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
 gb|AFW84390.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
Length=641

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVDD+I ++HR GLE+AGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  319  AITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQRIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRNIDFLF +PEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKVIFIDADLLILRNIDFLFALPEITATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLM+HIDEI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  439  FRLLMEHIDEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTRLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV+IL+EFASD AH +WW+VH+ M  +L+ +CLL
Sbjct  499  NPPVLYVLHYLGRKPWLCFRDYDCNWNVEILREFASDVAHARWWKVHNRMPRKLQSYCLL  558

Query  722  RSKQKAQL  745
            RS  KA L
Sbjct  559  RSSLKAGL  566



>ref|XP_004290562.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=640

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GL AAGWKI +IQRIRNPKAE +AYNEWN
Sbjct  326  AIAAAQSIRMSGSTRDLVILVDETISEYHREGLAAAGWKIHSIQRIRNPKAEPEAYNEWN  385

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  386  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNFT  445

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K+RKT LF  
Sbjct  446  FQLLMDHINEIVSYNGGDQGYLNEMFTWWHRIPKHMNFLKHFWEGDEPEKKERKTHLFQV  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD LQEFASD AH +WW+VHD+M   L++FCLL
Sbjct  506  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLL  565

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  566  RSKQKAAL  573



>gb|KHN41007.1| Glycogenin-2 [Glycine soja]
Length=644

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I EYHR GL+AAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDETISEYHRGGLKAAGWKIHTIQRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  448  FQLLMDHINEIVSYNGGDQGYLNELFTWWHRIPKHMNFLKHFWEGDEEEKKAMKTRLFRA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  508  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPENLQKFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>dbj|BAJ87677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score =   440 bits (1132),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR AGSTRD VILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  320  AIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNATLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT+LF A
Sbjct  440  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTQLFGA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  500  NPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  559

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  560  RSRLKAGL  567



>ref|XP_010680014.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Beta vulgaris subsp. vulgaris]
Length=648

 Score =   441 bits (1133),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  331  AIAAAQSIRMSGSTRDLVILVDETISEYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  390

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLFG+PEISATGNN TLFNSGVMVIEPSNCT
Sbjct  391  YSKFRLWQLTDYDKIIFIDADLLILRNLDFLFGLPEISATGNNATLFNSGVMVIEPSNCT  450

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPK MNFLKH+W GDE   K+ KT LF A
Sbjct  451  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKRMNFLKHYWEGDEPEKKEMKTRLFGA  510

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN ++L EFASD AH  WW+VHD+M   L ++CLL
Sbjct  511  DPPILYVLHYLGLKPWLCFRDYDCNWNNELLHEFASDIAHRTWWKVHDAMPENLHKYCLL  570

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  571  RSKQKASL  578



>gb|EMS55920.1| Glycogenin-1 [Triticum urartu]
Length=622

 Score =   439 bits (1130),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR AGSTRD VILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  308  AIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  367

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  368  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNATLFNSGVMVIEPSNCT  427

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT+LF A
Sbjct  428  FQLLMNHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTQLFGA  487

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  488  NPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  547

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  548  RSRLKAGL  555



>emb|CDM85463.1| unnamed protein product [Triticum aestivum]
Length=634

 Score =   440 bits (1131),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR AGSTRD VILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  320  AIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNATLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT+LF A
Sbjct  440  FQLLMNHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTQLFGA  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  500  NPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  559

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  560  RSRLKAGL  567



>ref|XP_006356283.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X2 [Solanum tuberosum]
Length=642

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHR GLEAAGWKI TI+RIRNPKAE+DAYNEWN
Sbjct  326  AIAAAQSIRLAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIKRIRNPKAEQDAYNEWN  385

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  386  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  445

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKH+W GDE   KQ KT LF A
Sbjct  446  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHYWEGDEEEKKQMKTRLFGA  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV  LQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  506  DPPVLYVLHYLGLKPWLCFRDYDCNWNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLL  565

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  566  RSKQKAAL  573



>gb|EEC79261.1| hypothetical protein OsI_20036 [Oryza sativa Indica Group]
Length=671

 Score =   441 bits (1134),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVDD+I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  363  AISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQRIRNPKAERDAYNEWN  422

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  423  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  482

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD+ + K +KTELF A
Sbjct  483  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDDDSAKAKKTELFGA  542

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN+ +++EFASD AH +WW+VHD+M  +L+ +CLL
Sbjct  543  DPPILYVLHYLGMKPWLCFRDYDCNWNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLL  602

Query  722  RSKQKAQL  745
            RSK KA L
Sbjct  603  RSKLKAGL  610



>ref|NP_001152387.1| LOC100286027 [Zea mays]
 gb|ACG47359.1| secondary cell wall-related glycosyltransferase family 8 [Zea 
mays]
Length=633

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  324  AISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQRIRNPKAERDAYNEWN  383

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  384  YSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNATLFNSGVMVVEPSNCT  443

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHIDEI SYNGGDQGYLNEIFTWWHR+P+HMNFLKHFW GD  A+K +KT+LF A
Sbjct  444  FRLLMDHIDEITSYNGGDQGYLNEIFTWWHRVPRHMNFLKHFWEGDSEAMKAKKTQLFGA  503

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN   ++EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  504  DPPVLYVLHYLGLKPWLCFRDYDCNWNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLL  563

Query  722  RSKQKAQL  745
            RS+QKA+L
Sbjct  564  RSRQKARL  571



>gb|KHN04164.1| Glycogenin-2 [Glycine soja]
Length=643

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  327  AITAAQSIRMSGSTRDLVILVDETISEYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF M EISA GNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMSEISAIGNNATLFNSGVMVVEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  447  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEERKAMKTRLFGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M  +L+ FCLL
Sbjct  507  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPEKLQNFCLL  566

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  567  RSKQKAAL  574



>ref|XP_006607044.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like, partial [Glycine max]
Length=634

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I EYHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  318  AITAAQSIRMSGSTRDLVILVDETISEYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  377

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF M EISA GNN TLFNSGVMV+EPSNCT
Sbjct  378  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMSEISAIGNNATLFNSGVMVVEPSNCT  437

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  438  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEERKAMKTRLFGA  497

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M  +L+ FCLL
Sbjct  498  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNVAHARWWKVHDAMPEKLQNFCLL  557

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  558  RSKQKAAL  565



>ref|XP_008647980.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 ref|XP_008647981.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 gb|ACR35990.1| unknown [Zea mays]
 gb|AFW78066.1| secondary cell wall glycosyltransferase family 8 isoform 1 [Zea 
mays]
 gb|AFW78067.1| secondary cell wall glycosyltransferase family 8 isoform 2 [Zea 
mays]
Length=632

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  323  AISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQRIRNPKAERDAYNEWN  382

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  383  YSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNATLFNSGVMVVEPSNCT  442

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHIDEI SYNGGDQGYLNEIFTWWHR+P+HMNFLKHFW GD  A+K +KT+LF A
Sbjct  443  FRLLMDHIDEITSYNGGDQGYLNEIFTWWHRVPRHMNFLKHFWEGDSEAMKAKKTQLFGA  502

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN   ++EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  503  DPPVLYVLHYLGLKPWLCFRDYDCNWNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLL  562

Query  722  RSKQKAQL  745
            RS+QKA+L
Sbjct  563  RSRQKARL  570



>ref|XP_006356282.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X1 [Solanum tuberosum]
Length=648

 Score =   440 bits (1131),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGSTRDLVILVD++I +YHR GLEAAGWKI TI+RIRNPKAE+DAYNEWN
Sbjct  332  AIAAAQSIRLAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIKRIRNPKAEQDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN TLFNSGVMV+EPSNCT
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNATLFNSGVMVVEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPKHMNFLKH+W GDE   KQ KT LF A
Sbjct  452  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHYWEGDEEEKKQMKTRLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV  LQEFASD AH  WW+VHD+M   L ++CLL
Sbjct  512  DPPVLYVLHYLGLKPWLCFRDYDCNWNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLL  571

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  572  RSKQKAAL  579



>ref|XP_004498382.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cicer arietinum]
Length=644

 Score =   440 bits (1131),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD++I +YHR GLEAAGWKI TI+RIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDETISDYHRGGLEAAGWKIHTIKRIRNPKAEPEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISA GNN TLFNSGVMV+EPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAIGNNATLFNSGVMVVEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE   K  KT LF A
Sbjct  448  FQLLMDHINEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEKKAMKTHLFGA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFAS+ AH +WW+VHD+M   L++FCLL
Sbjct  508  DPPILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASNIAHARWWKVHDAMPENLQKFCLL  567

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  568  RSKQKAAL  575



>gb|AAS90653.1| putative glycogenin [Oryza sativa Japonica Group]
Length=671

 Score =   441 bits (1133),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVDD+I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  363  AISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQRIRNPKAERDAYNEWN  422

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  423  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  482

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD+ + K +KTELF A
Sbjct  483  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDDDSAKAKKTELFGA  542

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN+ +++EFASD AH +WW+VHD+M  +L+ +CLL
Sbjct  543  DPPILYVLHYLGMKPWLCFRDYDCNWNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLL  602

Query  722  RSKQKAQL  745
            RSK KA L
Sbjct  603  RSKLKAGL  610



>dbj|BAG90458.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   437 bits (1124),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVD++I  +HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  262  AITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  321

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  322  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  381

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  382  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGA  441

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  442  DPPILYVLHYLGLKPWLCFRDYDCNWNNPILREFASDVAHARWWKVHDKMPKKLQHYCLL  501

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  502  RSRQKAGL  509



>gb|EEC71899.1| hypothetical protein OsI_04661 [Oryza sativa Indica Group]
Length=635

 Score =   439 bits (1129),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVD++I  +HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  322  AITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  382  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  442  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  502  DPPILYVLHYLGLKPWLCFRDYDCNWNNPILREFASDVAHARWWKVHDKMPKKLQHYCLL  561

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  562  RSRQKAGL  569



>gb|EMT19434.1| Glycogenin-1 [Aegilops tauschii]
Length=642

 Score =   439 bits (1129),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR AGSTRD VILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  328  AIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  388  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNATLFNSGVMVIEPSNCT  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT+LF A
Sbjct  448  FQLLMNHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTQLFGA  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  508  NPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  567

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  568  RSRLKAGL  575



>ref|NP_001044991.1| Os01g0880200 [Oryza sativa Japonica Group]
 dbj|BAD81673.1| glycogenin-like protein [Oryza sativa Japonica Group]
 dbj|BAF06905.1| Os01g0880200 [Oryza sativa Japonica Group]
Length=635

 Score =   439 bits (1128),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVD++I  +HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  322  AITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  382  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  442  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  502  DPPILYVLHYLGLKPWLCFRDYDCNWNNPILREFASDVAHARWWKVHDKMPKKLQHYCLL  561

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  562  RSRQKAGL  569



>ref|XP_009392550.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392551.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392552.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392553.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392554.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392555.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392556.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   439 bits (1128),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGS RDLVILVD+++ ++HR GLEAAGWKI+TI RIRNPKAE+DAYNEWN
Sbjct  334  AIAAAQSIRLAGSKRDLVILVDETVSDHHRGGLEAAGWKIKTITRIRNPKAERDAYNEWN  393

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEI+ATGNN T FNSGVMV+EPSNCT
Sbjct  394  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPEITATGNNVTFFNSGVMVVEPSNCT  453

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GDE  +K +K  LF A
Sbjct  454  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWFGDEEEIKAKKIRLFGA  513

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PPLLY +HYLG KPWLC+RDYDCNWNVDI+QEFASD AH  WW+VHD+M   L+ FCLL
Sbjct  514  DPPLLYVLHYLGLKPWLCFRDYDCNWNVDIMQEFASDVAHATWWKVHDTMPQHLQSFCLL  573

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  574  RSKQKAGL  581



>gb|EEE63788.1| hypothetical protein OsJ_18611 [Oryza sativa Japonica Group]
Length=684

 Score =   440 bits (1132),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGSTRDLVILVDD+I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  376  AISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQRIRNPKAERDAYNEWN  435

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  436  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  495

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD+ + K +KTELF A
Sbjct  496  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDDDSAKAKKTELFGA  555

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN+ +++EFASD AH +WW+VHD+M  +L+ +CLL
Sbjct  556  DPPILYVLHYLGMKPWLCFRDYDCNWNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLL  615

Query  722  RSKQKAQL  745
            RSK KA L
Sbjct  616  RSKLKAGL  623



>ref|XP_003564767.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=632

 Score =   438 bits (1127),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVDD+I E+HR GLEAAGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  320  AITAAQSIRQAGSTRDFVILVDDTISEHHRKGLEAAGWKVRIIERIRNPKAERDAYNEWN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  380  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF +
Sbjct  440  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGS  499

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNV IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  500  DPPILYVLHYLGRKPWLCFRDYDCNWNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLL  559

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  560  RSRLKAGL  567



>ref|XP_008674740.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Zea mays]
 tpg|DAA56541.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=634

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVDD+I ++HR GLE+AGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  319  AITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQRIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  439  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEDEVKAKKTRLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV+IL+EFA+D AH +WW+VH+ M  +L+ +CLL
Sbjct  499  NPPILYVLHYLGRKPWLCFRDYDCNWNVEILREFATDVAHARWWKVHNKMPKKLQSYCLL  558

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  559  RSRLKAGL  566



>gb|EAZ14371.1| hypothetical protein OsJ_04291 [Oryza sativa Japonica Group]
Length=651

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRD VILVD++I  +HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  338  AITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  397

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  398  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  457

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  458  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKVKKTRLFGA  517

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  IL+EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  518  DPPILYVLHYLGLKPWLCFRDYDCNWNNPILREFASDVAHARWWKVHDKMPKKLQHYCLL  577

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  578  RSRQKAGL  585



>ref|XP_002456736.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
 gb|EES01856.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
Length=633

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVDD+I ++HR GLE+AGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  319  AITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIERIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  439  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEEEVKAKKTRLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV+IL+EFASD AH +WW+VH+ M  +L+ +CLL
Sbjct  499  NPPILYVLHYLGRKPWLCFRDYDCNWNVEILREFASDVAHARWWKVHNKMPKKLQSYCLL  558

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  559  RSRLKAGL  566



>ref|XP_009392557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGS RDLVILVD+++ ++HR GLEAAGWKI+TI RIRNPKAE+DAYNEWN
Sbjct  333  AIAAAQSIRLAGSKRDLVILVDETVSDHHRGGLEAAGWKIKTITRIRNPKAERDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDADLLILRNIDFLF MPEI+ATGNN T FNSGVMV+EPSNCT
Sbjct  393  YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPEITATGNNVTFFNSGVMVVEPSNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GDE  +K +K  LF A
Sbjct  453  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWFGDEEEIKAKKIRLFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PPLLY +HYLG KPWLC+RDYDCNWNVDI+QEFASD AH  WW+VHD+M   L+ FCLL
Sbjct  513  DPPLLYVLHYLGLKPWLCFRDYDCNWNVDIMQEFASDVAHATWWKVHDTMPQHLQSFCLL  572

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  573  RSKQKAGL  580



>ref|XP_006858468.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
 gb|ERN19935.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
Length=640

 Score =   438 bits (1126),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+ GSTRDLVILVD++I  +HRSGL AAGWKIRTIQRIRNPKAEKDAYNEWN
Sbjct  327  AIAAAQSIRLTGSTRDLVILVDETISSHHRSGLAAAGWKIRTIQRIRNPKAEKDAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMV+EPSNCT
Sbjct  387  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITATGNNATLFNSGVMVLEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLMDHI+EIESYNGGDQGYLNEIFTWWHRIPK MNFLKHFW  DE   K+ KT LFAA
Sbjct  447  FNLLMDHINEIESYNGGDQGYLNEIFTWWHRIPKRMNFLKHFWAKDEEE-KEYKTRLFAA  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH +WW+VHD M  +L+ FCLL
Sbjct  506  DPPELYVLHYLGLKPWLCFRDYDCNWNVDILQEFASDIAHWRWWKVHDMMPEKLQRFCLL  565

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  566  RSKQKAGL  573



>tpg|DAA56540.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=640

 Score =   438 bits (1126),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVDD+I ++HR GLE+AGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  325  AITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQRIRNPKAERDAYNEWN  384

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRNIDFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  385  YSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  444

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  VK +KT LF A
Sbjct  445  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEDEVKAKKTRLFGA  504

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP+LY +HYLG KPWLC+RDYDCNWNV+IL+EFA+D AH +WW+VH+ M  +L+ +CLL
Sbjct  505  NPPILYVLHYLGRKPWLCFRDYDCNWNVEILREFATDVAHARWWKVHNKMPKKLQSYCLL  564

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  565  RSRLKAGL  572



>gb|AGT16755.1| glycogenin [Saccharum hybrid cultivar R570]
Length=631

 Score =   437 bits (1125),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  319  AITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRIIQRIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEISATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEISATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD  A+K +KT+LF A
Sbjct  439  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDSQAMKAKKTQLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC++DYDCNWN   ++EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  499  DPPILYVLHYLGLKPWLCFKDYDCNWNNAGMREFASDVAHARWWKVHDKMPRKLQSYCLL  558

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  559  RSRQKASL  566



>ref|XP_009414973.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414974.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414975.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=643

 Score =   438 bits (1126),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+AGS RDLVILVD+++ ++HRSGLEAAGWKI+TI RIRNPKAE DAYNEWN
Sbjct  332  AIAAAQSIRLAGSKRDLVILVDETVSDHHRSGLEAAGWKIKTITRIRNPKAEHDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDK+IFIDADLL+LRNIDFLF MPEI+ATGNN T FNSGVMVIEPSNCT
Sbjct  392  YSKFRLWQLTEYDKVIFIDADLLVLRNIDFLFTMPEITATGNNVTFFNSGVMVIEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNE+FTWWHRIP+ MNFLKH+W+GDE  +K+ KT LF A
Sbjct  452  FQLLMDHINEIESYNGGDQGYLNEVFTWWHRIPRRMNFLKHYWIGDEKEIKEMKTHLFGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDI+QEFASD AH  WW+VHD M   L+ FCLL
Sbjct  512  DPPVLYVLHYLGLKPWLCFRDYDCNWNVDIMQEFASDVAHTTWWKVHDVMPKHLQSFCLL  571

Query  722  RSKQKAQL  745
            R+KQKA L
Sbjct  572  RTKQKAAL  579



>ref|XP_010063886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Eucalyptus grandis]
Length=635

 Score =   437 bits (1124),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD++I E+HR+GLEAAGWK+ TIQRIRNPKA+ DAYNEWN
Sbjct  319  AITAAQSIRMAGSTRDLVILVDETISEHHRTGLEAAGWKVHTIQRIRNPKAQPDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD L+LRNIDFLFGMPE+SATGNN +LFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKIIFIDADQLVLRNIDFLFGMPELSATGNNASLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GD+   K  KT LF+A
Sbjct  439  FKLLMNHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWEGDDEETKLMKTRLFSA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWNVD  +EFASDAAH  WW++HD+M   L +FCLL
Sbjct  499  DPPTLYVLHYLGLKPWLCFRDYDCNWNVDYYREFASDAAHGTWWKLHDAMPEHLHKFCLL  558

Query  722  RSKQKAQL  745
             SKQKA L
Sbjct  559  SSKQKAAL  566



>gb|KFK39187.1| hypothetical protein AALP_AA3G211300 [Arabis alpina]
Length=1277

 Score =   454 bits (1169),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 226/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2     AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
             AIAAAQSIR +GSTRDLVILVD++I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  956   AIAAAQSIRQSGSTRDLVILVDENISSYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  1015

Query  182   YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
             YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  1016  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  1075

Query  362   FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
             F LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFW GDE  V+++KTELF A
Sbjct  1076  FELLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWSGDEDDVRRKKTELFGA  1135

Query  542   EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             EPP+LY +HYLG KPWLCYRDYDCN+N DI  EFA+D AH +WW VHD+M  EL +FC L
Sbjct  1136  EPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYL  1195

Query  722   RSKQKAQL  745
             RSKQKAQL
Sbjct  1196  RSKQKAQL  1203



>ref|XP_002441128.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
 gb|EES19558.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
Length=631

 Score =   436 bits (1122),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  319  AITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRIIQRIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD  A+K +KT+LF A
Sbjct  439  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDSQAMKAKKTQLFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC++DYDCNWN   ++EFASD AH +WW+VHD M  +L+ +CLL
Sbjct  499  DPPILYVLHYLGLKPWLCFKDYDCNWNNAGMREFASDVAHARWWKVHDKMPRKLQSYCLL  558

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  559  RSRQKASL  566



>ref|XP_008237675.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3 [Prunus mume]
Length=816

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAA QSIRMAGSTRDLVILVD++I EYHR GLEAAGWKI TIQRIR PKAE +AYNEWN
Sbjct  500  AIAATQSIRMAGSTRDLVILVDETITEYHRGGLEAAGWKIHTIQRIRKPKAEPEAYNEWN  559

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGN+ +LFNSGVMV+EPSNCT
Sbjct  560  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGNDASLFNSGVMVVEPSNCT  619

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH++EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +KQ KT LF A
Sbjct  620  FQLLMDHVNEIVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFEA  679

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVD +QEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  680  DPPILYVLHYLGNKPWLCFRDYDCNWNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLL  739

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  740  RTEQKAGL  747



>ref|XP_006654430.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=626

 Score =   434 bits (1116),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+AAQSIR AGS+RDL+ILVD++I ++HR GLE+AGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  319  AISAAQSIRQAGSSRDLIILVDETISDHHRKGLESAGWKVRLIQRIRNPKAERDAYNEWN  378

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  379  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  438

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD  +VK +KTELF A
Sbjct  439  FQLLMDHIDEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDNESVKAKKTELFGA  498

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN  +++EFASD AH +WW+VHD M  +L+ +C L
Sbjct  499  DPPVLYVLHYLGLKPWLCFRDYDCNWNNPVMREFASDVAHARWWKVHDKMPEKLQSYCFL  558

Query  722  RSKQKAQL  745
            RS+ KA L
Sbjct  559  RSRLKAGL  566



>emb|CDY50243.1| BnaA06g15200D [Brassica napus]
Length=1035

 Score =   446 bits (1147),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI E+HRSGL AAGWKI +IQRIRNPKAE +AYNEWN
Sbjct  327  AITAAQSIRMAGSTRDLVILVDDSITEHHRSGLAAAGWKIYSIQRIRNPKAEAEAYNEWN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  387  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  447  FQLLMDHINEIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH  WWRVHD+M   L++FCLL
Sbjct  507  DPPILYVLHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLL  566

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  567  RSKQKAQL  574



>ref|XP_008786543.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=644

 Score =   434 bits (1117),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+ GS RDLVILVD++I +++RSGL AAGWK+RTIQRIRNPKAE ++YNEWN
Sbjct  333  AIAAAQSIRLTGSKRDLVILVDETITDHYRSGLAAAGWKVRTIQRIRNPKAEPESYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNNGTLFNSGVMVIEPSNCT
Sbjct  393  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEITAIGNNGTLFNSGVMVIEPSNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEIESYNGGDQGYLNEI+TWWHRIP+HMNFLKHFW GDE  +K+ KT LF A
Sbjct  453  FQLLMDHIDEIESYNGGDQGYLNEIYTWWHRIPQHMNFLKHFWEGDEEEIKEMKTRLFGA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP++Y +HYLG KPW C+RDYDCNWN+DI+QEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  513  EPPVIYVLHYLGLKPWQCFRDYDCNWNLDIMQEFASDVAHARWWKVHDTMPEYLQSFCLL  572

Query  722  RSKQKAQL  745
             +K+KA L
Sbjct  573  STKRKASL  580



>ref|XP_003568405.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=628

 Score =   434 bits (1115),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVDDSI ++HR GLEAAGWK+R IQRIRNPKAE+DAYNEWN
Sbjct  316  AITAAQSIRQAGSTRDLVILVDDSISDHHRKGLEAAGWKVRIIQRIRNPKAERDAYNEWN  375

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  376  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  435

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GD  A K +KT+LF A
Sbjct  436  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWEGDSEAAKAKKTQLFGA  495

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +H+LG KPWLC+RDYDCNWN  ++++FASD AH++WW+VHD M  +L+ +CLL
Sbjct  496  DPPNLYVLHFLGLKPWLCFRDYDCNWNSLVMRDFASDVAHNRWWKVHDKMPRKLQSYCLL  555

Query  722  RSKQKAQL  745
            RS+QKA L
Sbjct  556  RSRQKAGL  563



>ref|XP_007161486.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
 gb|ESW33480.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
Length=645

 Score =   434 bits (1116),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVD++I +YHR GLEAAGWKI TIQRIRNPKAE +AYNEWN
Sbjct  329  AITAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKIHTIQRIRNPKAEPEAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNN +LFNSGVMV+EPSNCT
Sbjct  389  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEITAIGNNASLFNSGVMVVEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFT WHRIPKHMNFLKHFW GDE   K  KT LFAA
Sbjct  449  FQLLMDHINEIVSYNGGDQGYLNEIFTRWHRIPKHMNFLKHFWEGDEEEKKVMKTRLFAA  508

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +P +LY +HYLG KPWLC+RDYDCNWNVDILQEFASD AH +WW+VHD+M   L +FCLL
Sbjct  509  DPSILYVIHYLGNKPWLCFRDYDCNWNVDILQEFASDVAHARWWKVHDAMPENLHKFCLL  568

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  569  RSKQKAAL  576



>gb|EPS62267.1| hypothetical protein M569_12523, partial [Genlisea aurea]
Length=503

 Score =   429 bits (1103),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR+  S RDLVILVDD+IG+YHRSGLE+AGWK++TIQRIRNPKAEKDAYNEWN
Sbjct  195  AIAAARSIRLTRSDRDLVILVDDTIGDYHRSGLESAGWKVKTIQRIRNPKAEKDAYNEWN  254

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YD+++FIDADLL+LRNIDFLF MPEISATGNNGTLFNSGVMVIEPS+CT
Sbjct  255  YSKFRLWQLTEYDRVVFIDADLLLLRNIDFLFAMPEISATGNNGTLFNSGVMVIEPSDCT  314

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDH+ E ESYNGGDQGYLNE+FTWWHRIPK +NFLK FW GD+ A K+ K  LF  
Sbjct  315  FRLLMDHVGEFESYNGGDQGYLNEVFTWWHRIPKRVNFLKDFWHGDDEAAKRNKIRLFEE  374

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP +YA+HYLG KPW+C+RDYDCNWNV+IL EFASDAAH +WW VHDSM  +L+EFCLL
Sbjct  375  DPPRIYALHYLGTKPWMCFRDYDCNWNVEILHEFASDAAHRRWWAVHDSMPEKLQEFCLL  434

Query  722  RSKQKAQL  745
             SKQKAQL
Sbjct  435  PSKQKAQL  442



>dbj|BAJ85213.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=628

 Score =   431 bits (1109),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  316  AITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIERIRNPKAERDAYNEWN  375

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  376  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  435

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD  A K +KT+LF A
Sbjct  436  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDSEAAKAKKTQLFGA  495

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWN  I++EFASD AH++WW+VHD M  +L+ +CLL
Sbjct  496  DPPNLYVLHYLGLKPWLCFRDYDCNWNNFIMREFASDVAHNRWWKVHDKMPRKLQSYCLL  555

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  556  RTRQKAGL  563



>ref|XP_006302009.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
 gb|EOA34907.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
Length=618

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVDDSI EYH+SGL+AAGWKI   QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWKIHMFQRIRNPNAIPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISATGNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>ref|XP_011099766.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Sesamum indicum]
Length=605

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD SI ++HR+GLE AGW++RTI+RIRNPKAEKDAYNEWN
Sbjct  306  AIVAAQSIRMSGSTRDLVILVDKSISDHHRNGLELAGWQVRTIERIRNPKAEKDAYNEWN  365

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGN+G  FNSGVMVIEPSNCT
Sbjct  366  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFVMPEISATGNSGPRFNSGVMVIEPSNCT  425

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GD+  V+Q K  LF A
Sbjct  426  FELLMHHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDDEQVRQTKVHLFEA  485

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPW+C+RDYDCNWNVD LQEFAS+ AH  WW+VHD M  +L+ FC+L
Sbjct  486  EPPILYVLHYLGNKPWVCFRDYDCNWNVDQLQEFASNVAHRTWWKVHDMMPEKLQGFCML  545

Query  722  RSKQKAQL  745
            ++ QKAQL
Sbjct  546  KTIQKAQL  553



>ref|XP_011099765.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Sesamum indicum]
Length=614

 Score =   429 bits (1104),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVD SI ++HR+GLE AGW++RTI+RIRNPKAEKDAYNEWN
Sbjct  315  AIVAAQSIRMSGSTRDLVILVDKSISDHHRNGLELAGWQVRTIERIRNPKAEKDAYNEWN  374

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEISATGN+G  FNSGVMVIEPSNCT
Sbjct  375  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFVMPEISATGNSGPRFNSGVMVIEPSNCT  434

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F LLM HI+EIESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW+GD+  V+Q K  LF A
Sbjct  435  FELLMHHINEIESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWIGDDEQVRQTKVHLFEA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPW+C+RDYDCNWNVD LQEFAS+ AH  WW+VHD M  +L+ FC+L
Sbjct  495  EPPILYVLHYLGNKPWVCFRDYDCNWNVDQLQEFASNVAHRTWWKVHDMMPEKLQGFCML  554

Query  722  RSKQKAQL  745
            ++ QKAQL
Sbjct  555  KTIQKAQL  562



>ref|XP_010416641.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   429 bits (1103),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVDDSI EYH+SGL+AAGWKI+  QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWKIQMFQRIRNPNAVPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISA GNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISAIGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>ref|XP_010930628.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Elaeis guineensis]
Length=648

 Score =   430 bits (1106),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR+ GS RDLVILVD++I ++H+SGL AAGWK+R IQRIRNPKAE +AYNEWN
Sbjct  337  AIAAAQSIRLTGSKRDLVILVDETINDHHKSGLAAAGWKVRMIQRIRNPKAEPEAYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LWQLTDYDKIIFIDADLLILRNIDFLF MPEI+A GNNGTLFNSGVMVIEPSNCT
Sbjct  397  YSKFLLWQLTDYDKIIFIDADLLILRNIDFLFTMPEITAIGNNGTLFNSGVMVIEPSNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EIESYNGGDQGYLNEIFTWWHRIP+HMN+LKHFW GDE  +K+ KT LF A
Sbjct  457  FQLLMDHINEIESYNGGDQGYLNEIFTWWHRIPQHMNYLKHFWEGDEEEIKEMKTRLFGA  516

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP++Y +HYLG KPW CYRDYDCNWN DI+QEFASD AH +WW+VHD+M   L+ FCLL
Sbjct  517  DPPIIYVLHYLGLKPWQCYRDYDCNWNEDIMQEFASDVAHARWWKVHDTMPEYLQSFCLL  576

Query  722  RSKQKAQL  745
             +K+KA L
Sbjct  577  STKRKASL  584



>ref|XP_010471900.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   429 bits (1103),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVDDSI EYH+SGL+AAGWKI+  QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWKIQMFQRIRNPNAVPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISA GNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISAIGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>ref|XP_010428781.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   429 bits (1103),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVDDSI EYH+SGL+AAGWKI+  QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWKIQMFQRIRNPNAVPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISA GNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISAIGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>gb|ADC84479.1| glycosyltransferase family 8B [Salix miyabeana]
Length=220

 Score =   414 bits (1064),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 190/218 (87%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  92   SGLEAAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  271
            SGLE +GWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF
Sbjct  1    SGLEKSGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  60

Query  272  LFGMPEISATGNNGTLFNSGVMVIEPSNCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWH  451
            LFGMPEISATGNN TLFNSGVMVIEPSNCTF LLM+HI+EIESYNGGDQGYLNEIFTWWH
Sbjct  61   LFGMPEISATGNNATLFNSGVMVIEPSNCTFNLLMEHINEIESYNGGDQGYLNEIFTWWH  120

Query  452  RIPKHMNFLKHFWVGDEAAVKQRKTELFAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDI  631
            RIPKHMNFLKHFW+GDE  VKQ KT LF AEPP+LY +HYLG KPWLC+RDYDCNWNVDI
Sbjct  121  RIPKHMNFLKHFWIGDEEEVKQEKTSLFGAEPPILYVLHYLGVKPWLCFRDYDCNWNVDI  180

Query  632  LQEFASDAAHDKWWRVHDSMAPELREFCLLRSKQKAQL  745
             QEFASD AH+KWWRVHD+M  +L +FC L+SKQKAQL
Sbjct  181  FQEFASDIAHEKWWRVHDAMPEQLHQFCSLKSKQKAQL  218



>gb|ADC84480.1| glycosyltransferase family 8B [Salix sachalinensis]
Length=220

 Score =   413 bits (1062),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  92   SGLEAAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  271
            SGLE +GWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLL+LRNIDF
Sbjct  1    SGLEKSGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLVLRNIDF  60

Query  272  LFGMPEISATGNNGTLFNSGVMVIEPSNCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWH  451
            LFGMPEISATGNN TLFNSGVMVIEPSNCTF LLM+HI+EIESYNGGDQGYLNEIFTWWH
Sbjct  61   LFGMPEISATGNNATLFNSGVMVIEPSNCTFNLLMEHINEIESYNGGDQGYLNEIFTWWH  120

Query  452  RIPKHMNFLKHFWVGDEAAVKQRKTELFAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDI  631
            RIP+HMNFLKHFW+GDE  VKQ+KT LF AEPP+LY +HYLG KPWLC+RDYDCNWNVDI
Sbjct  121  RIPRHMNFLKHFWIGDEEEVKQKKTSLFGAEPPILYVLHYLGVKPWLCFRDYDCNWNVDI  180

Query  632  LQEFASDAAHDKWWRVHDSMAPELREFCLLRSKQKAQL  745
             QEFASD AH+KWWRVHD+M  +L +FC L+SKQKAQL
Sbjct  181  FQEFASDIAHEKWWRVHDAMPKQLHQFCSLKSKQKAQL  218



>ref|XP_002889125.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65384.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   427 bits (1099),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVDD+I EYH+SGL AAGWKI   QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDDTISEYHKSGLVAAGWKIHMFQRIRNPNAIPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISATGNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>ref|NP_177838.2| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 sp|Q8W4A7.1|GUX3_ARATH RecName: Full=Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3; Short=UDP-GlcA:xylan glucuronyltransferase 
3; AltName: Full=Glycogenin-like protein 3; AltName: Full=Plant 
glycogenin-like starch initiation protein 2; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 3; Short=AtGUX3 
[Arabidopsis thaliana]
 gb|AAL32773.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47996.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35939.1| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 gb|AHL38869.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=618

 Score =   427 bits (1097),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIRM+GSTRDLVILVD++I EYH+SGL AAGWKI+  QRIRNP A  +AYNEWN
Sbjct  301  AIAAAQSIRMSGSTRDLVILVDETISEYHKSGLVAAGWKIQMFQRIRNPNAVPNAYNEWN  360

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISATGNN TLFNSG+MV+EPSN T
Sbjct  361  YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNST  420

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  421  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  480

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  481  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  540

Query  719  LRSKQKAQL  745
            LRSKQKAQL
Sbjct  541  LRSKQKAQL  549



>gb|ADC84478.1| glycosyltransferase family 8C [Salix sachalinensis]
Length=220

 Score =   412 bits (1058),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +2

Query  92   SGLEAAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  271
            SGL  AGW+IRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF
Sbjct  1    SGLAEAGWEIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  60

Query  272  LFGMPEISATGNNGTLFNSGVMVIEPSNCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWH  451
            LFGMPEISATGNN +LFNSGVMVIEPSNCTF LLM+HI+EIESYNGGDQGYLNE+FTWWH
Sbjct  61   LFGMPEISATGNNASLFNSGVMVIEPSNCTFNLLMEHINEIESYNGGDQGYLNEVFTWWH  120

Query  452  RIPKHMNFLKHFWVGDEAAVKQRKTELFAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDI  631
            RIPKHMNFLKHFW+GDE  VKQ+KT LFAAEPP+LY +HYLG KPWLC+RDYDCNWNVDI
Sbjct  121  RIPKHMNFLKHFWIGDEEEVKQKKTRLFAAEPPILYVLHYLGVKPWLCFRDYDCNWNVDI  180

Query  632  LQEFASDAAHDKWWRVHDSMAPELREFCLLRSKQKAQL  745
             QEFASD AH+KWWRVHD+M  +L +FC L+SKQKAQL
Sbjct  181  FQEFASDIAHEKWWRVHDAMPEQLHQFCSLKSKQKAQL  218



>gb|EPS59757.1| hypothetical protein M569_15049, partial [Genlisea aurea]
Length=494

 Score =   422 bits (1084),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA A SIRM+GSTRDLVILVD SI E+HR GLEAAGW++RTI+RIRNP AEKD+YNEWN
Sbjct  200  AIAVAHSIRMSGSTRDLVILVDASINEHHRRGLEAAGWQVRTIERIRNPNAEKDSYNEWN  259

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+LILRNID LF MPEISATGNNG+LFNSGVMVIEPSNCT
Sbjct  260  YSKFRLWQLTDYDKIIFIDSDMLILRNIDVLFRMPEISATGNNGSLFNSGVMVIEPSNCT  319

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+L+MDHI EI SYNGGDQG+LNE+F WWHRIP+ MNFLKHFW GD+   +++K +LF+A
Sbjct  320  FQLVMDHIHEIHSYNGGDQGFLNEMFPWWHRIPQRMNFLKHFWPGDDEETRRKKLQLFSA  379

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP++Y +H+LGYKPW C+RDYDCNWNV+ LQEFASDAAH +WW++HDSM  +L+ +CLL
Sbjct  380  EPPIVYVLHFLGYKPWQCFRDYDCNWNVERLQEFASDAAHRRWWKMHDSMPEKLQRYCLL  439

Query  722  RSKQKAQL  745
            R+ QKAQL
Sbjct  440  RTIQKAQL  447



>ref|XP_009396821.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=618

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA A+SIR+AGSTRDLVILVD+SI ++H  GLEAAGWK+RTIQRIRNPKAEK+AYNEWN
Sbjct  316  AIAVARSIRLAGSTRDLVILVDESISDHHLGGLEAAGWKVRTIQRIRNPKAEKNAYNEWN  375

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLLILRNIDFLF MPEISATGNN T+FNSGVMV+EPSNCT
Sbjct  376  YSKFRLWQLTDYDKVIFIDADLLILRNIDFLFKMPEISATGNNATIFNSGVMVVEPSNCT  435

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHRIP+ MNFLKHFW GD  +VK RKT LFAA
Sbjct  436  FQLLMDHIDEITSYNGGDQGYLNEIFTWWHRIPRQMNFLKHFWEGDSQSVKARKTRLFAA  495

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            E P LY +HYLG KPWLC+RD+DCNWN  + + FASD AH  WWRVHDSM   L+ FCLL
Sbjct  496  ETPGLYVLHYLGLKPWLCFRDFDCNWNSVLYRSFASDEAHATWWRVHDSMPEGLQRFCLL  555

Query  722  RSKQKAQL  745
             +  KA L
Sbjct  556  STVTKAGL  563



>gb|EMT13493.1| Glycogenin-1 [Aegilops tauschii]
Length=685

 Score =   426 bits (1095),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR AGSTRDLVILVD++I ++HR GLEAAGWK+R I+RIRNPKAE+DAYNEWN
Sbjct  371  AITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIERIRNPKAERDAYNEWN  430

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRN+DFLF MPEI+ATGNN TLFNSGVMVIEPSNCT
Sbjct  431  YSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNATLFNSGVMVIEPSNCT  490

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EI SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD    K +KT+LF A
Sbjct  491  FQLLMEHINEITSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDSEEAKAKKTQLFGA  550

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
             PP LY +HYLG KPWLC+RDYDCNWN  +++EFASD AH +WW+ HD M  +L+ +CLL
Sbjct  551  APPNLYVLHYLGLKPWLCFRDYDCNWNNFMMREFASDVAHSRWWKTHDKMPRKLQSYCLL  610

Query  722  RSKQKAQL  745
            R++QKA L
Sbjct  611  RTRQKAGL  618



>gb|ADC84477.1| glycosyltransferase family 8C [Salix miyabeana]
Length=220

 Score =   405 bits (1041),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  92   SGLEAAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  271
            SGL  AGW+IRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF
Sbjct  1    SGLAEAGWEIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDF  60

Query  272  LFGMPEISATGNNGTLFNSGVMVIEPSNCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWH  451
            LFGMPEISATGNN +LFNSGVMVIEPSNCTF LLM+HI+EIESYNGGDQGYLNE+FTWWH
Sbjct  61   LFGMPEISATGNNASLFNSGVMVIEPSNCTFNLLMEHINEIESYNGGDQGYLNEVFTWWH  120

Query  452  RIPKHMNFLKHFWVGDEAAVKQRKTELFAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDI  631
            RIPKHMNFLKHFW+GDE  VKQ+KT LFAAEPP+LY +HYLG KPWLC+RDYDCNWNVDI
Sbjct  121  RIPKHMNFLKHFWIGDEEEVKQKKTRLFAAEPPILYVLHYLGVKPWLCFRDYDCNWNVDI  180

Query  632  LQEFASDAAHDKWWRVHDSMAPELREFCLLRSKQKAQL  745
             QEFASD AH+KWWRVHD+M  +L +F   +SKQKAQL
Sbjct  181  FQEFASDIAHEKWWRVHDAMPEQLHQFYSSKSKQKAQL  218



>ref|XP_009384289.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=630

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 215/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR+AGS RDL+ILVD SI E  RSGLE AGWK+RTI+RIRNPKA++DAYNEWN
Sbjct  330  AIAAAKSIRLAGSVRDLIILVDGSISERERSGLEDAGWKVRTIRRIRNPKAKRDAYNEWN  389

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLL+LRNIDFLF MPEISA GNN TLFNSGVMVIEPSNCT
Sbjct  390  YSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFAMPEISAIGNNATLFNSGVMVIEPSNCT  449

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HIDEI SYNGGDQGYLNEIFTWWHR PKH NFLKHFW GD A  K RK  L+ A
Sbjct  450  FQLLMEHIDEITSYNGGDQGYLNEIFTWWHRTPKHTNFLKHFWAGDTAKRKARKDSLYGA  509

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY VHYLG KPWLCYRDYDCNW++ +   FASDAAH  WW+VHD+++  L+ FCLL
Sbjct  510  DPPVLYVVHYLGLKPWLCYRDYDCNWDLQMFWGFASDAAHATWWKVHDALSENLQRFCLL  569

Query  722  RSKQKAQL  745
            ++K KA L
Sbjct  570  QTKTKAFL  577



>ref|XP_009414600.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   414 bits (1063),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR+AGSTRDLVILVD+SI ++HRSGL AAGWK+R IQRIRNPKAEK+AYNE+N
Sbjct  322  AIAAARSIRLAGSTRDLVILVDESISDHHRSGLTAAGWKVRVIQRIRNPKAEKNAYNEYN  381

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDK+IFIDADLLILRNIDFLFGMPEISATGNN T+FNSGVMV+EP NCT
Sbjct  382  YSKFRLWQLTEYDKVIFIDADLLILRNIDFLFGMPEISATGNNATIFNSGVMVVEPCNCT  441

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI+EI SYNGGDQGYLNEIFTWWHRIP+H+NFLKHFW GD   VK +KT+LF A
Sbjct  442  FQLLMDHINEITSYNGGDQGYLNEIFTWWHRIPRHINFLKHFWEGDTEEVKAKKTKLFKA  501

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            + P LY +HYLG KPWLC+RD+DCNWN  + + FASD AH  WWRVHDSM   L+  CLL
Sbjct  502  DTPGLYVLHYLGLKPWLCFRDFDCNWNSILYRSFASDEAHATWWRVHDSMPENLQNLCLL  561

Query  722  RSKQKAQL  745
             +  KA L
Sbjct  562  STVTKAGL  569



>emb|CDP04730.1| unnamed protein product [Coffea canephora]
Length=644

 Score =   414 bits (1065),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQS+RMAGSTRDLVILVD++I EYH+SGL+ AGWK+RTI RIRNPKAEK AYN WN
Sbjct  348  AIAAAQSVRMAGSTRDLVILVDETISEYHKSGLQMAGWKVRTILRIRNPKAEKYAYNAWN  407

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+DLLI RNIDFLF MPEISA GNNG LFNSGVMVIEPSNCT
Sbjct  408  YSKFRLWQLTDYDKIIFIDSDLLIRRNIDFLFSMPEISARGNNGVLFNSGVMVIEPSNCT  467

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI +IESYNGGDQGYLNE+FTWWHRIP H NFLK+F   +   V ++K  L AA
Sbjct  468  FQLLMDHITDIESYNGGDQGYLNEVFTWWHRIPNHFNFLKNFLSYEGEEVNEKKIRLIAA  527

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLGYKPW+C RDYDCNWNV  L EFASD AH  WW VHD+M  +L++FC L
Sbjct  528  EPPVLYVIHYLGYKPWMCSRDYDCNWNVGKLHEFASDDAHGSWWEVHDAMPEKLQDFCKL  587

Query  722  RSKQKAQL  745
            +SKQKAQL
Sbjct  588  KSKQKAQL  595



>ref|XP_009408314.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=631

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 213/248 (86%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA A+SIR+AGSTRDLV+LVD+SI   HRSGLEAAGWK+RTI+RIRNPKAEK+AYNEWN
Sbjct  332  AIAVARSIRLAGSTRDLVVLVDESISGRHRSGLEAAGWKVRTIRRIRNPKAEKNAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLL+LRNIDFLFGMPE+SATGNN T+FNSGVMVIEP N T
Sbjct  392  YSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFGMPEVSATGNNATIFNSGVMVIEPCNFT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM HID+I SYNGGDQGYLNEIFTWWHRIP+HMNFLKHFW GD   V+ +KT LFAA
Sbjct  452  FQLLMAHIDDITSYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWEGDSERVRAKKTALFAA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            E P LY +HYLG KPW+C+RD+DCNWN    + FASD AH  WW+VHDSM   L+ FCLL
Sbjct  512  ETPGLYVLHYLGVKPWMCFRDFDCNWNSVTYRSFASDEAHATWWKVHDSMPESLQSFCLL  571

Query  722  RSKQKAQL  745
             +  KA L
Sbjct  572  STLTKAGL  579



>gb|AAC34345.1| Unknown protein [Arabidopsis thaliana]
Length=1201

 Score =   426 bits (1095),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2     AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
             AIAAAQSIRM+GSTRDLVILVD++I EYH+SGL AAGWKI+  QRIRNP A  +AYNEWN
Sbjct  884   AIAAAQSIRMSGSTRDLVILVDETISEYHKSGLVAAGWKIQMFQRIRNPNAVPNAYNEWN  943

Query  182   YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
             YSKFRLWQLT+Y KIIFIDAD+LILRNIDFLF  PEISATGNN TLFNSG+MV+EPSN T
Sbjct  944   YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNST  1003

Query  362   FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
             F+LLMD+I+E+ SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GDE  +K+ KT LF A
Sbjct  1004  FQLLMDNINEVVSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDEPEIKKMKTSLFGA  1063

Query  542   EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
             +PP+LY +HYLGY KPWLC+RDYDCNWNVDI QEFASD AH  WWRVHD+M   L +FCL
Sbjct  1064  DPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCL  1123

Query  719   LRSKQKAQL  745
             LRSKQKAQL
Sbjct  1124  LRSKQKAQL  1132


 Score =   415 bits (1066),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 218/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQSIRM+GSTR+LVILVDDSI EYHRSGLE+AGWKI T QRIRNPKAE +AYN+WN
Sbjct  277  AIAVAQSIRMSGSTRNLVILVDDSISEYHRSGLESAGWKIHTFQRIRNPKAEANAYNQWN  336

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLW+LT+Y+KIIFIDAD+LILRN+DFLF  PEIS TGN+GTLFNSG+MVIEPSN T
Sbjct  337  YSKFRLWELTEYNKIIFIDADMLILRNMDFLFEYPEISTTGNDGTLFNSGLMVIEPSNST  396

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI++I SYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW GD    ++ KT LF A
Sbjct  397  FQLLMDHINDINSYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWEGDTPKHRKSKTRLFGA  456

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY +HYLGY KPW+C+RDYDCNWNV    +FASD AH  WWRVHD+M  +L+ FCL
Sbjct  457  DPPILYVLHYLGYNKPWVCFRDYDCNWNVVGYHQFASDEAHKTWWRVHDAMPKKLQRFCL  516

Query  719  LRSKQKAQL  745
            L SKQKAQL
Sbjct  517  LSSKQKAQL  525



>ref|XP_010921631.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
 ref|XP_010921632.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   411 bits (1056),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+ GST+DLVILVD++I  +HRSGLEAAGWK+RTIQRIRNPKA++DAYNEWN
Sbjct  329  AITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAAGWKVRTIQRIRNPKAKRDAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEI+AT NN TLFNSGVMVIEPSNCT
Sbjct  389  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFTMPEITATENNATLFNSGVMVIEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+ I+EIESYNGGDQGYLNEIFTWWHR+PK+MNFLK FW GD   V+ +KT+L  A
Sbjct  449  FQLLMERINEIESYNGGDQGYLNEIFTWWHRMPKYMNFLKFFWNGDR--VRAKKTQLLGA  506

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN    Q+FASD AH +WW+VHD M   L+ FCLL
Sbjct  507  EPPVLYVLHYLGLKPWLCFRDYDCNWNDAGFQQFASDEAHARWWKVHDMMPENLQRFCLL  566

Query  722  RSKQKAQL  745
             S +KA L
Sbjct  567  TSLRKAIL  574



>ref|XP_009420264.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=643

 Score =   411 bits (1056),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR+AGS RDLVILVD+++ E  R+GLEAAGWK+R I+RIRNPKA++DAYNEWN
Sbjct  331  AIAAARSIRLAGSARDLVILVDEAVSEQDRNGLEAAGWKVRVIERIRNPKAKRDAYNEWN  390

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDADLL+LRNIDFLF MPEISA GNNG+LFNSGVMVIEPSNCT
Sbjct  391  YSKFRLWQLTDYDKVIFIDADLLVLRNIDFLFAMPEISAIGNNGSLFNSGVMVIEPSNCT  450

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHID+I SYNGGDQGYLNEIFTWWHR P+H NFLKHFWVGD    K++K   F A
Sbjct  451  FQLLMDHIDDITSYNGGDQGYLNEIFTWWHRTPRHTNFLKHFWVGDSEERKKKKDGTFGA  510

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPWLC+RDYDCNWN      FASDAAH  WWRVHD++  +L+  CLL
Sbjct  511  DPPVLYVIHYLGLKPWLCFRDYDCNWNSQKFWGFASDAAHATWWRVHDTLPEDLQNLCLL  570

Query  722  RSKQKAQL  745
             +K+KA L
Sbjct  571  STKRKAYL  578



>ref|XP_010921630.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=659

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+ GST+DLVILVD++I  +HRSGLEAAGWK+RTIQRIRNPKA++DAYNEWN
Sbjct  355  AITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAAGWKVRTIQRIRNPKAKRDAYNEWN  414

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+LILRNIDFLF MPEI+AT NN TLFNSGVMVIEPSNCT
Sbjct  415  YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFTMPEITATENNATLFNSGVMVIEPSNCT  474

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+ I+EIESYNGGDQGYLNEIFTWWHR+PK+MNFLK FW GD   V+ +KT+L  A
Sbjct  475  FQLLMERINEIESYNGGDQGYLNEIFTWWHRMPKYMNFLKFFWNGDR--VRAKKTQLLGA  532

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY +HYLG KPWLC+RDYDCNWN    Q+FASD AH +WW+VHD M   L+ FCLL
Sbjct  533  EPPVLYVLHYLGLKPWLCFRDYDCNWNDAGFQQFASDEAHARWWKVHDMMPENLQRFCLL  592

Query  722  RSKQKAQL  745
             S +KA L
Sbjct  593  TSLRKAIL  600



>ref|XP_008803691.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=746

 Score =   412 bits (1060),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 219/248 (88%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIR+ GSTRDLVILVD++I  +HRSGLEAAGWK+RTIQRIRNPKA++DAYNEWN
Sbjct  458  AITAAQSIRLTGSTRDLVILVDETISNHHRSGLEAAGWKVRTIQRIRNPKAQRDAYNEWN  517

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD++ILRNIDFLF MPEI+AT NN TLFNSGVMVIEPSNCT
Sbjct  518  YSKFRLWQLTDYDKIIFIDADMIILRNIDFLFTMPEITATENNATLFNSGVMVIEPSNCT  577

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNEIFTWWHR+PKH+NFLK+FW GD+ +++ +KT+L  A
Sbjct  578  FQLLMEHINEIESYNGGDQGYLNEIFTWWHRMPKHLNFLKYFW-GDK-SMRVKKTQLIGA  635

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP++Y +HYLG KPWLC+RDYDCNWN   L  FASD AH +WW+VHD M   L+ FCLL
Sbjct  636  DPPVIYVLHYLGLKPWLCFRDYDCNWNYVGLPMFASDVAHARWWKVHDMMPENLQSFCLL  695

Query  722  RSKQKAQL  745
             S +KA L
Sbjct  696  SSMRKAVL  703



>ref|XP_009404956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR +GS RDLVILVDD+I E+ RSGLEAAGWK+RT++RIRNPKA++DAYNEWN
Sbjct  329  AIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTMERIRNPKAKRDAYNEWN  388

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDK++F+DADLL+LRNIDFLF +PEI+A GNN  LFNSGVMV+EPSNCT
Sbjct  389  YSKFRLWQLTEYDKVVFLDADLLVLRNIDFLFALPEITAVGNNAALFNSGVMVVEPSNCT  448

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHR+PK MNFLKHFW G+    +++K  L  A
Sbjct  449  FQLLMDHIDEITSYNGGDQGYLNEIFTWWHRVPKSMNFLKHFWAGNTERRREKKNRLLGA  508

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY VHYLG KPWLC+RDYDCNW++     FASDAAH+ WW+VHD++  +L+ FCLL
Sbjct  509  DPPALYVVHYLGLKPWLCFRDYDCNWDLRTYWGFASDAAHETWWKVHDTLTEKLKAFCLL  568

Query  722  RSKQKAQL  745
             +K KA L
Sbjct  569  TTKTKAYL  576



>ref|XP_009411206.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=569

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 211/248 (85%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQS+R +GS RDLVILVD++I    R GLEAAGWK+RTI+RIRNPKA++DAYNEWN
Sbjct  263  AIAAAQSLRSSGSARDLVILVDETISRRDRGGLEAAGWKLRTIERIRNPKAKRDAYNEWN  322

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK++FIDADLL+LRNIDFLF MPE+SA GNN TLFNSGVMV+EPS+CT
Sbjct  323  YSKFRLWQLTDYDKVVFIDADLLVLRNIDFLFAMPEVSAVGNNATLFNSGVMVVEPSDCT  382

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDH+DEI SYNGGDQGYLNEIFTWWHR+P++MNFLKHFWVG     K +K  L  A
Sbjct  383  FRLLMDHVDEITSYNGGDQGYLNEIFTWWHRVPRNMNFLKHFWVGYTERRKAKKNGLMGA  442

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLC+RDYDCNWN    ++FASDAAH  WWRVHD++   LR FCLL
Sbjct  443  DPPALYVLHYLGPKPWLCFRDYDCNWNPQSYRDFASDAAHATWWRVHDALPENLRGFCLL  502

Query  722  RSKQKAQL  745
             +K KA L
Sbjct  503  PTKTKAYL  510



>ref|XP_009404954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404955.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=644

 Score =   407 bits (1045),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAA+SIR +GS RDLVILVDD+I E+ RSGLEAAGWK+RT++RIRNPKA++DAYNEWN
Sbjct  332  AIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTMERIRNPKAKRDAYNEWN  391

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDK++F+DADLL+LRNIDFLF +PEI+A GNN  LFNSGVMV+EPSNCT
Sbjct  392  YSKFRLWQLTEYDKVVFLDADLLVLRNIDFLFALPEITAVGNNAALFNSGVMVVEPSNCT  451

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHIDEI SYNGGDQGYLNEIFTWWHR+PK MNFLKHFW G+    +++K  L  A
Sbjct  452  FQLLMDHIDEITSYNGGDQGYLNEIFTWWHRVPKSMNFLKHFWAGNTERRREKKNRLLGA  511

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY VHYLG KPWLC+RDYDCNW++     FASDAAH+ WW+VHD++  +L+ FCLL
Sbjct  512  DPPALYVVHYLGLKPWLCFRDYDCNWDLRTYWGFASDAAHETWWKVHDTLTEKLKAFCLL  571

Query  722  RSKQKAQL  745
             +K KA L
Sbjct  572  TTKTKAYL  579



>emb|CDY38364.1| BnaA02g18570D [Brassica napus]
Length=555

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 211/249 (85%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            A AAAQSIRM+GST DLVILVDDSI E+HR+GLE+AGWKI   QRIRNPK + + YNEWN
Sbjct  238  ATAAAQSIRMSGSTHDLVILVDDSITEHHRNGLESAGWKIHMFQRIRNPKVKPNTYNEWN  297

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LWQL++YDKIIF+DAD+LILRNI FLF  PEISA GN+GTLFNSG+MV+EPSN T
Sbjct  298  YSKFCLWQLSEYDKIIFVDADMLILRNIYFLFEFPEISAMGNDGTLFNSGLMVVEPSNVT  357

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDH+DE+ SYNGGDQGYL EIFTWWH IPKHMNFLKHFW GD+  + + KT+LF  
Sbjct  358  FKLLMDHMDEVVSYNGGDQGYLKEIFTWWHHIPKHMNFLKHFWAGDKPKINRLKTKLFGF  417

Query  542  EPPLLYAVHYLGY-KPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCL  718
            +PP+LY VHYLGY KPWLC RDYDCNWNV+   +FASD AH  WWRVHD+M   L+ FCL
Sbjct  418  DPPVLYVVHYLGYNKPWLCLRDYDCNWNVEGYHQFASDEAHKTWWRVHDAMPESLQRFCL  477

Query  719  LRSKQKAQL  745
            LRS+QKA+L
Sbjct  478  LRSEQKAKL  486



>ref|XP_010110483.1| hypothetical protein L484_003529 [Morus notabilis]
 gb|EXC26584.1| hypothetical protein L484_003529 [Morus notabilis]
Length=523

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 209/248 (84%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQSIR  GSTRDL+ILVD+SIGE+HR GLE AGWKIRTI+RIRNPKA++  YNEWN
Sbjct  236  AIAVAQSIRRTGSTRDLLILVDESIGEHHRRGLELAGWKIRTIRRIRNPKAKRGLYNEWN  295

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIF+DADLL+LRNIDFLFG PEISA+GN+  LFNSGVMVIEPSNCT
Sbjct  296  YSKFRLWQLTDYDKIIFLDADLLVLRNIDFLFGFPEISASGNHAALFNSGVMVIEPSNCT  355

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F++L+D I+EIESYNGGDQG+LNEIFTWWHRIP+ MNFLKH W  D+   ++ K  L+ +
Sbjct  356  FQMLIDQINEIESYNGGDQGFLNEIFTWWHRIPRRMNFLKHLWRIDDEREREMKNRLYRS  415

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY +HYLG KPW+C+RDYDCNWN     +FASD AH+ WW+V D M   LR FCLL
Sbjct  416  DPPILYVLHYLGRKPWVCFRDYDCNWNEKYATKFASDDAHETWWKVFDEMPERLRRFCLL  475

Query  722  RSKQKAQL  745
              KQKA+L
Sbjct  476  SEKQKARL  483



>emb|CDX92257.1| BnaA05g21500D [Brassica napus]
Length=629

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 206/248 (83%), Gaps = 27/248 (11%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIAAAQSIR +GSTRDLVI+VD++I  YHRSGLEAAGW+IRTIQRIRNPKAEKDAYNEWN
Sbjct  335  AIAAAQSIRQSGSTRDLVIVVDENISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWN  394

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDADLLILRNIDFLF MPEISATGNNGTLFNSGVMVIEP NCT
Sbjct  395  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCT  454

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLM+HI+EIESYNGGDQGYLNE+FTWWHRIPKHMNFLKHFWVGDE  VK++KTELF A
Sbjct  455  FQLLMEHINEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVKRKKTELFGA  514

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LY                           FA+D AH +WW VHD+M  EL +FC L
Sbjct  515  EPPILY---------------------------FATDIAHRRWWMVHDAMPQELHQFCYL  547

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  548  RSKQKAQL  555



>ref|XP_002992480.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
 gb|EFJ06418.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
Length=516

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 214/248 (86%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+ A+SIRM+GS RDLVILVD++I  +HR GLEAAGW++  IQRIRNPKAE ++YNEWN
Sbjct  201  AISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAGWRVIQIQRIRNPKAEPESYNEWN  260

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y K+I+IDAD+++LRN+DFLF MPEISATGN+ ++FNSGVMVIEPSNCT
Sbjct  261  YSKFRLWQLTEYHKLIYIDADIILLRNMDFLFQMPEISATGNHESMFNSGVMVIEPSNCT  320

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F +LM  I+E+ESYNGGDQGYLNE++TWWHR+PKHMNFLKHF + D   +  R  EL  +
Sbjct  321  FEMLMQQINEVESYNGGDQGYLNEVYTWWHRLPKHMNFLKHFGLNDSEELAHR-LELLGS  379

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP++YA+H+LG KPWLC+RDYDCNWN   L E+A+DAAH +WWRVHDSM+ +L+ +CLL
Sbjct  380  EPPVVYAMHFLGLKPWLCFRDYDCNWNQQKLHEYANDAAHARWWRVHDSMSKKLQGYCLL  439

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  440  RSKQKASL  447



>ref|XP_002990211.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
 gb|EFJ08771.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
Length=528

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 214/248 (86%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+ A+SIRM+GS RDLVILVD++I  +HR GLEAAGW++  IQRIRNPKAE ++YNEWN
Sbjct  213  AISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAGWRVIQIQRIRNPKAEPESYNEWN  272

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y K+I+IDAD+++LRN+DFLF MPEISATGN+ ++FNSGVMVIEPSNCT
Sbjct  273  YSKFRLWQLTEYHKLIYIDADIILLRNMDFLFQMPEISATGNHESMFNSGVMVIEPSNCT  332

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F +LM  I+E+ESYNGGDQGYLNE++TWWHR+PKHMNFLKHF + D   +  R  EL  +
Sbjct  333  FEMLMQQINEVESYNGGDQGYLNEVYTWWHRLPKHMNFLKHFGLNDSEELAHR-LELLGS  391

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP++YA+H+LG KPWLC+RDYDCNWN   L E+A+DAAH +WWRVHDSM+ +L+ +CLL
Sbjct  392  EPPVVYAMHFLGLKPWLCFRDYDCNWNQQKLHEYANDAAHARWWRVHDSMSKKLQGYCLL  451

Query  722  RSKQKAQL  745
            RSKQKA L
Sbjct  452  RSKQKASL  459



>gb|EPS60482.1| hypothetical protein M569_14321, partial [Genlisea aurea]
Length=317

 Score =   373 bits (958),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 204/248 (82%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI +AQSIRM GSTRDLV LVD+SI EYH+SGL  AGWKIR ++ I NPK+EK A   W+
Sbjct  27   AIVSAQSIRMTGSTRDLVALVDESISEYHKSGLREAGWKIRPLEPIMNPKSEKHAQYAWS  86

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFR+W+L +YDKI+FIDADLLILRNIDFLF +PE+SA GN+ +LFNSGVMVIEPS CT
Sbjct  87   YSKFRVWELIEYDKIVFIDADLLILRNIDFLFRLPEMSAAGNHASLFNSGVMVIEPSKCT  146

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMD I++I+SY+GGDQGYLNEIFTWWHRIP+ +NFL HFW+GD++  K+ KT LF A
Sbjct  147  FQLLMDRINDIDSYDGGDQGYLNEIFTWWHRIPRRVNFLTHFWIGDDSRAKEMKTYLFGA  206

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LYA+ Y+G KPW C+RDYDCNWNV+ L   ASD AH  WW+VHD M   L  +CLL
Sbjct  207  DPPVLYAIQYVGIKPWFCFRDYDCNWNVEELHTCASDVAHRTWWKVHDGMPENLHRYCLL  266

Query  722  RSKQKAQL  745
            RSK KA L
Sbjct  267  RSKYKAAL  274



>gb|EMS63875.1| Glycogenin-2 [Triticum urartu]
Length=533

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 202/248 (81%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            A+ AAQSIRMAGS RD+V LVD++I E HRS L AAGWK+RTI+RIRNP+A +DAYNEWN
Sbjct  221  AMVAAQSIRMAGSDRDMVALVDETISERHRSALAAAGWKVRTIRRIRNPRASRDAYNEWN  280

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LW LT+YD+++F+DADLL+ R ++ LF MPE+SATGN+GT+FNSGVMV+EP NCT
Sbjct  281  YSKFWLWTLTEYDRVVFLDADLLVQRPMEPLFAMPEVSATGNHGTVFNSGVMVVEPCNCT  340

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLMDHI +I+SYNGGDQGYLNE+F+WWHR+P   N++KHFW GD A     K  + AA
Sbjct  341  FRLLMDHIADIQSYNGGDQGYLNEVFSWWHRLPSRANYMKHFWEGDTAERAAAKRRVLAA  400

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP + AVH++G KPW C+RDYDCNWN   L++FASD AH +WW  HD+M P L+ FCLL
Sbjct  401  DPPAVLAVHFVGMKPWFCFRDYDCNWNAPELRQFASDEAHARWWTAHDAMPPRLQGFCLL  460

Query  722  RSKQKAQL  745
              +QKA L
Sbjct  461  DERQKALL  468



>emb|CDX96589.1| BnaA08g21320D [Brassica napus]
Length=618

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 199/248 (80%), Gaps = 26/248 (10%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRM+GSTRDLVILVDDSI E+HRSGL AAGWKI  IQRIRNPKAE +AYNEWN
Sbjct  328  AITAAQSIRMSGSTRDLVILVDDSITEHHRSGLAAAGWKIYPIQRIRNPKAEAEAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  388  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI++I SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  448  FQLLMDHINDIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDETEIKQMKTRLFGT  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY                          EFASD AH  WW+VHD+M   L++FCLL
Sbjct  508  DPPILY--------------------------EFASDVAHRTWWKVHDAMPENLQKFCLL  541

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  542  RSKQKAQL  549



>emb|CDY38807.1| BnaC08g19810D [Brassica napus]
Length=617

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 198/248 (80%), Gaps = 27/248 (11%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AAQSIRMAGSTRDLVILVDDSI E+HRSGL AAGWKI  IQRIRNPKAE DAYNEWN
Sbjct  328  AITAAQSIRMAGSTRDLVILVDDSITEHHRSGLAAAGWKIYPIQRIRNPKAEADAYNEWN  387

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+YDKIIFIDAD+LILRNIDFLF MPEISATGNN TLFNSGVMV+EPSN T
Sbjct  388  YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNNATLFNSGVMVVEPSNST  447

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F+LLMDHI++I SYNGGDQGYLNE++TWWHRIPKHMNFLKHFW GDE  +KQ KT LF  
Sbjct  448  FQLLMDHINDIVSYNGGDQGYLNEVYTWWHRIPKHMNFLKHFWEGDEPEIKQMKTRLFGT  507

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+LY                           FASD AH  WW+VHD+M   L++FCLL
Sbjct  508  DPPILY---------------------------FASDVAHRTWWKVHDAMPENLQKFCLL  540

Query  722  RSKQKAQL  745
            RSKQKAQL
Sbjct  541  RSKQKAQL  548



>ref|XP_004952800.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Setaria italica]
Length=642

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 203/248 (82%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AA+SIRMAGS RD+V LVD++IG  HR  LEAAGWK+R I+RIRNP+A +DAYNEWN
Sbjct  333  AITAARSIRMAGSGRDMVALVDETIGARHRGALEAAGWKVRAIRRIRNPRASRDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LW LT+Y+++IF+DADLL+ R ++ LFGMPE+SATGN+G+ FNSGVMV+EP  CT
Sbjct  393  YSKFWLWTLTEYERVIFLDADLLVQRPMEPLFGMPEVSATGNDGSRFNSGVMVVEPCECT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLL  H+ +IESYNGGDQGYLNE+F+WWHR+P H N++KHFW GD A  +  K  + AA
Sbjct  453  FRLLAAHVGDIESYNGGDQGYLNEVFSWWHRLPSHANYMKHFWEGDTAERRAAKRRVLAA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+  AVH++G KPW C+RDYDCNWNV  L++FASD AH +WW+VHD++ P L+ FCLL
Sbjct  513  DPPVALAVHFVGLKPWFCFRDYDCNWNVPALRQFASDEAHARWWKVHDALPPPLQGFCLL  572

Query  722  RSKQKAQL  745
              +QKA L
Sbjct  573  DERQKALL  580



>dbj|BAJ97980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 202/248 (81%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            A+ AAQSIRMAGS RD+V LVD++I E HRS LEAAGWK+R I+RIRNP+A +DAYNEWN
Sbjct  335  AMVAAQSIRMAGSDRDMVALVDETISERHRSALEAAGWKVRAIRRIRNPRASRDAYNEWN  394

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LW LT+Y++++F+DADLL+ R ++ LF MPE+SATGN+GT+FNSGVMV+EP NCT
Sbjct  395  YSKFWLWTLTEYERVVFLDADLLVQRPMEPLFAMPEVSATGNHGTVFNSGVMVVEPCNCT  454

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLL+DHI +IESYNGGDQGYLNE+F+WWHR+P   N++KHFW GD A     K  + AA
Sbjct  455  FRLLVDHIGDIESYNGGDQGYLNEVFSWWHRLPSRANYMKHFWEGDTAERAAAKRRVLAA  514

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP + AVH++G KPW C+RDYDCNWN   L++FASD AH +WW  HD+M P L+ FCLL
Sbjct  515  DPPAVLAVHFVGMKPWFCFRDYDCNWNAPELRQFASDEAHARWWSAHDAMPPRLQRFCLL  574

Query  722  RSKQKAQL  745
              +QKA L
Sbjct  575  DERQKALL  582



>gb|ABK25357.1| unknown [Picea sitchensis]
Length=611

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 203/248 (82%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQSIRM+GS +DL+ILVD  +GE  R GL AAGW++R I+RIRNP+AEK +YNEWN
Sbjct  337  AIALAQSIRMSGSMKDLIILVDKKVGEEKREGLRAAGWQVREIRRIRNPRAEKYSYNEWN  396

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+DLLILRN+DFLF +PEISATGN+  +FNSG+MVIEPSNCT
Sbjct  397  YSKFRLWQLTDYDKIIFIDSDLLILRNLDFLFDLPEISATGNSRFIFNSGMMVIEPSNCT  456

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F  L+ H  +I SYNGGDQGYLNE+FTWWHRIPK MN+LKHFW  D    +  KT LF A
Sbjct  457  FSFLLRHRRDIVSYNGGDQGYLNEVFTWWHRIPKRMNYLKHFWSNDTEEFEM-KTSLFGA  515

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPWLCYRDYDCNWNV+  + +AS+ AH +WW++HD+M  +L +FCL+
Sbjct  516  DPPELYVLHYLGIKPWLCYRDYDCNWNVENQRAYASNVAHARWWKIHDNMPRQLHKFCLV  575

Query  722  RSKQKAQL  745
             + QK  L
Sbjct  576  PTVQKEIL  583



>ref|XP_002453984.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
 gb|EES06960.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
Length=644

 Score =   370 bits (951),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 200/248 (81%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI AA+SIRMAGS RD+V LVD++I   HR  LEAAGW +RTI+RIRNP+A +DAYNEWN
Sbjct  333  AITAARSIRMAGSGRDMVALVDETISARHRGALEAAGWVVRTIRRIRNPRASRDAYNEWN  392

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LW LT+Y+++IF+DADLL+ R ++ LF MPE+SATGN+G  FNSGVMV+EP NCT
Sbjct  393  YSKFWLWTLTEYERVIFLDADLLVQRPMEPLFAMPEVSATGNHGAYFNSGVMVVEPCNCT  452

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLL DH+ +IESYNGGDQGYLNE+F WWHR+P H N++KHFW GD A     K  + AA
Sbjct  453  FRLLADHVGDIESYNGGDQGYLNEVFAWWHRLPSHANYMKHFWGGDTAERAAAKRRVLAA  512

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+  AVH++G KPW C+RDYDCNWNV  L++FASD AH +WW+VHD+M P L+ FCLL
Sbjct  513  DPPVALAVHFVGLKPWFCFRDYDCNWNVPALRQFASDEAHARWWKVHDAMPPRLQGFCLL  572

Query  722  RSKQKAQL  745
              +QKA L
Sbjct  573  DERQKALL  580



>ref|XP_008645791.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Zea mays]
 gb|AFW71791.1| hypothetical protein ZEAMMB73_625729 [Zea mays]
Length=584

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 201/248 (81%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            A+ AA+SIRMAGS RD+V LVD++I   HR+ LEAAGWK+RTI+RIRNP+A +DAYNEWN
Sbjct  274  AVTAARSIRMAGSGRDMVALVDETISARHRAALEAAGWKVRTIRRIRNPRASRDAYNEWN  333

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKF LW LT+YD++IF+DADLL+ R ++ LF MPE+SATGN+G  FNSGVMV+EP NCT
Sbjct  334  YSKFWLWTLTEYDRVIFLDADLLVQRPMEPLFAMPEVSATGNHGAYFNSGVMVVEPCNCT  393

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLL DH+ +I+SYNGGDQGYLNE+F+WWHR+P H N++KHFW GD       K  + AA
Sbjct  394  FRLLADHVGDIDSYNGGDQGYLNEVFSWWHRLPSHANYMKHFWEGDTEERAAAKRRVLAA  453

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP+  AVH++G KPW C+RDYDCNWNV  L++FASD AH +WW+VHD+M   L+ FCLL
Sbjct  454  DPPIALAVHFVGLKPWFCFRDYDCNWNVPALRQFASDEAHARWWKVHDAMPRRLQGFCLL  513

Query  722  RSKQKAQL  745
              +QKA L
Sbjct  514  DERQKALL  521



>ref|XP_002969246.1| hypothetical protein SELMODRAFT_91619, partial [Selaginella moellendorffii]
 gb|EFJ29334.1| hypothetical protein SELMODRAFT_91619, partial [Selaginella moellendorffii]
Length=501

 Score =   359 bits (921),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 198/245 (81%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+ A SIR  GSTRDLV+LVD+SI    R GLE AGWK+ TIQRIRNPKAE  +YNEWN
Sbjct  213  AISLAHSIRSTGSTRDLVLLVDESIRPDQRQGLELAGWKVFTIQRIRNPKAEPSSYNEWN  272

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT YDKII+IDAD+++LRN+DFLF +PEI+AT N+ +LFNSGVMVIEP NCT
Sbjct  273  YSKFRLWQLTQYDKIIYIDADIVLLRNLDFLFDLPEITATRNDQSLFNSGVMVIEPCNCT  332

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F  L+D+I  I+SYNGGDQGYLNEIFTWWHR+P  +NFLKHF   +     +RK +LF A
Sbjct  333  FDFLVDNIGSIDSYNGGDQGYLNEIFTWWHRLPGTVNFLKHF--DNNTVENRRKLQLFTA  390

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LYA+H+LG KPWLC+RDYDCNWN D L  FASD  H  WW++HD+M  EL++FC+L
Sbjct  391  EPPVLYAMHFLGIKPWLCFRDYDCNWNQDQLHIFASDPVHAMWWKIHDTMPAELQKFCVL  450

Query  722  RSKQK  736
            +  QK
Sbjct  451  QGTQK  455



>ref|XP_002960604.1| hypothetical protein SELMODRAFT_73856, partial [Selaginella moellendorffii]
 gb|EFJ38143.1| hypothetical protein SELMODRAFT_73856, partial [Selaginella moellendorffii]
Length=501

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 198/245 (81%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI+ A SIR  GSTRDLV+LVD+SI    R GLE AGWK+ TIQRIRNPKAE  +YNEWN
Sbjct  213  AISLAHSIRSTGSTRDLVLLVDESIRLDQRQGLELAGWKVFTIQRIRNPKAEPSSYNEWN  272

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT YDKII+IDAD+++LRN+DFLF +PEI+AT N+ +LFNSGVMVIEP NCT
Sbjct  273  YSKFRLWQLTQYDKIIYIDADIVLLRNLDFLFDLPEITATRNDQSLFNSGVMVIEPCNCT  332

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F  L+D+I  I+SYNGGDQGYLNEIFTWWHR+P  +NFLKHF   +     +RK +LF A
Sbjct  333  FEFLVDNIGSIDSYNGGDQGYLNEIFTWWHRLPGTVNFLKHF--DNNTVENRRKLQLFTA  390

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP+LYA+H+LG KPWLC+RDYDCNWN D L  FASD  H  WW++HD+M  EL++FC+L
Sbjct  391  EPPVLYAMHFLGIKPWLCFRDYDCNWNQDQLHIFASDPVHAMWWKIHDTMPAELQKFCVL  450

Query  722  RSKQK  736
            +  QK
Sbjct  451  QGTQK  455



>gb|KHN44079.1| Glycogenin-2 [Glycine soja]
Length=503

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +2

Query  152  AEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSG  331
            +EKDAYNEWNY+KFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEI+AT NNGTLFNSG
Sbjct  224  SEKDAYNEWNYNKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITATRNNGTLFNSG  283

Query  332  VMVIEPSNCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAV  511
            VMV+E SNCTF+LLMDHI+E ESYNGGDQGYLNEIFTWWHRIP+HMNFLKHFWVGDE   
Sbjct  284  VMVVELSNCTFKLLMDHINEFESYNGGDQGYLNEIFTWWHRIPRHMNFLKHFWVGDEEEK  343

Query  512  KQRKTELFAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSM  691
            KQ KT LF A+PP+LY +HYLG KPWLC+RDYDCNWN D+  EF SD AH++WW+VHD M
Sbjct  344  KQMKTLLFGADPPILYVLHYLGMKPWLCFRDYDCNWNCDVFHEFPSDVAHERWWKVHDVM  403

Query  692  APELREFCLLRSKQKAQL  745
               L++FC+L+SKQKAQL
Sbjct  404  PELLQQFCMLKSKQKAQL  421



>ref|XP_003575141.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Brachypodium distachyon]
Length=660

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 195/252 (77%), Gaps = 4/252 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGST---RDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYN  172
            AI AAQSIR + +    RD+V LVD++I   HR+ LE AGWK+RTI+RIRNP+A  DAYN
Sbjct  345  AIVAAQSIRTSSAPDVQRDMVALVDETISSRHRAALELAGWKVRTIRRIRNPRASPDAYN  404

Query  173  EWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPS  352
            EWNYSKF LW LTDY +++F+DADLL+ R +D LF MPE+SATGN+GTLFNSGVMVIEP 
Sbjct  405  EWNYSKFWLWTLTDYSRVVFLDADLLVQRAMDPLFAMPELSATGNHGTLFNSGVMVIEPC  464

Query  353  NCTFRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTEL  532
            NCTF LLM HI +I SYNGGDQGYLNE+F+WWHR+P   N++KHFW GD A  ++ K  +
Sbjct  465  NCTFSLLMSHIGDIGSYNGGDQGYLNEVFSWWHRLPSRANYMKHFWSGDSAERREAKRRV  524

Query  533  FAAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAP-ELRE  709
             AA PP+  AVH++G KPW C+RDYDCNWN   L++FASD AH +WW  HD+M P  LR 
Sbjct  525  LAARPPVALAVHFVGMKPWFCFRDYDCNWNAAELRQFASDEAHARWWEAHDAMRPTSLRR  584

Query  710  FCLLRSKQKAQL  745
            FCLL  +QKA L
Sbjct  585  FCLLDERQKALL  596



>ref|XP_001756144.1| predicted protein [Physcomitrella patens]
 gb|EDQ79010.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   352 bits (903),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 196/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  A SIR++GSTRDLV+LVD SI    R  L+AAGW++R I+RIRNP AEKD YNEWN
Sbjct  254  AIVLAHSIRLSGSTRDLVMLVDSSILPEQRRALQAAGWQVREIERIRNPYAEKDRYNEWN  313

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQ+T+YDKI+FID+DLL+LRNIDFLF +PEISATGN+   FNSGVMVIEPSNCT
Sbjct  314  YSKFRLWQITEYDKIVFIDSDLLVLRNIDFLFQLPEISATGNDQNRFNSGVMVIEPSNCT  373

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F +L+D I +  SYNGGDQGYLNEIF WWHR+PK +NFLKHFW  D   + + KT LF  
Sbjct  374  FGILLDQIMDTRSYNGGDQGYLNEIFPWWHRLPKRVNFLKHFWSNDTDEL-ETKTRLFGE  432

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LY +HYLG KPW+C+RDYDCNWN+   Q++ASD+AH  W+++HDSM   L+  C L
Sbjct  433  DPPELYVLHYLGMKPWVCFRDYDCNWNLKEQQKYASDSAHATWFKIHDSMPENLQRQCWL  492

Query  722  RSKQKA  739
            R+  KA
Sbjct  493  RTLAKA  498



>gb|KHG15663.1| Glycogenin-1 [Gossypium arboreum]
Length=582

 Score =   348 bits (893),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 199/248 (80%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+  +G+ RDL++L+DDSI E  R  LE AGW++R I+RIRNP+A+K  YNE+N
Sbjct  305  AITLAQSLLKSGTNRDLILLLDDSISEPKRHALELAGWRLRFIKRIRNPRAQKHTYNEYN  364

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDY+K+IFIDAD+++L+N+D LF  P+++ATGN+  LFNSG+M+IEPSNCT
Sbjct  365  YSKFRLWQLTDYEKVIFIDADIIVLKNLDHLFHFPQLTATGNDVWLFNSGIMIIEPSNCT  424

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F++LMD  DEI SYNGGDQGYLNE+F WWHR+P+ +NFLK+FW    A  K  K +LFAA
Sbjct  425  FKVLMDKRDEIISYNGGDQGYLNEVFVWWHRLPRRVNFLKNFWSNTTAETKM-KNQLFAA  483

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP LY++HYLG KPWLCYRDYDCNWN +    FASD AH +WW+ HD+M  +L+ FC L
Sbjct  484  EPPKLYSIHYLGLKPWLCYRDYDCNWNREDHHIFASDVAHRRWWKFHDAMDEKLQRFCGL  543

Query  722  RSKQKAQL  745
              K+KAQL
Sbjct  544  TKKRKAQL  551



>ref|XP_006828387.1| hypothetical protein AMTR_s00060p00013040 [Amborella trichopoda]
 gb|ERM95803.1| hypothetical protein AMTR_s00060p00013040 [Amborella trichopoda]
Length=601

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 196/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQS+    +TR+L+ILVD SI E  R GL  AGW++R I+RIRNP+A+K AYNE+N
Sbjct  327  AIALAQSLLATNTTRNLIILVDKSISEEKREGLRKAGWQVREIKRIRNPRAQKHAYNEYN  386

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLW+LTDYDKIIF+DAD+++L+N+D LF  P++SATGN+G++FNSGVM IEPSNCT
Sbjct  387  YSKFRLWKLTDYDKIIFVDADMVVLKNMDHLFAYPQMSATGNDGSIFNSGVMAIEPSNCT  446

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR LM    E+ SYNGGDQG+LNE+FTWWHR P+ +NFLK+FW    A V   KT+LF A
Sbjct  447  FRTLMSLRKEVVSYNGGDQGFLNEVFTWWHRWPRRVNFLKNFWSNKTAEVTV-KTQLFGA  505

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP LY +HYLG KPWLCYRDYDCNWNV+    +AS+ AH +WWRVHD+M   L+ FC+L
Sbjct  506  EPPKLYGIHYLGLKPWLCYRDYDCNWNVEDQHVYASNVAHRRWWRVHDAMEEGLQGFCVL  565

Query  722  RSKQKAQL  745
              ++K  L
Sbjct  566  TDQRKIDL  573



>ref|XP_010263572.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X2 [Nelumbo nucifera]
Length=538

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 196/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQSI   G+ RDLVIL+D SI +  R  LEAAGWKIR I+RIRNP+AEK++YNE+N
Sbjct  260  AITLAQSIIRTGTKRDLVILLDKSISQPMRDALEAAGWKIRLIKRIRNPRAEKNSYNEYN  319

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D +F  PE+SATGN+G++FNSG+M IEPS CT
Sbjct  320  YSKFRLWQLTDYDKIIFIDSDIVVLRNLDLVFHFPEMSATGNDGSIFNSGIMAIEPSKCT  379

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLM+   EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW    A     K +LF A
Sbjct  380  FRLLMEQRKEIVSYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTAEASM-KNQLFGA  438

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP +YA+H+LG KPW CYRDYDCNWN+   + +ASD AH +WW++HD+M   L+ FC L
Sbjct  439  DPPKVYAIHFLGLKPWHCYRDYDCNWNIGDQRVYASDIAHARWWKIHDAMDESLQHFCRL  498

Query  722  RSKQKAQL  745
              ++K +L
Sbjct  499  TPQRKIEL  506



>ref|XP_010263571.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X1 [Nelumbo nucifera]
Length=583

 Score =   345 bits (885),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 196/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQSI   G+ RDLVIL+D SI +  R  LEAAGWKIR I+RIRNP+AEK++YNE+N
Sbjct  305  AITLAQSIIRTGTKRDLVILLDKSISQPMRDALEAAGWKIRLIKRIRNPRAEKNSYNEYN  364

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D +F  PE+SATGN+G++FNSG+M IEPS CT
Sbjct  365  YSKFRLWQLTDYDKIIFIDSDIVVLRNLDLVFHFPEMSATGNDGSIFNSGIMAIEPSKCT  424

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FRLLM+   EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW    A     K +LF A
Sbjct  425  FRLLMEQRKEIVSYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTAEASM-KNQLFGA  483

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP +YA+H+LG KPW CYRDYDCNWN+   + +ASD AH +WW++HD+M   L+ FC L
Sbjct  484  DPPKVYAIHFLGLKPWHCYRDYDCNWNIGDQRVYASDIAHARWWKIHDAMDESLQHFCRL  543

Query  722  RSKQKAQL  745
              ++K +L
Sbjct  544  TPQRKIEL  551



>ref|XP_008444626.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X2 [Cucumis melo]
Length=520

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 196/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+   G+ R L++L+DDSI    R+ L +AGW IR I RIRNP+AEKD+YNE+N
Sbjct  244  AITLAQSLLQTGTKRHLILLMDDSISMSKRAALVSAGWNIRIITRIRNPRAEKDSYNEYN  303

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D LF  P++SA GN+ ++FNSG+MVIEPSNCT
Sbjct  304  YSKFRLWQLTDYDKIIFIDSDIIVLRNLDLLFHFPQMSAVGNDNSIFNSGIMVIEPSNCT  363

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR+ M+  DEI SYNGGDQG+LNE+F WWHR+P+  NFLK+FW  +    +  K E+F A
Sbjct  364  FRVFMERRDEIVSYNGGDQGFLNEVFVWWHRLPRRTNFLKNFW-SNTTLERSVKNEMFGA  422

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LYA+HYLG KPWLCYRDYDCNWN+D  + +ASD AH +WW++HD+M  +L+ FC L
Sbjct  423  DPPKLYAIHYLGLKPWLCYRDYDCNWNIDDQRVYASDVAHQRWWKLHDAMDEKLQSFCKL  482

Query  722  RSKQKAQL  745
              +++ +L
Sbjct  483  TERRRIEL  490



>ref|XP_002510223.1| glycogenin, putative [Ricinus communis]
 gb|EEF52410.1| glycogenin, putative [Ricinus communis]
Length=589

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 199/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQS+R +G+ RDL+IL+D SI E  R  L AAGWKIR I+RIRNP+AEKD+YNE+N
Sbjct  313  AIALAQSLRQSGTKRDLIILLDKSISESKREALAAAGWKIRLIKRIRNPRAEKDSYNEYN  372

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D LF  P++SATGN+  +FNSG+MVIEPSNCT
Sbjct  373  YSKFRLWQLTDYDKIIFIDSDIIVLRNLDILFHFPQMSATGNDIWIFNSGIMVIEPSNCT  432

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD--EAAVKQRKTELF  535
            F+ LMD   +I SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW     EA V   K ELF
Sbjct  433  FKFLMDRRKDIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTLEAGV---KNELF  489

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP +Y++HYLG KPW CYRDYDCNWN+   + +ASD AH +WW+ HD M  +L++FC
Sbjct  490  GADPPKVYSIHYLGLKPWNCYRDYDCNWNIGDQRVYASDVAHKRWWKFHDGMDEKLQKFC  549

Query  716  LLRSKQKAQL  745
             L  ++K +L
Sbjct  550  GLTKQRKIEL  559



>ref|XP_004168320.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like [Cucumis sativus]
Length=592

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+    + RDL++L+D+SI    R+ L +AGWKIR I RIRNP+AEKD+YNE+N
Sbjct  316  AITLAQSLLQTRTKRDLILLMDESISMPKRAALVSAGWKIRIITRIRNPRAEKDSYNEYN  375

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRN+D LF  P++SA GN+ ++FNSG+MVIEPSNCT
Sbjct  376  YSKFRLWQLTDYDKIIFIDADIIVLRNLDLLFHFPQMSAVGNDNSIFNSGIMVIEPSNCT  435

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR+ M+  DEI SYNGGDQG+LNE+F WWHR+P+  NFLK+FW  +    +  K E+F A
Sbjct  436  FRVFMERRDEIVSYNGGDQGFLNEVFVWWHRLPRRTNFLKNFW-SNTTLERSVKNEMFGA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LYA+HYLG KPWLCYRDYDCNWN+D  + +ASD AH +WW++HD+M  +L+ FC L
Sbjct  495  DPPKLYAIHYLGLKPWLCYRDYDCNWNIDDQRVYASDVAHQRWWKLHDAMDEKLQSFCKL  554

Query  722  RSKQKAQL  745
              +++ +L
Sbjct  555  TERRRIEL  562



>gb|KGN62510.1| hypothetical protein Csa_2G357330 [Cucumis sativus]
Length=585

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+    + RDL++L+D+SI    R+ L +AGWKIR I RIRNP+AEKD+YNE+N
Sbjct  309  AITLAQSLLQTRTKRDLILLMDESISMPKRAALVSAGWKIRIITRIRNPRAEKDSYNEYN  368

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRN+D LF  P++SA GN+ ++FNSG+MVIEPSNCT
Sbjct  369  YSKFRLWQLTDYDKIIFIDADIIVLRNLDLLFHFPQMSAVGNDNSIFNSGIMVIEPSNCT  428

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR+ M+  DEI SYNGGDQG+LNE+F WWHR+P+  NFLK+FW  +    +  K E+F A
Sbjct  429  FRVFMERRDEIVSYNGGDQGFLNEVFVWWHRLPRRTNFLKNFW-SNTTLERSVKNEMFGA  487

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LYA+HYLG KPWLCYRDYDCNWN+D  + +ASD AH +WW++HD+M  +L+ FC L
Sbjct  488  DPPKLYAIHYLGLKPWLCYRDYDCNWNIDDQRVYASDVAHQRWWKLHDAMDEKLQSFCKL  547

Query  722  RSKQKAQL  745
              +++ +L
Sbjct  548  TERRRIEL  555



>ref|XP_004150886.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like [Cucumis sativus]
Length=592

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+    + RDL++L+D+SI    R+ L +AGWKIR I RIRNP+AEKD+YNE+N
Sbjct  316  AITLAQSLLQTRTKRDLILLMDESISMPKRAALVSAGWKIRIITRIRNPRAEKDSYNEYN  375

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRN+D LF  P++SA GN+ ++FNSG+MVIEPSNCT
Sbjct  376  YSKFRLWQLTDYDKIIFIDADIIVLRNLDLLFHFPQMSAVGNDNSIFNSGIMVIEPSNCT  435

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR+ M+  DEI SYNGGDQG+LNE+F WWHR+P+  NFLK+FW  +    +  K E+F A
Sbjct  436  FRVFMERRDEIVSYNGGDQGFLNEVFVWWHRLPRRTNFLKNFW-SNTTLERSVKNEMFGA  494

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LYA+HYLG KPWLCYRDYDCNWN+D  + +ASD AH +WW++HD+M  +L+ FC L
Sbjct  495  DPPKLYAIHYLGLKPWLCYRDYDCNWNIDDQRVYASDVAHQRWWKLHDAMDEKLQSFCKL  554

Query  722  RSKQKAQL  745
              +++ +L
Sbjct  555  TERRRIEL  562



>ref|XP_006374946.1| hypothetical protein POPTR_0014s02980g [Populus trichocarpa]
 gb|ERP52743.1| hypothetical protein POPTR_0014s02980g [Populus trichocarpa]
Length=500

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
             IA AQS+   G+ RDLV+L+D+SI E  R  L AAGWKIR I+RIRNP+AEK +YNE+N
Sbjct  224  VIALAQSLLQTGTKRDLVLLLDNSISEPKRHALAAAGWKIRLIKRIRNPRAEKYSYNEYN  283

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKI+FIDAD+++LRN+D LF  P++SATGN+  +FNSG+MVIEPSNCT
Sbjct  284  YSKFRLWQLTDYDKIVFIDADIIVLRNLDILFHFPQMSATGNDVWIFNSGIMVIEPSNCT  343

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVG--DEAAVKQRKTELF  535
            F++LMD   EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW    +EA+V   K ELF
Sbjct  344  FKILMDRRKEIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTNEASV---KNELF  400

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP +Y++HYLG KPWLCYRDYDCNWN+   + +ASD AH +WW+ HD+M  +L++FC
Sbjct  401  GADPPKVYSIHYLGLKPWLCYRDYDCNWNIGDQRVYASDVAHQRWWKFHDAMDEKLQKFC  460

Query  716  LLRSKQKAQL  745
             L  ++K +L
Sbjct  461  GLTKQRKIEL  470



>ref|XP_011030050.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X2 [Populus euphratica]
Length=500

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
             IA AQS+   G+ RDLV+L+D+SI E  R  L AAGWKIR I+RIRNP+AEK +YNE+N
Sbjct  224  VIALAQSLLQTGTKRDLVLLLDNSISEPKRHALAAAGWKIRLIKRIRNPRAEKYSYNEYN  283

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKI+FIDAD+++LRN+D LF  P++SATGN+  +FNSG+MVIEPSNCT
Sbjct  284  YSKFRLWQLTDYDKIVFIDADIIVLRNLDILFHFPQMSATGNDVWIFNSGIMVIEPSNCT  343

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVG--DEAAVKQRKTELF  535
            F++LMD   EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW    +EA+V   K ELF
Sbjct  344  FKILMDRRKEIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTNEASV---KNELF  400

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP +Y++HYLG KPWLCYRDYDCNWN+   + +ASD AH +WW+ HD+M  +L++FC
Sbjct  401  GADPPKVYSIHYLGLKPWLCYRDYDCNWNIGDQRVYASDVAHQRWWKFHDAMDEKLQKFC  460

Query  716  LLRSKQKAQL  745
             L  ++K +L
Sbjct  461  GLTKRRKIEL  470



>ref|XP_008444625.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X1 [Cucumis melo]
Length=585

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 196/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+   G+ R L++L+DDSI    R+ L +AGW IR I RIRNP+AEKD+YNE+N
Sbjct  309  AITLAQSLLQTGTKRHLILLMDDSISMSKRAALVSAGWNIRIITRIRNPRAEKDSYNEYN  368

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D LF  P++SA GN+ ++FNSG+MVIEPSNCT
Sbjct  369  YSKFRLWQLTDYDKIIFIDSDIIVLRNLDLLFHFPQMSAVGNDNSIFNSGIMVIEPSNCT  428

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            FR+ M+  DEI SYNGGDQG+LNE+F WWHR+P+  NFLK+FW  +    +  K E+F A
Sbjct  429  FRVFMERRDEIVSYNGGDQGFLNEVFVWWHRLPRRTNFLKNFW-SNTTLERSVKNEMFGA  487

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP LYA+HYLG KPWLCYRDYDCNWN+D  + +ASD AH +WW++HD+M  +L+ FC L
Sbjct  488  DPPKLYAIHYLGLKPWLCYRDYDCNWNIDDQRVYASDVAHQRWWKLHDAMDEKLQSFCKL  547

Query  722  RSKQKAQL  745
              +++ +L
Sbjct  548  TERRRIEL  555



>ref|XP_008220218.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X2 [Prunus mume]
Length=530

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 198/250 (79%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  A+S+   G+ RDL++L+DDSI    R+ L AAGWK+R IQRIRNP+AE   YNE+N
Sbjct  253  AITLARSLLQTGTQRDLILLLDDSIPASKRAALSAAGWKLRFIQRIRNPRAENGTYNEYN  312

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y+K+IFIDAD+++LRN+D LF  P++SATGN+  LFNSG+MVIEPSNCT
Sbjct  313  YSKFRLWQLTEYNKVIFIDADIIVLRNLDLLFHFPQMSATGNDVYLFNSGIMVIEPSNCT  372

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD--EAAVKQRKTELF  535
            F+ LMDH ++I SYNGGDQGYLNE+F WWHR+P+ +NFLK+FW     EA+V   K ELF
Sbjct  373  FKFLMDHREDIVSYNGGDQGYLNEVFVWWHRLPRRVNFLKNFWANTTIEASV---KNELF  429

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP LYA+HYLG+KPWLCYRDYDCNW+V   + +ASD AH++WWRVHD+M   L+ FC
Sbjct  430  GADPPKLYAIHYLGWKPWLCYRDYDCNWDVADQRVYASDVAHERWWRVHDAMDGRLQRFC  489

Query  716  LLRSKQKAQL  745
             L   ++  L
Sbjct  490  GLTKVRRTYL  499



>ref|XP_011030042.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X1 [Populus euphratica]
Length=586

 Score =   343 bits (879),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
             IA AQS+   G+ RDLV+L+D+SI E  R  L AAGWKIR I+RIRNP+AEK +YNE+N
Sbjct  310  VIALAQSLLQTGTKRDLVLLLDNSISEPKRHALAAAGWKIRLIKRIRNPRAEKYSYNEYN  369

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKI+FIDAD+++LRN+D LF  P++SATGN+  +FNSG+MVIEPSNCT
Sbjct  370  YSKFRLWQLTDYDKIVFIDADIIVLRNLDILFHFPQMSATGNDVWIFNSGIMVIEPSNCT  429

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVG--DEAAVKQRKTELF  535
            F++LMD   EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW    +EA+V   K ELF
Sbjct  430  FKILMDRRKEIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTNEASV---KNELF  486

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP +Y++HYLG KPWLCYRDYDCNWN+   + +ASD AH +WW+ HD+M  +L++FC
Sbjct  487  GADPPKVYSIHYLGLKPWLCYRDYDCNWNIGDQRVYASDVAHQRWWKFHDAMDEKLQKFC  546

Query  716  LLRSKQKAQL  745
             L  ++K +L
Sbjct  547  GLTKRRKIEL  556



>emb|CAB38791.1| putative protein [Arabidopsis thaliana]
 emb|CAB80050.1| putative protein [Arabidopsis thaliana]
Length=333

 Score =   334 bits (857),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 192/248 (77%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+    + RDL++L DDSI       L AAGWK+R I RIRNP AEKD+YNE+N
Sbjct  54   AITLAQSLLQTNTKRDLILLHDDSISITKLRALAAAGWKLRRIIRIRNPLAEKDSYNEYN  113

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDK+IFIDAD+++LRN+D LF  P++SATGN+  ++NSG+MVIEPSNCT
Sbjct  114  YSKFRLWQLTDYDKVIFIDADIIVLRNLDLLFHFPQMSATGNDVWIYNSGIMVIEPSNCT  173

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F  +M    EI SYNGGDQGYLNEIF WWHR+P+ +NFLK+FW  +    +  K  LFAA
Sbjct  174  FTTIMSQRSEIVSYNGGDQGYLNEIFVWWHRLPRRVNFLKNFW-SNTTKERNIKNNLFAA  232

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            EPP +YAVHYLG+KPWLCYRDYDCN++VD    +ASDAAH +WW+VHDSM   L++FC L
Sbjct  233  EPPQVYAVHYLGWKPWLCYRDYDCNYDVDEQLVYASDAAHVRWWKVHDSMDDALQKFCRL  292

Query  722  RSKQKAQL  745
              K++ ++
Sbjct  293  TKKRRTEI  300



>ref|XP_010320335.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X2 [Solanum lycopersicum]
Length=513

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+   G+ RDL++L+D+SI E  R  L  AGWK+R I+RIRNP+AEK+ YNE+N
Sbjct  239  AITLAQSLLRTGTKRDLILLLDNSISESKRDALIKAGWKLRFIKRIRNPRAEKNTYNEYN  298

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRNID LF  P+++ATGN+ ++FNSG+MVIEPSNCT
Sbjct  299  YSKFRLWQLTDYDKIIFIDADIIVLRNIDLLFHFPQMTATGNDASIFNSGIMVIEPSNCT  358

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F++ M    EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW  +   V   K +LFAA
Sbjct  359  FKMFMKRTKEIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWSNNSNEV-SVKNQLFAA  417

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP +Y++HYLG KPW+CYRDYDCNW++   + +ASD AH+ WW++HDSM   L++FC L
Sbjct  418  DPPKVYSIHYLGLKPWVCYRDYDCNWDIGDQRVYASDIAHETWWKLHDSMDESLQKFCGL  477

Query  722  RSKQKAQL  745
              ++K +L
Sbjct  478  TEQRKIEL  485



>ref|XP_007221825.1| hypothetical protein PRUPE_ppa003165mg [Prunus persica]
 gb|EMJ23024.1| hypothetical protein PRUPE_ppa003165mg [Prunus persica]
Length=597

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 198/250 (79%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  A+S+   G+ RDL++L+DDSI    R+ L AAGWK+R IQRIRNP+AE   YNE+N
Sbjct  320  AITLARSLLQTGTKRDLILLLDDSIPASKRAALSAAGWKLRFIQRIRNPRAENGTYNEYN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y+K+IFIDAD+++LRN+D LF  P++SATGN+  LFNSG+MVIEPSNCT
Sbjct  380  YSKFRLWQLTEYNKVIFIDADIIVLRNLDLLFHFPQMSATGNDVYLFNSGIMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD--EAAVKQRKTELF  535
            F+ LMDH ++I SYNGGDQGYLNE+F WWHR+P+ +NFLK+FW     EA+V   K ELF
Sbjct  440  FKFLMDHREDIVSYNGGDQGYLNEVFVWWHRLPRRVNFLKNFWANTTIEASV---KNELF  496

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP LYA+HYLG+KPWLCYRDYDCNW+V   + +ASD AH++WWRVHD+M   L+ FC
Sbjct  497  GADPPKLYAIHYLGWKPWLCYRDYDCNWDVADQRVYASDVAHERWWRVHDAMDGRLQRFC  556

Query  716  LLRSKQKAQL  745
             L   ++  L
Sbjct  557  GLTKVRRTYL  566



>ref|XP_008220217.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 isoform X1 [Prunus mume]
Length=597

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 198/250 (79%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  A+S+   G+ RDL++L+DDSI    R+ L AAGWK+R IQRIRNP+AE   YNE+N
Sbjct  320  AITLARSLLQTGTQRDLILLLDDSIPASKRAALSAAGWKLRFIQRIRNPRAENGTYNEYN  379

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLT+Y+K+IFIDAD+++LRN+D LF  P++SATGN+  LFNSG+MVIEPSNCT
Sbjct  380  YSKFRLWQLTEYNKVIFIDADIIVLRNLDLLFHFPQMSATGNDVYLFNSGIMVIEPSNCT  439

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD--EAAVKQRKTELF  535
            F+ LMDH ++I SYNGGDQGYLNE+F WWHR+P+ +NFLK+FW     EA+V   K ELF
Sbjct  440  FKFLMDHREDIVSYNGGDQGYLNEVFVWWHRLPRRVNFLKNFWANTTIEASV---KNELF  496

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP LYA+HYLG+KPWLCYRDYDCNW+V   + +ASD AH++WWRVHD+M   L+ FC
Sbjct  497  GADPPKLYAIHYLGWKPWLCYRDYDCNWDVADQRVYASDVAHERWWRVHDAMDGRLQRFC  556

Query  716  LLRSKQKAQL  745
             L   ++  L
Sbjct  557  GLTKVRRTYL  566



>ref|XP_011074444.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X2 [Sesamum indicum]
Length=523

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 198/250 (79%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+    + RDLV+L+D SI E +R  L  AGWK+R I+RIRNP+AEK++YNE+N
Sbjct  249  AITLAQSLLQTRTRRDLVLLLDTSISEPNRDALSRAGWKLRFIKRIRNPRAEKNSYNEYN  308

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFID+D+++LRN+D LF  P++SATGN+G++FNSGVMVIEPSNCT
Sbjct  309  YSKFRLWQLTDYDKIIFIDSDIVVLRNLDVLFHFPQMSATGNDGSIFNSGVMVIEPSNCT  368

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFW--VGDEAAVKQRKTELF  535
            F +LM    EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW     EA V   K +LF
Sbjct  369  FSMLMSRRKEIVSYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWSNTSSEATV---KNQLF  425

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             ++PP LY++HYLG KPWLCYRDYDCNW++   + +ASD AH +WWRVHD+M   L++FC
Sbjct  426  GSDPPKLYSIHYLGLKPWLCYRDYDCNWDIPEQRVYASDVAHARWWRVHDTMDEGLKQFC  485

Query  716  LLRSKQKAQL  745
             L  ++K +L
Sbjct  486  GLPERRKIEL  495



>gb|KDP38342.1| hypothetical protein JCGZ_04267 [Jatropha curcas]
Length=501

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 199/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AIA AQS+R +G+ RDL++L+D SI    R  L AAGWKIR I+RIRNP+AEK +YNE+N
Sbjct  224  AIALAQSLRQSGTKRDLILLLDKSISVPKREALAAAGWKIRIIKRIRNPRAEKHSYNEYN  283

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRN+D LF  P++SATGN+  +FNSG+MVIEPSNCT
Sbjct  284  YSKFRLWQLTDYDKIIFIDADIIVLRNLDILFHFPQMSATGNDIWIFNSGIMVIEPSNCT  343

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGD--EAAVKQRKTELF  535
            F+LLMD   +I SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW     EA+V   K ELF
Sbjct  344  FKLLMDRRKDIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWANTTLEASV---KNELF  400

Query  536  AAEPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFC  715
             A+PP +Y++HYLG KPW CYRDYDCNWN+   + +ASD AH +WW+ HD M  +L++FC
Sbjct  401  GADPPKVYSIHYLGLKPWNCYRDYDCNWNIGDQRVYASDVAHKRWWKFHDGMDEKLQKFC  460

Query  716  LLRSKQKAQL  745
             L  +++ +L
Sbjct  461  GLTKQRRIEL  470



>ref|XP_004238159.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like isoform X1 [Solanum lycopersicum]
Length=576

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 197/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    AIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWKIRTIQRIRNPKAEKDAYNEWN  181
            AI  AQS+   G+ RDL++L+D+SI E  R  L  AGWK+R I+RIRNP+AEK+ YNE+N
Sbjct  302  AITLAQSLLRTGTKRDLILLLDNSISESKRDALIKAGWKLRFIKRIRNPRAEKNTYNEYN  361

Query  182  YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNGTLFNSGVMVIEPSNCT  361
            YSKFRLWQLTDYDKIIFIDAD+++LRNID LF  P+++ATGN+ ++FNSG+MVIEPSNCT
Sbjct  362  YSKFRLWQLTDYDKIIFIDADIIVLRNIDLLFHFPQMTATGNDASIFNSGIMVIEPSNCT  421

Query  362  FRLLMDHIDEIESYNGGDQGYLNEIFTWWHRIPKHMNFLKHFWVGDEAAVKQRKTELFAA  541
            F++ M    EI SYNGGDQG+LNE+F WWHR+P+ +NFLK+FW  +   V   K +LFAA
Sbjct  422  FKMFMKRTKEIISYNGGDQGFLNEVFVWWHRLPRRVNFLKNFWSNNSNEV-SVKNQLFAA  480

Query  542  EPPLLYAVHYLGYKPWLCYRDYDCNWNVDILQEFASDAAHDKWWRVHDSMAPELREFCLL  721
            +PP +Y++HYLG KPW+CYRDYDCNW++   + +ASD AH+ WW++HDSM   L++FC L
Sbjct  481  DPPKVYSIHYLGLKPWVCYRDYDCNWDIGDQRVYASDIAHETWWKLHDSMDESLQKFCGL  540

Query  722  RSKQKAQL  745
              ++K +L
Sbjct  541  TEQRKIEL  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1284566944336