BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22528_g1_i1 len=1781 path=[2085:0-684 2770:685-703 2789:704-778
2863:779-1185 3269:1186-1203 3287:1204-1272 3355:1273-1279
32:1280-1780]

Length=1781
                                                                      Score     E

ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            689   0.0      
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    686   0.0      
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            683   0.0      
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            682   0.0      
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            682   0.0      
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            679   0.0      
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 679   0.0      
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                677   0.0      
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            676   0.0      
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            674   0.0      
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               674   0.0      
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            674   0.0      
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     673   0.0      
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            672   0.0      
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    668   0.0      
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    667   0.0      
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            667   0.0      
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               666   0.0      
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            666   0.0      
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            666   0.0      
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            665   0.0      
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            662   0.0      
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    662   0.0      
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    658   0.0      
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    655   0.0      
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            646   0.0      
gb|AHG12639.1|  histidine decarboxylase                                 642   0.0      
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    640   0.0      
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            635   0.0      
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            633   0.0      
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    626   0.0      
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            613   0.0      
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            609   0.0      
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            610   0.0      
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            605   0.0      
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            603   0.0      
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    600   0.0      
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            596   0.0      
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            596   0.0      
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 591   0.0      
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            576   0.0      
ref|NP_001234136.1|  histidine decarboxylase                            572   0.0      
dbj|BAA78331.1|  serine decarboxylase                                   561   0.0      Brassica napus [oilseed rape]
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               560   0.0      
emb|CDY41717.1|  BnaA09g15450D                                          559   0.0      
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               560   0.0      
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               559   0.0      
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             559   0.0      
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               558   0.0      
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               558   0.0      
emb|CDY48944.1|  BnaA08g04700D                                          558   0.0      
emb|CDX80723.1|  BnaC08g05570D                                          558   0.0      
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    557   0.0      
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    556   0.0      
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    556   0.0      
ref|XP_002306690.1|  serine decarboxylase family protein                555   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG24953.1|  Histidine decarboxylase                                 555   0.0      
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    555   0.0      
ref|NP_175036.1|  serine decarboxylase 1                                555   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             556   0.0      
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    555   0.0      
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               554   0.0      
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    551   0.0      
emb|CDY30753.1|  BnaC05g51500D                                          551   0.0      
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               551   0.0      
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               551   0.0      
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               551   0.0      
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 551   0.0      
gb|KHG04394.1|  Histidine decarboxylase                                 550   0.0      
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            550   0.0      
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               550   0.0      
ref|XP_004290538.1|  PREDICTED: histidine decarboxylase-like            550   0.0      
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    550   0.0      
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             548   0.0      
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    546   0.0      
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    546   0.0      
gb|KHN39188.1|  Histidine decarboxylase                                 546   0.0      
emb|CDY59264.1|  BnaC09g51700D                                          545   0.0      
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    544   0.0      
ref|XP_010108654.1|  Histidine decarboxylase                            545   0.0      
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            544   0.0      
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               543   0.0      
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               543   0.0      
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             543   0.0      
ref|XP_002533017.1|  group II plp decarboxylase, putative               541   0.0      Ricinus communis
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   541   0.0      
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               541   0.0      
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    541   0.0      
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         541   0.0      
ref|XP_002302186.1|  serine decarboxylase family protein                540   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI18554.3|  unnamed protein product                                539   0.0      
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     542   0.0      
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                540   0.0      
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               540   0.0      
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    540   0.0      
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    540   0.0      Vitis vinifera
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    539   0.0      
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               539   0.0      
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    539   0.0      
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      538   0.0      
emb|CAN70523.1|  hypothetical protein VITISV_034634                     538   0.0      Vitis vinifera
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      538   0.0      
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             537   0.0      
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    538   0.0      
emb|CDP11372.1|  unnamed protein product                                534   0.0      
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             537   0.0      
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             538   0.0      
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    535   0.0      
dbj|BAE07183.1|  putative serine decarboxylase                          536   0.0      Beta vulgaris [beet]
gb|EPS66281.1|  serine decarboxylase                                    533   0.0      
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    534   0.0      
ref|XP_003593129.1|  Histidine decarboxylase                            532   0.0      
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            531   0.0      
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            532   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY86197.1|  hypothetical protein OsI_07573                          531   3e-180   Oryza sativa Indica Group [Indian rice]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             529   5e-180   
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            529   5e-180   
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    529   7e-180   
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               528   7e-180   
ref|NP_001241244.1|  uncharacterized protein LOC100795577               529   1e-179   
gb|KHN26720.1|  Histidine decarboxylase                                 529   1e-179   
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  529   1e-179   
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 529   2e-179   
gb|ACJ85197.1|  unknown                                                 529   2e-179   Medicago truncatula
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  528   2e-179   
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               526   3e-179   
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          528   5e-179   Sorghum bicolor [broomcorn]
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          527   1e-178   
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  526   2e-178   
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            526   2e-178   
ref|XP_002893962.1|  EMB1075                                            523   1e-177   
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  523   2e-177   
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            523   3e-177   
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             521   8e-177   
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               519   2e-176   
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            518   2e-175   
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               513   6e-174   
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             513   3e-173   
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             511   1e-172   
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                505   8e-172   
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                503   1e-170   
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    503   2e-170   
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                502   9e-170   
ref|XP_001761266.1|  predicted protein                                  499   2e-168   
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             498   1e-167   
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             497   2e-167   
ref|XP_001754291.1|  predicted protein                                  486   1e-163   
ref|NP_001242861.1|  uncharacterized protein LOC100792053               486   2e-163   
gb|KHN16991.1|  Histidine decarboxylase                                 482   2e-162   
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            480   2e-161   
gb|EMT14427.1|  Histidine decarboxylase                                 477   4e-159   
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            474   2e-158   
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             473   1e-157   
ref|XP_003592126.1|  Histidine decarboxylase                            470   5e-157   
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            469   1e-156   
ref|XP_003607341.1|  Embryo defective 1075-like protein                 468   5e-156   
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            465   8e-155   
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            464   2e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like            455   5e-154   
gb|EAY77466.1|  hypothetical protein OsI_32510                          462   6e-154   Oryza sativa Indica Group [Indian rice]
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             461   1e-153   
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             462   2e-153   
ref|XP_003592128.1|  Embryo defective 1075-like protein                 457   7e-152   
ref|XP_001689659.1|  serine decarboxylase                               450   2e-150   Chlamydomonas reinhardtii
gb|AES62380.2|  serine decarboxylase                                    452   3e-150   
gb|EMS65243.1|  Histidine decarboxylase                                 448   6e-150   
ref|XP_002953989.1|  serine decarboxylase                               449   2e-148   
gb|KEH43660.1|  serine decarboxylase                                    449   2e-147   
ref|XP_003592129.1|  Serine decarboxylase                               442   4e-146   
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          443   4e-146   Sorghum bicolor [broomcorn]
gb|KFM28243.1|  Histidine decarboxylase                                 442   6e-146   
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            437   5e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              434   1e-142   
gb|AFK39410.1|  unknown                                                 428   1e-142   
gb|KDD76585.1|  hypothetical protein H632_c172p0                        433   3e-142   
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            430   2e-141   
ref|XP_005646136.1|  serine decarboxylase                               424   5e-140   
ref|XP_002292250.1|  histidine decarboxylase                            416   5e-137   Thalassiosira pseudonana CCMP1335
ref|XP_002178784.1|  predicted protein                                  414   1e-136   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003592132.1|  FAR1-related protein                               438   2e-135   
gb|EEC76705.1|  hypothetical protein OsI_14710                          403   1e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_002679079.1|  predicted protein                                  399   1e-129   Naegleria gruberi strain NEG-M
gb|EYU40386.1|  hypothetical protein MIMGU_mgv1a026369mg                387   5e-127   
gb|EEE60437.1|  hypothetical protein OsJ_13648                          379   4e-123   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         400   5e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004364837.1|  serine decarboxylase                               384   1e-120   
gb|EFW43925.2|  serine decarboxylase                                    384   1e-120   
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          372   7e-119   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49846.1|  Histidine decarboxylase                                 366   5e-118   
ref|WP_012408195.1|  histidine decarboxylase                            364   1e-116   
ref|WP_015112001.1|  Histidine decarboxylase                            356   1e-113   
ref|WP_026730962.1|  histidine decarboxylase                            351   4e-112   
ref|WP_026731780.1|  histidine decarboxylase                            342   2e-108   
ref|WP_017312078.1|  histidine decarboxylase                            340   3e-107   
ref|WP_016859640.1|  histidine decarboxylase                            339   5e-107   
ref|WP_016870188.1|  histidine decarboxylase                            336   6e-106   
ref|WP_026721610.1|  histidine decarboxylase                            336   1e-105   
ref|WP_009455225.1|  histidine decarboxylase                            335   1e-105   
ref|XP_009600053.1|  PREDICTED: histidine decarboxylase-like            325   5e-104   
ref|XP_003619923.1|  L-tyrosine decarboxylase                           330   1e-103   
gb|AFA36595.1|  putative serine decarboxylase                           320   2e-101   
gb|AES76141.2|  serine decarboxylase                                    320   2e-101   
gb|EMT14424.1|  Histidine decarboxylase                                 325   6e-101   
gb|EJK75470.1|  hypothetical protein THAOC_02802                        326   1e-100   
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like            321   1e-100   
gb|KHN17002.1|  Histidine decarboxylase                                 321   1e-98    
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             311   8e-97    
dbj|BAH97114.1|  amino acid decarboxylase                               305   4e-95    Naegleria fowleri [brain-eating amoeba]
gb|KFF73912.1|  histidine decarboxylase                                 305   4e-94    
ref|WP_036288070.1|  histidine decarboxylase                            305   5e-94    
ref|WP_002682709.1|  PLP-dependent enzyme, glutamate decarboxylase      301   1e-92    
gb|AFK28253.1|  putative serine decarboxylase                           296   2e-92    
gb|AFK28260.1|  putative serine decarboxylase                           295   3e-92    
gb|AFK28264.1|  putative serine decarboxylase                           295   3e-92    
gb|AFK28270.1|  putative serine decarboxylase                           295   3e-92    
ref|WP_026815498.1|  histidine decarboxylase                            300   4e-92    
ref|WP_038170807.1|  histidine decarboxylase                            300   5e-92    
gb|AFK28277.1|  putative serine decarboxylase                           295   5e-92    
ref|WP_014680343.1|  histidine decarboxylase                            300   6e-92    
gb|AFK28273.1|  putative serine decarboxylase                           295   6e-92    
gb|AFK28267.1|  putative serine decarboxylase                           295   7e-92    
gb|AFK28256.1|  putative serine decarboxylase                           294   8e-92    
gb|AFK28281.1|  putative serine decarboxylase                           294   8e-92    
gb|AFK28271.1|  putative serine decarboxylase                           294   8e-92    
gb|AFK28262.1|  putative serine decarboxylase                           294   9e-92    
gb|AFK28287.1|  putative serine decarboxylase                           294   1e-91    
gb|AFK28254.1|  putative serine decarboxylase                           294   1e-91    
gb|AFK28291.1|  putative serine decarboxylase                           293   2e-91    
gb|AFK28279.1|  putative serine decarboxylase                           293   3e-91    
ref|WP_011533709.1|  histidine decarboxylase                            298   6e-91    
gb|AFK28272.1|  putative serine decarboxylase                           291   9e-91    
gb|AFK28257.1|  putative serine decarboxylase                           291   1e-90    
gb|AFK28269.1|  putative serine decarboxylase                           291   1e-90    
gb|AFK28261.1|  putative serine decarboxylase                           291   1e-90    
ref|WP_025665600.1|  histidine decarboxylase                            294   1e-89    
ref|WP_014680621.1|  histidine decarboxylase                            293   1e-89    
dbj|GAL64497.1|  histidine decarboxylase                                293   3e-89    
ref|WP_033002296.1|  histidine decarboxylase                            292   4e-89    
ref|WP_028889574.1|  histidine decarboxylase                            291   7e-89    
ref|WP_025146293.1|  histidine decarboxylase                            291   9e-89    
ref|WP_013663956.1|  histidine decarboxylase                            291   1e-88    
ref|XP_003593130.1|  Histidine decarboxylase                            288   1e-88    
ref|WP_034760693.1|  histidine decarboxylase                            291   1e-88    
ref|WP_034238501.1|  histidine decarboxylase                            290   2e-88    
gb|EZH75803.1|  histidine decarboxylase                                 290   2e-88    
ref|WP_036985757.1|  histidine decarboxylase                            290   2e-88    
ref|WP_038863593.1|  histidine decarboxylase                            290   3e-88    
dbj|GAL81626.1|  histidine decarboxylase                                290   4e-88    
gb|AIS17429.1|  histidine decarboxylase                                 290   8e-88    
ref|NP_001047064.2|  Os02g0541300                                       283   9e-88    Oryza sativa Japonica Group [Japonica rice]
ref|WP_039472909.1|  histidine decarboxylase                            288   1e-87    
ref|WP_018151708.1|  hypothetical protein                               286   5e-87    
ref|WP_034524496.1|  histidine decarboxylase                            286   6e-87    
ref|WP_035090976.1|  histidine decarboxylase                            286   7e-87    
gb|EQC02399.1|  histidine decarboxylase                                 286   7e-87    
ref|WP_015132658.1|  Histidine decarboxylase                            295   7e-87    
ref|WP_036146264.1|  histidine decarboxylase                            286   8e-87    
ref|WP_011899266.1|  histidine decarboxylase                            286   8e-87    
ref|WP_029274788.1|  histidine decarboxylase                            286   9e-87    
ref|WP_005319562.1|  histidine decarboxylase                            287   1e-86    
ref|WP_013661870.1|  histidine decarboxylase                            286   1e-86    
ref|WP_034281999.1|  histidine decarboxylase                            286   1e-86    
ref|XP_008620940.1|  histidine decarboxylase                            287   2e-86    
emb|CAN84646.1|  histidine decarboxylase                                285   2e-86    Aeromonas salmonicida subsp. salmonicida
gb|AIS56626.1|  histidine decarboxylase                                 285   2e-86    
gb|AIW21915.1|  histidine decarboxylase                                 285   3e-86    
ref|WP_034646581.1|  histidine decarboxylase                            285   4e-86    
gb|AFK28252.1|  putative serine decarboxylase                           279   5e-86    
ref|WP_006960325.1|  MULTISPECIES: histidine decarboxylase              284   5e-86    
ref|WP_013621330.1|  histidine decarboxylase                            284   7e-86    
ref|WP_019275400.1|  histidine decarboxylase                            284   7e-86    
ref|WP_038505799.1|  histidine decarboxylase                            283   1e-85    
ref|WP_026632650.1|  histidine decarboxylase                            283   1e-85    
ref|WP_023062889.1|  histidine decarboxylase                            284   1e-85    
ref|WP_003516909.1|  histidine decarboxylase                            284   1e-85    
ref|WP_026362388.1|  histidine decarboxylase                            282   2e-85    
ref|WP_003514849.1|  histidine decarboxylase                            283   2e-85    
ref|WP_020457998.1|  histidine decarboxylase                            283   2e-85    
ref|WP_019817102.1|  histidine decarboxylase                            283   3e-85    
ref|WP_034119545.1|  histidine decarboxylase                            281   5e-85    
ref|WP_038239506.1|  histidine decarboxylase                            281   7e-85    
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              282   9e-85    
ref|WP_020302734.1|  histidine decarboxylase                            281   1e-84    
ref|WP_011142216.1|  histidine decarboxylase                            281   1e-84    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         281   1e-84    
ref|WP_005788362.1|  histidine decarboxylase                            281   3e-84    
ref|WP_027411177.1|  histidine decarboxylase                            279   5e-84    
ref|WP_007138876.1|  histidine decarboxylase                            279   7e-84    
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              278   1e-83    
ref|WP_017497877.1|  histidine decarboxylase                            278   2e-83    
ref|WP_025821204.1|  histidine decarboxylase                            277   2e-83    
ref|WP_025152530.1|  histidine decarboxylase                            277   3e-83    
ref|WP_028892147.1|  histidine decarboxylase                            277   3e-83    
ref|WP_002058887.1|  histidine decarboxylase                            277   3e-83    
gb|EIQ69282.1|  histidine decarboxylase                                 277   4e-83    
ref|WP_024474395.1|  histidine decarboxylase                            276   5e-83    
ref|WP_004737502.1|  histidine decarboxylase                            276   5e-83    
ref|WP_010913856.1|  histidine decarboxylase                            276   5e-83    
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    276   6e-83    
ref|WP_014201338.1|  histidine decarboxylase                            276   6e-83    
ref|WP_009841733.1|  histidine decarboxylase                            276   7e-83    
gb|KGR35339.1|  histidine decarboxylase                                 276   7e-83    
emb|CDG20727.1|  Histidine decarboxylase                                276   8e-83    
gb|AHV37347.1|  histidine decarboxylase                                 276   8e-83    
gb|AAA25071.1|  histidine decarboxylase                                 276   9e-83    
ref|WP_010864579.1|  histidine decarboxylase                            276   9e-83    
ref|WP_017779468.1|  histidine decarboxylase                            276   9e-83    
ref|WP_013332582.1|  histidine decarboxylase                            276   9e-83    
ref|WP_010635694.1|  histidine decarboxylase                            276   9e-83    
ref|WP_012166190.1|  histidine decarboxylase                            281   1e-82    
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              275   1e-82    
ref|WP_005427952.1|  histidine decarboxylase                            275   1e-82    
ref|WP_039116802.1|  histidine decarboxylase                            275   2e-82    
ref|WP_031964057.1|  histidine decarboxylase                            275   2e-82    
ref|WP_039045861.1|  histidine decarboxylase                            275   2e-82    
ref|WP_038890337.1|  histidine decarboxylase                            275   2e-82    
ref|WP_022551512.1|  Histidine decarboxylase                            275   3e-82    
ref|WP_032043772.1|  histidine decarboxylase                            274   4e-82    
ref|WP_032063040.1|  histidine decarboxylase                            274   4e-82    
ref|WP_005196164.1|  histidine decarboxylase                            274   4e-82    
ref|WP_010473064.1|  histidine decarboxylase                            279   5e-82    
ref|WP_012127831.1|  histidine decarboxylase                            274   5e-82    
ref|WP_032058148.1|  histidine decarboxylase                            274   5e-82    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              274   5e-82    
ref|WP_038258978.1|  histidine decarboxylase                            274   5e-82    
ref|WP_000603861.1|  histidine decarboxylase                            274   6e-82    
ref|WP_015192440.1|  Histidine decarboxylase                            279   6e-82    
ref|WP_019504461.1|  hypothetical protein                               279   7e-82    
ref|WP_017787016.1|  histidine decarboxylase                            274   7e-82    
ref|WP_005128217.1|  histidine decarboxylase                            273   7e-82    
ref|WP_002710662.1|  Pyridoxal-dependent decarboxylase                  273   7e-82    
ref|WP_032035746.1|  histidine decarboxylase                            273   8e-82    
ref|WP_024942642.1|  histidine decarboxylase                            273   9e-82    
ref|WP_017784253.1|  histidine decarboxylase                            274   9e-82    
gb|KGY51676.1|  histidine decarboxylase                                 274   1e-81    
ref|WP_002126558.1|  histidine decarboxylase                            273   1e-81    
ref|WP_005533429.1|  histidine decarboxylase                            273   1e-81    
ref|WP_019840896.1|  histidine decarboxylase                            273   1e-81    
ref|WP_022589616.1|  Histidine decarboxylase                            273   1e-81    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              273   2e-81    
ref|WP_024436628.1|  histidine decarboxylase                            273   2e-81    
ref|WP_000603866.1|  histidine decarboxylase                            273   2e-81    
ref|WP_036788792.1|  histidine decarboxylase                            272   2e-81    
ref|WP_037437993.1|  histidine decarboxylase                            272   2e-81    
ref|WP_005306879.1|  MULTISPECIES: histidine decarboxylase              273   2e-81    
ref|WP_032874071.1|  histidine decarboxylase                            272   2e-81    
ref|WP_017764935.1|  histidine decarboxylase                            273   2e-81    
ref|WP_031976591.1|  histidine decarboxylase                            272   2e-81    
ref|WP_017781294.1|  histidine decarboxylase                            273   2e-81    
ref|WP_017725496.1|  histidine decarboxylase                            272   2e-81    
ref|WP_004401828.1|  histidine decarboxylase                            272   2e-81    
ref|WP_000603877.1|  histidine decarboxylase                            272   2e-81    
ref|WP_010647516.1|  histidine decarboxylase                            272   2e-81    
ref|WP_016529303.1|  histidine decarboxylase                            272   2e-81    
ref|WP_005138337.1|  histidine decarboxylase                            272   2e-81    
ref|WP_032060642.1|  histidine decarboxylase                            272   3e-81    
ref|WP_009507303.1|  histidine decarboxylase                            272   3e-81    
ref|WP_020977926.1|  histidine decarboxylase                            272   3e-81    
ref|WP_022610851.1|  Histidine decarboxylase                            272   3e-81    
ref|WP_004840538.1|  histidine decarboxylase                            272   3e-81    
ref|WP_017815795.1|  histidine decarboxylase                            272   3e-81    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              272   3e-81    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              272   3e-81    
ref|WP_032866759.1|  histidine decarboxylase                            271   4e-81    
ref|WP_000603876.1|  histidine decarboxylase                            271   4e-81    
ref|WP_032027924.1|  histidine decarboxylase                            271   4e-81    
ref|WP_038528108.1|  histidine decarboxylase                            271   4e-81    
ref|WP_038006112.1|  histidine decarboxylase                            271   4e-81    
ref|WP_031955420.1|  histidine decarboxylase                            271   4e-81    
ref|WP_005073362.1|  histidine decarboxylase                            271   4e-81    
ref|WP_039759067.1|  histidine decarboxylase                            271   4e-81    
ref|WP_032009129.1|  histidine decarboxylase                            271   5e-81    
ref|WP_023896388.1|  Histidine decarboxylase                            271   5e-81    
ref|WP_031965236.1|  histidine decarboxylase                            271   5e-81    
ref|WP_011154645.1|  histidine decarboxylase                            272   5e-81    
ref|WP_021511013.1|  histidine decarboxylase                            271   5e-81    
ref|WP_002046800.1|  histidine decarboxylase                            271   6e-81    
ref|WP_000603865.1|  histidine decarboxylase                            271   6e-81    
ref|WP_000603871.1|  histidine decarboxylase                            271   6e-81    
ref|WP_004746555.1|  histidine decarboxylase                            271   6e-81    
ref|WP_031948968.1|  histidine decarboxylase                            271   6e-81    
ref|WP_038267770.1|  histidine decarboxylase                            271   7e-81    
ref|WP_013995757.1|  histidine decarboxylase                            270   8e-81    
ref|WP_031995260.1|  histidine decarboxylase                            271   8e-81    
ref|WP_004639823.1|  histidine decarboxylase                            271   8e-81    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    271   9e-81    
ref|WP_032017576.1|  histidine decarboxylase                            271   9e-81    
ref|WP_031978061.1|  histidine decarboxylase                            271   9e-81    
ref|WP_032058746.1|  histidine decarboxylase                            271   1e-80    
ref|WP_032045777.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603875.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603862.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603867.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603863.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603869.1|  histidine decarboxylase                            270   1e-80    
ref|WP_000603873.1|  histidine decarboxylase                            270   1e-80    
ref|WP_024439211.1|  histidine decarboxylase                            270   1e-80    
ref|WP_039098800.1|  histidine decarboxylase                            270   1e-80    
ref|WP_032004531.1|  histidine decarboxylase                            270   1e-80    
ref|WP_026037108.1|  histidine decarboxylase                            270   2e-80    
ref|WP_000603872.1|  histidine decarboxylase                            270   2e-80    
ref|WP_031993225.1|  histidine decarboxylase                            270   2e-80    
gb|KGF60681.1|  histidine decarboxylase                                 270   2e-80    
ref|WP_000603878.1|  histidine decarboxylase                            270   2e-80    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              270   2e-80    
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...    270   2e-80    
ref|WP_010521317.1|  histidine decarboxylase                            270   2e-80    
ref|WP_032037888.1|  histidine decarboxylase                            270   2e-80    
ref|WP_024433575.1|  histidine decarboxylase                            270   2e-80    
ref|WP_030424673.1|  histidine decarboxylase                            270   3e-80    
ref|WP_000603864.1|  histidine decarboxylase                            270   3e-80    
ref|WP_033851982.1|  histidine decarboxylase                            269   3e-80    
ref|WP_012069347.1|  histidine decarboxylase                            269   3e-80    
gb|AII01327.1|  histidine decarboxylase                                 269   3e-80    
ref|WP_000603868.1|  MULTISPECIES: histidine decarboxylase              269   3e-80    
ref|WP_000603870.1|  histidine decarboxylase                            269   3e-80    
dbj|BAE94284.1|  histidine decarboxylase                                269   3e-80    
ref|WP_032068226.1|  histidine decarboxylase                            269   4e-80    
ref|WP_032055342.1|  histidine decarboxylase                            269   4e-80    
ref|WP_033847713.1|  histidine decarboxylase                            268   6e-80    
ref|WP_000603874.1|  histidine decarboxylase                            268   6e-80    
ref|WP_005301029.1|  histidine decarboxylase                            268   7e-80    
ref|WP_000603881.1|  histidine decarboxylase                            268   7e-80    
ref|WP_000603885.1|  histidine decarboxylase                            268   8e-80    
ref|WP_000603880.1|  histidine decarboxylase                            268   8e-80    
ref|WP_017055794.1|  histidine decarboxylase                            268   8e-80    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            268   9e-80    
ref|WP_002069908.1|  histidine decarboxylase                            268   1e-79    
ref|WP_002132193.1|  histidine decarboxylase                            267   2e-79    
ref|WP_000603882.1|  histidine decarboxylase                            267   2e-79    
dbj|BAE94285.1|  histidine decarboxylase                                267   2e-79    
ref|WP_031380129.1|  histidine decarboxylase                            267   2e-79    
ref|WP_000603884.1|  histidine decarboxylase                            267   2e-79    
ref|WP_005109677.1|  histidine decarboxylase                            267   3e-79    
ref|WP_031961008.1|  histidine decarboxylase                            266   3e-79    
ref|WP_016653750.1|  histidine decarboxylase                            266   4e-79    
ref|WP_024740708.1|  histidine decarboxylase                            266   5e-79    
ref|WP_005123263.1|  histidine decarboxylase                            266   5e-79    
ref|WP_000603883.1|  histidine decarboxylase                            266   6e-79    
ref|WP_000927250.1|  histidine decarboxylase                            266   6e-79    
ref|WP_032000503.1|  histidine decarboxylase                            266   6e-79    
ref|WP_004863422.1|  histidine decarboxylase                            266   7e-79    
ref|WP_000603879.1|  histidine decarboxylase                            266   8e-79    
ref|WP_032001354.1|  histidine decarboxylase                            265   1e-78    
ref|XP_003607343.1|  Aromatic amino acid decarboxylase 1B               261   4e-78    
gb|AES89540.2|  serine decarboxylase                                    261   5e-78    
ref|WP_015369839.1|  histidine decarboxylase                            263   7e-78    
ref|WP_038349211.1|  histidine decarboxylase                            263   1e-77    
ref|WP_004156018.1|  histidine decarboxylase                            262   2e-77    
ref|WP_033003777.1|  histidine decarboxylase                            261   2e-77    
ref|WP_010181748.1|  histidine decarboxylase                            261   2e-77    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                  261   3e-77    
dbj|GAJ47127.1|  histidine decarboxylase                                258   6e-77    
ref|WP_036558522.1|  histidine decarboxylase                            259   1e-76    
gb|KCY40668.1|  histidine decarboxylase                                 255   1e-75    
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  256   1e-75    
ref|WP_014207282.1|  histidine decarboxylase                            251   1e-73    
gb|AGT16577.1|  histidine decarboxylase-like protein                    251   2e-73    
ref|WP_005692801.1|  histidine decarboxylase                            250   4e-73    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase              250   5e-73    
ref|WP_023248740.1|  histidine decarboxylase                            249   1e-72    
ref|WP_001750840.1|  histidine decarboxylase                            249   2e-72    
dbj|GAE88421.1|  pyridoxal-dependent decarboxylase [ [                  248   2e-72    
ref|WP_023221881.1|  histidine decarboxylase                            248   4e-72    
ref|WP_011859800.1|  histidine decarboxylase                            243   3e-71    
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  243   2e-69    
ref|WP_035278364.1|  hypothetical protein                               239   3e-69    
gb|EWC64176.1|  Siderophore biosynthesis L-2,4-diaminobutyrate de...    240   4e-69    
ref|WP_026948110.1|  hypothetical protein                               238   4e-68    
ref|WP_029661164.1|  hypothetical protein                               234   1e-67    
gb|ERE46826.1|  hypothetical protein N036_34105                         229   4e-66    
gb|EXE40895.1|  histidine decarboxylase                                 228   5e-66    
gb|AGE54711.1|  histidine decarboxylase                                 229   2e-65    
gb|AGE52662.1|  histidine decarboxylase                                 229   3e-65    
gb|AGE51647.1|  histidine decarboxylase                                 228   6e-65    
dbj|BAC20384.1|  histidine decarboxylase                                223   1e-64    
gb|ACM40364.1|  histidine decarboxylase                                 223   1e-64    
ref|NP_048954.1|  hypothetical protein                                  227   2e-64    
dbj|BAC20380.1|  histidine decarboxylase                                222   2e-64    
gb|AGE48530.1|  histidine decarboxylase                                 226   2e-64    
gb|ACM40363.1|  histidine decarboxylase                                 222   2e-64    
gb|ACM40367.1|  histidine decarboxylase                                 222   3e-64    
dbj|BAC20387.1|  histidine decarboxylase                                221   5e-64    
dbj|BAC20385.1|  histidine decarboxylase                                221   6e-64    
gb|ACM40359.1|  histidine decarboxylase                                 221   6e-64    
gb|ACM40358.1|  histidine decarboxylase                                 221   8e-64    
gb|ACM40365.1|  histidine decarboxylase                                 221   9e-64    
gb|ACM40361.1|  histidine decarboxylase                                 220   1e-63    
gb|ACM40366.1|  histidine decarboxylase                                 220   2e-63    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  224   2e-63    
gb|ACM40360.1|  histidine decarboxylase                                 219   2e-63    
ref|YP_001497992.1|  hypothetical protein NY2A_B796L                    223   7e-63    
dbj|BAC20381.1|  histidine decarboxylase                                218   1e-62    
ref|WP_030518864.1|  hypothetical protein                               222   1e-62    
dbj|BAC20383.1|  histidine decarboxylase                                218   1e-62    
dbj|BAC20388.1|  histidine decarboxylase                                218   2e-62    
gb|AGE58518.1|  histidine decarboxylase                                 221   3e-62    
gb|AGE57683.1|  histidine decarboxylase                                 220   4e-62    
gb|KDS84442.1|  hypothetical protein SFRA_29810                         221   4e-62    
gb|AGE55081.1|  histidine decarboxylase                                 220   1e-61    



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/466 (69%), Positives = 391/466 (84%), Gaps = 9/466 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA-RKNMHITVAE  1442
             MG+L+F+++F P  V  P  L P     G   NGDF E K++K+A P A RKN++ITV E
Sbjct  1     MGSLSFEKEFEPSAVT-PRGLAP----PGLIGNGDFGEMKRLKVATPTAPRKNLNITVTE  55

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             P S++D   L C L  ++DT+SQRINYHIGYPVNI Y+HYA+LAPL+++HLNNCGDPF++
Sbjct  56    PGSRNDGQSLDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPFLQ  115

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P GILYAS
Sbjct  116   NTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILYAS  175

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             K+SHYSV KAA MYRM+ E +NT ++GEMDY DL+ KLL NKGKPAIINVTIGTTFKG +
Sbjct  176   KDSHYSVAKAAMMYRMDFEMVNTSVHGEMDYSDLKVKLLQNKGKPAIINVTIGTTFKGAV  235

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LDVI++TL++CGY+ D+FYIHCDAAL+GLI+PF+KN+  ISFKKPIGSVTISGHKFLG
Sbjct  236   DDLDVILQTLKDCGYTYDQFYIHCDAALNGLIIPFIKNM--ISFKKPIGSVTISGHKFLG  293

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCGIQ+TRKS I+N+SR VEYIASVDATISGSRNGL PIFLWYSLS KG+ GLQKD 
Sbjct  294   CPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQVGLQKDV  353

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMPG
Sbjct  354   KRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPG  413

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +  E +D+F NDL+Q+R  WY++G   PPC+ +D+G+ NC C  HK
Sbjct  414   ITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/466 (68%), Positives = 392/466 (84%), Gaps = 9/466 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA-RKNMHITVAE  1442
             MG+L+F++DF P  V  P  L P     G   NGDF E K++K+A P A RKN+++ V E
Sbjct  1     MGSLSFEKDFEPSAVT-PRGLAP----PGLIANGDFGEMKRLKVATPTAPRKNLNVAVTE  55

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             P S+++   L C L  ++DT+SQRINYHIGYPVNI Y+HYA+LAPL+++HLNNCGDPF++
Sbjct  56    PGSRNNGPSLDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPFLQ  115

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P GILYAS
Sbjct  116   NTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILYAS  175

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             K+SHYSV KAA MYRM+ E +NT ++GEMDY DL++KLL NKGKPAIINVTIGTTFKG +
Sbjct  176   KDSHYSVAKAAMMYRMDFEMVNTSVHGEMDYSDLKAKLLQNKGKPAIINVTIGTTFKGAV  235

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD+I++TL++CGY+ D+FYIHCDAAL+GLI+PF+KN+  ISFKKPIGSVTISGHKFLG
Sbjct  236   DDLDIILQTLKDCGYTYDQFYIHCDAALNGLIIPFIKNM--ISFKKPIGSVTISGHKFLG  293

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCGIQ+TRKS I+N+SR VEYIASVDATISGSRNGL PIFLWYSLS+KG+ GLQKD 
Sbjct  294   CPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLSSKGQIGLQKDV  353

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             +RC++ A +L+DRLQ AG+S M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMPG
Sbjct  354   KRCLDNAKYLKDRLQQAGVSVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPG  413

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +  E +D+F NDL+Q+R  WY++G   PPC+ +D+G+ NC C  HK
Sbjct  414   ITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/467 (68%), Positives = 386/467 (83%), Gaps = 11/467 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITVA  1445
             MG+L+F++DF P  V  P  L P     G   NGDF E  ++K+++ P   RKN++++V 
Sbjct  1     MGSLSFEKDFEPSAVT-PRGLAP----PGLIVNGDFSEMMRLKVSSTPTTPRKNLNLSVT  55

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             EP  K+D   L CTL  ++DT++QRINYHIGYPVNI Y+HYA LAPL+++HLNNCGDPF+
Sbjct  56    EP-GKNDGPSLDCTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFHLNNCGDPFL  114

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             +NTVDFHSKDFEV VL+WFA+LWEIE+D+YWGY+TNGGTEGNLHGIL+GRE+ P GILYA
Sbjct  115   QNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGREIFPTGILYA  174

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             SK+SHYSV KAA MYRM+ E IN  INGEMDY DL++KLL NKGKPAIINVTIGTTFKG 
Sbjct  175   SKDSHYSVAKAAMMYRMDFENINASINGEMDYSDLKAKLLQNKGKPAIINVTIGTTFKGA  234

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D+LDVI++TLEECGY+QD+FYIHCDAAL+GLI+PF+KN+  I+FKKPIGSVTISGHKFL
Sbjct  235   VDDLDVILQTLEECGYTQDQFYIHCDAALNGLIIPFIKNM--ITFKKPIGSVTISGHKFL  292

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCPMPCG+Q+TRKS I+N+SR VEYIASVDATISGSRNGLTPIFLWYSLS KG+ G QKD
Sbjct  293   GCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKD  352

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              +RC + A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMP
Sbjct  353   VKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMP  412

Query  364   GVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             G+  E +D F  DL+Q+R  WY++G   PPC+  D+G+ NC C  HK
Sbjct  413   GITRETLDGFITDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/466 (68%), Positives = 388/466 (83%), Gaps = 14/466 (3%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA-RKNMHITVAE  1442
             MG+L+F++DF P  V  P  L+          NGDF E K++K+A P   RKN+++ V E
Sbjct  1     MGSLSFEKDFEP-SVVTPRGLIA---------NGDFGEMKRLKVATPTTPRKNLNVAVTE  50

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             P S++D   L C L  ++DT+SQRINYHIGYPVNI Y+HYA+LAPL+++HLNNCGDPF++
Sbjct  51    PGSRNDGPSLDCILMNYIDTLSQRINYHIGYPVNIFYEHYASLAPLLQFHLNNCGDPFLQ  110

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P GILYAS
Sbjct  111   NTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILYAS  170

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             K+SHYSV KAA MYRM+ E INT ++GEMDY DL++KLL NKGKPAIINVTIGTTFKG +
Sbjct  171   KDSHYSVAKAAMMYRMDFEMINTSVHGEMDYSDLKAKLLQNKGKPAIINVTIGTTFKGAV  230

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD+I++TL++CGY+ D+FYIHCDAAL+GLI+PF+KN+  ISFKKPIGSVTISGHKFLG
Sbjct  231   DDLDIILQTLKDCGYTYDQFYIHCDAALNGLIIPFIKNM--ISFKKPIGSVTISGHKFLG  288

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCGIQ+TRKS I+N+SR VEYIASVDATISGSRNGL PIFLWYSLS KG+ GLQKD 
Sbjct  289   CPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQIGLQKDV  348

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMPG
Sbjct  349   KRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPG  408

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +  + +D+F NDL+Q+R  WY++G   PPC+  D+G+ NC C  HK
Sbjct  409   ITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/466 (68%), Positives = 388/466 (83%), Gaps = 14/466 (3%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA-RKNMHITVAE  1442
             MG+L+F++DF P  V  P  L+          NGDF E K++K+A P   RKN+++ V E
Sbjct  1     MGSLSFEKDFEP-SVVTPRGLI---------ANGDFGEMKRLKVATPTTPRKNLNVAVTE  50

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             P S++D   L C L  ++DT+SQRINYHIGYPVNI Y+HYA+LAPL+++HLNNCGDPF++
Sbjct  51    PGSRNDGPSLDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPFLQ  110

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P GILYAS
Sbjct  111   NTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILYAS  170

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             K+SHYSV KAA MYRM+ E INT ++GEMDY DL++KLL NKGKPAIINVTIGTTFKG +
Sbjct  171   KDSHYSVAKAAMMYRMDFEMINTSVHGEMDYSDLKAKLLQNKGKPAIINVTIGTTFKGAV  230

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD+I++TL++CGY+ D+FYIHCDAAL+GLI+PF+KN+  ISFKKPIGSVTISGHKFLG
Sbjct  231   DDLDIILQTLKDCGYTYDQFYIHCDAALNGLIIPFIKNM--ISFKKPIGSVTISGHKFLG  288

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCGIQ+TRKS I+N+SR VEYIASVDATISGSRNGL PIFLWYSLS KG+ GLQKD 
Sbjct  289   CPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQIGLQKDV  348

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMPG
Sbjct  349   KRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPG  408

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +  + +D+F NDL+Q+R  WY++G   PPC+  D+G+ NC C  HK
Sbjct  409   ITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 388/467 (83%), Gaps = 11/467 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITVA  1445
             MG+L+F++DF P  V  P  L+P     G   NGDF E  ++KI++ P   RKN++++V 
Sbjct  1     MGSLSFEKDFEP-SVITPRGLVP----PGLIVNGDFGEMMRLKISSTPTTPRKNLNLSVT  55

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             EP  K+D   L CTL  ++DT++QRINYHIGYPVNI Y+HYA LAPL+++HLNNCGDPF+
Sbjct  56    EP-GKNDGPSLDCTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFHLNNCGDPFL  114

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             +NTVDFHSKDFEV VL+WFA+LWEIE+D+YWGY+TNGGTEGNLHGIL+GRE+ P+GILYA
Sbjct  115   QNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRELFPDGILYA  174

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             SK+SHYSV KAA MYRM+ E IN  INGEMDY DL++KLL NKGKPAIINVTIG+TFKG 
Sbjct  175   SKDSHYSVAKAAMMYRMDFENINASINGEMDYSDLKAKLLQNKGKPAIINVTIGSTFKGA  234

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D+LDVI++TLE+CGY+QD+FYIHCDAAL+GLI+PF+KN+  I+FKKPIGSVTISGHKFL
Sbjct  235   IDDLDVILQTLEDCGYTQDQFYIHCDAALNGLIIPFIKNM--ITFKKPIGSVTISGHKFL  292

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCPMPCG+Q+TRKS I+N+SR VEYIASVDATISGSRNGLTPIFLWYSLS KG+ G QKD
Sbjct  293   GCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKD  352

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMP
Sbjct  353   VKRCLDNAIYLKDRLQKAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMP  412

Query  364   GVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             G+  E +D F  DL+Q+R  WY++G    PC+  D+G+ NC C  HK
Sbjct  413   GITRETLDGFITDLLQQRKKWYQDGRISAPCVASDIGAQNCACSYHK  459



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/467 (68%), Positives = 385/467 (82%), Gaps = 11/467 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITVA  1445
             MG+L+F++DF P  V  P  L P     G   NGDF E  ++K+++ P   RKN++++V 
Sbjct  1     MGSLSFEKDFEPSAVT-PRGLAP----PGLIVNGDFSEMMRLKVSSTPTTPRKNLNLSVT  55

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             EP  K+D   L CTL  ++DT++QRINYHIGYPVNI Y+HYA LAPL+++HLNNCGDPF+
Sbjct  56    EP-GKNDGPTLDCTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFHLNNCGDPFL  114

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             +NTVDFHSKDFEV VL+WFA+LWEIE+D+YWGY+TNGGTEGNLHGIL+GRE+ P GILYA
Sbjct  115   QNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRELFPTGILYA  174

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             SK+SHYSV KAA MYRM+ E IN  INGE+DY DL+ KLL NKGKPAIINVTIGTTFKG 
Sbjct  175   SKDSHYSVAKAAMMYRMDFENINASINGEIDYSDLKVKLLQNKGKPAIINVTIGTTFKGA  234

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D+LDVI++ LEECGY+QD+FYIHCDAAL+GLI+PF+KN+  I+FKKPIGSVTISGHKFL
Sbjct  235   VDDLDVILQILEECGYTQDQFYIHCDAALNGLIIPFIKNM--ITFKKPIGSVTISGHKFL  292

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCPMPCG+Q+TRKS I+N+SR VEYIASVDATISGSRNGLTPIFLWYSLS KG+ G QKD
Sbjct  293   GCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKD  352

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              +RC + A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMP
Sbjct  353   VKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMP  412

Query  364   GVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             G+  E +D F NDL+Q+R  WY++G   PPC+  D+G+ NC C  HK
Sbjct  413   GITRETLDGFINDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/467 (67%), Positives = 387/467 (83%), Gaps = 11/467 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITVA  1445
             MG+L+F++DF P  +  P  L P     G   NGDF E  ++K+++ P   RKN++++V 
Sbjct  1     MGSLSFEKDFEPSAIT-PRGLAP----PGLIVNGDFGEMMRLKVSSTPTTPRKNLNLSVT  55

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             EP  K+D   L CTL  ++DT++QRINYHIGYPVNI Y+HYA LAPL+++HLNNCGDPF+
Sbjct  56    EP-GKNDGPSLDCTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFHLNNCGDPFL  114

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             +NTVDFHSKDFEV VL+WFA+LWEIE+D+YWGY+TNGGTEGNLHGIL+GRE+ P+GILYA
Sbjct  115   QNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGILVGRELFPDGILYA  174

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             SK+SHYSV KAA MYRM+ E IN  INGE+DY DL+ KLL NKGKPAIINVTIGTTFKG 
Sbjct  175   SKDSHYSVAKAAMMYRMDFENINASINGEIDYSDLKVKLLQNKGKPAIINVTIGTTFKGA  234

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D+LDVI++ LEECGY++D+FYIHCDAAL+GLI+PF+KN+  I+FKKPIGSVTISGHKFL
Sbjct  235   VDDLDVILQILEECGYTRDQFYIHCDAALNGLIIPFIKNM--ITFKKPIGSVTISGHKFL  292

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCPMPCG+Q+TRKS I+N+SR VEYIASVDATISGSRNGLTPIFLWYS+S KG+ G QKD
Sbjct  293   GCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLWYSISAKGQIGFQKD  352

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              +RC + A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCVRDMAHVIVMP
Sbjct  353   VKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMP  412

Query  364   GVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             G+  E +D F NDL+Q+R  WY++G   PPC+ +D+G+ NC C  HK
Sbjct  413   GITRETLDGFINDLLQQRKKWYQDGRISPPCVANDIGAQNCACSYHK  459



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/465 (68%), Positives = 377/465 (81%), Gaps = 16/465 (3%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEP  1439
             MG+L+F++DF    +  P            F NGD   NK+ K+  P  RKN+ + V EP
Sbjct  1     MGSLSFEKDFEVSAITPPSL----------FPNGD---NKRQKLEPPGPRKNLQLAVTEP  47

Query  1438  RSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMEN  1259
                 D   L   L  +LDT++QR+N+HIGYPVNI Y HYATLAPL+++HLNNCGDPF++N
Sbjct  48    GFGSDGPSLDSILVNYLDTLTQRVNFHIGYPVNICYHHYATLAPLLQFHLNNCGDPFIDN  107

Query  1258  TVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASK  1079
             TVDFHSKDFE+ VLDWFA LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ P+GILYASK
Sbjct  108   TVDFHSKDFEMAVLDWFANLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPDGILYASK  167

Query  1078  ESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMD  899
             +SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTFKG +D
Sbjct  168   DSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRTKLLQNKDKPAIINVTIGTTFKGAVD  227

Query  898   NLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGC  719
             +LD+I++TL++CGYSQD FYIHCDAAL GLIVPF+ N+  ISFKKPIGSVTISGHKFLGC
Sbjct  228   DLDIILQTLKDCGYSQDMFYIHCDAALCGLIVPFINNM--ISFKKPIGSVTISGHKFLGC  285

Query  718   PMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQ  539
             PMPCG+Q+TRKS I+N+SRNVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQKD +
Sbjct  286   PMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVK  345

Query  538   RCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGV  359
             RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSC++DMAHVIVMPG+
Sbjct  346   RCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCMKDMAHVIVMPGI  405

Query  358   APEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
               E +DNF NDLVQ+R  WY+ G    PC+ DD+G+ NC C  HK
Sbjct  406   TRETLDNFVNDLVQQRKLWYQHGRVTTPCIADDIGAQNCSCSYHK  450



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/470 (68%), Positives = 384/470 (82%), Gaps = 11/470 (2%)
 Frame = -2

Query  1618  MGTLAFDEDF--MPMGVAAPEALLP-FFVHSGSFKNGDFVENKKMKIAAPP--ARKNMHI  1454
             MG+L  + DF  +PM   +  A+ P        F N   V+NKK K+A P    RKN+ +
Sbjct  1     MGSLLLEMDFESLPMSPRSLAAMTPRSLARRRLFPN---VDNKKQKVAPPGDGPRKNLQL  57

Query  1453  TVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              V EP  K+D   L   L  +LDT++QR+NYH+GYPVNI YDHYATLAPL+++HLNNCGD
Sbjct  58    EVMEPGLKNDGPSLDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFHLNNCGD  117

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGI
Sbjct  118   PFLQNTVDFHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGI  177

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYASK+SHYSVFKAARMYRM+ E INT +NGEM+Y DLR+KLL NK KPAIINVTIGTTF
Sbjct  178   LYASKDSHYSVFKAARMYRMDSETINTSVNGEMNYSDLRAKLLQNKDKPAIINVTIGTTF  237

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D+LDVI++TL+ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGH
Sbjct  238   KGAIDDLDVILETLKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGH  295

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GL
Sbjct  296   KFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGL  355

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QKD +RC++ A +L++RLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVI
Sbjct  356   QKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVI  415

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             VMPG+  E +DNF ++LVQ+R  WYR+G  + PC+ +D+G+ NC C  HK
Sbjct  416   VMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/470 (68%), Positives = 383/470 (81%), Gaps = 11/470 (2%)
 Frame = -2

Query  1618  MGTLAFDEDF--MPMGVAAPEALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHI  1454
             MG+L+ + DF   PM   +  A+ P        F N   V+NKK K+A P A  RKN+ +
Sbjct  1     MGSLSLEMDFEPSPMTPRSLAAMTPRSLARRRLFPN---VDNKKQKMAQPGAGPRKNLEL  57

Query  1453  TVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              V EP  K+D   L   L  +LDT++QR+NYH+GYPVNI YDHYATLAPL+++HLNNCGD
Sbjct  58    EVMEPALKNDGPSLDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFHLNNCGD  117

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF++NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGI
Sbjct  118   PFLQNTVDFHSKDFEVAVLNWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGI  177

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTF
Sbjct  178   LYASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTF  237

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D+LDVI++ L+ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGH
Sbjct  238   KGAIDDLDVILEILKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGH  295

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GL
Sbjct  296   KFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGL  355

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QKD +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVI
Sbjct  356   QKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVI  415

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             VMPG+  E +DNF ++LVQ+R  WY+ G   PPC+ +D+G+ NC C  HK
Sbjct  416   VMPGITREMLDNFMSELVQQRKVWYQNGKTDPPCVGEDIGAQNCACSYHK  465



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/469 (68%), Positives = 384/469 (82%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGS--FKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG+L+ + DF P+ +      +     +G   F NG   ENKK K+A P A  RKN+ + 
Sbjct  1     MGSLSLEMDFEPLPMTPRSLAMTPRSLAGRRLFPNG---ENKKQKVAPPGAGPRKNLELE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D   L   L  +LDT++QR+N+H+GYPVNI YDHYATLAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDGPSLDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ P+GIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPDGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +DN+DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDNVDVILQTLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD ++C++ A +L+DRL  AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVKKCLDNAKYLKDRLLQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++LVQ+R  WY++G  + PC+ DD+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYHK  464



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/466 (68%), Positives = 383/466 (82%), Gaps = 14/466 (3%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA-RKNMHITVAE  1442
             MG+L+F++DF P  V  P  L+          NGDF E K++K+A P   RKN+++ V E
Sbjct  1     MGSLSFEKDFEP-SVVTPRGLI---------ANGDFGEMKRLKVATPTTPRKNLNVAVTE  50

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             P S++D   L C L  ++DT+SQRINYHIGYPVNI Y+HYA+LAPL+++HLNNCGDPF++
Sbjct  51    PGSRNDGPSLDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPFLQ  110

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             NTVDFHS+DFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P GILYAS
Sbjct  111   NTVDFHSEDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGILVGRELLPTGILYAS  170

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             K+SHYSV KAA MYRM+ E INT ++GEMDY DL+++LL NKGKPAIINVTIGTTFKG +
Sbjct  171   KDSHYSVAKAAMMYRMDFEMINTSVHGEMDYSDLKARLLQNKGKPAIINVTIGTTFKGAV  230

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD+I++TL++CGY+ D+FYIHCDAAL+GLI+PF+KN+  ISFKKPIGSVTISGHKFLG
Sbjct  231   DDLDIILQTLKDCGYTYDQFYIHCDAALNGLIIPFIKNM--ISFKKPIGSVTISGHKFLG  288

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PIFLWYSL  KGRAGLQ+DA
Sbjct  289   CPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDA  348

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             + C E A +L+ RL  AGISAM+N++SI VVFERP D  FIR WQLSC RDMAHV+VMPG
Sbjct  349   KICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQLSCTRDMAHVVVMPG  408

Query  361   VAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGSHNCYCPLHK  227
             +  E ID+FFNDL+QER  WY+ G   PPCL DD+GS NC C   K
Sbjct  409   ITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQK  454



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/469 (68%), Positives = 383/469 (82%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPE-ALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG L+ + DF P+ +     A+ P        F NG   ENKK K+A P A  RKN+ + 
Sbjct  1     MGGLSLEMDFEPLPMTPRSLAMTPRSLARRRLFPNG---ENKKQKLAPPGAGPRKNLELE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D+  L   L  +LDT+ QR+NYH+GYPVNI YDHYATLAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDDPSLDTILVNYLDTLKQRVNYHLGYPVNICYDHYATLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ P+GIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPDGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD +RC++ A +L+DRLQ  GIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++LVQ+R  WY++G  + PC+ +D+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/469 (67%), Positives = 382/469 (81%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPE-ALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG+L+ + DF P+ +     A+ P        F N   VENKK K+    A  RKN+ + 
Sbjct  1     MGSLSLEMDFEPLPMTPRSLAMTPRSLARRRLFPN---VENKKQKVEQSGAGPRKNLQLE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D   L   L  +LDT+ QR+N+H+GYPVNI YDHYATLAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDGPSLDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK +PAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDRPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD ++C++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++LVQ+R  WY++G  + PC+ +D+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/469 (67%), Positives = 381/469 (81%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPE-ALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG+L+   DF P+ +     A+ P        F N   VENKK K+    A  RKN+ + 
Sbjct  1     MGSLSLQMDFEPLPMTPRSLAMTPRSLARRRLFPN---VENKKQKVEQSGAGPRKNLQLE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D   L   L  +LDT+ QR+N+H+GYPVNI YDHYATLAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDGPSLDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK +PAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDRPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD ++C++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++LVQ+R  WY++G  + PC+ +D+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/469 (67%), Positives = 381/469 (81%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPE-ALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG+L+ + DF P+ +     A+ P        F N   VENKK K+    A  RKN+ + 
Sbjct  1     MGSLSLEMDFEPLPMTPRSLAMTPRSLARRRLFPN---VENKKQKVEQSGAGPRKNLQLE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D   L   L  +LDT++QR+N+H+GYPVNI YDHYATLAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDGPSLDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ P+GIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPDGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKA RMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKATRMYRMDSETINTAVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVERCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++L+Q+R  WY+ G   PPC+ +D+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELMQQRKVWYQNGKTNPPCVGEDIGAQNCACSYHK  464



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/470 (67%), Positives = 380/470 (81%), Gaps = 11/470 (2%)
 Frame = -2

Query  1618  MGTLAFDEDF--MPMGVAAPEALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHI  1454
             MG+L  + DF   PM   +  A+ P        F N   V+NKK K+    A  RKN+ +
Sbjct  1     MGSLTLEMDFEPSPMTPRSLAAMTPKSLARRRLFPN---VDNKKQKVEQSGAGPRKNLQL  57

Query  1453  TVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              V EP   ++   L   L  +LDT++QR+NYH+GYPVNI YDHYA+LAPL+++HLNNCGD
Sbjct  58    EVMEPSLNNNGPSLDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFHLNNCGD  117

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGI
Sbjct  118   PFLQNTVDFHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGI  177

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYASK+SHYSVFKAARMYRM+ E INT + GEMDY DLR+KLL NK KPAIINVTIGTTF
Sbjct  178   LYASKDSHYSVFKAARMYRMDSETINTSVTGEMDYSDLRAKLLQNKDKPAIINVTIGTTF  237

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D+LDVI++TL+ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGH
Sbjct  238   KGAIDDLDVILETLKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGH  295

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GL
Sbjct  296   KFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGL  355

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QKD +RC++ A +L++RLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVI
Sbjct  356   QKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVI  415

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             VMPG+  E +DNF ++LVQ+R  WYR+G  + PC+ +D+G+ NC C  HK
Sbjct  416   VMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/431 (71%), Positives = 365/431 (85%), Gaps = 5/431 (1%)
 Frame = -2

Query  1510  VENKKMKIAAPPA--RKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNI  1337
             V NKK K+    A  RKN+ + V EP  K+D   L   L  +LDT++QR+N+H+GYPVNI
Sbjct  49    VNNKKQKVEQSGAGPRKNLQLEVLEPGLKNDGPSLDTILVNYLDTLTQRVNFHLGYPVNI  108

Query  1336  VYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITN  1157
              YDHYATLAPL+++HLNNCGDPF++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TN
Sbjct  109   CYDHYATLAPLLQFHLNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTN  168

Query  1156  GGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLR  977
             GGTEGNLHGILLGRE+ PEGILYASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR
Sbjct  169   GGTEGNLHGILLGRELLPEGILYASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLR  228

Query  976   SKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPF  797
             SKLL NK KPAIINVTIGTTFKG +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF
Sbjct  229   SKLLQNKDKPAIINVTIGTTFKGAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPF  288

Query  796   LKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGS  617
             + N+  ISFKKPIGSVTISGHKFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGS
Sbjct  289   INNM--ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGS  346

Query  616   RNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERP  437
             RNGLTPIFLWYSLS KG+ GLQKD ++C++ A +L+DRLQ  GIS M+N+ SI VV ERP
Sbjct  347   RNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQEGISVMLNELSIIVVLERP  406

Query  436   PDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDL  260
              D +F+RRWQLSCV+DMAHVIVMPG+  E +DNF ++LVQ+R  WY++G  + PC+ DD+
Sbjct  407   RDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDI  466

Query  259   GSHNCYCPLHK  227
             G+ NC C  HK
Sbjct  467   GAQNCACSYHK  477



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/467 (67%), Positives = 382/467 (82%), Gaps = 9/467 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITVA  1445
             MG+L+ + DF P    +P +L          +    V+NKK K+A P A  RKN+ + V 
Sbjct  1     MGSLSLEMDFEP----SPRSLAMTPRSLARRRLFPNVDNKKPKVAQPGAGPRKNLQLEVM  56

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             EP  K+D   L   L  +LDT++QR+NYH+GYPVNI YDHYA+LAPL+++HLNNCGDPF+
Sbjct  57    EPGLKNDGPSLDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFHLNNCGDPFL  116

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             +NTVDFHSKDFEV VL+WFA+LWEIEKD+YWGY+TNGGTEGNLHGIL+GRE+ P+GILYA
Sbjct  117   QNTVDFHSKDFEVAVLNWFAQLWEIEKDQYWGYVTNGGTEGNLHGILIGRELLPDGILYA  176

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             SK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR KLL NK KPAIINVTIGTTFKG 
Sbjct  177   SKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLREKLLQNKDKPAIINVTIGTTFKGA  236

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHKFL
Sbjct  237   IDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHKFL  294

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQKD
Sbjct  295   GCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKD  354

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIVMP
Sbjct  355   VKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMP  414

Query  364   GVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             G+  E +DNF ++LVQ+R  WY++G  + PC+ +D+G+ NC C  HK
Sbjct  415   GITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  461



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/470 (67%), Positives = 379/470 (81%), Gaps = 11/470 (2%)
 Frame = -2

Query  1618  MGTLAFDEDF--MPMGVAAPEALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHI  1454
             MG+L+ + DF   PM   +  A+ P        F N   V+NKK K+    A  RKN+ +
Sbjct  1     MGSLSLEMDFEPSPMTPRSLAAMTPRSLARRRLFPN---VDNKKQKVEQSGAGPRKNLQL  57

Query  1453  TVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              V EP   +D   L   L  +LDT++QR+NYH+GYPVNI YDHYA+LAPL+++HLNNCGD
Sbjct  58    EVMEPALDNDGPSLDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFHLNNCGD  117

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF++NTVDFHSKDFEV VLDWFA+LW IEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGI
Sbjct  118   PFLQNTVDFHSKDFEVAVLDWFAQLWGIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGI  177

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTF
Sbjct  178   LYASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTF  237

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D++DVI++TL+ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGH
Sbjct  238   KGAIDDVDVILETLKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGH  295

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLT IFLWYSLS KG+ GL
Sbjct  296   KFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTLIFLWYSLSAKGQVGL  355

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QKD +RC++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVI
Sbjct  356   QKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVI  415

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             VMPG+  E +DNF ++LVQ+R  WY+ G   PPC+ +D+G+ NC C  HK
Sbjct  416   VMPGITREMLDNFMSELVQQRKVWYQNGKTNPPCVGEDIGAQNCACSYHK  465



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/468 (67%), Positives = 378/468 (81%), Gaps = 18/468 (4%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVA-APEALLPFFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHITV  1448
             MG+L+   DF P   + A   LLP             V+NKK  ++   A  RKN+ + V
Sbjct  1     MGSLSLKMDFEPTPRSLARRCLLPN------------VDNKKQNVSQSGAGPRKNLELEV  48

Query  1447  AEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPF  1268
              EP  K+D   L  TL  +LDT++QR+NYH+GYPVNI YDHYA+LAPL+++HLNNCGDPF
Sbjct  49    MEPGLKNDGPSLDTTLVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFHLNNCGDPF  108

Query  1267  MENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILY  1088
             ++NTVDFHSKDFEV VL+WFA+LWEIEKD+ WGY+TNGGTEGNLHGILLGRE+ PEGILY
Sbjct  109   LQNTVDFHSKDFEVAVLNWFAQLWEIEKDQCWGYVTNGGTEGNLHGILLGRELLPEGILY  168

Query  1087  ASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKG  908
             ASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTFKG
Sbjct  169   ASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTFKG  228

Query  907   GMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKF  728
              +D+LDVI++T +ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHKF
Sbjct  229   AIDDLDVILETFKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHKF  286

Query  727   LGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQK  548
             LGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLSTKG+ GLQK
Sbjct  287   LGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSTKGQIGLQK  346

Query  547   DAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVM  368
             D +RC++ A +L+D LQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHV+VM
Sbjct  347   DVKRCLDNAKYLKDGLQQAGISVMLNEISIIVVLERPHDHEFVRRWQLSCVKDMAHVVVM  406

Query  367   PGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             PG+  E +DNF ++LVQ+R  WY+ G  + PC+ DD+G+ NC C  HK
Sbjct  407   PGITREMLDNFISELVQQRKHWYQGGKAEAPCVADDIGTQNCACSYHK  454



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/469 (67%), Positives = 381/469 (81%), Gaps = 10/469 (2%)
 Frame = -2

Query  1618  MGTLAFDEDFMPMGVAAPE-ALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHIT  1451
             MG+L+ + DF P  +     A+ P        F  GD   NKK K+    A  RKN+ + 
Sbjct  1     MGSLSLEMDFDPSPMTPRSLAMTPRSLARRRLFPIGD---NKKQKVEQSGAGPRKNLQLE  57

Query  1450  VAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             V EP  K+D   L   L  +LDT++QR+N+H+GYPVNI YDHYA+LAPL+++HLNNCGDP
Sbjct  58    VMEPGLKNDGPSLDTILVNYLDTLTQRVNFHLGYPVNICYDHYASLAPLLQFHLNNCGDP  117

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ PEGIL
Sbjct  118   FLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPEGIL  177

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK +PAIINVTIGTTFK
Sbjct  178   YASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDRPAIINVTIGTTFK  237

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D++DVI++TL++CGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGHK
Sbjct  238   GAIDDVDVILETLKDCGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGHK  295

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GLQ
Sbjct  296   FLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQ  355

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             KD ++C++ A +L+DRLQ AGIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVIV
Sbjct  356   KDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIV  415

Query  370   MPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             MPG+  E +DNF ++LVQ+R  WY++G  + PC+ +D+G+ NC C  HK
Sbjct  416   MPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/470 (66%), Positives = 377/470 (80%), Gaps = 11/470 (2%)
 Frame = -2

Query  1618  MGTLAFDEDF--MPMGVAAPEALLP-FFVHSGSFKNGDFVENKKMKIAAPPA--RKNMHI  1454
             M +L+ + DF   PM   +  A+ P        F N   V+NKK K+    A  RKN+ +
Sbjct  1     MDSLSLEMDFEPSPMTPRSLAAMTPRSLARRRLFPN---VDNKKQKVEQSGAGPRKNLQL  57

Query  1453  TVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              V EP   +D   L   L  +LDT+++R+NYH+GYPVNI YDHYA+LAPL+++HLNNCGD
Sbjct  58    EVMEPALNNDGPSLDTILVNYLDTLTRRVNYHLGYPVNICYDHYASLAPLLQFHLNNCGD  117

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TNGGTEGNLHGILLGRE+ P+GI
Sbjct  118   PFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGILLGRELLPDGI  177

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR+KLL NK KPAIINVTIGTTF
Sbjct  178   LYASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLRAKLLQNKDKPAIINVTIGTTF  237

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D++D I++ L+ECGYSQD FYIHCDAAL GL+ PF+ N+  ISFKKPIGSVTISGH
Sbjct  238   KGAIDDVDTILEILKECGYSQDRFYIHCDAALCGLMTPFINNM--ISFKKPIGSVTISGH  295

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGSRNGLTPIFLWYSLS KG+ GL
Sbjct  296   KFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQLGL  355

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QKD +RC++ A +L+DRLQ  GIS M+N+ SI VV ERP D +F+RRWQLSCV+DMAHVI
Sbjct  356   QKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVI  415

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGSHNCYCPLHK  227
             VMPG+  E +DNF ++LVQ+R  WY+ G   PPC+ +D+G+ NC C  HK
Sbjct  416   VMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYHK  465



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/431 (70%), Positives = 362/431 (84%), Gaps = 5/431 (1%)
 Frame = -2

Query  1510  VENKKMKIAAPPA--RKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNI  1337
             V+NKK K+    A  RKN+ + V EP   +D   L   L  +LDT+++R+NYH+GYPVNI
Sbjct  30    VDNKKQKVEQSGAGPRKNLQLEVMEPALNNDGPSLDTILVNYLDTLTRRVNYHLGYPVNI  89

Query  1336  VYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITN  1157
              YDHYA+LAPL+++HLNNCGDPF++NTVDFHSKDFEV VLDWFA+LWEIEKD+YWGY+TN
Sbjct  90    CYDHYASLAPLLQFHLNNCGDPFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTN  149

Query  1156  GGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLR  977
             GGTEGNLHGILLGRE+ P+GILYASK+SHYSVFKAARMYRM+ E INT +NGEMDY DLR
Sbjct  150   GGTEGNLHGILLGRELLPDGILYASKDSHYSVFKAARMYRMDSETINTSVNGEMDYSDLR  209

Query  976   SKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPF  797
             +KLL NK KPAIINVTIGTTFKG +D++D I++ L+ECGYSQD FYIHCDAAL GL+ PF
Sbjct  210   AKLLQNKDKPAIINVTIGTTFKGAIDDVDTILEILKECGYSQDRFYIHCDAALCGLMTPF  269

Query  796   LKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGS  617
             + N+  ISFKKPIGSVTISGHKFLGCPMPCG+Q+TRKS I+N+S NVEYIASVDATISGS
Sbjct  270   INNM--ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGS  327

Query  616   RNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERP  437
             RNGLTPIFLWYSLS KG+ GLQKD +RC++ A +L+DRLQ  GIS M+N+ SI VV ERP
Sbjct  328   RNGLTPIFLWYSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERP  387

Query  436   PDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDL  260
              D +F+RRWQLSCV+DMAHVIVMPG+  E +DNF ++LVQ+R  WY+ G   PPC+ +D+
Sbjct  388   RDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDI  447

Query  259   GSHNCYCPLHK  227
             G+ NC C  HK
Sbjct  448   GAQNCACSYHK  458



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/424 (70%), Positives = 354/424 (83%), Gaps = 4/424 (1%)
 Frame = -2

Query  1486  AAPPARKNMHITVAEPRSKDDE---ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
             A PP RKN+ ++V EP  KD++     L   L ++++T+S R  YHIGYPVNI Y+H+A 
Sbjct  20    APPPPRKNLSLSVVEPDEKDNKMSSQELDRILTQYIETLSHRTEYHIGYPVNICYEHHAA  79

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             LAPL+++HLNNCGDPF +NTVDFHSKDFEV VLDWFA+LWEIEKDEYWGYITNGGTEGNL
Sbjct  80    LAPLLQFHLNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNL  139

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             HG+L+GRE+HP GI+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSKLLLNK
Sbjct  140   HGLLIGRELHPTGIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSKLLLNK  199

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
              KPAIINV IGTTFKG +D++D+I++ L++CGYS D +YIHCDAAL GLI+PF+++   I
Sbjct  200   NKPAIINVNIGTTFKGAIDDIDLILQILQKCGYSNDRYYIHCDAALYGLIIPFIQHAKTI  259

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             +FKKPIGSV+ISGHKFLGCPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PI
Sbjct  260   TFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPI  319

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWYSL  KGRAGLQ+DA+ C E A +L+ RL  AGISAM+N++SI VVFERP D  FIR
Sbjct  320   FLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIR  379

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGSHNCYC  239
              WQLSC RDMAHV+VMPG+  E ID+FFNDL+QER  WY+ G   PPCL DD+GS NC C
Sbjct  380   HWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLC  439

Query  238   PLHK  227
                K
Sbjct  440   SYQK  443



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/424 (69%), Positives = 353/424 (83%), Gaps = 4/424 (1%)
 Frame = -2

Query  1486  AAPPARKNMHITVAEPRSKDDE---ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
             A PP RKN+ ++V EP  KD++     L   L ++++T+S R  YHIGYPVNI Y+H+A 
Sbjct  20    APPPPRKNLSLSVVEPDEKDNKMSSQELDRILTQYIETLSHRTEYHIGYPVNICYEHHAA  79

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             LAPL+++HLNNCGDPF +NTVDFHSKDFEV VLDWFA+LWEIEKDEYWGYITNGGTEGNL
Sbjct  80    LAPLLQFHLNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNL  139

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             HG+L+GRE+H  GI+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSKLLLNK
Sbjct  140   HGLLIGRELHLTGIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSKLLLNK  199

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
              KPAIINV IGTTFKG +D++D+I++ L++CGYS D +YIHCDAAL GLI+PF+++   I
Sbjct  200   NKPAIINVNIGTTFKGAIDDIDLILQILQKCGYSNDRYYIHCDAALYGLIIPFIQHAKTI  259

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             +FKKPIGSV+ISGHKFLGCPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PI
Sbjct  260   TFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPI  319

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWYSL  KGRAGLQ+DA+ C E A +L+ RL  AGISAM+N++SI VVFERP D  FIR
Sbjct  320   FLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIR  379

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGSHNCYC  239
              WQLSC RDMAHV+VMPG+  E ID+FFNDL+QER  WY+ G   PPCL DD+GS NC C
Sbjct  380   HWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLC  439

Query  238   PLHK  227
                K
Sbjct  440   SYQK  443



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/429 (69%), Positives = 357/429 (83%), Gaps = 5/429 (1%)
 Frame = -2

Query  1498  KMKIAAP-PARKNMHITVAEPRSKDDEA---RLKCTLGKFLDTISQRINYHIGYPVNIVY  1331
             K +I AP P R+N++++V EP SKD++     L   L ++++T+S R  YHIGYPVNI Y
Sbjct  13    KGEINAPTPLRENLNLSVVEPDSKDNKTFSQELDRILTQYIETLSHRTEYHIGYPVNICY  72

Query  1330  DHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGG  1151
             +H+A LAPL+++HLNNCGDPF +NTVDFHSKDFEV VLDWFA+LWEIEKDEYWGYITNGG
Sbjct  73    EHHAALAPLLQFHLNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGG  132

Query  1150  TEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSK  971
             TEGNLHG+L+GRE+HP GI+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSK
Sbjct  133   TEGNLHGLLIGRELHPTGIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSK  192

Query  970   LLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLK  791
             LLLNK KPAIIN+ IGTTFKG +D+LD++++ L++CGYS D +YIHCDAAL GLIVPF++
Sbjct  193   LLLNKNKPAIININIGTTFKGAIDDLDLVLQILQKCGYSNDRYYIHCDAALYGLIVPFIQ  252

Query  790   NVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRN  611
             +V  I+FKKPIGSV+ISGHKFLGCPMPCGIQ+TRK  I ++S  +EYIASVDATISGSRN
Sbjct  253   HVKTITFKKPIGSVSISGHKFLGCPMPCGIQITRKGYITSLSTKIEYIASVDATISGSRN  312

Query  610   GLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPD  431
             GL PIFLWYSL  KGRAGLQ+DA+ C E A +L+ RL  AGI+AM+N+ SI VVFERP D
Sbjct  313   GLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGINAMLNECSIIVVFERPND  372

Query  430   RDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGS  254
               FIR WQLSC RDMAHV++MPG+  E ID+FF DL+QER  WY+ G   PPCL DD+GS
Sbjct  373   PKFIRHWQLSCTRDMAHVVIMPGITRETIDSFFKDLMQERXKWYQVGTTVPPCLADDIGS  432

Query  253   HNCYCPLHK  227
              NC C   K
Sbjct  433   QNCICSKQK  441



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/422 (69%), Positives = 348/422 (82%), Gaps = 4/422 (1%)
 Frame = -2

Query  1480  PPARKNMHITVAEPRSKD---DEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLA  1310
             PP  KN+  +V EP  K+       L   L ++++T+S R  YHIGYPVNI Y+H+  LA
Sbjct  22    PPPWKNLSFSVVEPDEKNIKMSSQELDKILTQYIETLSHRTEYHIGYPVNICYEHHDALA  81

Query  1309  PLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHG  1130
             PL+++HLNNCGDPF +NTVDFHSKDFEV VLDWFA+LWEIEKDEYWGYITNGGTEGNLHG
Sbjct  82    PLLQFHLNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHG  141

Query  1129  ILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGK  950
             +L+GRE+HP  I+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSKLLLNK K
Sbjct  142   LLIGRELHPTAIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSKLLLNKNK  201

Query  949   PAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISF  770
             PAIIN+ IGTTFKG +D+LD++++ L++CGYS D +YIHCDAAL GLIVPF+++V  I+F
Sbjct  202   PAIININIGTTFKGAIDDLDLVLQILQKCGYSNDRYYIHCDAALYGLIVPFIQHVKTITF  261

Query  769   KKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFL  590
             KKPIGSV+ISGHKFLGCPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PIFL
Sbjct  262   KKPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFL  321

Query  589   WYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRW  410
             WYSL  KGRAGLQ+DA+ C E A +L+ RL  AGISAM+N++SI VVFERP D  FIR W
Sbjct  322   WYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHW  381

Query  409   QLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPL  233
             QLSC RDMAHV+VMPG+  E ID+FFNDL+QER  WY+ G   PPCL DD+GS NC C  
Sbjct  382   QLSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTIVPPCLADDIGSQNCLCSK  441

Query  232   HK  227
              K
Sbjct  442   QK  443



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/422 (69%), Positives = 347/422 (82%), Gaps = 4/422 (1%)
 Frame = -2

Query  1480  PPARKNMHITVAEPRSKD---DEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLA  1310
             PP RKN+ ++V EP  KD       L   L ++++T+S R  YHIGYPVNI Y+H+A LA
Sbjct  22    PPPRKNLSLSVVEPDGKDIKTSSQELDRILIQYIETLSHRTEYHIGYPVNICYEHHAALA  81

Query  1309  PLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHG  1130
             PL+++HLNNCGDPF +NTVDFHSKDFEV VLDWFA+LWEIEKDEYWGYITNGGTEGNLHG
Sbjct  82    PLLQFHLNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHG  141

Query  1129  ILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGK  950
             +L+GRE+HP GI+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSKLLLNK K
Sbjct  142   LLIGRELHPTGIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSKLLLNKNK  201

Query  949   PAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISF  770
             PAIIN  +GTTFKG +D+LD++++ L++CGYS D +YIHCDAAL GLIVPF ++V  I+F
Sbjct  202   PAIINNNLGTTFKGAIDDLDLVLQILQKCGYSNDRYYIHCDAALYGLIVPFTQHVKTITF  261

Query  769   KKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFL  590
             KKPIGSV+ISGHKFLGCPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PIFL
Sbjct  262   KKPIGSVSISGHKFLGCPMPCGIQITRKSYITSLSTKIEYIASVDATISGSRNGLAPIFL  321

Query  589   WYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRW  410
             WYSL  KGRAGLQ+DA+ C E A +L+ +L  AGIS M+N++SI VVFERP    FIR W
Sbjct  322   WYSLCMKGRAGLQQDAKMCNENARYLKGQLHKAGISTMLNESSIIVVFERPNVPKFIRHW  381

Query  409   QLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPL  233
             QLSC RDMAHV+VMPG+  E IDNFF DL+QER  WY+ G   PPCL DD+GS NC C  
Sbjct  382   QLSCTRDMAHVVVMPGITRETIDNFFKDLMQERKKWYQVGIIVPPCLADDIGSQNCLCSK  441

Query  232   HK  227
              K
Sbjct  442   QK  443



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/431 (67%), Positives = 348/431 (81%), Gaps = 7/431 (2%)
 Frame = -2

Query  1498  KMKIAAP---PARKNMHITVAEPRSKD---DEARLKCTLGKFLDTISQRINYHIGYPVNI  1337
             K +I AP   P RKN+ ++V EP  KD      +L   + ++L+T+S R  YH+GYP+N+
Sbjct  15    KGEINAPSPSPPRKNLSLSVVEPDEKDIKISSHKLDRIVTQYLETLSHRKKYHLGYPINV  74

Query  1336  VYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITN  1157
              Y+H+A LAPL++++LNNCGDPF ENT+DFHSKDFEV VLDWFA+LWEIEKDEYWGYITN
Sbjct  75    CYEHHAALAPLLQFYLNNCGDPFTENTIDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITN  134

Query  1156  GGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLR  977
             GGTEGNLHG+L+GRE+HP GI+YASK+SHYSVFKAARMYRME+E INT+ NGE+DY DLR
Sbjct  135   GGTEGNLHGLLIGRELHPTGIIYASKDSHYSVFKAARMYRMELETINTLFNGEIDYADLR  194

Query  976   SKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPF  797
             SKLLLNK KPAIINV IGTTFKG +D+LD+I++ L++CGYS D++YIHCDAAL GLI+PF
Sbjct  195   SKLLLNKNKPAIINVNIGTTFKGAIDDLDLILQILKKCGYSNDKYYIHCDAALYGLIIPF  254

Query  796   LKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGS  617
             +++   I+FKK +GSV+ISGHKFLGCPMPCGIQMTRKS I ++S  +EYIAS DATISGS
Sbjct  255   IQHAKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIASTDATISGS  314

Query  616   RNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERP  437
             RNGL PI LWYSL  KGR GLQ+DA+ C+E A +L+ +L  AGISAM+N+ SI VVFERP
Sbjct  315   RNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSIIVVFERP  374

Query  436   PDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDL  260
              D  FIR+WQLSC RDM H +VMP +  E IDNFF DL+ ER  WYR G   PPCL DD+
Sbjct  375   NDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDI  434

Query  259   GSHNCYCPLHK  227
              S NC C  HK
Sbjct  435   ASQNCLCCCHK  445



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 351/437 (80%), Gaps = 5/437 (1%)
 Frame = -2

Query  1537  SGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYH  1358
             S +  NG+   N  +K+  P  RK + + V EP      +     L  +L T++QR+ YH
Sbjct  18    SENIVNGNI--NTVVKVTPPGPRKKLQLAVIEPGLGSGVSSPDYILDNYLKTLTQRVKYH  75

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             +G+P NI YDH+  LAPL+++HLNNCGDPF EN VDFHSKDFEV VLDWFA+LWEIEKDE
Sbjct  76    LGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEVAVLDWFAKLWEIEKDE  135

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             YWGY+T+GGTEGNLHGI +GRE+ P GILYASK+SHYSVFKAAR+Y++++E INT  NGE
Sbjct  136   YWGYVTHGGTEGNLHGIWIGRELLPNGILYASKDSHYSVFKAARLYKIDLEMINTTTNGE  195

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             MDY DLR+KLL NK KPAIIN+ IGTTFKG +D++DVI++TLE+CGYS ++FYIHCDAAL
Sbjct  196   MDYSDLRAKLLHNKDKPAIININIGTTFKGAIDDIDVILQTLEDCGYSHNKFYIHCDAAL  255

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             SGLIVPF+KNV  ISFKKPIGSVTISGHKFLGCP+PCG+Q+TRKS I  +SRNVEYIAS+
Sbjct  256   SGLIVPFIKNV--ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASM  313

Query  637   DATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSI  458
             DATISGSRNGLTPI LWYSLS+K + G+Q+D +RC+  A +L+DRLQ A IS M+N+ S 
Sbjct  314   DATISGSRNGLTPILLWYSLSSKNQIGIQQDVKRCLYNARYLKDRLQQANISVMLNELST  373

Query  457   TVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QP  281
              VV ERP D +F R WQLSCVRD+AHVIVMP +  E +D+FF DLVQ+R  WY++G  +P
Sbjct  374   IVVLERPLDHEFTRHWQLSCVRDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKP  433

Query  280   PCLEDDLGSHNCYCPLH  230
             PC+ DD+G+ NC C LH
Sbjct  434   PCVADDIGAQNCACALH  450



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/437 (65%), Positives = 350/437 (80%), Gaps = 5/437 (1%)
 Frame = -2

Query  1537  SGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYH  1358
             S +  NG+    K +K+  P  RK + + V EP      +     L  +L T++QR+ YH
Sbjct  18    SENIVNGNM--KKLVKVTPPRPRKKLQLAVIEPGLGSGVSSPDYILDNYLKTLAQRVKYH  75

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             +G+P NI YDH+  LAPL+++HLNNCGDPF EN VDFHSKDFEV VLDWFA+LWEI+KDE
Sbjct  76    LGFPENIFYDHHLALAPLLQFHLNNCGDPFTENPVDFHSKDFEVAVLDWFAKLWEIDKDE  135

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             YWGY+T+GGTEGNLHGI +GRE+ P GILY SK+SHYSVFKAAR+YR+++E INT  NGE
Sbjct  136   YWGYVTHGGTEGNLHGIWIGRELLPNGILYTSKDSHYSVFKAARLYRIDLEMINTSTNGE  195

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             MDY DL++KLL NK KPAIIN+ IGTTFKG MD++DVI++TLE+CGYS D+FYIHCDAAL
Sbjct  196   MDYSDLKAKLLHNKDKPAIININIGTTFKGAMDDIDVILQTLEDCGYSHDKFYIHCDAAL  255

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             +GLIVPF KNV  ISFKKPIGSVTISGHKF+GCP+PCG+Q+TRKS I  +SRNVEYIAS+
Sbjct  256   NGLIVPFTKNV--ISFKKPIGSVTISGHKFIGCPIPCGVQITRKSHIGYLSRNVEYIASM  313

Query  637   DATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSI  458
             DATISGSRNGLTPI LWYSLS+KG+ G+Q+D +RC+  A +LRDRL+ A IS M+N+ S 
Sbjct  314   DATISGSRNGLTPILLWYSLSSKGQIGIQQDVKRCLNNARYLRDRLKQANISVMLNELST  373

Query  457   TVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QP  281
              VV ERP D +F R WQLSCV+D+AHVIVMP +  E +D+FF DLVQ+R  WY++G  +P
Sbjct  374   IVVLERPHDHEFTRHWQLSCVKDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKP  433

Query  280   PCLEDDLGSHNCYCPLH  230
             PC+ DD+G+ NC C LH
Sbjct  434   PCVADDIGAQNCACALH  450



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/437 (65%), Positives = 349/437 (80%), Gaps = 5/437 (1%)
 Frame = -2

Query  1537  SGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYH  1358
             S +  NG+    K +K+  P  RK + + V EP      +     L  +L T++QR+ YH
Sbjct  18    SENIVNGNI--KKVVKVTPPGPRKKLQLAVIEPGLGSGVSSPDYILDNYLKTLTQRVKYH  75

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             +G+P NI YDH+  LAPL+++HLNNCGDPF EN VDFHSKDFEV VLDWFA+LWEIEKDE
Sbjct  76    LGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEVAVLDWFAKLWEIEKDE  135

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             YWGY+T+GGTEGNLHGI +GRE+ P GILY+SK+SHYSVFKAAR+YR+++E INT  +GE
Sbjct  136   YWGYVTHGGTEGNLHGIWIGRELLPNGILYSSKDSHYSVFKAARLYRIDLEMINTSTHGE  195

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             MDY DLR+KLL NK KPAIIN+ IGTTFKG +D++DVI++ LE+CGYS D+FYIHCDAAL
Sbjct  196   MDYSDLRAKLLHNKDKPAIININIGTTFKGAVDDIDVILQILEDCGYSHDKFYIHCDAAL  255

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             +GLIVPF+KNV  ISFKKPIGSVTISGHKFLGCP+PCG+Q+TRKS I  +SRNVEYIAS+
Sbjct  256   NGLIVPFIKNV--ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASM  313

Query  637   DATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSI  458
             DATISGSRNGLTPI LWYSLS+KG+ G+QKD +RC+  A +L+DRLQ A IS M+N+ S 
Sbjct  314   DATISGSRNGLTPILLWYSLSSKGQIGIQKDVKRCLNNARYLKDRLQQANISVMLNELST  373

Query  457   TVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QP  281
              VV ERP D +F R WQLSCVR +AHVIVMP +  E +D+FF DLVQ+R  WY++G  +P
Sbjct  374   IVVLERPHDHEFTRHWQLSCVRHIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKP  433

Query  280   PCLEDDLGSHNCYCPLH  230
             PC+ DD+G+ NC C  H
Sbjct  434   PCVADDIGAQNCSCAFH  450



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/415 (66%), Positives = 348/415 (84%), Gaps = 4/415 (1%)
 Frame = -2

Query  1474  ARKNMHITVAEPRSKDDEA--RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLM  1301
             +RKN+ ++V EP  +++ +  +L   L ++L+T+S++  YHIGYP+N+ Y+H A LAPL+
Sbjct  24    SRKNLCLSVVEPNIENETSSQKLDIILAQYLETLSKQKKYHIGYPINMCYEHQAILAPLL  83

Query  1300  RYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILL  1121
             ++ LNNCGDPF ++  DFHSKDFEV VLDWFA+LWEIEKDEYWGYIT+GGTEGNLHG+L+
Sbjct  84    QFSLNNCGDPFTQSPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLLV  143

Query  1120  GREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAI  941
             GRE+HP GILYASK+SHYS+FKAARMYRME+E INT++NGE+DY+DLRSKLL+NK KPAI
Sbjct  144   GRELHPSGILYASKDSHYSIFKAARMYRMELETINTLVNGEIDYEDLRSKLLVNKNKPAI  203

Query  940   INVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKP  761
             IN+ IGTTFKG +D+LD +I+TLE CGYS D +YIHCDAAL GLI+PF+++  KI+FKKP
Sbjct  204   ININIGTTFKGAIDDLDFVIQTLENCGYSNDNYYIHCDAALCGLILPFMEHAKKITFKKP  263

Query  760   IGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYS  581
             IGS++ISGHKFLGCPMPCGIQ+TRKS + ++S+ +EYIAS+D TISGSRNGLTPIFLWY 
Sbjct  264   IGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYIASIDTTISGSRNGLTPIFLWYC  322

Query  580   LSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLS  401
             L+ KG A LQ+D+  C+E A +L+DRL  AGISAM+N+ SI VVFERP D +FIRRWQL 
Sbjct  323   LNMKGHARLQQDSITCIENARYLKDRLVKAGISAMLNELSIIVVFERPCDHEFIRRWQLC  382

Query  400   CVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYC  239
              +  MAH++VMP +  E ID+FFNDL+QER  W+++G  +PPCL DD G+ NC C
Sbjct  383   YLSVMAHIVVMPFITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  437



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/420 (66%), Positives = 350/420 (83%), Gaps = 5/420 (1%)
 Frame = -2

Query  1474  ARKNMHITVAEPRSKDDEA--RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLM  1301
             +RKN+ ++V EP  KD+ +   L   L ++L+T+S+R  YHIGYP N+ Y+H+A LAPL+
Sbjct  1     SRKNLCLSVVEPDIKDETSFQELDMILTQYLETLSERKKYHIGYPTNMHYEHHAILAPLL  60

Query  1300  RYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILL  1121
             ++ LNNCGDPF ++  DFHSKDFEV VLDWFA+LWEI+KDEYWGYIT+GGTEGNLHG+L+
Sbjct  61    QFSLNNCGDPFTQSPADFHSKDFEVAVLDWFAQLWEIDKDEYWGYITSGGTEGNLHGLLV  120

Query  1120  GREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAI  941
             GRE+ P GILYASK+SHYS+FKAAR+YRME+E INT++NGE+DY+DLRSKLL+NK KPAI
Sbjct  121   GRELLPTGILYASKDSHYSIFKAARLYRMELETINTLVNGEIDYEDLRSKLLVNKNKPAI  180

Query  940   INVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVP-KISFKK  764
             IN+ IGTTFKG +D+LD +I+TLE CGYS D +Y+HCDAAL GLI+PF+++V  KI+FKK
Sbjct  181   ININIGTTFKGAIDDLDFVIQTLENCGYSNDRYYVHCDAALCGLILPFIRHVSKKITFKK  240

Query  763   PIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWY  584
             PIGS++ISGHKFLGCPMPCGIQ+TRKS + ++S+ +EYI S DATISGSRNGLTPIFLWY
Sbjct  241   PIGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYINSTDATISGSRNGLTPIFLWY  299

Query  583   SLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQL  404
              LSTKG   LQ+D++ C+E A +L+DRL  AGISAM+N+ SITVVFERP D  FIRRW L
Sbjct  300   CLSTKGHVRLQQDSKICIENARYLKDRLLEAGISAMLNEFSITVVFERPCDHKFIRRWNL  359

Query  403   SCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
               +R MAHV+VMPG+  E ID+FFNDL+QER  W+++G  +PPCL DD G+ NC C  +K
Sbjct  360   CYLRGMAHVVVMPGITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMCSNNK  419



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/384 (70%), Positives = 323/384 (84%), Gaps = 1/384 (0%)
 Frame = -2

Query  1375  QRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELW  1196
             + +N+++GYP+N+ Y+H+A LAPL++++LNNCGDPF ENT+DFHSKDFEV VLDWFA+LW
Sbjct  22    ETLNHNLGYPINVCYEHHAALAPLLQFYLNNCGDPFTENTIDFHSKDFEVAVLDWFAQLW  81

Query  1195  EIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGIN  1016
             EIEKDEYWGYITNGGTEGNLHG+L+GRE+HP GI+YASK+SHYSVFKAARMYRME+E IN
Sbjct  82    EIEKDEYWGYITNGGTEGNLHGLLIGRELHPTGIIYASKDSHYSVFKAARMYRMELETIN  141

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+ NGE+DY DLRSKLLLNK KPAIINV IGTTFKG +D+LD+I++ L++CGYS D++YI
Sbjct  142   TLFNGEIDYADLRSKLLLNKNKPAIINVNIGTTFKGAIDDLDLILQILKKCGYSNDKYYI  201

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCDAAL GLI+PF+++   I+FKK +GSV+ISGHKFLGCPMPCGIQMTRKS I ++S  +
Sbjct  202   HCDAALYGLIIPFIQHAKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKI  261

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EYIAS DATISGSRNGL PI LWYSL  KGR GLQ+DA+ C+E A +L+ +L  AGISAM
Sbjct  262   EYIASTDATISGSRNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAM  321

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ SI VVFERP D  FIR+WQLSC RDM H +VMP +  E IDNFF DL+ ER  WYR
Sbjct  322   LNEFSIIVVFERPNDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYR  381

Query  295   EGPQ-PPCLEDDLGSHNCYCPLHK  227
              G   PPCL DD+ S NC C  HK
Sbjct  382   VGTTVPPCLADDIASQNCLCCCHK  405



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/418 (64%), Positives = 345/418 (83%), Gaps = 4/418 (1%)
 Frame = -2

Query  1471  RKNMHITVAEPRSKDD--EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             RKN+ + V EP  K++    +L   L +F++ +S+R  YHIGYP+N+ Y+H+ATLAPL++
Sbjct  24    RKNLCVNVVEPNIKNEISSQKLDIILTQFMEILSKRKKYHIGYPINVCYEHHATLAPLLQ  83

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             +HLNNCGDPF ++  DFHSKDFEV VLDWFA+LWEIEKDEYWGYIT+GGTEGNLHG+L+G
Sbjct  84    FHLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLLVG  143

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             RE+ P GILYASK+SHYS+FKAARMYRME++ INT++NGE+DY+DL+SKLL+NK KPAII
Sbjct  144   RELLPSGILYASKDSHYSIFKAARMYRMELQTINTLVNGEIDYEDLKSKLLVNKNKPAII  203

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
             N+ IGTTFKG +D+LD +++TLE CGYS D +YIHCDAALSGLI+PF+K+  KI+F KPI
Sbjct  204   NINIGTTFKGAIDDLDFVVQTLENCGYSSDRYYIHCDAALSGLILPFIKHAKKITFMKPI  263

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSL  578
             GS+++SGHKFLGCPMPCGIQ+TRK+ +  +S+ +EYIAS+D TISGSR GLTPIFLWY L
Sbjct  264   GSISVSGHKFLGCPMPCGIQITRKTYVSTLSK-IEYIASIDTTISGSRYGLTPIFLWYYL  322

Query  577   STKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSC  398
             + KG AGLQ+D+  C+E A +L+D+L  AGI AM+N+ SI VVFERP D  FI RWQL  
Sbjct  323   NMKGHAGLQQDSITCIENARYLKDKLVKAGIGAMLNEFSIIVVFERPCDHKFILRWQLCY  382

Query  397   VRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +  +AH++VMPG+  E I++FFN+L+QER  W+++G  +PPCL D+ GS NC C  +K
Sbjct  383   LSGLAHIVVMPGITREIINSFFNELMQERKRWFQDGKTKPPCLADEFGSQNCMCSHNK  440



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/424 (65%), Positives = 340/424 (80%), Gaps = 5/424 (1%)
 Frame = -2

Query  1498  KMKIAAPPA--RKNMHITVAEP--RSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVY  1331
             K  I AP +  R NM +++ EP  ++K     L   L +++DT+SQR+ YHIGYP+N+ Y
Sbjct  15    KTGINAPLSSPRDNMCLSLIEPHIKNKTSSEELNMILTQYVDTLSQRMKYHIGYPINLSY  74

Query  1330  DHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGG  1151
             +H+ATLAPL+++HLNNCGDPF ++  DFHSKDFEV VLDWFA+LWEIEKDEYWGYIT+GG
Sbjct  75    EHHATLAPLLQFHLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGG  134

Query  1150  TEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSK  971
             TEGNLHG+L+GRE+HP GILYASK+SHYS+ KAAR+YRME++ IN+++NGE+DY+DL+SK
Sbjct  135   TEGNLHGLLVGRELHPSGILYASKDSHYSISKAARLYRMELQTINSLVNGEIDYEDLQSK  194

Query  970   LLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLK  791
             LL+NK KPAIIN+  GTT+K  +D++D+I++ LE CGYS D +YIHCDAAL GLIVPF+ 
Sbjct  195   LLVNKNKPAIININFGTTYKVAIDDVDMILQILENCGYSNDRYYIHCDAALYGLIVPFIN  254

Query  790   NVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRN  611
             +   I+FKK IGS+++SGHKFLGC MPCG+Q+T+++ I  IS+ VEYIAS+D TISGSRN
Sbjct  255   HAKIITFKKSIGSISVSGHKFLGCSMPCGVQITKRTYITTISKQVEYIASIDNTISGSRN  314

Query  610   GLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPD  431
             GL PIFLWYSLS KG AGLQKDA+ C E A +L+DRL  AGISAM+N+ S  VVFERP D
Sbjct  315   GLAPIFLWYSLSMKGNAGLQKDAKICYENARYLKDRLHKAGISAMLNEFSNIVVFERPCD  374

Query  430   RDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSH  251
               FIRRWQLSC RD AHV+VMPG   E IDNFF DLVQER  W       PCL DD+GS 
Sbjct  375   NKFIRRWQLSCARDTAHVVVMPGTTKEIIDNFFKDLVQEREKWCGI-TLGPCLADDIGSQ  433

Query  250   NCYC  239
             NC C
Sbjct  434   NCLC  437



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/426 (64%), Positives = 346/426 (81%), Gaps = 5/426 (1%)
 Frame = -2

Query  1492  KIAAPPA-RKNMHITVAEPRSKDDEA--RLKCTLGKFLDTISQRINYHIGYPVNIVYDHY  1322
             +I AP + RKN+ ++V E   K++ +  +L   L ++L+T+S+R  YHIGYP N+ Y+H+
Sbjct  17    EIDAPLSPRKNLCLSVVESDIKNETSFQKLDMILTQYLETLSKRKKYHIGYPTNMHYEHH  76

Query  1321  ATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEG  1142
             ATLAPL+++HLNN GDPF ++  DFHSKDFEV VLDWFA+LWEIEKDEYWGYIT+GGTEG
Sbjct  77    ATLAPLLQFHLNNFGDPFAQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEG  136

Query  1141  NLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLL  962
             NLHG+L+GRE+ P GILYASK+SHYS+FKAARMYRME++ INT++NGE+DY+DL+SKLL+
Sbjct  137   NLHGLLVGRELLPSGILYASKDSHYSIFKAARMYRMELQTINTLVNGEIDYEDLQSKLLV  196

Query  961   NKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVP  782
             NK KPAIIN+ IGTTFKG +D+LD +I+TLE CGYS D +YIHCDAAL GLI+PF+K+  
Sbjct  197   NKNKPAIININIGTTFKGAIDDLDFVIQTLENCGYSNDNYYIHCDAALCGLILPFIKHAK  256

Query  781   KISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLT  602
             KI+FKKPIGS++ISGHKFLGCPMPCGIQ+TRK+ +   S+ +EYI S DATISGSRNG T
Sbjct  257   KITFKKPIGSISISGHKFLGCPMPCGIQITRKTYVSTHSK-IEYINSTDATISGSRNGFT  315

Query  601   PIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDF  422
             PIFLWY LS KG A LQ+D+  C+E A +L+DRL  AGIS M+N+ SITV+FER  D  F
Sbjct  316   PIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEAGISVMLNEFSITVIFERSCDHKF  375

Query  421   IRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNC  245
             I RW L  +R MAHV+VMPG+  E ID+FF DL+QER  W+++G  QPPCL D+ GS NC
Sbjct  376   IHRWNLCYLRGMAHVVVMPGITRETIDSFFKDLMQERKRWFQDGKTQPPCLADEFGSQNC  435

Query  244   YCPLHK  227
              C  +K
Sbjct  436   MCSHNK  441



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/387 (68%), Positives = 320/387 (83%), Gaps = 2/387 (1%)
 Frame = -2

Query  1381  ISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAE  1202
             IS +I + +GYP NI  D Y  LAPL+RYHLNN GDPF EN    HS+ FEVGVLDWF++
Sbjct  31    ISHKILFILGYPHNIYCDEYVALAPLLRYHLNNFGDPFTENNYGMHSRHFEVGVLDWFSK  90

Query  1201  LWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEG  1022
             LWEIEKD+YWGY+T+ GTEGNLHGILLGRE  P+GILYAS ESHYSV KAARMY+ME E 
Sbjct  91    LWEIEKDQYWGYVTHCGTEGNLHGILLGREQFPDGILYASGESHYSVLKAARMYKMECEV  150

Query  1021  INTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEF  842
             I T++ GEMDY DLRSKLLLNK KPAI+++ IGTTFKGG+DNLDV+I+TL+ECGYSQD+F
Sbjct  151   IGTLLTGEMDYHDLRSKLLLNKNKPAILHLNIGTTFKGGIDNLDVVIETLKECGYSQDKF  210

Query  841   YIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISR  662
             YIHCDAAL GLI+PFLKN PKI+FKKPIGSV++SGHKFLGCPMPCGIQ+ RK  +  +SR
Sbjct  211   YIHCDAALCGLILPFLKNAPKITFKKPIGSVSVSGHKFLGCPMPCGIQIARKKHVDILSR  270

Query  661   NVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGIS  482
             N+EYIAS+DATISGSR G  PIFLWYSLS K    LQ DA+RC++ A +L+D L+ +GIS
Sbjct  271   NIEYIASIDATISGSRGGHAPIFLWYSLSKKCHTTLQDDAKRCIQNARYLKDSLRNSGIS  330

Query  481   AMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATW  302
             AM+N++SITVVFERP +++FI +WQLSC RDM HV+VMPGV  + +DNF ++  ++R  W
Sbjct  331   AMLNEHSITVVFERPLEQEFIHKWQLSCERDMTHVVVMPGVTTQMLDNFVSEFAKKRLIW  390

Query  301   YREGP--QPPCLEDDLGSHNCYCPLHK  227
             Y++G   QPPCL +D+G HNC CP HK
Sbjct  391   YQDGNKVQPPCLANDIGMHNCVCPHHK  417



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 324/395 (82%), Gaps = 5/395 (1%)
 Frame = -2

Query  1414  LKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKD  1235
             L   L ++L+T+S+R  YHIGYP+N+ Y+H+ATLAPL+++HLNNCGDPF ++  DFHSKD
Sbjct  14    LDMILTQYLETLSERKKYHIGYPINMCYEHHATLAPLLQFHLNNCGDPFTQHPTDFHSKD  73

Query  1234  FEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGR-EVHPEGILYASKESHYSVF  1058
             FEV VLDWFA+LWEIEKDEYWGYIT+GGTEGNLHG  LGR E+ P G LYASK+SHYS+F
Sbjct  74    FEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGFWLGRRELLPNGYLYASKDSHYSIF  133

Query  1057  KAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIK  878
             KAARMYRME++ INT++NGE+DY+DL+SKLL+NK KPAIIN+ IGTTFKG +D+LD +I+
Sbjct  134   KAARMYRMELQTINTLVNGEIDYEDLQSKLLVNKNKPAIININIGTTFKGAIDDLDFVIQ  193

Query  877   TLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQ  698
             TLE CGYS D +YIHCD AL GLI+PF+K+  KI+FKKPIGS++ISGHKFLGCPM CG+Q
Sbjct  194   TLENCGYSNDNYYIHCDRALCGLILPFIKHAKKITFKKPIGSISISGHKFLGCPMSCGVQ  253

Query  697   MTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETAT  518
             +TR+S +  +S+ +EYI S DATISGSRNG TPIFLWY LS KG A LQ+D+  C+E A 
Sbjct  254   ITRRSYVSTLSK-IEYINSADATISGSRNGFTPIFLWYCLSKKGHARLQQDSITCIENAR  312

Query  517   HLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDN  338
             +L+DRL  AGIS M+ND SITVVFERP D  FIRRW L C+R MAHV++MPG+  E ID+
Sbjct  313   YLKDRLLEAGISVMLNDFSITVVFERPCDHKFIRRWNLCCLRGMAHVVIMPGITRETIDS  372

Query  337   FFNDLVQERA-TWYRE-GPQPPCLEDDLGSHNCYC  239
             FF DL+QER   WY++    PPCL DDL   NC C
Sbjct  373   FFKDLMQERNYKWYQDVKALPPCLADDLAL-NCMC  406



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/472 (57%), Positives = 339/472 (72%), Gaps = 14/472 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPAR-----KNMHIT---V  1448
               E F P  VA     LP    +G+ +  D ++  K+       R     +N+H T   V
Sbjct  20    LSEGFDPTAVAPEPLPLPVTNGTGADQEEDNLKKTKVVTNGGGEREMVLGRNVHTTSLAV  79

Query  1447  AEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNN  1283
              EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +NN
Sbjct  80    TEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSINN  138

Query  1282  CGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHP  1103
              GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GREV P
Sbjct  139   LGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFP  198

Query  1102  EGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIG  923
             +GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK KPAI+NV IG
Sbjct  199   DGILYASSESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRRKLLANKDKPAILNVNIG  258

Query  922   TTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTI  743
             TT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV++
Sbjct  259   TTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSV  318

Query  742   SGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGR  563
             SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG 
Sbjct  319   SGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGY  378

Query  562   AGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMA  383
              G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP + +F+RRWQL+C  D+A
Sbjct  379   KGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIA  438

Query  382   HVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             HV+VMP V  E +D+F  DLV+ R  WY +G QPPCL  D+G +NC CP HK
Sbjct  439   HVVVMPSVTVEKLDHFLKDLVEHRLVWYEDGSQPPCLVKDVGINNCICPAHK  490



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/473 (57%), Positives = 341/473 (72%), Gaps = 17/473 (4%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARK------NMHIT---  1451
               EDF+P  V      LP+ V +G+  + +    KK K+      +      N+H T   
Sbjct  8     LSEDFVPTAVFNEP--LPWPVINGNKADHEGENLKKTKVMNGRGEREMVLGRNVHTTSLA  65

Query  1450  VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L ++ +N
Sbjct  66    VTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQQFSIN  124

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDP +E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GREV 
Sbjct  125   NLGDPVIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVF  184

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
             P+GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK KPAI+NV I
Sbjct  185   PDGILYASSESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRRKLLANKDKPAILNVNI  244

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV+
Sbjct  245   GTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVS  304

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             +SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+LS KG
Sbjct  305   VSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLSRKG  364

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  D+
Sbjct  365   YKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGDI  424

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             AHV+VMP V  E +D+F  DLV+ R+ WY +G QPPCL  D+G  NC CP HK
Sbjct  425   AHVVVMPSVTIEKLDHFLKDLVENRSVWYEDGSQPPCLVKDVGIKNCICPAHK  477



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/422 (61%), Positives = 322/422 (76%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  47    RNVHTTSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  105

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  106   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  165

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK 
Sbjct  166   GILVGREVFPDGILYASSESHYSVFKAARMYRMECERVDTLISGEIDCDDFRRKLLANKD  225

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  226   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  285

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  286   FNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLF  345

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+LS KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  346   LWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  405

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +D+F  DLV+ R+ WY +G QPPCL  D+G  NC CP 
Sbjct  406   WQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDGSQPPCLVKDVGIKNCICPA  465

Query  232   HK  227
             HK
Sbjct  466   HK  467



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/472 (56%), Positives = 340/472 (72%), Gaps = 14/472 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPAR-----KNMHIT---V  1448
               E F P  VA     LP    +G+ +  + ++  K+ I     R     +N+H T   V
Sbjct  20    LSEGFDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGGGEREMVLGRNVHTTSLAV  79

Query  1447  AEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNN  1283
              EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +NN
Sbjct  80    TEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSINN  138

Query  1282  CGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHP  1103
              GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GREV P
Sbjct  139   LGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFP  198

Query  1102  EGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIG  923
             +GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK KPAI+NV IG
Sbjct  199   DGILYASSESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRRKLLANKDKPAILNVNIG  258

Query  922   TTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTI  743
             TT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV++
Sbjct  259   TTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSV  318

Query  742   SGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGR  563
             SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG 
Sbjct  319   SGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGY  378

Query  562   AGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMA  383
              G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP + +F+RRWQL+C  D+A
Sbjct  379   KGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIA  438

Query  382   HVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             HV+VMP V  E +D+F  DLV+ R  WY +G +PPCL  D+G +NC CP HK
Sbjct  439   HVVVMPSVTVEKLDHFLKDLVEHRLVWYEDGSKPPCLVKDVGINNCICPAHK  490



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/422 (61%), Positives = 324/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   DD     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  65    RNIHTTSLAVTEPEVNDDFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  123

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  124   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  183

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK 
Sbjct  184   GILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRKKLLANKD  243

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  244   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  303

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  304   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLF  363

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  364   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  423

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +DNF  DLV+ R+ WY +G QPPCL  ++G++NC CP 
Sbjct  424   WQLACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDGTQPPCLVSEVGTNNCICPA  483

Query  232   HK  227
             HK
Sbjct  484   HK  485



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/472 (56%), Positives = 339/472 (72%), Gaps = 15/472 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPAR-----KNMHIT---V  1448
               +DF P  V   E L P   +     +G+    K +       R     +N+H T   V
Sbjct  20    LSDDFDPTAVVT-EPLPPSLTNGTGADHGEENPRKTVVTNGGGDREMVLGRNVHTTSLAV  78

Query  1447  AEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNN  1283
              EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +NN
Sbjct  79    TEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSINN  137

Query  1282  CGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHP  1103
              GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GRE+ P
Sbjct  138   LGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFP  197

Query  1102  EGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIG  923
             +GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D +D R KLL NK KPAI+NV IG
Sbjct  198   DGILYASSESHYSVFKAARMYRMECEKVDTLISGEIDCEDFRKKLLANKDKPAILNVNIG  257

Query  922   TTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTI  743
             TT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV++
Sbjct  258   TTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSV  317

Query  742   SGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGR  563
             SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG 
Sbjct  318   SGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGY  377

Query  562   AGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMA  383
              G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  D+A
Sbjct  378   KGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIA  437

Query  382   HVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             HV+VMP V  E +D+F  DLV+ R+ WY +G QPPCL  D+G++NC CP HK
Sbjct  438   HVVVMPSVTIEKLDHFLKDLVEHRSVWYEDGSQPPCLAKDVGTNNCICPTHK  489



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/465 (56%), Positives = 336/465 (72%), Gaps = 13/465 (3%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKD  1427
             +DF P  V       P   +  + K  + V   +  +      +N+H T   V EP   D
Sbjct  22    DDFDPTAVVTEPLPSPVTTNEENLKKTNGVGGDREMVLG----RNIHTTSLAVTEPEVND  77

Query  1426  D-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             D     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +NN GDPF+E
Sbjct  78    DFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIE  136

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             +    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GRE+ P+GILYAS
Sbjct  137   SNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREMFPDGILYAS  196

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             +ESHYSVFKAARMYRME E ++T+I+GE+D DD   KLL NK KPAI+NV IGTT KG +
Sbjct  197   RESHYSVFKAARMYRMECEKVDTLISGEIDCDDFSQKLLANKDKPAILNVNIGTTVKGAV  256

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV++SGHKF+G
Sbjct  257   DDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSVSGHKFVG  316

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ 
Sbjct  317   CPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEV  376

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  D+AHV+VMP 
Sbjct  377   QKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPS  436

Query  361   VAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             V  E +DNF  DLV+ R+ WY +G QPPCL  ++G++NC CP HK
Sbjct  437   VTIEKLDNFVKDLVKHRSVWYEDGTQPPCLVSEVGTNNCLCPAHK  481



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/466 (57%), Positives = 343/466 (74%), Gaps = 19/466 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKD  1427
             EDF    V  PE L P      + +NGD    +++ +      KN+H T   V EP + D
Sbjct  18    EDFDISAVVQPEPLPPIL----AAENGDKQNGREIVLG-----KNVHTTCLEVTEPEAND  68

Query  1426  D-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             +     EA +   L ++   + +R  YH+GYP N+ +D Y  L  L  + +NN GDPF+E
Sbjct  69    EFTGDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIE  127

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             +    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLHGIL+GREV P+G+LYAS
Sbjct  128   SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVLPDGVLYAS  187

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             +ESHYSVFKAARMYRM+ E ++ +I+GE+D  D ++KLL NK KPAIINV IGTT KG +
Sbjct  188   RESHYSVFKAARMYRMDCEKVDCLISGEIDTADFKAKLLANKDKPAIINVNIGTTVKGAV  247

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD++I+TLEE G+SQD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+G
Sbjct  248   DDLDLVIQTLEESGFSQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVG  307

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCG+Q+TR   I  +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ 
Sbjct  308   CPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEV  367

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VMP 
Sbjct  368   QKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQLACQGNIAHVVVMPS  427

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             V  E +D+F N+LV++R+TWYR+G  QPPC+  D+G  NC C LHK
Sbjct  428   VTIEKLDDFLNELVEKRSTWYRDGGVQPPCIAADVGCENCACALHK  473



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/472 (56%), Positives = 340/472 (72%), Gaps = 14/472 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPAR-----KNMHIT---V  1448
               E F P  VA     LP    +G+ +  + ++  K+ I     R     +N+H T   V
Sbjct  20    LSEGFDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGGGEREMVLGRNVHTTSLAV  79

Query  1447  AEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNN  1283
              EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +NN
Sbjct  80    TEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSINN  138

Query  1282  CGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHP  1103
              GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GREV P
Sbjct  139   LGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVFP  198

Query  1102  EGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIG  923
             +GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK KPAI+NV IG
Sbjct  199   DGILYASSESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRRKLLANKDKPAILNVNIG  258

Query  922   TTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTI  743
             TT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV++
Sbjct  259   TTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSV  318

Query  742   SGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGR  563
             SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG 
Sbjct  319   SGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGY  378

Query  562   AGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMA  383
              G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP + +F+RRWQL+C  D+A
Sbjct  379   KGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIA  438

Query  382   HVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             HV+VMP V  E +D+F  DLV+ R  WY +G +PPCL  D+G +NC CP HK
Sbjct  439   HVVVMPSVTVEKLDHFLKDLVEHRLVWYEDGCKPPCLVKDVGINNCICPAHK  490



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/473 (57%), Positives = 341/473 (72%), Gaps = 17/473 (4%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARK------NMHIT---  1451
               + F P  VA PE L P  V +G+  + +    KK K+      +      N+H T   
Sbjct  20    LSDGFDPTAVA-PEPL-PLPVTNGTGADQEEENLKKTKVVNGGGEREMVLGRNVHTTSLA  77

Query  1450  VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L  L  + +N
Sbjct  78    VTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALGQLQHFSIN  136

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLHGIL+GREV 
Sbjct  137   NLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGILVGREVF  196

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
             P+GILYAS ESHYSVFKAARMYRME + ++T+I+GE+D DD R KLL NK KPAI+NV I
Sbjct  197   PDGILYASSESHYSVFKAARMYRMECQKVDTLISGEIDCDDFRRKLLANKDKPAILNVNI  256

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++F KPIGSV+
Sbjct  257   GTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVS  316

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             +SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+FLWY+L+ KG
Sbjct  317   VSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKG  376

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP + +F+RRWQL+C  D+
Sbjct  377   YKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQLACQGDI  436

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             AHV+VMP V  E +D+F  DLV+ R  WY +G QPPCL  D+G +NC CP HK
Sbjct  437   AHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDGSQPPCLVKDVGINNCICPAHK  489



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/422 (60%), Positives = 323/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  70    RNIHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  128

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  129   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  188

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK 
Sbjct  189   GILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRKKLLANKD  248

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  249   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  308

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  309   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLF  368

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  369   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  428

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +DNF  DLV+ R  WY +G QPPCL  ++G++NC CP 
Sbjct  429   WQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLVWYEDGTQPPCLVSEVGTNNCICPA  488

Query  232   HK  227
             HK
Sbjct  489   HK  490



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/483 (56%), Positives = 346/483 (72%), Gaps = 18/483 (4%)
 Frame = -2

Query  1645  VLTSVSKNRMGTLAFDEDFMPMGVAAPEALLPFFVHS--GSFKNGDFVENKKMKIAAPPA  1472
             V+ S+     G    D  F P  V  PE L+P  V S   +  NG   E K+  +     
Sbjct  7     VIESMGSAVNGKEVADVRFDPTAVV-PE-LVPAVVKSEVDAAVNGGGQEQKREIVLG---  61

Query  1471  RKNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
              +N+H    +V EP + DD     EA +   L ++  T++ R  YH+GYP N+ +D Y  
Sbjct  62    -RNIHTSSFSVTEPDADDDSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFD-YGA  119

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LW+IEKDEYWGYITN GTEGNL
Sbjct  120   LTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNL  179

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             HGIL+GREV PEGILYASKESHYS+FKAARMYRME E + T++ GE+D  D + KLL NK
Sbjct  180   HGILVGREVFPEGILYASKESHYSIFKAARMYRMECEKVGTLLTGEIDCADFKVKLLANK  239

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
              KPAIINV IGTT KG +D+LD++IKTLE+CG+S D FYIHCD AL GL++PF+K  PK+
Sbjct  240   DKPAIINVNIGTTVKGAVDDLDLVIKTLEDCGFSHDRFYIHCDGALFGLMMPFVKRAPKV  299

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             +FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  P+
Sbjct  300   TFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPL  359

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+R
Sbjct  360   FLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVR  419

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYC  239
             +WQL+C R+MAHV+VMP V  + +DNF ++LV+ R+ WY+ E  +PPCL  D+GS NC C
Sbjct  420   KWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCCC  479

Query  238   PLH  230
             P H
Sbjct  480   PQH  482



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/487 (56%), Positives = 351/487 (72%), Gaps = 24/487 (5%)
 Frame = -2

Query  1645  VLTSVSKNRMGT-LAFDEDFMPMGVAAPEALLPFFVHS----GSFKNGDFVENKKMKIAA  1481
             V+ SVS   +G  +A D  F    VA P   +P  V S    G+  +G   E +K +I  
Sbjct  7     VIESVSSAVIGKEVAADSQFDLTAVAEP---VPAVVKSEDVDGAVNDG---EEQKREIVL  60

Query  1480  PPARKNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDH  1325
                 +N+H T   V EP + D+     EA +   L ++  T++ R  YH+GYP N+ +D 
Sbjct  61    G---RNIHTTCLAVTEPDADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFD-  116

Query  1324  YATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTE  1145
             Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTE
Sbjct  117   YGALTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTE  176

Query  1144  GNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLL  965
             GNLHGIL+GREV PEGILYASKESHYSVFKAARMYRME   ++T++ GE+D  DL+ KLL
Sbjct  177   GNLHGILVGREVFPEGILYASKESHYSVFKAARMYRMECVKVDTLLTGEIDCADLKVKLL  236

Query  964   LNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNV  785
              NK KPAI+NV IGTT KG +D+LD++IKTLEECG+SQD FYIHCD AL GL++PF+K  
Sbjct  237   ANKDKPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSQDRFYIHCDGALFGLMMPFVKRA  296

Query  784   PKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGL  605
             P+++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG 
Sbjct  297   PQVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGH  356

Query  604   TPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRD  425
              P+FLW +L+ KG  G QK+ Q+C+  A +L+DRL  AGIS M+N+ S TVVFERP D +
Sbjct  357   APLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISGMLNELSSTVVFERPKDEE  416

Query  424   FIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHN  248
             F+R+WQL+C R+M+HV+VMP V  E +D+F ++LV+ R+ WY+ E   PPCL  D+GS N
Sbjct  417   FVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVNPPCLAADIGSRN  476

Query  247   CYCPLHK  227
             C CP H+
Sbjct  477   CCCPQHR  483



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/466 (57%), Positives = 342/466 (73%), Gaps = 19/466 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKD  1427
             EDF    V  PE L P      + +NGD    +++ +      KN+H T   V EP + D
Sbjct  18    EDFDISAVVQPEPLPPIV----AAENGDKQNGREIVLG-----KNVHTTCLEVTEPEAND  68

Query  1426  D-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             +     EA +   L ++   + +R  YH+GYP N+ +D Y  L  L  + +NN GDPF+E
Sbjct  69    EFTGDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIE  127

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
             +    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLHGIL+GREV P+G+LYAS
Sbjct  128   SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGVLYAS  187

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             +ESHYSVFKAARMYRM+ E ++ +I+GE+D  D ++KLL NK KPAIINV IGTT KG +
Sbjct  188   RESHYSVFKAARMYRMDCEKVDCLISGEIDCADFKAKLLANKDKPAIINVNIGTTVKGAV  247

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLG  722
             D+LD++I+TLEE G+SQD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+G
Sbjct  248   DDLDLVIQTLEESGFSQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVG  307

Query  721   CPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             CPMPCG+Q+TR   I  +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ 
Sbjct  308   CPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEV  367

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VMP 
Sbjct  368   QKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQLACQGNIAHVVVMPS  427

Query  361   VAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             V  E +D+F N+LV++R+ WYR+G  QPPC+  D+G  NC C LHK
Sbjct  428   VTIEKLDDFLNELVEKRSIWYRDGGVQPPCIAADVGCENCACALHK  473



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/422 (61%), Positives = 325/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   +T+ EP   D+     EA++   L ++   + +R  YH+GYP N+ +D Y  L
Sbjct  58    RNVHSTCLTITEPEVNDEVTGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFD-YGAL  116

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKDEYWGYITN GTEGNLH
Sbjct  117   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLH  176

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++T+++GE+D  DLR KLL NK 
Sbjct  177   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDTLVSGEIDCSDLRPKLLANKD  236

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LDV+IKTLEECG+S D FYIHCD AL GL++PF+K  PK+S
Sbjct  237   KPAILNVNIGTTVKGAVDDLDVVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVS  296

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  P+F
Sbjct  297   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLF  356

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QKD Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  357   LWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRR  416

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V  E +D F N+LV++R+TWY+   QPPC+  ++G  NC C L
Sbjct  417   WQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQGNVQPPCIAAEIGKANCVCAL  476

Query  232   HK  227
             HK
Sbjct  477   HK  478



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/485 (56%), Positives = 346/485 (71%), Gaps = 19/485 (4%)
 Frame = -2

Query  1645  VLTSVSKNRMGTLAFDEDFMPMGVAAPEALLPFFVHSGSFK---NGDFVENKKMKIAAPP  1475
             V+ S+S    G    D  F P  V  PE L+P  V S       NG   E ++  +    
Sbjct  7     VIESMSSAVNGKEVADVRFDPTAVV-PE-LVPAVVKSEGVDAAVNGGGEEQEREIVLG--  62

Query  1474  ARKNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYA  1319
               +N+H    +V EP + DD     EA +   L ++  T++ R  YH+GYP N+ +D Y 
Sbjct  63    --RNIHTSSFSVTEPDADDDSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFD-YG  119

Query  1318  TLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGN  1139
              L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LW+IEKDEYWGYITN GTEGN
Sbjct  120   ALTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGN  179

Query  1138  LHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLN  959
             LHGIL+GREV PEGILYASKESHYS+FKAARMYRME E + T++ GE+D  D + KLL N
Sbjct  180   LHGILVGREVFPEGILYASKESHYSIFKAARMYRMECEKVGTLLTGEIDCADFKVKLLAN  239

Query  958   KGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPK  779
             K KPAIINV IGTT KG +D+LD++IKTLE+CG+S D FYIHCD AL GL++PF+K  PK
Sbjct  240   KDKPAIINVNIGTTVKGAVDDLDLVIKTLEDCGFSHDRFYIHCDGALFGLMMPFVKRTPK  299

Query  778   ISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTP  599
             ++F KPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  P
Sbjct  300   VTFNKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAP  359

Query  598   IFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFI  419
             +FLWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+
Sbjct  360   LFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFV  419

Query  418   RRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCY  242
             R+WQL+C R+MAHV+VMP V  + +DNF ++LV+ R+ WY+ E  +PPCL  D+GS NC 
Sbjct  420   RKWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCC  479

Query  241   CPLHK  227
             CP H+
Sbjct  480   CPHHR  484



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 323/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     EA +   L ++  T+ +R   H+GYP N+ +D Y  L
Sbjct  62    RNIHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYPYNLDFD-YGAL  120

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  121   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  180

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSVFKAARMYRME E ++T+++GE+D DDLR KLL NK 
Sbjct  181   GILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLMSGEIDCDDLRKKLLANKD  240

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  241   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  300

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  301   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLF  360

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  361   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  420

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +DNF  DLV+ R  WY +G QPPCL  ++G++NC CP 
Sbjct  421   WQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYEDGSQPPCLASEVGTNNCICPA  480

Query  232   HK  227
             HK
Sbjct  481   HK  482



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 323/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  122   RNIHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  180

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  181   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  240

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSVFKAARMYRME E ++T+I+GE+D DD R KLL NK 
Sbjct  241   GILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLISGEIDCDDFRKKLLANKD  300

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  301   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  360

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  361   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLF  420

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+D+L+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  421   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLREAGISAMLNELSSTVVFERPKDEEFVRR  480

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +D+F  DLV+ R  WY +G QPPCL  ++G++NC CP 
Sbjct  481   WQLACQGDIAHVVVMPSVTIEKLDDFLKDLVKHRLVWYEDGTQPPCLASEVGTNNCICPA  540

Query  232   HK  227
             HK
Sbjct  541   HK  542



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/494 (54%), Positives = 348/494 (70%), Gaps = 28/494 (6%)
 Frame = -2

Query  1636  SVSKNRMGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENK----KMKIAAPPAR  1469
             +V+ N        EDF P  V A E L P          GDF E+     K K+      
Sbjct  9     TVAMNGKAVEILSEDFDPTAVVA-EPLPPLAETVNGV--GDFEEDDVCPVKEKVKNTTTT  65

Query  1468  ------------KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGY  1349
                         +N+H T   V EP + DD     EA +   L ++  T+ +R  +H+GY
Sbjct  66    EMNGGEKEIVLGRNVHTTCLAVTEPEANDDFTGDKEAYMASVLARYRKTLVERTKHHLGY  125

Query  1348  PVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWG  1169
             P N+ +D Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD+YWG
Sbjct  126   PYNLDFD-YGALGQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWG  184

Query  1168  YITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDY  989
             YITN GTEGNLHGIL+GREV P+G+LYAS+ESHYSVFKAARMYRME   ++T+I+GE+D 
Sbjct  185   YITNCGTEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMYRMECVKVDTLISGEIDC  244

Query  988   DDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGL  809
              D + KLL NKGKPAIINV IGTT KG +D+LD++I+TL+E G+SQD FYIHCD AL GL
Sbjct  245   KDFKEKLLANKGKPAIINVNIGTTVKGAVDDLDLVIETLKENGFSQDRFYIHCDGALFGL  304

Query  808   IVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDAT  629
             ++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I  +SRNVEY+AS DAT
Sbjct  305   MMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSRNVEYLASRDAT  364

Query  628   ISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVV  449
             I GSRNG  P+FLWY+LS KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVV
Sbjct  365   IMGSRNGHAPLFLWYTLSQKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVV  424

Query  448   FERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLE  269
             FERP D +F+RRWQL+C  ++AHV+VMP V+   +D+F N+LV++R+ WY++  QPPC+ 
Sbjct  425   FERPKDEEFVRRWQLACQGNIAHVVVMPSVSIGKLDSFLNELVEQRSLWYKDESQPPCVA  484

Query  268   DDLGSHNCYCPLHK  227
              D+G+ NC CP HK
Sbjct  485   SDVGTENCICPTHK  498



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 342/477 (72%), Gaps = 19/477 (4%)
 Frame = -2

Query  1615  GTLAFDEDFMPMGVAAPEALLPFFVHSGSF-----KNGDFVENKKMKIAAPPARKNMHIT  1451
             G+LA  +    + VA  E+  P  V +         NG   E  +  +      KN+H T
Sbjct  16    GSLAIGKSMERLRVANGESFDPMAVVTEPVPPVADSNGHDAEKGREIVLG----KNVHTT  71

Query  1450  ---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRY  1295
                V EP + D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  LA L  +
Sbjct  72    CLEVTEPDADDESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGALAQLQHF  130

Query  1294  HLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGR  1115
              +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK++YWGYITN GTEGNLHGIL+GR
Sbjct  131   SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNDYWGYITNCGTEGNLHGILVGR  190

Query  1114  EVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIIN  935
             EV P+GILYASKESHYSVFKAARMYRME   + T++ GE+D  D + KLL NK KPAIIN
Sbjct  191   EVFPDGILYASKESHYSVFKAARMYRMECVKVATLVTGEIDCTDFKRKLLPNKDKPAIIN  250

Query  934   VTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIG  755
             V IGTT KG +D+LD++I+TLEECGYS D FYIHCD AL GL++PF+K  PK+SFKKPIG
Sbjct  251   VNIGTTVKGAVDDLDLVIQTLEECGYSHDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIG  310

Query  754   SVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLS  575
             SV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  311   SVSVSGHKFVGCPMPCGVQLTRLQHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLN  370

Query  574   TKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCV  395
              KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C 
Sbjct  371   RKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRRWQLACE  430

Query  394   RDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
              +MAHV+VMP V  E +D F N+++Q R+ WY++G   PPCL  D+GS+NC C LHK
Sbjct  431   GNMAHVVVMPSVTVEKLDFFLNEIIQGRSIWYKDGNVHPPCLAADIGSNNCSCALHK  487



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 324/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  52    RNVHTTSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  110

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  111   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  170

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS ESHYSVFKAARMYRME + ++T+I+GE+D DDLR KLL NK 
Sbjct  171   GILVGREMLPDGILYASTESHYSVFKAARMYRMECDKVDTLISGEIDCDDLRGKLLANKD  230

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  231   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  290

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  291   FNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLF  350

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  351   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  410

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V  E +D+F  DLV+ R+ W ++G Q PCL  D+G++NC CP 
Sbjct  411   WQLACQGEIAHVVVMPSVTIEKLDHFLKDLVEHRSIWCKDGSQTPCLAKDVGTNNCVCPA  470

Query  232   HK  227
             HK
Sbjct  471   HK  472



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 324/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  52    RNVHTTSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  110

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  111   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  170

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS ESHYSVFKAARMYRME + ++T+I+GE+D DDLR KLL NK 
Sbjct  171   GILVGREMLPDGILYASTESHYSVFKAARMYRMECDKVDTLISGEIDCDDLRGKLLANKD  230

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  231   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  290

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  291   FNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLF  350

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  351   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRR  410

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  + +D+F  DLV+ R+ W ++G Q PCL  D+G++NC CP 
Sbjct  411   WQLACQGDIAHVVVMPSVTIKKLDHFLKDLVEHRSIWCKDGSQTPCLAKDVGTNNCVCPA  470

Query  232   HK  227
             HK
Sbjct  471   HK  472



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 327/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S DD     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  59    RNVHTTCLAVTEPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P+GILYAS+ESHYS+FKAARMYRME E I+ +I+GE+D  D ++KLL ++ 
Sbjct  178   GVLVGREVFPDGILYASRESHYSIFKAARMYRMECEKIDCLISGEIDCADFKTKLLAHQD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEECGY QD FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAIINVNIGTTVKGAVDDLDLVIRTLEECGYKQDRFYIHCDGALFGLMMPFVKRAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG +G QK+ Q+C+  A +L+ RL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  358   LWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRR  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V  E +D+F ++LV++R+TWY E  QPPC+  D+G+ NC C  
Sbjct  418   WQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYDEKVQPPCIAADVGTENCSCGQ  477

Query  232   HK  227
             HK
Sbjct  478   HK  479



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 327/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S DD     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  59    RNVHTTCLAVTEPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P+GILYAS+ESHYS+FKAARMYRME E I+ +I+GE+D  D ++KLL ++ 
Sbjct  178   GVLVGREVFPDGILYASRESHYSIFKAARMYRMECEKIDCLISGEIDCADFKTKLLAHQD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEECGY QD FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAIINVNIGTTVKGAVDDLDLVIQTLEECGYKQDRFYIHCDGALFGLMMPFVKRAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG +G QK+ Q+C+  A +L+ RL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  358   LWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRR  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V  E +D+F ++LV++R+TWY E  QPPC+  D+G+ NC C  
Sbjct  418   WQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYDEKVQPPCIAADVGTENCSCGQ  477

Query  232   HK  227
             HK
Sbjct  478   HK  479



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/422 (60%), Positives = 322/422 (76%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     EA +   L ++  T+ +R   H+GYP N+ +D Y  L
Sbjct  69    RNVHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYPYNLDFD-YGAL  127

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  128   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  187

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSVFKAARMYRME E ++T+I+GE+D +D R KL+ NK 
Sbjct  188   GILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLISGEIDCNDFRLKLMANKD  247

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  248   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  307

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  308   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLF  367

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  +GISAM+N+ S TVVFERP D +F+RR
Sbjct  368   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCESGISAMLNELSSTVVFERPKDEEFVRR  427

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +D+F  DLVQ R+ WY +G QPPCL  ++G+HNC CP 
Sbjct  428   WQLACQGDIAHVVVMPSVTIEKLDSFLKDLVQHRSVWYADGSQPPCLVSEVGTHNCICPA  487

Query  232   HK  227
             HK
Sbjct  488   HK  489



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/469 (56%), Positives = 342/469 (73%), Gaps = 12/469 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKN-GDFVENKK-MKIAAPPARKNMHIT---VAEP  1439
               +DF P  V A E L P    +      G   E++K  +       +N+H T   V EP
Sbjct  13    LSDDFDPTAVVA-EPLPPVVTSTDDCDLLGKLAEDRKGSREKQMVLGRNVHTTCLAVTEP  71

Query  1438  RSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGD  1274
              S DD     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L  L  + +NN GD
Sbjct  72    ESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFD-YGALTQLQHFSINNLGD  130

Query  1273  PFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGI  1094
             PF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLHG+L+GREV P+GI
Sbjct  131   PFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVLVGREVFPDGI  190

Query  1093  LYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTF  914
             LYAS+ESHYS+FKAARMYRME E I+ +I+GE+D  D ++KLL ++ KPAIINV IGTT 
Sbjct  191   LYASRESHYSIFKAARMYRMECEKIDCLISGEIDCADFKTKLLAHQDKPAIINVNIGTTV  250

Query  913   KGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGH  734
             KG +D+LD++I+TLEECGY QD FYIHCD AL GL++PF+K  PK+SFKKPIGSV++SGH
Sbjct  251   KGAVDDLDLVIQTLEECGYKQDRFYIHCDGALFGLMMPFVKRAPKVSFKKPIGSVSVSGH  310

Query  733   KFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
             KF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG +G 
Sbjct  311   KFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYSGF  370

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             QK+ Q+C+  A +L+ RL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+
Sbjct  371   QKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVV  430

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLHK  227
             VMP V  E +D+F N+LV++R+TWY E  Q PC+  D+G+ NC C  HK
Sbjct  431   VMPSVNIEKLDDFLNELVEKRSTWYDEKVQAPCIAADVGTENCSCGQHK  479



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 328/422 (78%), Gaps = 10/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H T   V EP + D+     EA +   L ++  ++ +R  +H+GYP N+ +D Y  L
Sbjct  57    KNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSLMERTKHHLGYPYNLDFD-YGAL  115

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+++WGYITN GTEGNLH
Sbjct  116   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNDFWGYITNCGTEGNLH  175

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++T+I+GE+D  D R+KLL NKG
Sbjct  176   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDTLISGEIDCADFRAKLLANKG  235

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLE CG+S+D FYIHCD AL GL++PF+K  PK+S
Sbjct  236   KPAIINVNIGTTVKGAVDDLDLVIQTLEGCGFSRDRFYIHCDGALFGLMMPFVKRAPKVS  295

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   ++ +S NVEY+AS DATI GSRNG  PIF
Sbjct  296   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIF  355

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G  K+ Q+C+  A +L+D+L+AAGI AM+N+ S TVVFERP D DF+RR
Sbjct  356   LWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRR  415

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V+ E +D F N+LV+ R+TWY+E  QPPC+  D+G  NC CPL
Sbjct  416   WQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQE-QQPPCIAADIGKENCACPL  474

Query  232   HK  227
             HK
Sbjct  475   HK  476



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 345/469 (74%), Gaps = 15/469 (3%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKN--GDFVENKKMKIAAPPAR-KNMHIT---VAEPR  1436
             EDF P  V A    LP  V S    +  G F E+ K  +  P    +N+H T   V EP 
Sbjct  15    EDFDPTAVVAEP--LPTVVTSDVNCDLIGKFAEDLKSSLEKPMVLGRNVHTTCLAVTEPE  72

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             + D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L  L  + +NN GDP
Sbjct  73    ANDEFTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFD-YGALTQLQHFSINNLGDP  131

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWEIEK +YWGYITN GTEGNLHG+L+GREV P+GIL
Sbjct  132   FIESNYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVLVGREVFPDGIL  191

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYS+FKAARMYRME   ++ +I+GE+D  D R+KL+LNK KPAIINV IGTT K
Sbjct  192   YASRESHYSIFKAARMYRMECVKVDCLISGEIDCKDFRAKLVLNKDKPAIINVNIGTTVK  251

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++I+TLEECG+ QD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHK
Sbjct  252   GAVDDLDLVIQTLEECGFKQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHK  311

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G Q
Sbjct  312   FVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYKGFQ  371

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             K+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+V
Sbjct  372   KEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVV  431

Query  370   MPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLHK  227
             MP V  + +D+F N+LV++R+TWY+ E  QPPC+  D+G+ NC C  H+
Sbjct  432   MPSVNIDKLDDFLNELVEKRSTWYKDEKVQPPCIAVDVGTENCACGQHQ  480



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/418 (60%), Positives = 325/418 (78%), Gaps = 7/418 (2%)
 Frame = -2

Query  1462  MHITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             M + V EP + D+     EA +   L ++  ++ +R  +H+GYP N+ +D Y  LA L  
Sbjct  67    MCLAVTEPDADDEVTGEREAYMASVLARYRKSLIERTKHHLGYPYNLDFD-YGALAQLQH  125

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+G
Sbjct  126   FSINNLGDPFIESNYGVHSRQFEVGVLDWFAHLWELEKDEYWGYITNCGTEGNLHGILVG  185

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             REV P+GILYAS+ESHYSVFKAARMYRME   I TM +GE+D DD ++KLL NK KPAII
Sbjct  186   REVFPDGILYASRESHYSVFKAARMYRMECIKIETMASGEIDCDDFKAKLLPNKDKPAII  245

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
             NV IGTT KG +D+LD++IKTLE+ G++ D+FYIHCD AL GL++PF+K  PK++FKKPI
Sbjct  246   NVNIGTTVKGAVDDLDLVIKTLEDTGFTHDQFYIHCDGALFGLMMPFVKRAPKVTFKKPI  305

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSL  578
             GSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L
Sbjct  306   GSVSVSGHKFVGCPMPCGVQITRLEHINTLSRNVEYLASRDATIMGSRNGHAPIFLWYTL  365

Query  577   STKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSC  398
             + KG  G QK+ Q+C+  A +L+DRL+AAGI AM+N+ S TVVFERP D +F+RRWQL+C
Sbjct  366   NRKGYRGFQKEVQKCLRNAHYLKDRLRAAGIGAMLNELSSTVVFERPQDEEFVRRWQLAC  425

Query  397   VRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
               ++AHV+VMP +  E +DNF N+L+Q+R TW+++G  QPPC+  D+G  NC C LHK
Sbjct  426   QGNIAHVVVMPNITIEKLDNFLNELIQKRLTWFQDGKSQPPCIAADVGKENCACVLHK  483



>ref|XP_004290538.1| PREDICTED: histidine decarboxylase-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 346/468 (74%), Gaps = 14/468 (3%)
 Frame = -2

Query  1603  FDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRS  1433
               E F P  V A E L P    +G+       +  K +I      +N+H T   V EP +
Sbjct  14    LSEHFDPTAVVA-EPLPPVVTTNGNLIGKVAEDPNKREIVLG---RNVHTTCLAVTEPDA  69

Query  1432  KDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPF  1268
              D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L+ L  + +NN GDPF
Sbjct  70    NDEFTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGALSQLQHFSINNLGDPF  128

Query  1267  MENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILY  1088
             +E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLHGIL+GREVHP+GILY
Sbjct  129   IESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVHPDGILY  188

Query  1087  ASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKG  908
             ASK++HYS+FKAARMYRME   ++T+++GE+D  D R+KLL NK KPAIINV IGTT KG
Sbjct  189   ASKDTHYSIFKAARMYRMECVKVDTLMSGEIDCADFRAKLLANKDKPAIINVNIGTTVKG  248

Query  907   GMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKF  728
              +D+LD++IKTLEECG++ D FYIHCD AL GL++PF+K  PK+SFKKPIGSV++SGHKF
Sbjct  249   AVDDLDLVIKTLEECGFNHDRFYIHCDGALFGLMMPFVKLAPKVSFKKPIGSVSVSGHKF  308

Query  727   LGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQK  548
             +GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK
Sbjct  309   VGCPMPCGVQITRLEHINVLSNNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQK  368

Query  547   DAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVM  368
             + Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VM
Sbjct  369   EVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVM  428

Query  367   PGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             P V+ + +D+F N+LV++R+TWY++G  QPPC+  D+GS NC C  HK
Sbjct  429   PSVSVDKLDDFLNELVEKRSTWYKDGKVQPPCIAADVGSENCVCGRHK  476



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/487 (55%), Positives = 350/487 (72%), Gaps = 24/487 (5%)
 Frame = -2

Query  1645  VLTSVSKNRMGT-LAFDEDFMPMGVAAPEALLPFFVHS----GSFKNGDFVENKKMKIAA  1481
             V+ SVS   +G  +A D       VA P   +P  V S    G+  +G   E +K +I  
Sbjct  7     VIESVSSAVIGKEVAADSRLDLTTVAEP---VPPVVKSDDVDGAVNDG---EEQKREIVL  60

Query  1480  PPARKNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDH  1325
                 +N+H T   V EP + D+     EA +   L ++  T++ R  YH+GYP N+ +D 
Sbjct  61    G---RNIHTTCLAVTEPDADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFD-  116

Query  1324  YATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTE  1145
             Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTE
Sbjct  117   YGALTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTE  176

Query  1144  GNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLL  965
             GNLHGIL+GREV PEGILYASKESHYSVFKAARMYRME   ++T++ GE+D  D + KLL
Sbjct  177   GNLHGILVGREVFPEGILYASKESHYSVFKAARMYRMECVKVDTLLTGEIDCADFKVKLL  236

Query  964   LNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNV  785
              NK KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  
Sbjct  237   ANKDKPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRA  296

Query  784   PKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGL  605
             P+++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG 
Sbjct  297   PQVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGH  356

Query  604   TPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRD  425
              P+FLW +L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +
Sbjct  357   APLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEE  416

Query  424   FIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHN  248
             F+R+WQL+C R+M+HV+VMP V  E +D+F ++LV+ R+ WY+ E  +PPCL  D+GS N
Sbjct  417   FVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGSQN  476

Query  247   CYCPLHK  227
             C CP H+
Sbjct  477   CCCPQHR  483



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/469 (56%), Positives = 343/469 (73%), Gaps = 15/469 (3%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKN--GDFVENKKMKIAAPPAR-KNMHIT---VAEPR  1436
             EDF P  V A    LP  V S    +  G   E+ K  +  P    +N+H T   V EP 
Sbjct  15    EDFDPTAVVAEP--LPTVVTSDVNCDLIGKLAEDLKGSLEKPMVLGRNVHTTCLAVTEPE  72

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             + D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L  L  + +NN GDP
Sbjct  73    ANDEFTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFD-YGALTQLQHFSINNLGDP  131

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWEIEK +YWGYITN GTEGNLHG+L+GREV P+GIL
Sbjct  132   FIESNYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVLVGREVFPDGIL  191

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYS+FKAARMYRME   ++ +I+GE+D  D R+KL+LNK KPAIINV IGTT K
Sbjct  192   YASRESHYSIFKAARMYRMECVKVDCLISGEIDCKDFRAKLVLNKDKPAIINVNIGTTVK  251

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++I+TLEECG+ QD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHK
Sbjct  252   GAVDDLDLVIQTLEECGFKQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHK  311

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G Q
Sbjct  312   FVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYKGFQ  371

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             K+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+V
Sbjct  372   KEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVV  431

Query  370   MPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLHK  227
             MP V  + +D+F N+LV++R+TWY  E  QPPC+  D+G+ NC C  HK
Sbjct  432   MPSVNIDKLDDFLNELVEKRSTWYNDEKVQPPCIAADVGTENCACGQHK  480



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 340/469 (72%), Gaps = 18/469 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFF---VHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPR  1436
             EDF  M +      L      + +G  +NG   EN + KI      +N+H T   V EP 
Sbjct  6     EDFSSMTIMRDHVTLTIGENGIGNGVVQNG--TENGERKIVLG---RNIHTTCLEVTEPD  60

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
               D+     EA +   L K+  ++++R NYH+GYP N+ +D Y  L+ L  + +NN GDP
Sbjct  61    IDDEVTGEREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFD-YDALSQLQHFSINNLGDP  119

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GIL
Sbjct  120   FIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  179

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYSVFKAARMYRME   INT+ +GE+D DD ++KLL +K KPAI+NV IGTT K
Sbjct  180   YASQESHYSVFKAARMYRMECVKINTLWSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVK  239

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++IK LEE G+SQD FYIHCD AL GL++PF+K  PKISFKKPIGSV++SGHK
Sbjct  240   GAVDDLDLVIKKLEEAGFSQDRFYIHCDGALFGLMLPFVKRAPKISFKKPIGSVSVSGHK  299

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   ++ +SRNVEY+AS DATI GSRNG  PIFLWYSL+ KG  G Q
Sbjct  300   FVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQ  359

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             K+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D  F+ +WQL+C  ++AHV+V
Sbjct  360   KEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVV  419

Query  370   MPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             MP V  E +D+F N+LVQ+RA W+R+G  QP C+  D+G  NC C LH+
Sbjct  420   MPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  468



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 340/469 (72%), Gaps = 18/469 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFF---VHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPR  1436
             EDF  M +      L      + +G  +NG   EN + KI      +N+H T   V EP 
Sbjct  23    EDFSSMTIMRDHVTLTIGENGIGNGVVQNG--TENGERKIVLG---RNIHTTCLEVTEPD  77

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
               D+     EA +   L K+  ++++R NYH+GYP N+ +D Y  L+ L  + +NN GDP
Sbjct  78    IDDEVTGEREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFD-YDALSQLQHFSINNLGDP  136

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GIL
Sbjct  137   FIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  196

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYSVFKAARMYRME   INT+ +GE+D DD ++KLL +K KPAI+NV IGTT K
Sbjct  197   YASQESHYSVFKAARMYRMECVKINTLWSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVK  256

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++IK LEE G+SQD FYIHCD AL GL++PF+K  PKISFKKPIGSV++SGHK
Sbjct  257   GAVDDLDLVIKKLEEAGFSQDRFYIHCDGALFGLMLPFVKRAPKISFKKPIGSVSVSGHK  316

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   ++ +SRNVEY+AS DATI GSRNG  PIFLWYSL+ KG  G Q
Sbjct  317   FVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQ  376

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             K+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D  F+ +WQL+C  ++AHV+V
Sbjct  377   KEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVV  436

Query  370   MPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             MP V  E +D+F N+LVQ+RA W+R+G  QP C+  D+G  NC C LH+
Sbjct  437   MPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  485



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 340/469 (72%), Gaps = 18/469 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFF---VHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPR  1436
             EDF  M +      L      + +G  +NG   EN + KI      +N+H T   V EP 
Sbjct  23    EDFNSMTIMRDHVTLTIGENGIGNGVVQNG--TENGERKIVLG---RNIHTTCLEVTEPD  77

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
               D+     EA +   L K+  ++++R NYH+GYP N+ +D Y  L+ L  + +NN GDP
Sbjct  78    IDDEVTGEREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFD-YDALSQLQHFSINNLGDP  136

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GIL
Sbjct  137   FIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  196

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYSVFKAARMYRME   INT+ +GE+D DD ++KLL +K KPAI+NV IGTT K
Sbjct  197   YASQESHYSVFKAARMYRMECVKINTLWSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVK  256

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++IK LEE G+SQD FYIHCD AL GL++PF+K  PKISFKKPIGSV++SGHK
Sbjct  257   GAVDDLDLVIKKLEEAGFSQDRFYIHCDGALFGLMLPFVKRAPKISFKKPIGSVSVSGHK  316

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   ++ +SRNVEY+AS DATI GSRNG  PIFLWYSL+ KG  G Q
Sbjct  317   FVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQ  376

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
             K+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D  F+ +WQL+C  ++AHV+V
Sbjct  377   KEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVV  436

Query  370   MPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             MP V  E +D+F N+LVQ+RA W+R+G  QP C+  D+G  NC C LH+
Sbjct  437   MPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALHR  485



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (76%), Gaps = 12/425 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP S D+     EA +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  47    RNVHTTSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  105

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  106   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  165

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS ESHYSVFKAARMYRME E ++T+I+GE+D  D R KLL NK 
Sbjct  166   GILVGREVFPDGILYASSESHYSVFKAARMYRMECERVDTLISGEIDCADFRQKLLANKD  225

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLK--NVPK  779
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  + PK
Sbjct  226   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRASAPK  285

Query  778   ISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTP  599
             ++F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P
Sbjct  286   VTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAP  345

Query  598   IFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFI  419
             +FLWY+LS KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+
Sbjct  346   LFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFV  405

Query  418   RRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCY  242
             RRWQL+C  D+AHV+VMP V  E +D+F  DLV+ R+ WY E G Q PCL  D+G  NC 
Sbjct  406   RRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEEYGSQLPCLVKDVGIKNCI  465

Query  241   CPLHK  227
             CP HK
Sbjct  466   CPAHK  470



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 334/448 (75%), Gaps = 15/448 (3%)
 Frame = -2

Query  1543  VHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKDD-----EARLKCTLGKFL  1388
             + +G  +NG   EN + KI      +N+H T   V EP   D+     EA +   L K+ 
Sbjct  17    IGNGVVQNG--TENGERKIVLG---RNIHTTCLEVTEPDIDDEVTGEREAYMAGVLAKYK  71

Query  1387  DTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWF  1208
              ++++R NYH+GYP N+ +D Y  L+ L  + +NN GDPF+E+    HS+ FEVGVLDWF
Sbjct  72    KSLTERTNYHLGYPYNLNFD-YDALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWF  130

Query  1207  AELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEV  1028
             A LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFKAARMYRME 
Sbjct  131   ARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASQESHYSVFKAARMYRMEC  190

Query  1027  EGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQD  848
               INT+ +GE+D DD ++KLL +K KPAI+NV IGTT KG +D+LD++IK LEE G+SQD
Sbjct  191   VKINTLWSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVKGAVDDLDLVIKKLEEAGFSQD  250

Query  847   EFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNI  668
              FYIHCD AL GL++PF+K  PKISFKKPIGSV++SGHKF+GCPMPCG+Q+TR   ++ +
Sbjct  251   RFYIHCDGALFGLMLPFVKRAPKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  310

Query  667   SRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAG  488
             SRNVEY+AS DATI GSRNG  PIFLWYSL+ KG  G QK+ Q+C+  A + +DRL  AG
Sbjct  311   SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  370

Query  487   ISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERA  308
             I AM+N+ S TVVFERP D  F+ +WQL+C  ++AHV+VMP V  E +D+F N+LVQ+RA
Sbjct  371   IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRA  430

Query  307   TWYREGP-QPPCLEDDLGSHNCYCPLHK  227
              W+R+G  QP C+  D+G  NC C LH+
Sbjct  431   VWFRDGNCQPYCIASDVGQENCLCALHR  458



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 345/476 (72%), Gaps = 20/476 (4%)
 Frame = -2

Query  1630  SKNRMGTLAFDEDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT  1451
             +K  +  +   EDF P  V A E L P  + +G  K     E KK +I      +N+H T
Sbjct  19    AKAAVAEILLTEDFDPAAVVA-EPLPPVVMSNGVGK-----EIKKREIVLG---RNVHTT  69

Query  1450  ---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRY  1295
                V EP + D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  LA L  +
Sbjct  70    CLAVTEPEANDELTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGALAQLQHF  128

Query  1294  HLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGR  1115
              +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLHGIL+GR
Sbjct  129   SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKEEYWGYITNCGTEGNLHGILVGR  188

Query  1114  EVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIIN  935
             EV  +G+LYASKESHYSVFKAARMYRME   ++T+++GE+D  D + KLL NK KPAIIN
Sbjct  189   EVFLDGVLYASKESHYSVFKAARMYRMECVKVDTLVSGEIDCADFKDKLLANKDKPAIIN  248

Query  934   VTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIG  755
             V IGTT KG +D+LD++I+TLEE G+  D FYIHCD AL GL++PF+K  PK++FKKPIG
Sbjct  249   VNIGTTVKGAVDDLDLVIQTLEENGF-HDRFYIHCDGALFGLMMPFVKLAPKVTFKKPIG  307

Query  754   SVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLS  575
             SV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+
Sbjct  308   SVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLN  367

Query  574   TKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCV  395
              KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +FIRRWQL+C 
Sbjct  368   RKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPLDEEFIRRWQLACQ  427

Query  394   RDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
              +MAHV+VMP V  E +D F N+L++ER+ WY+ E  QPPCL  ++G+ NC C LH
Sbjct  428   GNMAHVVVMPNVTIEKLDVFLNELIEERSAWYQDENVQPPCLAAEIGAENCACKLH  483



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 324/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  59    RNVHTTCLAVTEPEPNDEFTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P GILYAS+ESHYS+FKAARMYRME E I+ +I+GE+D  D ++KLL ++ 
Sbjct  178   GVLVGREVFPVGILYASRESHYSIFKAARMYRMECEKIDCLISGEIDCADFKTKLLAHQD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEECG+ QD FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAIINVNIGTTVKGAVDDLDLVIKTLEECGFKQDRFYIHCDGALFGLMMPFVKLAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHK +GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+ RL+ A ISAM+N+ S TVVFERP D +F+R+
Sbjct  358   LWYTLNKKGYTGFQKEVQKCLRNAHYLKGRLRDARISAMLNELSSTVVFERPKDEEFVRK  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V+ E +DNF N+LV++R+TWY E  QPPCL  D+G+ NC C  
Sbjct  418   WQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYDENVQPPCLAADVGTENCSCRQ  477

Query  232   HK  227
             HK
Sbjct  478   HK  479



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/465 (56%), Positives = 340/465 (73%), Gaps = 15/465 (3%)
 Frame = -2

Query  1594  DFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKDD  1424
             D +P+ +    A+  F +     +NGD    +++ +      KN+H T   V EP + D+
Sbjct  5     DAVPVHLNGKVAIEDFDLTVVEAENGDKQNEREIVLG-----KNVHTTCLEVTEPEANDE  59

Query  1423  -----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMEN  1259
                  EA +   L ++   + +R  +H+GYP N+ +D Y  L  L  + +NN GDPF+E+
Sbjct  60    STGDKEAYMASVLARYRKNLMERTKHHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIES  118

Query  1258  TVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASK  1079
                 HS+ FEVGVLDWFA LWEIEK EYWGYITN GTEGNLHGIL+GREV P+GILYAS+
Sbjct  119   NYGVHSRQFEVGVLDWFARLWEIEKSEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  178

Query  1078  ESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMD  899
             ESHYSVFKAARMYRM    ++ +++GE+D  D + KLL NK KPAIINV IGTT KG +D
Sbjct  179   ESHYSVFKAARMYRMGCVKVDCLVSGEIDCADFKVKLLANKDKPAIINVNIGTTVKGAVD  238

Query  898   NLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGC  719
             +LD++I+TLEE G+SQD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GC
Sbjct  239   DLDLVIQTLEESGFSQDRFYIHCDGALFGLMLPFVKRAPKVTFKKPIGSVSVSGHKFVGC  298

Query  718   PMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQ  539
             PMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q
Sbjct  299   PMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQ  358

Query  538   RCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGV  359
             +C+  A +L+DRL+ AGISAM+N+ S TVVFERP D DF+RRWQL+C  ++AHV+VMP V
Sbjct  359   KCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQLACQGNIAHVVVMPSV  418

Query  358   APEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLHK  227
               E +D+F N+LV++R+TWY+ E  +PPC+  D+GS NC C LHK
Sbjct  419   TIEKLDDFVNELVEKRSTWYQDEKARPPCIAADVGSQNCSCDLHK  463



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 324/422 (77%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  59    RNVHTTCLAVTEPEPNDEFTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P+GILYAS+ESHYS+FKAARMYRME E I+ +I+GE+D  D ++KLL ++ 
Sbjct  178   GVLVGREVFPDGILYASRESHYSIFKAARMYRMECEKIDCLISGEIDCADFKTKLLAHQD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEECG  QD FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAIINVNIGTTVKGAVDDLDLVIKTLEECGTKQDRFYIHCDGALFGLMMPFVKLAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHK +GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+  L+ AGISAM+N+ S TVVFERP D +F+R+
Sbjct  358   LWYTLNKKGYTGFQKEVQKCLRNAHYLKGHLRDAGISAMLNELSSTVVFERPKDEEFVRK  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V+ E +DNF N+LV++R+TWY E  QPPCL  D+G+ NC C  
Sbjct  418   WQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYDEKVQPPCLAADVGTENCSCRQ  477

Query  232   HK  227
             HK
Sbjct  478   HK  479



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/444 (57%), Positives = 332/444 (75%), Gaps = 10/444 (2%)
 Frame = -2

Query  1537  SGSFKNGDFVENKKMKIAAPPARKNMHITVAEP-----RSKDDEARLKCTLGKFLDTISQ  1373
             SG  + G+  E ++ +I        M + V EP      + + EA +   L K+  ++ +
Sbjct  46    SGEARRGE--EKQRREIVLGRNVHKMSLPVTEPDVDEEMTGEKEAYMASILAKYRKSLVE  103

Query  1372  RINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWE  1193
             R  +H+GYP N+ +D Y  LA L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE
Sbjct  104   RTEHHLGYPYNLDFD-YGALAQLQHFSINNLGDPFIESKYGVHSRQFEVGVLDWFARLWE  162

Query  1192  IEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINT  1013
             +EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++T
Sbjct  163   LEKDEYWGYITNCGTEGNLHGILVGREVLPDGILYASRESHYSVFKAARMYRMECIKVDT  222

Query  1012  MINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIH  833
             + +GE+D  D R+KLL NK KPAIINV IGTT KG +D+LD++IKTLE+ G++QD FYIH
Sbjct  223   LASGEIDCTDFRAKLLPNKDKPAIINVNIGTTVKGAIDDLDMVIKTLEDTGFTQDRFYIH  282

Query  832   CDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVE  653
             CD AL GL++PF+K  PK+SFKKPIGS ++SGHKF+GCPMPCG+++TR   I+ +SRNVE
Sbjct  283   CDGALFGLMMPFIKRAPKVSFKKPIGSASVSGHKFVGCPMPCGVEITRLEHINALSRNVE  342

Query  652   YIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMV  473
             Y+AS DATI GSRNG TPIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+AAG+ AM+
Sbjct  343   YLASRDATIMGSRNGHTPIFLWYTLNQKGYKGFQKEVQKCLSNAFYLKDRLRAAGVGAML  402

Query  472   NDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYRE  293
             N+ S TVVFERP D +F+RRW L+C  D+AHV+VMP V  E +D F ++L+Q+R+ W+R 
Sbjct  403   NEFSSTVVFERPQDEEFVRRWHLACQGDIAHVVVMPNVTIEKLDVFVDELMQKRSAWFRN  462

Query  292   GP--QPPCLEDDLGSHNCYCPLHK  227
             G   QPPC+  D+G+ NC C LHK
Sbjct  463   GRILQPPCIAADVGNENCACILHK  486



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/438 (58%), Positives = 332/438 (76%), Gaps = 14/438 (3%)
 Frame = -2

Query  1516  DFVENKKMKIAAPPARKNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINY  1361
             + VEN++  +      KN+H   + V EP + D+     +A +   L ++  T+ +R  Y
Sbjct  38    EVVENEREIVLG----KNVHTSCLEVTEPDADDELTGDKDAYMASVLARYRKTLIERTKY  93

Query  1360  HIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKD  1181
             H+GYP N+ +D Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE++
Sbjct  94    HLGYPYNLDFD-YGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIERN  152

Query  1180  EYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMING  1001
             EYWGYITN GTEGNLHGIL+GREV P+G+LYAS+ESHYSVFKAARMYRME   I+ +++G
Sbjct  153   EYWGYITNCGTEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMYRMESVKIDCLVSG  212

Query  1000  EMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAA  821
             E+D  D + KLL NK KPAIINV IGTT KG +D+LD++I+TLEECG++Q+ FYIHCD A
Sbjct  213   EIDCADFKVKLLANKDKPAIINVNIGTTVKGAVDDLDLVIQTLEECGFTQNRFYIHCDGA  272

Query  820   LSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIAS  641
             L GL++PF+K  PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S+NVEY+AS
Sbjct  273   LFGLMMPFVKRAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSKNVEYLAS  332

Query  640   VDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
              DATI GSRNG  PIFLWY+L+ KG  G QKD Q+C+  A +L+ RL+ AGISAM+N+ S
Sbjct  333   RDATIMGSRNGHAPIFLWYTLNRKGYKGFQKDVQKCLRNAHYLKGRLRDAGISAMLNELS  392

Query  460   ITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-Q  284
              TVV ERP D +F+RRWQL+C  ++AHV+VMP V  E +DNF ++LV++R+TWY++G  Q
Sbjct  393   STVVLERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQDGQVQ  452

Query  283   PPCLEDDLGSHNCYCPLH  230
              PC+  D+GS NC C LH
Sbjct  453   SPCIAADVGSENCACALH  470



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H    +V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  55    KNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  113

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+E +EYWGYITN GTEGNLH
Sbjct  114   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLH  173

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++ +I+GE+D  D ++KLL NK 
Sbjct  174   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKD  233

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G++QD FYIHCD AL GL++PF+K  PK+S
Sbjct  234   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVS  293

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  294   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIF  353

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  354   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRR  413

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D+F N+L++ R+TWY +G  QPPC+  D+GS NC C 
Sbjct  414   WQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCA  473

Query  235   LHK  227
              HK
Sbjct  474   AHK  476



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   + EP + D+     +A +   L ++  T+ +R   H+GYP N+ +D Y  L
Sbjct  56    RNVHTTCLAIEEPDANDELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFD-YGAL  114

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK +YWGYITN GTEGNLH
Sbjct  115   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLH  174

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   + T+++GE+D  D + KLL NK 
Sbjct  175   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVATLVSGEIDCADFKDKLLANKD  234

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIIN  IGTT KG +D+LD+IIKTLEE G++ D FYIHCD AL GL++PF+K  PK+S
Sbjct  235   KPAIINANIGTTVKGAVDDLDLIIKTLEESGFTHDRFYIHCDGALFGLMMPFVKRAPKVS  294

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  295   FKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIF  354

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+ RL+ AGISAM+N+ S TVVFERP + +F+RR
Sbjct  355   LWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRR  414

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V+ E +D F N+L+++R+TWYR+G  QPPCL  D+G+ NC C 
Sbjct  415   WQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCA  474

Query  235   LHK  227
             LHK
Sbjct  475   LHK  477



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H    +V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  55    KNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  113

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+E +EYWGYITN GTEGNLH
Sbjct  114   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLH  173

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++ +I+GE+D  D ++KLL NK 
Sbjct  174   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKD  233

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G++QD FYIHCD AL GL++PF+K  PK+S
Sbjct  234   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVS  293

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  294   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIF  353

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  354   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRR  413

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D+F N+L++ R+TWY +G  QPPC+  D+GS NC C 
Sbjct  414   WQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCA  473

Query  235   LHK  227
              HK
Sbjct  474   AHK  476



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  63    RNLHTECLEVTEPDANDEHTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  121

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD+YWGYITN GTEGNLH
Sbjct  122   GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDQYWGYITNCGTEGNLH  181

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM    I+ +++GE+D  D + KLL NK 
Sbjct  182   GILVGREVLPDGILYASRESHYSVFKAARMYRMGCVKIDCLVSGEIDCADFKVKLLANKD  241

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G++ D FYIHCD AL GL++PF+K  PK+S
Sbjct  242   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTHDRFYIHCDGALFGLMMPFVKRAPKVS  301

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  302   FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINVLSRNVEYLASRDATIMGSRNGHAPIF  361

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  362   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPRDEEFVRR  421

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C   +AHV+VMP V  E +DNF N+L+++R+TWY++G  Q PC+  D+GS NC C 
Sbjct  422   WQLACQGSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGSENCACA  481

Query  235   LHK  227
             LHK
Sbjct  482   LHK  484



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/465 (55%), Positives = 339/465 (73%), Gaps = 15/465 (3%)
 Frame = -2

Query  1594  DFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKDD  1424
             D +P+ +     +  F +     +NGD    +++ +      +N+H T   V EP + D+
Sbjct  5     DAVPVHLNGKVEIEDFDLTVVEAENGDKQNGREIVLG-----RNVHTTCLEVTEPEANDE  59

Query  1423  -----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMEN  1259
                  EA +   L ++   + +R  +H+GYP N+ +D Y  L  L  + +NN GDPF+E+
Sbjct  60    STGDKEAYMASVLARYRKNLMERTKHHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIES  118

Query  1258  TVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASK  1079
                 HS+ FEVGVLDWFA LWEIEK EYWGYITN GTEGNLHGIL+GREV P+GILYAS+
Sbjct  119   NYGVHSRQFEVGVLDWFARLWEIEKSEYWGYITNCGTEGNLHGILVGREVFPDGILYASR  178

Query  1078  ESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMD  899
             ESHYSVFKAARMYRM    ++ +++GE+D  D + KLL NK KPAIINV IGTT KG +D
Sbjct  179   ESHYSVFKAARMYRMGCVKVDCLVSGEIDCADFKVKLLANKDKPAIINVNIGTTVKGAVD  238

Query  898   NLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGC  719
             +LD++I+TLEE G+SQD FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GC
Sbjct  239   DLDLVIQTLEESGFSQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGC  298

Query  718   PMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQ  539
             PMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q
Sbjct  299   PMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQ  358

Query  538   RCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGV  359
             +C+  A +L+DRL+ AGISAM+N+ S TVVFERP D DF+RRWQL+C  ++AHV+VMP V
Sbjct  359   KCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQLACQGNIAHVVVMPSV  418

Query  358   APEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLHK  227
               E +D+F N+LV++R+TWY+ E  +PPC+  D+GS NC C LHK
Sbjct  419   TIEKLDDFVNELVEKRSTWYQDEKVRPPCIAADIGSQNCSCDLHK  463



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  17    RNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  75

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKDEYWGYITN GTEGNLH
Sbjct  76    SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLH  135

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+E+HYSVFKAARMYRME   + T ++GE+D  D ++KLL NK 
Sbjct  136   GILVGREVLPDGILYASQETHYSVFKAARMYRMECVKVATSLSGEIDCADFKAKLLANKD  195

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEECG++ D FYIHCD AL GL++PF+K  PK++
Sbjct  196   KPAIINVNIGTTVKGAVDDLDLVIETLEECGFTHDRFYIHCDGALFGLMMPFVKRAPKVT  255

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  256   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIF  315

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  316   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRR  375

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D F ++L+++R TW+ +   QPPC+  D+GS NC C 
Sbjct  376   WQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCD  435

Query  235   LHK  227
             LHK
Sbjct  436   LHK  438



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   + EP + D+     +A +   L ++  T+ +R   H+GYP N+ +D Y  L
Sbjct  96    RNVHTTCLAIEEPDANDELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFD-YGAL  154

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK +YWGYITN GTEGNLH
Sbjct  155   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLH  214

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   + T+++GE+D  D + KLL NK 
Sbjct  215   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVATLVSGEIDCADFKDKLLANKD  274

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIIN  IGTT KG +D+LD+IIKTLEE G++ D FYIHCD AL GL++PF+K  PK+S
Sbjct  275   KPAIINANIGTTVKGAVDDLDLIIKTLEESGFTHDRFYIHCDGALFGLMMPFVKRAPKVS  334

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  335   FKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIF  394

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+ RL+ AGISAM+N+ S TVVFERP + +F+RR
Sbjct  395   LWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRR  454

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V+ E +D F N+L+++R+TWYR+G  QPPCL  D+G+ NC C 
Sbjct  455   WQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCA  514

Query  235   LHK  227
             LHK
Sbjct  515   LHK  517



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/423 (60%), Positives = 322/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H T   V EP + D+     +A +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  66    KNVHTTCLEVTEPDADDESTGDKDAYMASVLARYRKTLLERTQHHLGYPYNLDFD-YGAL  124

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD+YWGYITN GTEGNLH
Sbjct  125   GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLH  184

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+G+LYASKESHYSVFKAARMYRM+ E + T++ GE+D  D ++KLLL+K 
Sbjct  185   GILVGREVFPDGVLYASKESHYSVFKAARMYRMDCEKVGTLVTGEIDCTDFKTKLLLHKD  244

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TL E G+S D FYIHCD AL GL++PF+K  PK+S
Sbjct  245   KPAIINVNIGTTVKGAVDDLDLVIQTLVENGFSHDRFYIHCDGALFGLMMPFVKKAPKVS  304

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCGIQ+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  305   FKKPIGSVSVSGHKFVGCPMPCGIQITRLRHINALSRNVEYLASRDATIMGSRNGHAPIF  364

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+R 
Sbjct  365   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRM  424

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  +MAH++VMP V  E +D F N+L + RA WY++G  QPPCL  D+G  NC C 
Sbjct  425   WQLACEGNMAHIVVMPNVTVEKLDYFLNELAKGRAIWYKDGKEQPPCLAVDVGIENCSCA  484

Query  235   LHK  227
             +HK
Sbjct  485   VHK  487



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/463 (54%), Positives = 341/463 (74%), Gaps = 8/463 (2%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD--  1424
             E+F P+ + + + L P  V +G   + +  + +  +I        M + V EP + D+  
Sbjct  23    EEFDPIAMIS-DPLPPQVVENGGIVDDEAEDKQNREIVLGKNVHTMCLAVTEPDADDEVT  81

Query  1423  ---EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTV  1253
                EA +   L ++  ++ +R  +H+GYP N+ +D Y  LA L  + +NN GDPF+E+  
Sbjct  82    GEREAYMASVLARYRRSLIERTKHHLGYPYNLDFD-YGALAQLQHFSINNLGDPFIESNY  140

Query  1252  DFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKES  1073
               HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLHGIL+GREV P+GILYAS+ES
Sbjct  141   GVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRES  200

Query  1072  HYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNL  893
             HYSVFKAARMYRME   + T+ +GE+D  D ++KLL NK KP+I+NV IGTT KG +D+L
Sbjct  201   HYSVFKAARMYRMECIKVETLASGEIDCTDFKAKLLPNKDKPSIVNVNIGTTVKGAVDDL  260

Query  892   DVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPM  713
             D++IKTLE+ G++ D FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPM
Sbjct  261   DLVIKTLEDTGFTHDRFYIHCDGALFGLMIPFVKRAPKVTFKKPIGSVSVSGHKFVGCPM  320

Query  712   PCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRC  533
             PCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C
Sbjct  321   PCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKC  380

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +L+DRL++AGI AM+N+ S TVVFERP D +F+RRWQL+C   +AHV+VMP +  
Sbjct  381   LRNAHYLKDRLRSAGIGAMLNELSSTVVFERPQDEEFVRRWQLACQGSIAHVVVMPNITV  440

Query  352   EAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             E +D+F N+L+ +R+TW+++G  QPPC+  D+G  NC C +HK
Sbjct  441   EKLDDFLNELIGKRSTWFQDGKSQPPCIAADVGKENCACVMHK  483



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   + EP + D+     EA +   L ++   + +R  YH+GYP N+ +D Y  L
Sbjct  59    RNVHTTCLSITEPDANDESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+E+HYSVFKAARMYRM+   + T+I+GE+D  DLR KLL NK 
Sbjct  178   GILVGREVLPDGILYASRETHYSVFKAARMYRMDCVKVGTLISGEIDCADLRVKLLANKD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+TL ECG+S+D FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAILNVNIGTTVKGAVDDLDLVIQTLNECGFSKDRFYIHCDGALFGLMMPFVKRAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL   GISAM+N+ S TVVFERP D +FIRR
Sbjct  358   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRR  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V+ E +D+F +DLV++R+TWY  E  QPPC+  +LG+ +C C 
Sbjct  418   WQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACK  477

Query  235   LHK  227
             LH+
Sbjct  478   LHR  480



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  61    RNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  119

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKDEYWGYITN GTEGNLH
Sbjct  120   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLH  179

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+E+HYSVFKAARMYRME   + T ++GE+D  D ++KLL NK 
Sbjct  180   GILVGREVLPDGILYASQETHYSVFKAARMYRMECVKVATSLSGEIDCADFKAKLLANKD  239

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEECG++ D FYIHCD AL GL++PF+K  PK++
Sbjct  240   KPAIINVNIGTTVKGAVDDLDLVIETLEECGFTHDRFYIHCDGALFGLMMPFVKRAPKVT  299

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  300   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIF  359

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  360   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRR  419

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D F ++L+++R TW+ +   QPPC+  D+GS NC C 
Sbjct  420   WQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCD  479

Query  235   LHK  227
             LHK
Sbjct  480   LHK  482



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   + EP + D+     EA +   L ++   + +R  YH+GYP N+ +D Y  L
Sbjct  64    RNVHTTCLSITEPDANDESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFD-YGAL  122

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  123   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  182

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+E+HYSVFKAARMYRM+   + T+I+GE+D  DLR KLL NK 
Sbjct  183   GILVGREVLPDGILYASRETHYSVFKAARMYRMDCVKVGTLISGEIDCADLRVKLLANKD  242

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+TL ECG+S+D FYIHCD AL GL++PF+K  PK+S
Sbjct  243   KPAILNVNIGTTVKGAVDDLDLVIQTLNECGFSKDRFYIHCDGALFGLMMPFVKRAPKVS  302

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  303   FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  362

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL   GISAM+N+ S TVVFERP D +FIRR
Sbjct  363   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRR  422

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V+ E +D+F +DLV++R+TWY  E  QPPC+  +LG+ +C C 
Sbjct  423   WQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACK  482

Query  235   LHK  227
             LH+
Sbjct  483   LHR  485



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/422 (58%), Positives = 321/422 (76%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  69    RNVHTSCLAVTEPEANDEFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFD-YGAL  127

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD+YWGYITN GTEGNLH
Sbjct  128   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLH  187

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+G+LYAS ESHYSVFKAARMYRME   + T+I+GE+D  D + KLL NK 
Sbjct  188   GILVGREVFPDGVLYASCESHYSVFKAARMYRMECVKVGTLISGEIDCKDFKEKLLANKD  247

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             +PAI+NV IGTT KG +D+LD++IKTLEE G+S+D FYIHCD AL GL++PF+K  PK++
Sbjct  248   RPAILNVNIGTTVKGAVDDLDLVIKTLEENGFSRDRFYIHCDGALFGLMMPFVKRAPKVT  307

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I  +SRNVEY+AS DATI GSRNG  P+F
Sbjct  308   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKALSRNVEYLASRDATIMGSRNGHAPLF  367

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  368   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRKAGISAMLNELSSTVVFERPKDEEFVRR  427

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  ++AHV+VMP V  E +D F ++LV++R+ WY++G Q  C+  D+G  NC CP 
Sbjct  428   WQLACQGNIAHVVVMPSVTIEKLDYFLDELVEQRSVWYKDGSQALCIASDVGVENCICPA  487

Query  232   HK  227
             HK
Sbjct  488   HK  489



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     +A +   L ++  T+ +R  +H+GYP N+ ++ Y  L
Sbjct  70    RNVHTSCLAVTEPEANDEFTGDKDAYMAGVLARYRKTLMERTKHHLGYPYNLDFE-YGAL  128

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  129   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  188

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYS+FKAARMYRME   ++T+++GE+D  D R KLL NK 
Sbjct  189   GILVGREVFPDGILYASRESHYSIFKAARMYRMECVKVDTLVSGEIDCSDFRVKLLANKD  248

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G+S D FYIHCD AL GL++PF+K  PK++
Sbjct  249   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  308

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  309   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIF  368

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  369   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPRDEEFVRR  428

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D F ++LV++R+TWY+E   QPPC+  D+G  NC C 
Sbjct  429   WQLACEGNIAHVVVMPNVTIEKLDLFLDELVEKRSTWYQEEHDQPPCIAADVGKENCACA  488

Query  235   LHK  227
             LHK
Sbjct  489   LHK  491



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   +++ EP + D+     EA +   L ++  ++ +R  YH+GYP N+ +D Y  L
Sbjct  59    RNVHTSCLSITEPDANDESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFD-YGAL  117

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  118   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  177

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV  +GILYAS+ESHYSVFKAARMYRM+   + T+I+GE+D  DLR KLL NK 
Sbjct  178   GILVGREVLSDGILYASRESHYSVFKAARMYRMDCVKVGTLISGEIDCADLRVKLLANKD  237

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+TL ECG+S+D FYIHCD AL GL++PF+K  PK+S
Sbjct  238   KPAILNVNIGTTVKGAVDDLDLVIQTLNECGFSKDRFYIHCDGALFGLMMPFVKRAPKVS  297

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  298   FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  357

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +FIRR
Sbjct  358   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRR  417

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWY-REGPQPPCLEDDLGSHNCYCP  236
             WQL+C   +AHV+VMP V+ E +D+F  +LV++R+TWY  E  QPPC+  +LG+ +C C 
Sbjct  418   WQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACK  477

Query  235   LHK  227
             LH+
Sbjct  478   LHR  480



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  52    RNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  110

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKDEYWGYITN GTEGNLH
Sbjct  111   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLH  170

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+E+HYSVFKAARMYRME   + T ++GE+D  D ++KLL NK 
Sbjct  171   GILVGREVLPDGILYASQETHYSVFKAARMYRMECVKVATSLSGEIDCADFKAKLLANKD  230

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEECG++ D FYIHCD AL GL++PF+K  PK++
Sbjct  231   KPAIINVNIGTTVKGAVDDLDLVIETLEECGFTHDRFYIHCDGALFGLMMPFVKRAPKVT  290

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  291   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIF  350

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  351   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPXDDEFVRR  410

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D F + L+++R TW+ +   QPPC+  D+GS NC C 
Sbjct  411   WQLACQGNIAHVVVMPNVTIEKLDYFLDXLIEKRNTWFLDKKVQPPCVAADIGSENCLCD  470

Query  235   LHK  227
             LHK
Sbjct  471   LHK  473



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 325/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   +++ EP + D+     EA +   L ++  ++ +R  YH+GYP N+ +D Y  L
Sbjct  64    RNVHTSCLSITEPDANDESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFD-YGAL  122

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEK+EYWGYITN GTEGNLH
Sbjct  123   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH  182

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV  +GILYAS+ESHYSVFKAARMYRM+   + T+I+GE+D  DLR KLL NK 
Sbjct  183   GILVGREVLSDGILYASRESHYSVFKAARMYRMDCVKVGTLISGEIDCADLRVKLLANKD  242

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+TL ECG+S+D FYIHCD AL GL++PF+K  PK+S
Sbjct  243   KPAILNVNIGTTVKGAVDDLDLVIQTLNECGFSKDRFYIHCDGALFGLMMPFVKRAPKVS  302

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  303   FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  362

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +FIRR
Sbjct  363   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRR  422

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWY-REGPQPPCLEDDLGSHNCYCP  236
             WQL+C   +AHV+VMP V+ E +D+F  +LV++R+TWY  E  QPPC+  +LG+ +C C 
Sbjct  423   WQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACK  482

Query  235   LHK  227
             LH+
Sbjct  483   LHR  485



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 322/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H    +V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  55    KNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  113

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+E +EYWGYITN GTEGNLH
Sbjct  114   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLH  173

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++ +I+GE+D    ++KLL NK 
Sbjct  174   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCAGFKAKLLQNKD  233

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G++QD FYIHCD AL GL++PF+K  PK+S
Sbjct  234   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVS  293

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  294   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIF  353

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  354   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRR  413

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D+F N+L+  R+TWY +G  QPPC+  D+GS NC C 
Sbjct  414   WQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCA  473

Query  235   LHK  227
              HK
Sbjct  474   AHK  476



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 330/439 (75%), Gaps = 15/439 (3%)
 Frame = -2

Query  1501  KKMKIAAPPAR-----KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINY  1361
             KKMK      R     +N+H   + + EP   D+     EA +   L ++  ++ +R  Y
Sbjct  50    KKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELTGDKEAYMASVLARYRQSLLERTKY  109

Query  1360  HIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKD  1181
             H+GYP N+ +D Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD
Sbjct  110   HLGYPYNLDFD-YGALNQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKD  168

Query  1180  EYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMING  1001
             EYWGYITN GTEGNLHGIL+GREV P+GILYASKESHYS+FKAARMYRM+   I T+++G
Sbjct  169   EYWGYITNCGTEGNLHGILVGREVFPDGILYASKESHYSLFKAARMYRMDCIKIETLLSG  228

Query  1000  EMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAA  821
             E+D  D ++KLL NK KPAI+NV IGTT KG +D+LD++I+TLEECG+  + FYIHCD A
Sbjct  229   EVDCADFKAKLLQNKDKPAIVNVNIGTTVKGAVDDLDLVIQTLEECGFPHNRFYIHCDGA  288

Query  820   LSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIAS  641
             L GL++PF+K  P+++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS
Sbjct  289   LFGLMLPFVKKAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLAS  348

Query  640   VDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
              DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+  GISAM+N+ S
Sbjct  349   RDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELS  408

Query  460   ITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-Q  284
              TVVFERP D +FIRRWQL+C  ++AHV+VMP +  + +++F ++LV++R+TW+R+G  +
Sbjct  409   STVVFERPLDEEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFRDGTNK  468

Query  283   PPCLEDDLGSHNCYCPLHK  227
             PPC+  D+G  NC CP+HK
Sbjct  469   PPCVASDIGQENCVCPMHK  487



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/397 (61%), Positives = 313/397 (79%), Gaps = 2/397 (1%)
 Frame = -2

Query  1414  LKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKD  1235
             +   L ++  T+ +R  +H+GYP N+ +D Y  LA L  + +NN GDPF+E+    HS+ 
Sbjct  1     MASVLARYRKTLIERTKHHLGYPYNLDFD-YGALAQLQHFSINNLGDPFIESNYGVHSRQ  59

Query  1234  FEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFK  1055
             FEVGVLDWFA LWEIEK EYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFK
Sbjct  60    FEVGVLDWFARLWEIEKSEYWGYITNCGTEGNLHGILVGREVLPDGILYASRESHYSVFK  119

Query  1054  AARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKT  875
             AARMYRME   ++T++ GE+D  D ++KLL+NK KPAIINV IGTT KG +D+LD++I+T
Sbjct  120   AARMYRMECVKVDTLVTGEIDCADFKTKLLVNKEKPAIINVNIGTTVKGAVDDLDLVIQT  179

Query  874   LEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQM  695
             LEECG+S D FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+Q+
Sbjct  180   LEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQI  239

Query  694   TRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATH  515
             TR   ++ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +
Sbjct  240   TRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHY  299

Query  514   LRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNF  335
             L+DRL+ AGISAM+N+ S TVVFERP D +F+R+WQL+C  +MAHV+VMP V  E ++ F
Sbjct  300   LKDRLRQAGISAMLNELSSTVVFERPRDEEFVRQWQLACQGNMAHVVVMPNVTIEKLEGF  359

Query  334   FNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
              + L++ R+ WY++   +PPCL  ++GS NC CPLHK
Sbjct  360   LDALIEGRSIWYKDDKGKPPCLAAEIGSGNCSCPLHK  396



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 331/448 (74%), Gaps = 7/448 (2%)
 Frame = -2

Query  1552  PFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD-----EARLKCTLGKFL  1388
             P  V +G+ +   + E +K  I        M + V EP + DD     EA +   L ++ 
Sbjct  37    PAVVDNGNEEVQVYKEKEKRLIVLGRNIHTMSLEVTEPDADDDITGDREAHIASVLARYK  96

Query  1387  DTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWF  1208
               +++R  +H+GYP N+ +D Y  L+ L  + +NN GDPF+E+    HS+ FEVGVLDWF
Sbjct  97    RALTERTKHHLGYPYNLDFD-YGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWF  155

Query  1207  AELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEV  1028
             A LWE+EK+EYWGYITN GTEGNLHGIL+GREV P GILYAS+ESHYSVFKAARMYRME 
Sbjct  156   ARLWELEKNEYWGYITNCGTEGNLHGILVGREVFPNGILYASRESHYSVFKAARMYRMEC  215

Query  1027  EGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQD  848
               I+T+ +GE+D DD ++KLL N+ KPAI+NV IGTT KG +D+LD++IK LEE G+SQD
Sbjct  216   VKIDTLWSGEIDCDDFKAKLLRNQDKPAIVNVNIGTTVKGAVDDLDLVIKKLEEAGFSQD  275

Query  847   EFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNI  668
              FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   ++ +
Sbjct  276   RFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLDYVNAL  335

Query  667   SRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAG  488
             SR+VEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A + +DRL  AG
Sbjct  336   SRDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAG  395

Query  487   ISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERA  308
             I AM+N+ S TVVFERP D +FIRRWQL+C  ++AHV+VMP +  E +D+F N+L+++R 
Sbjct  396   IGAMLNELSSTVVFERPHDEEFIRRWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRT  455

Query  307   TWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             TW+++G  QP C+  D+G  NC C LHK
Sbjct  456   TWFQDGKDQPYCISADVGEKNCLCALHK  483



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 322/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             KN+H    +V EP + D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  123   KNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD-YGAL  181

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+E +EYWGYITN GTEGNLH
Sbjct  182   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLH  241

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++ +I+GE+D    ++KLL NK 
Sbjct  242   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCAGFKAKLLQNKD  301

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLEE G++QD FYIHCD AL GL++PF+K  PK+S
Sbjct  302   KPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVS  361

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  362   FKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIF  421

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  422   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRR  481

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D+F N+L+  R+TWY +G  QPPC+  D+GS NC C 
Sbjct  482   WQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCA  541

Query  235   LHK  227
              HK
Sbjct  542   AHK  544



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/415 (59%), Positives = 320/415 (77%), Gaps = 8/415 (2%)
 Frame = -2

Query  1453  TVAEPRSKDDEA-------RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRY  1295
              V E   KD+E+        L   + +F D + +R + H+GYP N    HY  L+ L+++
Sbjct  46    AVVEVEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQF  105

Query  1294  HLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGR  1115
             ++NN GDPF E+    HSK FEVGVLDWFA+LW I+KDEYWGY+TNGGTEGNLHGIL+GR
Sbjct  106   NINNAGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGR  165

Query  1114  EVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIIN  935
             E+ P GILY S+ESHYS+FK ARMYRM+   I ++  GEMD +DLR KLL+NK +PAIIN
Sbjct  166   ELLPNGILYTSQESHYSMFKIARMYRMDCGTIASLATGEMDCNDLRDKLLINKDRPAIIN  225

Query  934   VTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIG  755
             VTIGTTFKG +DNLD++++TL +CG+S ++FYIHCDAA+SG +VPFLK V K +FKKPIG
Sbjct  226   VTIGTTFKGAVDNLDLVVQTLIDCGFSDNQFYIHCDAAISGFVVPFLKQVQKFTFKKPIG  285

Query  754   SVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLS  575
             SV+ISGHKFLGCPMPCG+ +TR+  I  ISRN+EYIAS D TI+GSRNG +P+F+WY L+
Sbjct  286   SVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMWYVLN  345

Query  574   TKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCV  395
              KG  GL++D Q+C+  A +LR RL+ AGIS+M+N+ SITVVFERPPD +F+R WQL C+
Sbjct  346   LKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQLQCL  405

Query  394   RDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
              +MAHV+VMP V  E ++ F +DL+++R TWY +  QPPCL +D+G  NC CP+H
Sbjct  406   ENMAHVVVMPHVTVEMLERFLSDLIRKRNTWYGK-VQPPCLAEDIGICNCACPVH  459



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/439 (56%), Positives = 330/439 (75%), Gaps = 15/439 (3%)
 Frame = -2

Query  1501  KKMKIAAPPAR-----KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINY  1361
             KKMK      R     +N+H   + + EP   D+     EA +   L ++  ++ +R  Y
Sbjct  50    KKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELTGDKEAYMASVLARYRQSLLERTKY  109

Query  1360  HIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKD  1181
             H+GYP N+ +D Y  L  L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD
Sbjct  110   HLGYPYNLDFD-YGALNQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKD  168

Query  1180  EYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMING  1001
             EYWGYITN GTEGNLHGIL+GREV P+GILYASKESHYS+FKAARMYRM+   I T+++G
Sbjct  169   EYWGYITNCGTEGNLHGILVGREVFPDGILYASKESHYSLFKAARMYRMDCIKIETLLSG  228

Query  1000  EMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAA  821
             E+D  D ++KLL NK KPAI+NV IGTT KG +D+LD++I+TLEECG+  + FYIHCD A
Sbjct  229   EVDCADFKAKLLKNKDKPAIVNVNIGTTVKGAVDDLDLVIQTLEECGFPHNRFYIHCDGA  288

Query  820   LSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIAS  641
             L GL++PF+K  P+++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS
Sbjct  289   LFGLMLPFVKKAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLAS  348

Query  640   VDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
              DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+  GISAM+N+ S
Sbjct  349   RDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELS  408

Query  460   ITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-Q  284
              TVVFERP D +FIRRWQL+C  ++AHV+VMP +  + +++F ++LV++R+TW+++G  +
Sbjct  409   STVVFERPLDEEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFKDGTNK  468

Query  283   PPCLEDDLGSHNCYCPLHK  227
             PPC+  D+G  NC CP+HK
Sbjct  469   PPCVASDIGQENCVCPMHK  487



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/422 (58%), Positives = 318/422 (75%), Gaps = 9/422 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     EA +   L ++  ++ +R  +H+GYP N+ +D Y  L
Sbjct  6     RNVHTSCLEVTEPDADDESTGDKEAYMASVLARYRKSLIERTQHHLGYPYNLDFD-YGAL  64

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIEKD+YWGYITN GTEGNLH
Sbjct  65    GQLQPFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLH  124

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYASKESHYSVFKAARMYRME   + T++ GE+D  D  +KLL N+ 
Sbjct  125   GILVGREVFPDGILYASKESHYSVFKAARMYRMECLKVATLVTGEIDCSDFEAKLLANRD  184

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLE C ++ D FYIHCD AL GL++PF+K  PK++
Sbjct  185   KPAIINVNIGTTVKGAVDDLDLVIQTLEACRFTHDRFYIHCDGALFGLMMPFVKKAPKVT  244

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SR+VEY+AS DATI GSRNG  PIF
Sbjct  245   FKKPIGSVSVSGHKFVGCPMPCGVQITRLRHINALSRDVEYLASRDATIMGSRNGHAPIF  304

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G +K+ Q+C+  A +L  RL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  305   LWYTLNRKGYKGFRKEVQKCLRNAHYLNHRLREAGISAMLNELSSTVVFERPRDEEFVRR  364

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C   MAHV+VMP V    +D F ++L++ R+ WY +G +PPCL  D+G+ NC CPL
Sbjct  365   WQLACEGSMAHVVVMPNVTVGKLDQFLDELIESRSVWYEDGVEPPCLAADIGTENCSCPL  424

Query  232   HK  227
             HK
Sbjct  425   HK  426



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 329/435 (76%), Gaps = 13/435 (3%)
 Frame = -2

Query  1504  NKKMKIAAPPARKNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGY  1349
             N+K KI      +N+H   + V EP + D+     EA +   L ++  ++++R  YH+GY
Sbjct  55    NEKRKIVLG---RNIHTSCLEVTEPEADDEVTGDREAHMASVLARYRRSLTERTKYHLGY  111

Query  1348  PVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWG  1169
             P N+ +D Y  L+ L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWG
Sbjct  112   PYNLDFD-YGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWG  170

Query  1168  YITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDY  989
             YITN GTEGNLHGIL+GREV P+GILYAS+ESHYS+FKAARMYRME E + T+ +GE+D 
Sbjct  171   YITNCGTEGNLHGILVGREVLPDGILYASRESHYSIFKAARMYRMECEKVETLCSGEIDC  230

Query  988   DDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGL  809
             DD ++KLL ++ KPAIINV IGTT KG +D+LD++I+ LEE G+SQD FYIHCD AL GL
Sbjct  231   DDFKAKLLCHQDKPAIINVNIGTTVKGAVDDLDLVIQKLEEAGFSQDRFYIHCDGALFGL  290

Query  808   IVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDAT  629
             ++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S+NVEY+AS DAT
Sbjct  291   MMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSQNVEYLASRDAT  350

Query  628   ISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVV  449
             I GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A + +DRL  AGI AM+N+ S TVV
Sbjct  351   IMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVV  410

Query  448   FERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCL  272
             FERP D +FIRRWQL+C  ++AHV+VMP V  + +D+F N+L ++RA W+ +G  QP C+
Sbjct  411   FERPHDEEFIRRWQLACKGNIAHVVVMPNVTIQKLDDFLNELKEKRAAWFEDGKYQPYCI  470

Query  271   EDDLGSHNCYCPLHK  227
               D+G ++C C LHK
Sbjct  471   ASDVGENHCLCALHK  485



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/423 (58%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     +A +   L ++  ++++R  YH+GYP N+ +D Y  L
Sbjct  65    RNIHTTCLEVTEPEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFD-YGAL  123

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  124   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  183

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYS+FKAARMYRME E + T+ +GE+D DD ++KLL ++ 
Sbjct  184   GILVGREVLPDGILYASRESHYSIFKAARMYRMECEKVETLNSGEIDCDDFKAKLLRHQD  243

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+ LEE G+SQD FYIH D AL GL++PF+K  PK++
Sbjct  244   KPAIINVNIGTTVKGAVDDLDLVIQKLEEAGFSQDRFYIHVDGALFGLMMPFVKRAPKVT  303

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIF
Sbjct  304   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIF  363

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D +FIR+
Sbjct  364   LWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRK  423

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D+F N+LVQ+RATW+ +G  QP C+  D+G ++C C 
Sbjct  424   WQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCA  483

Query  235   LHK  227
              HK
Sbjct  484   QHK  486



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEP-----RSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V+EP      + D EA +   L ++  ++ +R  +H+GYP N+ +D Y  L
Sbjct  36    RNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLDFD-YGAL  94

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  95    GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  154

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYASK+SHYSVFKAARMYRME   +NT+++GE+D DD ++KLL +K 
Sbjct  155   GILVGREVFPDGILYASKDSHYSVFKAARMYRMECVKVNTLVSGEIDCDDFKAKLLCHKD  214

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+ LEE G++ D FYIHCD AL GL++PF+K  PK++
Sbjct  215   KPAILNVNIGTTVKGAVDDLDLVIQKLEEAGFTHDRFYIHCDGALFGLMMPFVKRAPKVT  274

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  275   FKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIF  334

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+E A +L+DRL+ AGI AM+N+ S TVVFERP + +F+R+
Sbjct  335   LWYTLNRKGYGGFQKEVQKCLENAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRK  394

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHVIVMP +  E +D+F ++L+Q RA W+++G  Q PC+  D+G+ NC C 
Sbjct  395   WQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCA  454

Query  235   LHK  227
              HK
Sbjct  455   SHK  457



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 322/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDDE-----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H     V EP + D+E     A +   L  +   + +R  +H+GYP N+ +D Y  L
Sbjct  61    RNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYPYNLDFD-YGAL  119

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA +WE+EK+EYWGYITN GTEGNLH
Sbjct  120   GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARIWELEKNEYWGYITNCGTEGNLH  179

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+I+GE+D +D + KLLLN+ 
Sbjct  180   GILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLISGEIDCEDFQRKLLLNRD  239

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ +D FYIHCD AL GL++PF+K  PK+S
Sbjct  240   KPAIINVNIGTTVKGAVDDLDLVIKTLEEGGF-KDRFYIHCDGALFGLMIPFVKKAPKVS  298

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  299   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIF  358

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI AM+N+ S TVVFERP D +F+RR
Sbjct  359   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRR  418

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F N+L ++RATWY++G  QPPCL  D+G  NC C 
Sbjct  419   WQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCS  478

Query  235   LHK  227
             +HK
Sbjct  479   IHK  481



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   531 bits (1367),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 322/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDDE-----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H     V EP + D+E     A +   L  +   + +R  +H+GYP N+ +D Y  L
Sbjct  63    RNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYPYNLDFD-YGAL  121

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA +WE+EK+EYWGYITN GTEGNLH
Sbjct  122   GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARIWELEKNEYWGYITNCGTEGNLH  181

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+I+GE+D +D + KLLLN+ 
Sbjct  182   GILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLISGEIDCEDFQRKLLLNRD  241

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ +D FYIHCD AL GL++PF+K  PK+S
Sbjct  242   KPAIINVNIGTTVKGAVDDLDLVIKTLEEGGF-KDRFYIHCDGALFGLMIPFVKKAPKVS  300

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  301   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIF  360

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI AM+N+ S TVVFERP D +F+RR
Sbjct  361   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRR  420

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F N+L ++RATWY++G  QPPCL  D+G  NC C 
Sbjct  421   WQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCS  480

Query  235   LHK  227
             +HK
Sbjct  481   IHK  483



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   529 bits (1363),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 324/423 (77%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEP-----RSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V+EP      + D EA +   L ++  ++ +R  +H+GYP N+ +D Y  L
Sbjct  36    RNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLDFD-YGAL  94

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  95    GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFALLWELEKNEYWGYITNCGTEGNLH  154

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYASK+SHYSVFKAARMYRME   +NT+++GE+D DD ++KLL +K 
Sbjct  155   GILVGREVFPDGILYASKDSHYSVFKAARMYRMECVKVNTLVSGEIDCDDFKAKLLCHKD  214

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++I+ LEE G++ D FYIHCD AL GL++PF+K  PK++
Sbjct  215   KPAILNVNIGTTVKGAVDDLDLVIQKLEEAGFTHDRFYIHCDGALFGLMMPFVKRAPKVT  274

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  275   FKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIF  334

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C++ A +L+DRL+ AGI AM+N+ S TVVFERP + +F+R+
Sbjct  335   LWYTLNRKGYGGFQKEVQKCLKNAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRK  394

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHVIVMP +  E +D+F ++L+Q RA W+++G  Q PC+  D+G+ NC C 
Sbjct  395   WQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCA  454

Query  235   LHK  227
              HK
Sbjct  455   SHK  457



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   529 bits (1363),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 253/452 (56%), Positives = 332/452 (73%), Gaps = 17/452 (4%)
 Frame = -2

Query  1537  SGSFKNGDFVENKKMKIAAPPAR-----KNMH---ITVAEPRSKDDE-----ARLKCTLG  1397
             +G+   G  +E ++  + +P  R     +N+H     V EP + D+E     A +   L 
Sbjct  17    NGARGKGMGMEGEEDGVESPGRREIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLA  76

Query  1396  KFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVL  1217
              +  ++ +R  +H+GYP N+ +D Y  L  L  + +NN GDPF+E+    HS+ FEVGVL
Sbjct  77    LYRKSLVERTKHHLGYPYNLDFD-YGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVL  135

Query  1216  DWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYR  1037
             DWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+G+LYAS+ESHYSVFKAARMYR
Sbjct  136   DWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMYR  195

Query  1036  MEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGY  857
             ME   ++T I+GE+D +D + KLLLNK KPAIINV IGTT KG +D+LD++IKTLEE G+
Sbjct  196   MECVKVDTFISGEIDCEDFQRKLLLNKDKPAIINVNIGTTVKGAVDDLDLVIKTLEENGF  255

Query  856   SQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLI  677
              +D FYIHCD AL GL++PF+K  PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I
Sbjct  256   -KDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHI  314

Query  676   HNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQ  497
             + +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+
Sbjct  315   NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLR  374

Query  496   AAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQ  317
              AGI AM+N+ S TVVFERP D +F+RRWQL+C   +AHV+VMP V  + +D F N+L +
Sbjct  375   EAGIGAMLNELSSTVVFERPKDEEFVRRWQLACEGSIAHVVVMPNVTIDKLDYFLNELRE  434

Query  316   ERATWYREGP--QPPCLEDDLGSHNCYCPLHK  227
             +RATWY++G   Q PC+  D+G  +C C LHK
Sbjct  435   KRATWYQDGGMCQAPCIARDVGQDSCLCSLHK  466



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   529 bits (1362),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 245/415 (59%), Positives = 319/415 (77%), Gaps = 10/415 (2%)
 Frame = -2

Query  1453  TVAEPRSKDDEA-------RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRY  1295
              V E   KD+E+        L   + +F D + +R + H+GYP N    HY  L+ L+++
Sbjct  46    AVVEVEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQF  105

Query  1294  HLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGR  1115
             ++NN GDPF E+    HSK FEVGVLDWFA+LW I+KDEYWGY+TNGGTEGNLHGIL+GR
Sbjct  106   NINNAGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGR  165

Query  1114  EVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIIN  935
             E+ P GILY S+ESHYS+FK ARMYRM+   I ++  GEMD +DLR KLL+NK +PAIIN
Sbjct  166   ELLPNGILYTSQESHYSMFKIARMYRMDCGTIASLATGEMDCNDLRDKLLINKDRPAIIN  225

Query  934   VTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIG  755
             VTIGTTFKG +DNLD++++TL +CG+S ++FYIHCDAA+SG +VPFLK   K +FKKPIG
Sbjct  226   VTIGTTFKGAVDNLDLVVQTLIDCGFSDNQFYIHCDAAISGFVVPFLKQ--KFTFKKPIG  283

Query  754   SVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLS  575
             SV+ISGHKFLGCPMPCG+ +TR+  I  ISRN+EYIAS D TI+GSRNG +P+F+WY L+
Sbjct  284   SVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMWYVLN  343

Query  574   TKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCV  395
              KG  GL++D Q+C+  A +LR RL+ AGIS+M+N+ SITVVFERPPD +F+R WQL C+
Sbjct  344   LKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQLQCL  403

Query  394   RDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
              +MAHV+VMP V  E ++ F +DL+++R TWY +  QPPCL +D+G  NC CP+H
Sbjct  404   ENMAHVVVMPHVTVEMLERFLSDLIRKRNTWYGK-VQPPCLAEDIGICNCACPVH  457



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   528 bits (1361),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 242/403 (60%), Positives = 311/403 (77%), Gaps = 2/403 (0%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             S+  +A +   L ++     +R  + IGYP+N+ +D Y  L  L+++ +NN GDPF+E+ 
Sbjct  46    SEATDAYMTAVLARYTHKFLERTKHVIGYPINLDFD-YRALDQLLQFSINNVGDPFIESN  104

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                HSKDFEVG L+WFA LWEIEK+EYWGYITNGGTEGNLHGIL+GREV P+GILYASKE
Sbjct  105   YGVHSKDFEVGTLNWFARLWEIEKEEYWGYITNGGTEGNLHGILVGREVFPDGILYASKE  164

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             SHYSVFKAA MYRM    I T+ +GE+D  +L+ KLL NK  PAI+N+ IGTT +G +D+
Sbjct  165   SHYSVFKAAHMYRMSCVNIETLASGEIDCGELKVKLLQNKDTPAIMNINIGTTVRGAIDD  224

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCP  716
             LD++I+TLEECG+S + FYIHCDAAL GL++PFL    +++FKKPIGSV++SGHKFLGCP
Sbjct  225   LDLVIQTLEECGFSHNRFYIHCDAALFGLMLPFLDKATQVTFKKPIGSVSVSGHKFLGCP  284

Query  715   MPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQR  536
             MPCG+Q+ RK  I+ +SRN+EYIAS DATI+GSRNG TPIFLWY+L+ KG  GLQKD Q 
Sbjct  285   MPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLWYALNRKGYHGLQKDVQM  344

Query  535   CVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVA  356
             C+  A +L+ RL+  G+S M+N  S TVVFERP D +FIRRWQL+C  ++AHVIVMP V 
Sbjct  345   CMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQLACEGNIAHVIVMPHVT  404

Query  355   PEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCYCPLH  230
              E +D F N+LV++R TW+++ G QPPC+  +LG  NC CPLH
Sbjct  405   IEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   529 bits (1363),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     EA +   L ++   +++R  +H+GYP N+ +D Y  L
Sbjct  62    RNIHTSCLEVTEPEADDEVTGDREAHMASVLARYKRALTERTKHHLGYPYNLDFD-YGAL  120

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  121   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  180

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME E ++T+ +GE+D DD ++KLL ++ 
Sbjct  181   GILVGREVFPDGILYASRESHYSVFKAARMYRMECEKVDTLWSGEIDCDDFKAKLLSHQD  240

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IK LEE G+S D FYIHCD AL GL++PF+K  PK++
Sbjct  241   KPAIINVNIGTTVKGAVDDLDLVIKKLEEAGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  300

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKP+GSV++SGHKF+GCPMPCG+Q+TR   ++ ++R+VEY+AS DATI GSRNG  PIF
Sbjct  301   FKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIF  360

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A + + RL  AGI AM+N+ S TVVFERP D +FIR+
Sbjct  361   LWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRK  420

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP +  E +D+F N+L+++RATW+++G  QP C+  D+G  NC C 
Sbjct  421   WQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCA  480

Query  235   LHK  227
             LHK
Sbjct  481   LHK  483



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   529 bits (1363),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 240/423 (57%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H   + V EP + D+     EA +   L ++   +++R  +H+GYP N+ +D Y  L
Sbjct  64    RNIHTSCLEVTEPEADDEVTGDREAHMASVLARYKRALTERTKHHLGYPYNLDFD-YGAL  122

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  123   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  182

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME E ++T+ +GE+D DD ++KLL ++ 
Sbjct  183   GILVGREVFPDGILYASRESHYSVFKAARMYRMECEKVDTLWSGEIDCDDFKAKLLSHQD  242

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IK LEE G+S D FYIHCD AL GL++PF+K  PK++
Sbjct  243   KPAIINVNIGTTVKGAVDDLDLVIKKLEEAGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  302

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKP+GSV++SGHKF+GCPMPCG+Q+TR   ++ ++R+VEY+AS DATI GSRNG  PIF
Sbjct  303   FKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIF  362

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A + + RL  AGI AM+N+ S TVVFERP D +FIR+
Sbjct  363   LWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRK  422

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP +  E +D+F N+L+++RATW+++G  QP C+  D+G  NC C 
Sbjct  423   WQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCA  482

Query  235   LHK  227
             LHK
Sbjct  483   LHK  485



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   529 bits (1362),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 248/463 (54%), Positives = 334/463 (72%), Gaps = 15/463 (3%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD--  1424
             E+F P  ++ P    P    +G   +GD    K  +I        M   + EP + D+  
Sbjct  21    EEFDPKEISGPADSAP----NGILGSGD---GKNREIVLGRNVHKMCFAINEPEADDEVT  73

Query  1423  ---EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTV  1253
                EA +   L ++  ++ +R  +H+GYP N+ +D Y  L  L  + +NN GDPF+E+  
Sbjct  74    GEREAYMASVLARYRKSLVERTKHHLGYPYNLDFD-YGALNQLQHFSINNLGDPFIESNY  132

Query  1252  DFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKES  1073
               HS+ FEVGVLDWFA LWE+E+ EYWGYITN GTEGNLHG+L+GREV P+G+LYAS+ES
Sbjct  133   GVHSRQFEVGVLDWFARLWELERSEYWGYITNCGTEGNLHGLLVGREVFPDGMLYASRES  192

Query  1072  HYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNL  893
             HYSVFKAARMYRME   ++T+++GE+D  D R+KL+ NKGKPAI+NV IGTT KG +D+L
Sbjct  193   HYSVFKAARMYRMECIKVDTLVSGEIDCKDFRNKLVQNKGKPAIVNVNIGTTVKGAVDDL  252

Query  892   DVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPM  713
             D++I+TLEE G+ +D FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPM
Sbjct  253   DMVIQTLEESGF-RDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPM  311

Query  712   PCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRC  533
             PCG+Q+TR   I  +S NVEY+AS D+TI GSRNG  PIFLWY+L+ KG  G QK+ Q+C
Sbjct  312   PCGVQITRLEHIKVLSSNVEYLASRDSTIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKC  371

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +L+DRL+AAG+ AM+N+ S TVVFERP D +F+RRWQL+C  ++AH++VMP V  
Sbjct  372   LRNAHYLKDRLKAAGVGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHIVVMPNVTI  431

Query  352   EAIDNFFNDLVQERATWYREGPQP-PCLEDDLGSHNCYCPLHK  227
             E +D F N+L+Q+R++WY  G  P PCL  D+G  NC C LH+
Sbjct  432   EKLDTFLNELIQKRSSWYEGGKIPSPCLAADIGDENCLCSLHQ  474



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 322/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     EA +   L ++   +++R  +H+GYP N+ +D Y  L
Sbjct  64    RNVHTTCLEVTEPEADDEITGDREAHMASVLARYKRALTERTKHHLGYPYNLDFD-YGAL  122

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  123   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  182

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME E ++T+ +GE+D DD ++KLL ++ 
Sbjct  183   GILVGREVFPDGILYASRESHYSVFKAARMYRMECEKVDTLWSGEIDCDDFKAKLLSHQD  242

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IK LEE G+S D FYIHCD AL GL++PF+K  PK++
Sbjct  243   KPAIINVNIGTTVKGAVDDLDLVIKKLEEAGFSHDRFYIHCDGALFGLMMPFVKLAPKVT  302

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   ++ ++R+VEY+AS DATI GSRNG  PIF
Sbjct  303   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIF  362

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A + + RL  AGI AM+N+ S TVVFERP D +FIR+
Sbjct  363   LWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRK  422

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP +  E +D+F N+L+ +RATW+++G  QP C+  D+G  NC C 
Sbjct  423   WQLACKGNIAHVVVMPNITIEKLDDFLNELLDKRATWFQDGKDQPYCISSDVGEKNCLCA  482

Query  235   LHK  227
             LHK
Sbjct  483   LHK  485



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 323/423 (76%), Gaps = 10/423 (2%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     +A +   L ++  ++++R  YH+GYP N+ +D Y  L
Sbjct  65    RNIHTTCLEVTEPEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFD-YGAL  123

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  124   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  183

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYS+FKAARMYRME E + T+ +GE+D DD ++KLL ++ 
Sbjct  184   GILVGREVLPDGILYASRESHYSIFKAARMYRMECEKVETLNSGEIDCDDFKAKLLRHQD  243

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+ LEE G+SQD FYIH D AL GL++PF+K  PK++
Sbjct  244   KPAIINVNIGTTVKGAVDDLDLVIQKLEEAGFSQDRFYIHVDGALFGLMMPFVKRAPKVT  303

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVE +AS DATI GSRNG  PIF
Sbjct  304   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRNGHAPIF  363

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D +FIR+
Sbjct  364   LWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRK  423

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D+F N+LVQ+RATW+ +G  QP C+  D+G ++C C 
Sbjct  424   WQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCA  483

Query  235   LHK  227
              HK
Sbjct  484   QHK  486



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 320/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDDE-----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H+T   V EP + D+E     A +   L  +  ++ +R  +H+GYP N+ +D Y  L
Sbjct  49    RNVHMTCFEVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLDFD-YGAL  107

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLH
Sbjct  108   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLH  167

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRME   ++T I+GE+D  D   KLL N+ 
Sbjct  168   GILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDTHISGEIDCSDFERKLLQNRD  227

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ Q  FYIHCD AL GL++PF+K   K++
Sbjct  228   KPAIINVNIGTTVKGAVDDLDLVIKTLEESGF-QGRFYIHCDGALFGLMIPFVKKAAKVT  286

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  287   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  346

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL AAGI AM+N+ S TVVFERP D +F+RR
Sbjct  347   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKDEEFVRR  406

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F  +LV++RA WY++G  QPPC+  D+G  +C+C 
Sbjct  407   WQLACEGNIAHVVVMPSVTIDKLDYFLRELVEKRAVWYKDGICQPPCIARDVGEKSCFCS  466

Query  235   LHK  227
             LHK
Sbjct  467   LHK  469



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   526 bits (1356),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 241/403 (60%), Positives = 310/403 (77%), Gaps = 2/403 (0%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             S   +A +   L ++     +R  + IGYP+N+ +D Y  L  L+++ +NN GDPF+E+ 
Sbjct  46    SGATDAYMTAVLARYTHKFLERTKHFIGYPINLDFD-YRALDQLLQFSINNVGDPFIESN  104

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                HSKDFEVG L+WFA LWEIEK+EYWGYITNGGTEGNLHGIL+GRE+ P+GILYASKE
Sbjct  105   YGVHSKDFEVGTLNWFARLWEIEKEEYWGYITNGGTEGNLHGILVGRELFPDGILYASKE  164

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             SHYSVFKAA MYRM    I T+ +GE+D  +L+ KLL NK  PAI+N+ IGTT +G +D+
Sbjct  165   SHYSVFKAAHMYRMSCVNIETLASGEIDCGELKVKLLQNKDTPAIMNINIGTTVRGAIDD  224

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCP  716
             LD++I+TLEECG+S + FYIHCDAAL GL++PFL    +++FKKPIGSV++SGHKFLGCP
Sbjct  225   LDLVIQTLEECGFSHNRFYIHCDAALFGLMLPFLDKATQVTFKKPIGSVSVSGHKFLGCP  284

Query  715   MPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQR  536
             MPCG+Q+ RK  I+ +SRN+EYIAS DATI+GSRNG TPIFLWY+L+ KG  GLQKD Q 
Sbjct  285   MPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLWYALNRKGYHGLQKDVQM  344

Query  535   CVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVA  356
             C+  A +L+ RL+  G+S M+N  S TVVFERP D +FIRRWQL+C  ++AHVIVMP V 
Sbjct  345   CMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQLACEGNIAHVIVMPHVT  404

Query  355   PEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCYCPLH  230
              E +D F N+LV++R TW+++ G QPPC+  +LG  NC CPLH
Sbjct  405   IEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   528 bits (1360),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 323/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDDE-----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H +   V EP + D+E     A +   L  +  ++ +R  +H+GYP N+ +D Y  L
Sbjct  74    RNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLDFD-YGAL  132

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLH
Sbjct  133   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLH  192

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+++GE+D  D   KLL N+ 
Sbjct  193   GILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLMSGEIDCADFHRKLLQNRD  252

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ +D FYIHCD AL GL++PF+K  P+++
Sbjct  253   KPAIINVNIGTTVKGAVDDLDLVIKTLEENGF-KDRFYIHCDGALFGLMIPFVKKAPQVT  311

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  312   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  371

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AG+ AM+N+ S TVVFERP D +F+RR
Sbjct  372   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGVGAMLNELSSTVVFERPKDEEFVRR  431

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F N+LV++RATWY++G  QPPC+  D+G  NC C 
Sbjct  432   WQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVENCLCG  491

Query  235   LHK  227
             LHK
Sbjct  492   LHK  494



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   527 bits (1357),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 329/447 (74%), Gaps = 15/447 (3%)
 Frame = -2

Query  1528  FKNGDFVENKKMKIAAPPAR-----KNMH---ITVAEPRSKDD-----EARLKCTLGKFL  1388
              KN D  +N +        R     +N+H   + V EP + D+     EA +   L ++ 
Sbjct  42    LKNEDGADNGENSTLVSGKREIVLGRNVHTSCLEVTEPDADDEVTGDREACMASILARYR  101

Query  1387  DTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWF  1208
              ++ +R  +H+GYP N+ +D Y  LA L  + +NN GDPF+E+    HS+ FEVGVLDWF
Sbjct  102   KSLIERTRHHLGYPYNLDFD-YGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWF  160

Query  1207  AELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEV  1028
             A LWE+E++EYWGYITN GTEGNLHGIL+GREV P+GILYASKESHYSVFKAARMYRM+ 
Sbjct  161   ARLWELERNEYWGYITNCGTEGNLHGILVGREVFPDGILYASKESHYSVFKAARMYRMDC  220

Query  1027  EGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQD  848
               +NT+++GE+D  D R+KLL NK KPAIINV IGTT KG +D+LD++IK LE+ G++ D
Sbjct  221   VMVNTLVSGEIDCTDFRAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIKILEDTGFNHD  280

Query  847   EFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNI  668
              FYIHCD AL GL++PF+K  PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +
Sbjct  281   RFYIHCDGALFGLMMPFVKRAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLDHINAL  340

Query  667   SRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAG  488
             SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+D L++ G
Sbjct  341   SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDCLRSEG  400

Query  487   ISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERA  308
             ISAM+N+ S TVVFERP D +F+RRWQL+C  ++AH +VMP +  E +D+F  +L  +R+
Sbjct  401   ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHAVVMPNITIEKLDDFVKELTAKRS  460

Query  307   TWYREG-PQPPCLEDDLGSHNCYCPLH  230
             TW+++G  Q PC+ D++G+ NC C  H
Sbjct  461   TWFKDGKAQAPCIADEIGAENCACARH  487



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   526 bits (1355),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/463 (54%), Positives = 334/463 (72%), Gaps = 15/463 (3%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD--  1424
             E+F P  ++AP    P  V  G        + K  +I        +   + EP + D+  
Sbjct  21    EEFDPKEISAPVDSQPNGVLEGR-------DGKSREIVLGRNVHKLCFAINEPEADDEVT  73

Query  1423  ---EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTV  1253
                EA +   L ++  ++ +R  +H+GYP N+ +D Y  L+ L  + +NN GDPF+E+  
Sbjct  74    GEREAYMASVLARYRKSLIERTKHHLGYPYNLDFD-YGALSQLQHFSINNLGDPFIESNY  132

Query  1252  DFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKES  1073
               HS+ FEVGVLDWFA LWE+E++EYWGYITN GTEGNLHG L+GREV P+GILYAS+ES
Sbjct  133   GVHSRQFEVGVLDWFARLWELERNEYWGYITNCGTEGNLHGFLVGREVFPDGILYASRES  192

Query  1072  HYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNL  893
             HYSVFKAARMYRME   ++T+++GE+D  D R+KL+ NKGKPAI+NV IGTT KG +D+L
Sbjct  193   HYSVFKAARMYRMECIRVDTLVSGEIDCKDFRNKLVQNKGKPAIVNVNIGTTVKGAVDDL  252

Query  892   DVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPM  713
             D++I+TLEE G+ +D FYIHCD AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPM
Sbjct  253   DMVIQTLEESGF-RDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPM  311

Query  712   PCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRC  533
             PCG+Q+TR   I  +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C
Sbjct  312   PCGVQITRLEHIKVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKC  371

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +L+DRL+AAG+SAM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VMP V  
Sbjct  372   LRNAHYLKDRLKAAGVSAMLNELSSTVVFERPKDGEFVRRWQLACEGNIAHVVVMPNVTV  431

Query  352   EAIDNFFNDLVQERATWYREGPQP-PCLEDDLGSHNCYCPLHK  227
             E +D F N+L+Q R++ Y +G  P PC+  D+G  NC C LH+
Sbjct  432   EKLDTFLNELIQNRSSCYEDGNIPFPCIAADIGDENCLCSLHQ  474



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   526 bits (1356),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 322/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H +   V EP + D+     EA +   L  +  ++ +R  +H+GYP N+ +D Y  L
Sbjct  69    RNVHTSCFAVKEPDADDEVTGEREATMASVLALYRRSLVERTKHHLGYPYNLDFD-YGAL  127

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLH
Sbjct  128   GQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLH  187

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+++GE+D  D + K+L N+ 
Sbjct  188   GILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLMSGEIDCADFQRKILQNRD  247

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ +D FYIHCD AL GL++PF+K  PK++
Sbjct  248   KPAIINVNIGTTVKGAVDDLDLVIKTLEESGF-KDRFYIHCDGALFGLMIPFVKKAPKVT  306

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  307   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINVLSSNVEYLASRDATIMGSRNGHAPIF  366

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI AM+N+ S TVVFERP D +F+RR
Sbjct  367   LWYTLNRKGYVGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRR  426

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F  +LV++RATWY++G  +PPCL  DLG  NC C 
Sbjct  427   WQLACEGNIAHVVVMPSVNIDKLDYFLTELVEKRATWYQDGISKPPCLARDLGVENCLCG  486

Query  235   LHK  227
             LHK
Sbjct  487   LHK  489



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   523 bits (1347),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 243/422 (58%), Positives = 311/422 (74%), Gaps = 23/422 (5%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP   D+     EA +   L ++  T+ +R  +H+GYP N+ +D Y  L
Sbjct  56    RNIHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKFHLGYPYNLDFD-YGAL  114

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWEIE+D+YWGYITN GTEGNLH
Sbjct  115   GQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLH  174

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE+ P+GILYAS+ESHYSV              +T+I+GE+D DD R KLL NK 
Sbjct  175   GILVGREMFPDGILYASRESHYSV--------------DTLISGEIDCDDFRKKLLANKD  220

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD++IKTLEECG+S D FYIHCD AL GL++PF+K  PK++
Sbjct  221   KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVT  280

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             F KPIGSV++SGHKF+GCPMPCG+Q+TR   I  +S NVEY+AS DATI GSRNG  P+F
Sbjct  281   FNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLF  340

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL  AGISAM+N+ S TVVFERP D +F+RR
Sbjct  341   LWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCEAGISAMLNELSSTVVFERPKDEEFVRR  400

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPL  233
             WQL+C  D+AHV+VMP V  E +DNF  DLV+ R+ WY +G QPPCL  ++G++NC CP 
Sbjct  401   WQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRSVWYEDGSQPPCLASEVGTNNCICPT  460

Query  232   HK  227
             HK
Sbjct  461   HK  462



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 243/423 (57%), Positives = 321/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H +   V EP + D+     EA +   L ++   + +R  +H+GYP N+ +D Y  L
Sbjct  48    RNVHASCFAVKEPDADDEVTGEREATMAGVLARYRRCLIERTKHHLGYPYNLDFD-YGAL  106

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             A L  + +NN GDPF+E+    HS+ FEVGVLDWFA LW++EKDEYWGYITN GTEGNLH
Sbjct  107   AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDLEKDEYWGYITNCGTEGNLH  166

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+G+LYAS+ESHYSVFKAARMYRM+   + T+++GE+D  D   KL  NK 
Sbjct  167   GILVGREVFPDGVLYASRESHYSVFKAARMYRMDCVKVETLVSGEIDCTDFGRKLFENKD  226

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++I+TLE+ G+ Q+ FYIHCD AL GL++PF+K  PK+S
Sbjct  227   KPAIINVNIGTTVKGAVDDLDLVIETLEKTGF-QNRFYIHCDGALFGLMMPFVKLAPKVS  285

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ ++ NVEY+AS DATI GSRNG  PIF
Sbjct  286   FKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPIF  345

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGISAM+N+ S TVVFERP D +F+RR
Sbjct  346   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRNAGISAMLNELSSTVVFERPKDEEFVRR  405

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  +++HV+VMP V    +D+F N+LV++R TWY+EG  Q PC+  D+G HNC C 
Sbjct  406   WQLACEGNISHVVVMPSVTINKLDSFLNELVEKRVTWYQEGICQSPCIAGDVGQHNCLCT  465

Query  235   LHK  227
             +HK
Sbjct  466   MHK  468



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   523 bits (1347),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 322/423 (76%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDDE-----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H +   V EP + D+E     A +   L  +  ++ +R  +H+GYP N+ +D Y  L
Sbjct  74    RNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLDFD-YGAL  132

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
               L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLH
Sbjct  133   TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLH  192

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+++GE+D  D + KLL N+ 
Sbjct  193   GILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLMSGEIDCADFQRKLLQNRD  252

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAIINV IGTT KG +D+LD++IKTLEE G+ +  FYIHCD AL GL++PF+K  P+++
Sbjct  253   KPAIINVNIGTTVKGAVDDLDLVIKTLEENGF-KGRFYIHCDGALFGLMIPFVKKAPQVT  311

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIF
Sbjct  312   FKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIF  371

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI AM+N+ S TVVFERP D +F+RR
Sbjct  372   LWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRR  431

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  + +D F N+LV++RATWY++G  QPPC+  D+G  +C C 
Sbjct  432   WQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVESCLCG  491

Query  235   LHK  227
             LHK
Sbjct  492   LHK  494



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   521 bits (1343),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 243/418 (58%), Positives = 319/418 (76%), Gaps = 8/418 (2%)
 Frame = -2

Query  1462  MHITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             M  T+ EP   D+     EA +   L ++  ++ +R  +H+GYP N+ +D Y  LA L  
Sbjct  63    MCFTIKEPEVDDEVTGEREAYMASVLARYRRSLIERTKHHLGYPYNLDFD-YGALAQLQH  121

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLHGIL+G
Sbjct  122   FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVG  181

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             REV P+GILYASKESHYSVFKAARMYRME   ++T+I+GE+D  D ++KLL NK +PA+I
Sbjct  182   REVFPDGILYASKESHYSVFKAARMYRMECVKVDTLISGEIDCIDFKAKLLQNKERPAVI  241

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
             NV IGTT KG +D+LD++I+TLEE G+ +  FYIHCD AL GL++PF+K  PK++FKKPI
Sbjct  242   NVNIGTTVKGAVDDLDMVIQTLEENGF-KGRFYIHCDGALFGLMMPFVKRAPKVTFKKPI  300

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSL  578
             GSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L
Sbjct  301   GSVSVSGHKFVGCPMPCGVQITRLKHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTL  360

Query  577   STKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSC  398
             + KG  G QK+ Q+CV  A +L+DRL+ AGI AM+N+ S TVVFERP D +F+RRWQL+C
Sbjct  361   NRKGYRGFQKEVQKCVRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDDEFVRRWQLAC  420

Query  397   VRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQ-PPCLEDDLGSHNCYCPLHK  227
               ++AHV+VMP V  + +D+F  +L Q+R+ WY++G   PPC+  D+G  NC+C LHK
Sbjct  421   EGNIAHVVVMPNVNIDKLDSFLEELFQKRSCWYQDGKMPPPCIAADIGQDNCFCVLHK  478



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   519 bits (1336),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 313/400 (78%), Gaps = 4/400 (1%)
 Frame = -2

Query  1486  AAPPARKNMHITVAEPRSKDDEA----RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYA  1319
             A    +K     V EP +++       RL  T+ +F + + +R++Y++GYP N   +HY 
Sbjct  28    AMAEEKKGEGFAVEEPNNEECAVERVDRLSKTVTEFQEHLRERVSYYLGYPANHNCEHYL  87

Query  1318  TLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGN  1139
              L+ L+++++NN GDPF E+    HSK FEVGVLDWFA+LW I+KDEYWGY+TNGGTEGN
Sbjct  88    ALSTLLQFNINNVGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGN  147

Query  1138  LHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLN  959
             LHGIL+GRE+ P GILY S+ESHYS+FK ARMYRM+ E I ++  G+MD +DLR KLL+N
Sbjct  148   LHGILMGRELLPNGILYTSQESHYSMFKIARMYRMDCETIASLATGKMDCNDLRDKLLIN  207

Query  958   KGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPK  779
             K +PAIIN+ IGTTFKG  D+LD++++TLE+CG+S+D+FYIHCDAA+SG +VPFLK  PK
Sbjct  208   KDRPAIININIGTTFKGATDDLDLVVQTLEDCGFSRDQFYIHCDAAISGFVVPFLKQAPK  267

Query  778   ISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTP  599
              +FKKPIGSV+ISGHKFLGCPMPCG+ +TRK  I  +S ++EYIA+VD TI+GSRNG +P
Sbjct  268   FTFKKPIGSVSISGHKFLGCPMPCGVLLTRKRYIDILSTSIEYIATVDTTIAGSRNGHSP  327

Query  598   IFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFI  419
             IFLWY L+ KG+ GL++D ++C+  + +LRDRL+ AGI++M+N+ SITVVFERPPD +FI
Sbjct  328   IFLWYVLNIKGQKGLEEDVEKCLINSRYLRDRLKKAGINSMLNEMSITVVFERPPDSEFI  387

Query  418   RRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWY  299
             R WQL C+ +MAHV++MP V  E +D+F  DL+Q+R  WY
Sbjct  388   RHWQLQCLGNMAHVVIMPHVTVEMLDHFLYDLLQKRNIWY  427



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   518 bits (1335),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 251/463 (54%), Positives = 334/463 (72%), Gaps = 22/463 (5%)
 Frame = -2

Query  1588  MPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPRSKDDE-  1421
             +P+ +  PEA++           G+   N K +I      +N+H +   V EP + D+E 
Sbjct  40    LPVELEPPEAVVA--------PTGEEAANGKREIVMG---RNVHTSCFAVKEPDADDEET  88

Query  1420  ----ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTV  1253
                 A +   L  +  ++ +R  +H+GYP N+ +D Y  LA L  + +NN GDPF+E+  
Sbjct  89    GEREATMASILALYRRSLVERTKHHLGYPYNLDFD-YGALAQLQHFSINNLGDPFIESNY  147

Query  1252  DFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKES  1073
               HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ES
Sbjct  148   GVHSRQFEVGVLDWFASLWELEKDEYWGYITNCGTEGNLHGILVGREVFPKGILYASRES  207

Query  1072  HYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNL  893
             HYSVFKAARMYRM+   ++T+++GE+D  D + KLL N+ KPAIINV IGTT KG +D+L
Sbjct  208   HYSVFKAARMYRMDCVKVDTLMSGEIDCADFQRKLLQNRDKPAIINVNIGTTVKGAVDDL  267

Query  892   DVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPM  713
             D++IKTLEE G+ +  FYIHCD AL GL++PF+K  P+++FKKPIGSV++SGHKF+GCPM
Sbjct  268   DLVIKTLEENGF-KGRFYIHCDGALFGLMIPFVKKAPQVTFKKPIGSVSVSGHKFVGCPM  326

Query  712   PCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRC  533
             PCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C
Sbjct  327   PCGVQITRLEYINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKC  386

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +L+DRL+ AGI AM+N+ S TVVFERP D  F+RRWQL+C  ++ HV+VMP V  
Sbjct  387   LRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEVFVRRWQLACEGNICHVVVMPSVNI  446

Query  352   EAIDNFFNDLVQERATWYREG-PQPPCLEDDLGSHNCYCPLHK  227
             + +D F N+LV++RATWY++G  QPPC+   +G  NC C  HK
Sbjct  447   DKLDYFLNELVEKRATWYQDGISQPPCIARVVGFENCLCGRHK  489



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   513 bits (1322),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 313/413 (76%), Gaps = 9/413 (2%)
 Frame = -2

Query  1450  VAEPRSKDDEA------RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHL  1289
             V EP  KD+E        L   + +F D + +R +  +G+P N    HY  L+ L++Y++
Sbjct  46    VVEP--KDEECAVERLHHLTKIVTEFQDHLRERASNQLGHPGNHNCSHYLALSTLLQYNI  103

Query  1288  NNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREV  1109
             NN GDPF E+    H+K FEV VLDWFA+LW I+KDEYWGY+TNGGTEGNLHGIL+GRE+
Sbjct  104   NNVGDPFKESNYGLHTKKFEVSVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGILMGREL  163

Query  1108  HPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVT  929
              P GILY S+ESHYS+ K ARMYRM+ E I ++  GEMD +DL+ KLL+NK +PAIINVT
Sbjct  164   LPNGILYTSQESHYSMLKIARMYRMDCETIASLATGEMDCNDLQDKLLMNKDRPAIINVT  223

Query  928   IGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSV  749
             IGTTFKG +D+LD++++TL + G+S ++FYIHCDAA+SGL+VPFLK V K +FKKPIGSV
Sbjct  224   IGTTFKGAVDDLDLVVQTLIDSGFSDNQFYIHCDAAMSGLVVPFLKQVTKFTFKKPIGSV  283

Query  748   TISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTK  569
             +ISGHKFLGCPMPCG+ +TR+  I  ISRN+EYIA+ D+TI+GSRNG +PIF+WY L+ K
Sbjct  284   SISGHKFLGCPMPCGVLLTRRKYIKLISRNIEYIATCDSTIAGSRNGHSPIFMWYVLNIK  343

Query  568   GRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRD  389
             G  GL++D ++C++ A +LR  L+ AGIS+M+N+ S+TVVFERP D +FIR WQL C+  
Sbjct  344   GWKGLKQDVEKCLKNARYLRHHLKKAGISSMLNETSVTVVFERPQDSEFIRHWQLQCLGS  403

Query  388   MAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
             MAHV+VMP V  E +D F  DL+++R  W+     PPCL +D+G  NC CP+H
Sbjct  404   MAHVVVMPHVTIEMLDRFLYDLIRKRNIWHGT-LHPPCLAEDMGICNCACPVH  455



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   513 bits (1320),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 314/423 (74%), Gaps = 11/423 (3%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +NMH     + EP S D+     E  +   L K+  ++ +R  +H+GYP N+  D Y  L
Sbjct  52    RNMHTVSFAIKEPESDDELTGEREGYMASVLAKYRKSLVERTKHHLGYPYNLDLD-YGAL  110

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK EYWGYITN GTEGNLH
Sbjct  111   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKHEYWGYITNCGTEGNLH  170

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GRE  P+GILYAS+ESHYSVFKAARMYRM    ++T+ +GE+D  D R+KLL +K 
Sbjct  171   GILVGRESFPDGILYASRESHYSVFKAARMYRMHCVKVDTLTSGEIDCMDFRAKLLDHKD  230

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LDV+I+TLEE G+ +D FYIHCD AL GL++PF+   PK++
Sbjct  231   KPAILNVNIGTTVKGAVDDLDVLIQTLEESGF-KDRFYIHCDGALFGLMLPFVTRAPKVT  289

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ ++ NVEY+AS DATI GSRNG  P+F
Sbjct  290   FKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPLF  349

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G +K+ Q+C+  A +LRDRL AAG+ AM+N  S TVVFERP D  F+RR
Sbjct  350   LWYTLNRKGYRGFRKEVQKCLRNAHYLRDRLMAAGVGAMLNPLSSTVVFERPKDEGFVRR  409

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQP-PCLEDDLGSHNCYCP  236
             WQL+C  ++AHV+VMP V  E +D+F ++LV  R+ WYR+  +P PC+  ++G  NC+C 
Sbjct  410   WQLACEGNIAHVVVMPSVTIEKLDDFLDELVAGRSAWYRDRSRPSPCIAAEIGQENCHCS  469

Query  235   LHK  227
             +HK
Sbjct  470   MHK  472



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 314/418 (75%), Gaps = 8/418 (2%)
 Frame = -2

Query  1462  MHITVAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             M   + EP + D+     EA +   L ++  ++  R  +H+GYP N+ +D Y  L  L  
Sbjct  63    MCFAIKEPEADDEVTGEREAYMASVLARYRRSLIDRTKHHLGYPYNLDFD-YGALGQLQH  121

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLHGIL+G
Sbjct  122   FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGILVG  181

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             REV P+G+LYAS+ESHYS+FKAARMYRME   ++T+++GE+D    ++ LL N  +PAI+
Sbjct  182   REVFPDGVLYASRESHYSIFKAARMYRMECVKVDTLVSGEIDCTHFKASLLQNMERPAIV  241

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
             NV IGTT KG +D+LD++IKTLEE G+ +D FYIHCD AL GL++PF+K  PK++F KPI
Sbjct  242   NVNIGTTVKGAVDDLDMVIKTLEENGF-KDRFYIHCDGALFGLMMPFVKRAPKVTFTKPI  300

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSL  578
             GSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+AS DATI GSRNG  PIFLWY+L
Sbjct  301   GSVSVSGHKFVGCPMPCGVQITRSKHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTL  360

Query  577   STKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSC  398
             + KG  G QK+ Q+C+  A +L+DRL+ AGIS M+N+ S TVVFERP D +F+R+WQL+C
Sbjct  361   NRKGYRGFQKEVQKCLRNAHYLKDRLKEAGISVMLNELSSTVVFERPKDEEFVRQWQLAC  420

Query  397   VRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
               ++AHV+VMP V  + +D+F N+L++ R+ WY+EG   PPC+  D+G  NC C LH+
Sbjct  421   EGNIAHVVVMPNVTIDKLDSFLNELLRHRSCWYQEGNISPPCIAADIGEENCCCALHR  478



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   505 bits (1300),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 231/375 (62%), Positives = 292/375 (78%), Gaps = 1/375 (0%)
 Frame = -2

Query  1351  YPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYW  1172
             YP N+   H   L+PL+ + LNN GDPF E+    HSK FEV VLDWFAELWEIE DEYW
Sbjct  1     YPGNLNCKHLVDLSPLLSFLLNNVGDPFKESNFGLHSKKFEVAVLDWFAELWEIENDEYW  60

Query  1171  GYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMD  992
             GY+TNGGTEGNLHG+LLGR++ P+GILY SKESHYS+FK AR+YR+E + INT++ GE+D
Sbjct  61    GYVTNGGTEGNLHGMLLGRDLLPDGILYTSKESHYSIFKGARIYRIESQIINTLVTGEID  120

Query  991   YDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSG  812
             Y DL+ KL LNK KPAIIN+ IGTTFKGG+DNLD++IKTL ECG+S D FYIHCDAALSG
Sbjct  121   YTDLQEKLFLNKDKPAIINLNIGTTFKGGVDNLDLVIKTLRECGFSHDRFYIHCDAALSG  180

Query  811   LIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDA  632
             L+ PFL+N P  SFKKPIGSV++S HK LG  +PCG+ ++RK  + + S N+EYIA+ D 
Sbjct  181   LVSPFLENGPLFSFKKPIGSVSVSAHKLLGSSIPCGVFISRKMHMTDFSTNIEYIATQDT  240

Query  631   TISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITV  452
             TISGSRNG TPIF+WY L+ KGR G QK+ + C+  A +LRD L+ AGISAM+N++SI V
Sbjct  241   TISGSRNGHTPIFIWYGLNMKGRIGFQKEVKSCLTNARYLRDGLKEAGISAMLNESSIVV  300

Query  451   VFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPC  275
             VFERP DR+F+  WQLS + +MAHV++MP V  + +D+F +DLVQ+R  WY  G  +P C
Sbjct  301   VFERPLDREFVDFWQLSFLDNMAHVVLMPHVTVKMLDDFLSDLVQKREIWYGSGEVRPVC  360

Query  274   LEDDLGSHNCYCPLH  230
             L +++G  NC C +H
Sbjct  361   LAEEIGVSNCACSIH  375



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   503 bits (1296),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/416 (57%), Positives = 310/416 (75%), Gaps = 6/416 (1%)
 Frame = -2

Query  1456  ITVAEPRSKDDEA-RLKCTLG----KFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYH  1292
             + + EP  ++  A R +C +     +F + +++R N+ +GYP N+  +H   L+PL+ + 
Sbjct  1     LALVEPHDEECVAERQRCMVTNIMFEFQEYLNERSNHLLGYPTNLNCNHLMDLSPLLCFL  60

Query  1291  LNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGRE  1112
             +NN GDPF E+    HSK FEV VLDWFA+LWEIEK EYWGY+TNGGTEGNLHG+L+GR 
Sbjct  61    MNNVGDPFKESNFGLHSKKFEVAVLDWFAQLWEIEKGEYWGYVTNGGTEGNLHGMLIGRN  120

Query  1111  VHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINV  932
             + P+GILY SKESHYS+FK +R+YR+E + I T+I GE+D  DL+ KL  NK KPAIIN+
Sbjct  121   LLPDGILYTSKESHYSIFKGSRIYRIECQIIGTLITGEIDCTDLKEKLFFNKDKPAIINL  180

Query  931   TIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGS  752
              IGTTFKGG+DNLD +IKTLEECG+S D FYIHCDAA  GL+ PFL+N P  SFKKPIGS
Sbjct  181   NIGTTFKGGVDNLDHVIKTLEECGFSHDRFYIHCDAASYGLVSPFLENGPLFSFKKPIGS  240

Query  751   VTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLST  572
             V++S HK LG  MPCGI ++RK  + + S N+EYIA++D TISGSRNG TPIF+WY L+ 
Sbjct  241   VSVSAHKLLGSSMPCGILISRKMHMTDFSTNIEYIATLDTTISGSRNGHTPIFIWYGLNL  300

Query  571   KGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVR  392
             KGR GLQK+   C+  A +LRD L  AGISAM+N++SI VVFERP DR+FI  WQLS + 
Sbjct  301   KGRIGLQKEVNNCLTNAKYLRDGLNKAGISAMLNESSIVVVFERPLDREFIDYWQLSFLG  360

Query  391   DMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
              MAHV++MP V  + +D+F +DLV++R  WY  G  +P CL +++G+ NC C +H+
Sbjct  361   KMAHVVLMPHVTMKMLDDFLSDLVRKREIWYGSGEVRPVCLAEEIGASNCACSIHR  416



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   503 bits (1295),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 298/380 (78%), Gaps = 3/380 (1%)
 Frame = -2

Query  1363  YHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEK  1184
             +H GYP N+ +D Y  LA L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK
Sbjct  29    FHEGYPYNLDFD-YGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFASLWELEK  87

Query  1183  DEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMIN  1004
             DEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFKAARMYRM+   ++T+++
Sbjct  88    DEYWGYITNCGTEGNLHGILVGREVFPKGILYASRESHYSVFKAARMYRMDCVKVDTLMS  147

Query  1003  GEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDA  824
             GE+D  D + KLL N+ KPAIINV IGTT KG +D+LD++IKTLEE G+ +  FYIHCD 
Sbjct  148   GEIDCADFQRKLLQNRDKPAIINVNIGTTVKGAVDDLDLVIKTLEENGF-KGRFYIHCDG  206

Query  823   ALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIA  644
             AL GL++PF+K  P+++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S NVEY+A
Sbjct  207   ALFGLMIPFVKKAPQVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLA  266

Query  643   SVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDN  464
             S DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI AM+N+ 
Sbjct  267   SRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNEL  326

Query  463   SITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG-P  287
             S TVVFERP D  F+RRWQL+C  ++ HV+VMP V  + +D F N+LV++RATWY++G  
Sbjct  327   SSTVVFERPKDEVFVRRWQLACEGNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGIS  386

Query  286   QPPCLEDDLGSHNCYCPLHK  227
             QPPC+   +G  NC C  HK
Sbjct  387   QPPCIARVVGFENCLCGRHK  406



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   502 bits (1293),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 301/402 (75%), Gaps = 2/402 (0%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             D + RL   L +F + +++R N+ +GY +N        L+P +R+H+NN GDPF E+ + 
Sbjct  28    DRQRRLTKILSEFQEHLAERSNHFLGYHLNQDCSCLTDLSPFLRFHINNVGDPFKESNLG  87

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              HSK FEV VLDWFAELWEIE DEYWGY+TNGGTE NL  +LLGR++ P+GILYASKESH
Sbjct  88    LHSKKFEVAVLDWFAELWEIENDEYWGYVTNGGTEANLQALLLGRDLLPDGILYASKESH  147

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLD  890
             YS+FKAAR+ RME + I T+I GE+D  DLR KL  NK KPAIIN+ IGTTFKGG+DNLD
Sbjct  148   YSIFKAARICRMECQIIGTLITGEIDCMDLREKLFANKDKPAIINLNIGTTFKGGVDNLD  207

Query  889   VIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMP  710
             +++KTLEEC +S+D FYIHCDAAL GLI PFL+N PK SFKKPIGSV++S HK LG  MP
Sbjct  208   LVLKTLEECDFSRDRFYIHCDAALYGLISPFLENGPKFSFKKPIGSVSVSAHKLLGSSMP  267

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTK-GRAGLQKDAQRC  533
             CG+ MTRK  I + SRN+EYIA+VD TISGSRNG  PIF+WYSL+ K GR GLQK+  +C
Sbjct  268   CGVFMTRKRHIADFSRNIEYIATVDNTISGSRNGHAPIFIWYSLNMKLGRMGLQKEVNKC  327

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +LRD L+ AGIS M+N+++I VVFERP D +FI  WQLS    MAHVIVMP V  
Sbjct  328   LMNARYLRDGLKNAGISVMLNESNILVVFERPLDLEFIYHWQLSVDGKMAHVIVMPHVTV  387

Query  352   EAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLH  230
             + +D+F +DL ++R  WY  G  +  CL +D+G  NC C +H
Sbjct  388   KMLDDFLSDLTRKREIWYGSGEVRRLCLAEDIGLSNCACSVH  429



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   499 bits (1285),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/414 (56%), Positives = 306/414 (74%), Gaps = 7/414 (2%)
 Frame = -2

Query  1450  VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             + EP   D+     +A +   L ++  +++++  YH+GYP N+ +D Y  L+ L  + +N
Sbjct  8     ITEPDHDDEVTGEKDAYMASVLARYRKSLTEKSKYHLGYPYNLDFD-YGALSQLQHFSIN  66

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDPF+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV 
Sbjct  67    NLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVL  126

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
             P+GILYAS++SHYSVFKAARMYRME   ++T+++GE+D  DL  KL   K KPAI+NV I
Sbjct  127   PDGILYASRDSHYSVFKAARMYRMEAVKVDTLLSGEIDCVDLERKLTEGKDKPAILNVNI  186

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KG +D+LD+I+K LE  GY++D FYIH D AL GL++PF+K  PK++FKKPIGSV+
Sbjct  187   GTTVKGAVDDLDLILKVLERVGYTEDRFYIHVDGALFGLMMPFVKKAPKVTFKKPIGSVS  246

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             +SGHKF+GCPMPCG+Q TR   I+++SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG
Sbjct  247   VSGHKFIGCPMPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKG  306

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               G QKD QRC+  A +L++RL+ A I  M+N+ S TVVFERP D  FI +WQL+C   +
Sbjct  307   YRGFQKDVQRCLRNAHYLKERLREAKIGVMLNELSSTVVFERPLDEAFILKWQLACQGKI  366

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             AH +VMP V  E +DNF  +L++ R   + EG  + PC+ +++G  NC C LH+
Sbjct  367   AHAVVMPSVTVEKLDNFVEELIEVRKRSFPEGNVKIPCIVEEVGVQNCACSLHR  420



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 310/422 (73%), Gaps = 10/422 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDDEARLK-----CTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H    ++ EP   D+E   K       L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  48    RNLHDQCFSITEPEHDDEETGEKDVYMAGVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  106

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  107   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  166

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P+GILYASK+SHYSVFKA RMYRMEV  ++T+++GE+D  D + +LL N+ 
Sbjct  167   GLLVGREVFPDGILYASKDSHYSVFKAGRMYRMEVVKVDTLLSGEIDCADFQRRLLENQD  226

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD +I+TLE+CG+SQD FYIHCD AL GL++PF+K  PK+S
Sbjct  227   KPAIVNVNIGTTVKGAVDDLDGVIRTLEDCGFSQDRFYIHCDGALFGLMMPFVKRAPKVS  286

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCGIQ+TR   I+ +SRNVEY+AS DATI GSRNG  P+F
Sbjct  287   FKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLF  346

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G +K+ ++C+  A +L   L+ +G  AM+N+ S TVVFERP D  F+R+
Sbjct  347   LWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRK  406

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C   +AH +VMP V  + +  F  +L++ R+  + +G    PC+ D+LG+ NC C 
Sbjct  407   WQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVADELGAKNCACV  466

Query  235   LH  230
              H
Sbjct  467   KH  468



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 310/422 (73%), Gaps = 10/422 (2%)
 Frame = -2

Query  1468  KNMH---ITVAEPRSKDDEA-----RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H    ++ EP   D+E       +   L ++  T+ +R  YH+GYP N+ +D Y  L
Sbjct  48    RNLHDQCFSITEPEHDDEETGDKDVYMAGVLARYRKTLVERTKYHLGYPYNLDFD-YGAL  106

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  107   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  166

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             G+L+GREV P+GILYASK+SHYSVFKA RMYRMEV  ++T+++GE+D  D + +LL N+ 
Sbjct  167   GLLVGREVFPDGILYASKDSHYSVFKAGRMYRMEVVKVDTLLSGEIDCADFQRRLLENQD  226

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS  773
             KPAI+NV IGTT KG +D+LD +IKTLE+CG+SQD FYIHCD AL GL++PF+K  PK+S
Sbjct  227   KPAIVNVNIGTTVKGAVDDLDGVIKTLEDCGFSQDRFYIHCDGALFGLMMPFVKRAPKVS  286

Query  772   FKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIF  593
             FKKPIGSV++SGHKF+GCPMPCGIQ+TR   I+ +SRNVEY+AS DATI GSRNG  P+F
Sbjct  287   FKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLF  346

Query  592   LWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRR  413
             LWY+L+ KG  G +K+ ++C+  A +L   L+ +G  AM+N+ S TVVFERP D  F+R+
Sbjct  347   LWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRK  406

Query  412   WQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCP  236
             WQL+C   +AH +VMP V  + +  F  +L++ R+  + +G    PC+ ++LG+ NC C 
Sbjct  407   WQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVAEELGAKNCACV  466

Query  235   LH  230
              H
Sbjct  467   KH  468



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   486 bits (1251),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 301/402 (75%), Gaps = 2/402 (0%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             D +A +   L ++  T+ ++  +H+GYP N+ +D Y  L+ L  + +NN GDPF+E+   
Sbjct  8     DRDAYMAGILARYRKTLVEKTKFHLGYPYNLDFD-YGALSQLQHFSINNLGDPFIESNYG  66

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLHGIL+GREV P+GILYAS++SH
Sbjct  67    VHSRQFEVGVLDWFARLWELEKEEYWGYITNCGTEGNLHGILVGREVLPDGILYASRDSH  126

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLD  890
             YSVFKAARMYRME   ++T+++GE+D  D   KL   K KPAI+NV IGTT KG +D+LD
Sbjct  127   YSVFKAARMYRMEAVKVDTLLSGEIDCADFERKLTERKDKPAILNVNIGTTVKGAVDDLD  186

Query  889   VIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMP  710
             +++KTLE+ GY++D FYIH D AL GL++PF++  PK++FKKPIGSV++SGHKF+GCPMP
Sbjct  187   LVLKTLEKVGYTEDRFYIHVDGALFGLMMPFVRRAPKVTFKKPIGSVSVSGHKFVGCPMP  246

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCV  530
             CG+Q+TR   I+ +SRNVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ QRC+
Sbjct  247   CGVQITRMKHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQRCL  306

Query  529   ETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPE  350
               A +L++RL+ A +  ++N+ S TVVFERP D  FI +WQL+C   +AH +VMP V  E
Sbjct  307   RNAYYLKERLREANVGVLLNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVE  366

Query  349   AIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
              +D+F  +L++ R   + +G    PC+ +++G  NC C +H+
Sbjct  367   KLDDFVEELIEVRNRAFPDGDVVVPCIVEEVGPENCACSVHR  408



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/418 (57%), Positives = 304/418 (73%), Gaps = 17/418 (4%)
 Frame = -2

Query  1597  EDFMPMGVAAPEALLPFF---VHSGSFKNGDFVENKKMKIAAPPARKNMHIT---VAEPR  1436
             EDF  M +      L      + +G  +NG   EN + KI      +N+H T   V EP 
Sbjct  23    EDFSSMTIMRDHVTLTIGENGIGNGVVQNG--TENGERKIVLG---RNIHTTCLEVTEPD  77

Query  1435  SKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
               D+     EA +   L K+  ++++R NYH+GYP N+ +D Y  L+ L  + +NN GDP
Sbjct  78    IDDEVTGEREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFD-YDALSQLQHFSINNLGDP  136

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             F+E+    HS+ FEVGVLDWFA LWE+EKDEYWGYITN GTEGNLHGIL+GREV P+GIL
Sbjct  137   FIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGILVGREVFPDGIL  196

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YAS+ESHYSVFKAARMYRME   INT+ +GE+D DD ++KLL +K KPAI+NV IGTT K
Sbjct  197   YASQESHYSVFKAARMYRMECVKINTLWSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVK  256

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +D+LD++IK LEE G+SQD FYIHCD AL GL++PF+K  PKISFKKPIGSV++SGHK
Sbjct  257   GAVDDLDLVIKKLEEAGFSQDRFYIHCDGALFGLMLPFVKRAPKISFKKPIGSVSVSGHK  316

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             F+GCPMPCG+Q+TR   ++ +SRNVEY+AS DATI GSRNG  PIFLWYSL+ KG  G Q
Sbjct  317   FVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQ  376

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHV  377
             K+ Q+C+  A + +DRL  AGI AM+N+ S TVVFERP D  F+ +WQL+C  ++AHV
Sbjct  377   KEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHV  434



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   482 bits (1241),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 302/405 (75%), Gaps = 3/405 (1%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             S + +A L   + ++++T++Q     +GYP N  +D Y  LAPL+ +HLNN GDPF E++
Sbjct  10    SGETQANLASVITQYVETLNQHNLRFLGYPTNQDFD-YDALAPLLHFHLNNVGDPFTESS  68

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                +S  FEV VLDWFA LWEI+K EYWGY+T GGTEGNLHGIL GRE  P+GILY S++
Sbjct  69    FSLNSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLHGILTGREQFPDGILYTSQD  128

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             SHYS+FKAARMYRM+   + T+++GE+D  DL++ LL +K KPAIIN+ IGTT KG +D+
Sbjct  129   SHYSIFKAARMYRMQCVTVGTLVSGEIDCVDLKALLLAHKDKPAIINLNIGTTMKGAIDD  188

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCP  716
             +D++++TLE  G+S D+FYIHCD AL G+++PFL   PK++FKKPIGS+TISGHKFLGCP
Sbjct  189   IDLVVQTLEGSGFSCDQFYIHCDGALFGMMMPFLIQAPKVTFKKPIGSITISGHKFLGCP  248

Query  715   MPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQR  536
              PCG+ +TR   I+ +++NVEYIAS D TI+GSR+G  PIFLWY+L  +G  GLQ + Q+
Sbjct  249   FPCGVLITRLEYINTLAKNVEYIASRDVTITGSRSGHAPIFLWYALKERGSVGLQNEVQK  308

Query  535   CVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVA  356
             C+ +A +L+ RL+ A I AM+N+ S TVVFERP D DF R+W L+C +++AH +VM  V 
Sbjct  309   CIISARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWSLACKKNIAHGVVMQHVT  368

Query  355   PEAIDNFFNDLVQERATWYREGPQ--PPCLEDDLGSHNCYCPLHK  227
              E +D+F N+ +QER  W+++  +  P CL +D+G  NC C LH+
Sbjct  369   VEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACILHE  413



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   480 bits (1235),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 299/402 (74%), Gaps = 3/402 (1%)
 Frame = -2

Query  1426  DEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDF  1247
             D + L   + ++++T++Q     +GYP N  +D Y  LAPL+ +HLNN GDPF E++   
Sbjct  23    DRSNLASVITQYVETLNQHNLRFLGYPTNQDFD-YDALAPLLHFHLNNVGDPFTESSFSL  81

Query  1246  HSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHY  1067
             +S  FEV VLDWFA LWEI+K EYWGY+T GGTEGNLHGIL GRE  P+GILY S++SHY
Sbjct  82    NSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLHGILTGREQFPDGILYTSQDSHY  141

Query  1066  SVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDV  887
             S+FKAARMYRM+   + T+++GE+D  DL++ LL +K KPAIIN+ IGTT KG +D++D+
Sbjct  142   SIFKAARMYRMQCVTVGTLVSGEIDCVDLKALLLAHKDKPAIINLNIGTTMKGAIDDIDL  201

Query  886   IIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPC  707
             +++TLE  G+S D+FYIHCD AL G+++PFL   PK++FKKPIGS+TISGHKFLGCP PC
Sbjct  202   VVQTLEGSGFSCDQFYIHCDGALFGMMMPFLIQAPKVTFKKPIGSITISGHKFLGCPFPC  261

Query  706   GIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVE  527
             G+ +TR   I+ +++NVEYIAS D TI+GSR G  PIFLWY+L  +G  GLQ + Q+C+ 
Sbjct  262   GVLITRLEYINTLAKNVEYIASRDVTITGSRRGHAPIFLWYALKERGSVGLQNEVQKCII  321

Query  526   TATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEA  347
             +A +L+ RL+ A I AM+N+ S TVVFERP D DF R+W L+C +++AH +VM  V  E 
Sbjct  322   SARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWSLACKKNIAHGVVMQHVTVEM  381

Query  346   IDNFFNDLVQERATWYREGPQ--PPCLEDDLGSHNCYCPLHK  227
             +D+F N+ +QER  W+++  +  P CL +D+G  NC C LH+
Sbjct  382   LDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACILHE  423



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   477 bits (1227),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 297/392 (76%), Gaps = 3/392 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L  F   + +R  +H+GYP N+ +D ++ +A    + +NN GDPF+E+    HS+ FEV 
Sbjct  92    LAGFARHLQERTTHHLGYPYNLDFD-FSVMAQFQNFSINNLGDPFIESNYGVHSRQFEVA  150

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VLDWFA LW++++DEYWGYITN GTEGNLHG+L+GRE+ P+GI+YAS ESHYSVFKAARM
Sbjct  151   VLDWFARLWDLQQDEYWGYITNCGTEGNLHGLLVGRELFPDGIIYASCESHYSVFKAARM  210

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YR+E   I+T+++GEM+  D +SKL  N G+PAI+NV IGTT KG +D+LD II+TLE+C
Sbjct  211   YRVECVEIDTLVSGEMNCADFKSKLSQNPGRPAIVNVNIGTTVKGAIDDLDRIIRTLEKC  270

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
             G+ +D FYIHCD AL+GL++PF+K  PK++FKKPIGSV++SGHKF+GCP+PCG+ +TR  
Sbjct  271   GF-RDRFYIHCDGALAGLMMPFIKQAPKVTFKKPIGSVSVSGHKFMGCPVPCGVVITRLE  329

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  +S ++EY++S DATI GSRNG  P+FLWY+L+ KG  G++K+ Q+C+  A HL +R
Sbjct  330   HVKVLSTDIEYLSSRDATIMGSRNGHAPMFLWYTLNKKGYRGIRKEVQKCLRNAHHLANR  389

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L+ AG+SA +N+ S TVVFERP D  F+ +WQL+C   +AHV+VMP V+ E ++NF  +L
Sbjct  390   LREAGVSAYLNELSSTVVFERPHDEAFVHKWQLACEGSIAHVVVMPNVSVEKLNNFVEEL  449

Query  322   VQERATWYREGP-QPPCLEDDLGSHNCYCPLH  230
             + ER  W+  G  + PC+  D+G  NC C +H
Sbjct  450   IGERPRWHEGGGFRVPCVAKDIGQENCLCGVH  481



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 225/454 (50%), Positives = 320/454 (70%), Gaps = 7/454 (2%)
 Frame = -2

Query  1588  MPMGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDDEARLK  1409
             M M    P       + S    N +F  ++K +      ++N+ IT     S + +A L 
Sbjct  9     MAMDFIIPRTHATELLSSKVVSNANF--SRKEENLPIDIKENLAITKC---SGETQANLA  63

Query  1408  CTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFE  1229
               +  +++T++Q    ++GYP N  ++ Y TLA L+ +HLNN GDPF+ ++   +S  FE
Sbjct  64    SVITHYVETLNQYSLRNLGYPTNQNFN-YDTLASLLHFHLNNAGDPFLGSSFSLNSTRFE  122

Query  1228  VGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAA  1049
             V VLDWFA LWEIEK++YWGY+T GGTEGNLHGIL+GRE  P+GILY S++SHYS+FK A
Sbjct  123   VCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGILVGREQLPDGILYTSQDSHYSIFKIA  182

Query  1048  RMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLE  869
             RMYRM+   ++T+++GE++  DL++ LL +K KPAIIN+ IGTT KGG+D+LD++I+TL+
Sbjct  183   RMYRMQCMKVSTLVSGEINCVDLKALLLAHKDKPAIINLNIGTTMKGGVDDLDLVIQTLQ  242

Query  868   ECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTR  689
             ECG+++D FYIHCD AL G+++PF++  P+I+F+KPIGSV ISGHKFLGCP+PCGI +TR
Sbjct  243   ECGFTRDRFYIHCDGALFGMMLPFVEQAPRITFEKPIGSVAISGHKFLGCPIPCGIVITR  302

Query  688   KSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLR  509
                I+ +SR+VEYI S D TI+GSR G  PIFLWY++  KG  GLQ + ++C+  A +L+
Sbjct  303   LRYINALSRDVEYIGSRDVTITGSRCGHAPIFLWYAIKRKGLIGLQNEVRKCIMNAHYLQ  362

Query  508   DRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFN  329
              RL+ AGI AM+N  S TVVF+RP D +F RRW L+C  ++AHV+VM  V  E +D+F  
Sbjct  363   SRLRNAGIGAMLNRFSSTVVFKRPLDEEFTRRWNLACKGNIAHVVVMQHVTIEMLDSFVA  422

Query  328   DLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
             + +Q+R+ W+  E  Q  C+  D+GS NC C +H
Sbjct  423   EFLQKRSIWFEDEQFQHVCIAKDIGSGNCGCSMH  456



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/406 (53%), Positives = 298/406 (73%), Gaps = 3/406 (1%)
 Frame = -2

Query  1444  EPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM  1265
             E  + +  A++   L  F   + +R  +H+GYP N+ +D ++ L     + +NN GDPF+
Sbjct  71    EEAAAERRAQVAALLASFGHHLRERTAHHLGYPYNLDFD-FSPLTQFQSFSINNLGDPFI  129

Query  1264  ENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYA  1085
             E+    HS+ FEV VLDWFA LWE+++DEYWGYITN GTEGNLHG+L+GRE+ P+GI+YA
Sbjct  130   ESNYGVHSRQFEVAVLDWFARLWELKQDEYWGYITNCGTEGNLHGLLVGRELFPDGIMYA  189

Query  1084  SKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGG  905
             S ESHYSVFKAARMYR+E   I+T+++GEMD  D +SKLL+N G PAI+NV IGTT KG 
Sbjct  190   SHESHYSVFKAARMYRVECVKIDTLVSGEMDCADFKSKLLMNPGCPAIVNVNIGTTVKGA  249

Query  904   MDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFL  725
             +D+LD II+ LE+CG+ +D FYIHCD AL+GL++PF+K  PK++F+KPIGSV+ISGHKF+
Sbjct  250   IDDLDKIIRILEKCGF-RDRFYIHCDGALAGLMMPFIKQAPKVTFEKPIGSVSISGHKFM  308

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GCP+PCG+ +TR + +  +S ++EY++S D TI GSRNG  PIFLWY+L+ KG  G +K+
Sbjct  309   GCPVPCGVVITRLAHVKVLSTDIEYLSSRDTTIMGSRNGHAPIFLWYTLNKKGYRGFRKE  368

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
              ++C+  A +L +RL+  G+SA +N  S TVVFERP D  F+ +WQL+C   +AHV+VMP
Sbjct  369   VRKCLRNAHYLANRLREEGVSASLNMLSSTVVFERPRDVAFVHKWQLACEGSIAHVVVMP  428

Query  364   GVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
              V+ E +D F  +LV  R+ WY  +G   PC+  D+G  NC C LH
Sbjct  429   NVSVEKLDGFVEELVANRSCWYDGKGHDIPCVAKDIGQDNCLCSLH  474



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   470 bits (1209),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 213/413 (52%), Positives = 306/413 (74%), Gaps = 3/413 (1%)
 Frame = -2

Query  1465  NMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             NM++ +    + + + +L   +  +  T++Q I++ +GYP N  +D Y+ LAPL+ +H+N
Sbjct  42    NMNLAITNC-TGESQGKLAEVINHYAGTLNQEISHLLGYPTNQSFD-YSALAPLLHFHIN  99

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDPFM ++   +S +FEV VLDWFA+LWEI+K+EYWGYIT+GGTEGN HGILLGRE  
Sbjct  100   NVGDPFMGSSYGVNSANFEVSVLDWFAKLWEIKKEEYWGYITSGGTEGNFHGILLGREKF  159

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
              +GI+Y S++SHYS+FK ARMYRM+   ++T++ GE+D  +L++ LL +K KPAIIN+ I
Sbjct  160   SDGIIYTSQDSHYSIFKIARMYRMKCMKVSTLVTGEIDCANLKTLLLAHKDKPAIINLNI  219

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KG +DN+D++I+TLEE G+S+D FYIHCD AL G+++P LK  P I+FKKPIGS+T
Sbjct  220   GTTVKGAIDNIDIVIQTLEESGFSRDRFYIHCDGALFGMMLPLLKQAPSITFKKPIGSIT  279

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             ISGHKFLGCP+PCG+ +TR   I+ + ++VE I S D TISGSR+G  PIFLWY+L  +G
Sbjct  280   ISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHAPIFLWYALQKRG  339

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               GLQ +  +C+  A +L+ +L+ AGI  M+N+ S TVVFE+P D +FIR+W L+   ++
Sbjct  340   IIGLQNEVHKCMMNARYLQRKLRDAGIGTMLNEFSNTVVFEKPLDIEFIRKWSLAYQGNI  399

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPP-CLEDDLGSHNCYCPLH  230
             AHV+VM  V  E +D+F ++  ++RA W++ G + P CL D++G+ NC C LH
Sbjct  400   AHVVVMQHVTIEMLDSFVDEFTKKRAIWFQYGLRKPICLADEIGAENCICSLH  452



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 218/414 (53%), Positives = 301/414 (73%), Gaps = 3/414 (1%)
 Frame = -2

Query  1465  NMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             N ++T+ +   + D A LK  +  ++DT++     ++GYP N  ++ Y  LA L  +HLN
Sbjct  33    NTNLTINQCIGETD-ANLKAIITHYVDTLTYSSLRNLGYPTNQDFN-YDALASLFHFHLN  90

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDPF+ ++   +S  FEVGVLDWFAELWEIEK +YWGY+T GGTEGNLHGIL+GRE  
Sbjct  91    NAGDPFVGSSFSLNSTKFEVGVLDWFAELWEIEKSDYWGYVTTGGTEGNLHGILVGREQF  150

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
             P+GILY S++SHYS+FK ARMYRME   + ++++GE+D  +L + LL +K KPAIIN+ I
Sbjct  151   PDGILYTSQDSHYSIFKIARMYRMECVKVGSLLSGEIDCVELEASLLAHKDKPAIINLNI  210

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KGG+D+LD++I+TL++CG+++D FYIHCD AL G+++PF+K   +ISFKKPI SVT
Sbjct  211   GTTMKGGIDDLDIVIQTLKKCGFTRDRFYIHCDGALFGIMLPFIKQAQRISFKKPIDSVT  270

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             ISGHKFLGCP PCG+ +TR   I+ +SR+VE IAS DATI+GSR G  PI LWY+L  KG
Sbjct  271   ISGHKFLGCPSPCGVVITRLKYINELSRDVEIIASRDATITGSRCGHAPILLWYALKKKG  330

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               GL+ +   C+  A +L D+L+ AGI AM+N+ S  VVFE+P D +F RRW L+   ++
Sbjct  331   LIGLKNEVHECIINARYLLDQLRDAGIGAMLNEFSNIVVFEKPLDDNFTRRWNLATKGNI  390

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             AHV+V+  V  E +D F  + +Q+R+ WY+ G  QP C+ + +GS NC C +HK
Sbjct  391   AHVVVLMHVTKEMLDTFVREFIQKRSIWYKHGHFQPLCIANHVGSTNCVCSIHK  444



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   468 bits (1203),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 219/453 (48%), Positives = 314/453 (69%), Gaps = 7/453 (2%)
 Frame = -2

Query  1582  MGVAAPEALLPFFVHSGSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDDEARLKCT  1403
             M +     +LP  V +         E +   I      +  +I + +   + D A L   
Sbjct  1     MAIIPDAEMLPTVVGNAKLSG----EERHANIHEEDINRLTNIAITQCIGETD-ANLDAV  55

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             +  +++TI++    ++GYP N  ++ Y  LAPL+++HLNN GDPF+ ++   +S  FEV 
Sbjct  56    ITHYVETINKYNLRNLGYPTNQDFN-YEALAPLLQFHLNNAGDPFLGSSFSLNSMTFEVS  114

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VLDWFA+LWEIEKD+YWGYIT GGTEGNLHGIL+ RE  P+GILY S++SHYS+FK ARM
Sbjct  115   VLDWFAKLWEIEKDQYWGYITTGGTEGNLHGILVAREQFPDGILYTSQDSHYSIFKIARM  174

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YRM+   + ++++GE+D  +L + LL +K KPAIIN+ IGTT KGG+D+LD++I+TL++C
Sbjct  175   YRMQCVKVGSLLSGEIDCVELEASLLSHKDKPAIINLNIGTTLKGGIDDLDLVIQTLDKC  234

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
             G+++D+FYIHCD AL G+++PF+    +ISFKKPI SVTISGHKFLGCP PCG+ +TR  
Sbjct  235   GFTRDQFYIHCDGALFGIMLPFINQALRISFKKPIDSVTISGHKFLGCPSPCGVLITRLK  294

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              I+ +SR+VEYIAS DATI+GSR+G  PI LWY+L  +G  GL+ +   C+  A +L ++
Sbjct  295   YINALSRDVEYIASRDATITGSRSGHAPILLWYALKKRGLIGLENEVHECITNARYLLNQ  354

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L+ AGI AM+N+ S  VVFERP D  F RRW L+   ++AHV+V+  +  E +D F ++ 
Sbjct  355   LRDAGIGAMLNEFSNIVVFERPFDDHFTRRWNLASNENIAHVVVLKHITIEMLDTFVHEF  414

Query  322   VQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +Q+R+ W ++G  QPPC+  D+GS NC C +H 
Sbjct  415   IQKRSIWSKDGHFQPPCIASDVGSKNCACSIHS  447



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   465 bits (1196),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 218/423 (52%), Positives = 295/423 (70%), Gaps = 11/423 (3%)
 Frame = -2

Query  1495  MKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
             ++I  PP        V E    + +A +   +  ++  +  R  +H+GYP+N+ YD ++ 
Sbjct  40    LEIEEPP--------VDETEVAEKKAGIARLMAGYVQHLQHRSAFHLGYPLNLDYD-FSP  90

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             LAP + + LNN GDPF +     HS+ FEV VL WFA+ WE+++DEYWGYIT+GGTEGNL
Sbjct  91    LAPFLNFSLNNAGDPFCKVNSSVHSRQFEVAVLHWFADFWEVQRDEYWGYITSGGTEGNL  150

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             +G+LLGRE+ P+GILYAS +SHYSVFKAA+MYR++   I T ++GEM+Y DL+S+LL N 
Sbjct  151   YGLLLGRELFPDGILYASYDSHYSVFKAAKMYRVKCIRIATTVSGEMNYADLKSRLLQNT  210

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
               PAIIN  IGTTFKG +D++D II TLE+CG+ Q+ +YIHCD ALSG++ PF+K  PK+
Sbjct  211   NSPAIINANIGTTFKGAVDDIDQIISTLEKCGF-QNRYYIHCDGALSGMMTPFMKQAPKV  269

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             SFKK IGS+++SGHKF+GCPMPCG+ +TR      +S +VEYIAS D+TI+GSRNG  PI
Sbjct  270   SFKKTIGSISVSGHKFMGCPMPCGVVITRLEHAKVLSTDVEYIASRDSTITGSRNGHAPI  329

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWY+L+ KG  G+ K+ Q C+  A +L   L+  GISA     S  VVFERP D  F+ 
Sbjct  330   FLWYTLNKKGYKGILKEVQMCLGNARYLEVLLKQVGISASCATTSNIVVFERPKDEKFVC  389

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCYC  239
             RWQL+C  ++AH++VMP V  E I  F  +  ++R  WY++ G   PCL  D+G  NCYC
Sbjct  390   RWQLACEGNLAHIVVMPNVTFEKIIVFVEEFAKKRRDWYQDKGFNIPCLAVDIGKENCYC  449

Query  238   PLH  230
              LH
Sbjct  450   NLH  452



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 296/423 (70%), Gaps = 11/423 (3%)
 Frame = -2

Query  1495  MKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
             ++I  PPA         E  + + +A +   +  ++  +  R  YH+GYP+N  YD ++ 
Sbjct  46    LEIEEPPAD--------EMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYD-FSP  96

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             LAP + + LNN GDPF +     HS+ FEV VL+WFA  W++++D++WGYIT+GGTEGNL
Sbjct  97    LAPFLNFSLNNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNL  156

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             +G+L+GRE+ P+GILYAS +SHYSVFKAA+MYR++   I T ++GEM+Y DL+SKL  N 
Sbjct  157   YGLLVGRELFPDGILYASNDSHYSVFKAAKMYRVKCIRIATTVSGEMNYADLKSKLQHNT  216

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
               PAIIN  IGTTFKG +D++D II TLE+CG+ Q+ +YIHCD+ALSG++ PF+K  PK+
Sbjct  217   NSPAIINANIGTTFKGAVDDIDQIISTLEKCGF-QNRYYIHCDSALSGMMTPFMKQAPKV  275

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             SFKKPIGS+++SGHKFLGCPMPCG+ +TR      +S ++EYIAS D+TI+GSRNG  PI
Sbjct  276   SFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPI  335

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWY+LS KG  GL K+   C+  A +L   L+  GISA  N  S  VVFERP D   + 
Sbjct  336   FLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVC  395

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCYC  239
             RWQL+C  ++AH++VMP V  E +  F  +L ++R  WY++ G   PCL  D+G  NCYC
Sbjct  396   RWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYC  455

Query  238   PLH  230
              LH
Sbjct  456   NLH  458



>ref|XP_009609584.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=269

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 245/271 (90%), Gaps = 2/271 (1%)
 Frame = -2

Query  1180  EYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMING  1001
             +YWGY+TNGGTEGNLHGILLGRE+ P+GILYASK+SHYSVFKAARMYRM+ E INT +NG
Sbjct  1     QYWGYVTNGGTEGNLHGILLGRELLPDGILYASKDSHYSVFKAARMYRMDSETINTSVNG  60

Query  1000  EMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAA  821
             EMDY DLR+KLL NK KPAIINVTIGTTFKG +D+LD+I++TL++CGYSQD FYIHCDAA
Sbjct  61    EMDYSDLRAKLLQNKDKPAIINVTIGTTFKGAVDDLDIILQTLKDCGYSQDMFYIHCDAA  120

Query  820   LSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIAS  641
             L GLIVPF+ N+  ISFKKPIGSVTISGHKFLGCPMPCG+Q+TRKS I+N+SRNVEYIAS
Sbjct  121   LCGLIVPFINNM--ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIAS  178

Query  640   VDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
             VDATISGSRNGLTPIFLWYSLS KG+ GLQKD +RC++ A +L+DRLQ AGIS M+N+ S
Sbjct  179   VDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKRCLDNAIYLKDRLQQAGISVMLNELS  238

Query  460   ITVVFERPPDRDFIRRWQLSCVRDMAHVIVM  368
             I VV ERP D +F+RRWQLSC++DMAHVIVM
Sbjct  239   IIVVLERPRDHEFVRRWQLSCMKDMAHVIVM  269



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   462 bits (1190),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 295/423 (70%), Gaps = 11/423 (3%)
 Frame = -2

Query  1495  MKIAAPPARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYAT  1316
             ++I  PPA         E  + + +A +   +  ++  +  R  YH+GYP+N  YD +  
Sbjct  46    LEIEEPPAD--------EMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYD-FGP  96

Query  1315  LAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNL  1136
             LAP + + LNN GDPF +     HS+ FEV VL+WFA  W++++D++WGYIT+GGTEGNL
Sbjct  97    LAPFLNFSLNNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNL  156

Query  1135  HGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNK  956
             +G+L+GRE+ P+GILYAS +SHYSVFKAA+MYR++   I T ++GEM+Y DL+SKL  N 
Sbjct  157   YGLLVGRELFPDGILYASNDSHYSVFKAAKMYRVKCIRIATTVSGEMNYADLKSKLQHNT  216

Query  955   GKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKI  776
               PAIIN  IGTTFKG +D++D II TLE+CG+ Q+ +YIHCD+ALSG++ PF+K  PK+
Sbjct  217   NSPAIINANIGTTFKGAVDDIDQIISTLEKCGF-QNRYYIHCDSALSGMMTPFMKQAPKV  275

Query  775   SFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPI  596
             SFKKPIGS+++SGHKFLGCPMPCG+ +TR      +S ++EYIAS D+TI+GSRNG  PI
Sbjct  276   SFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPI  335

Query  595   FLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR  416
             FLWY+LS KG  GL K+   C+  A +L   L+  GISA  N  S  VVFERP D   + 
Sbjct  336   FLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVC  395

Query  415   RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYRE-GPQPPCLEDDLGSHNCYC  239
             RWQL+C  ++AH++VMP V  E +  F  +L ++R  WY++ G   PCL  D+G  NCYC
Sbjct  396   RWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPCLAVDIGKENCYC  455

Query  238   PLH  230
              LH
Sbjct  456   NLH  458



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 298/442 (67%), Gaps = 43/442 (10%)
 Frame = -2

Query  1534  GSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD-----EARLKCTLGKFLDTISQR  1370
             G  +NG   EN +  I        M + V+EP   D+     EA +   L K+  ++++R
Sbjct  50    GEAQNG--TENGERNIVLGRNIHTMCLEVSEPDIDDEVTGEREAYMASVLAKYKKSLTER  107

Query  1369  INYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEI  1190
               YH+GYP N+ +D Y  L+ L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+
Sbjct  108   TKYHLGYPYNLDFD-YEALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEL  166

Query  1189  EKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTM  1010
             EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFKAARMYRME   I+T+
Sbjct  167   EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASEESHYSVFKAARMYRMECVKIDTL  226

Query  1009  INGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHC  830
              +GE+D DD ++KLL +K KPAI+NV IGTT KG +D+LD++IK +EE G+S+D FYIHC
Sbjct  227   CSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVKGAVDDLDLVIKKIEEAGFSRDSFYIHC  286

Query  829   DAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEY  650
             D AL GL++PF+K  PK+SFKKPIGSV++SGHKF+                         
Sbjct  287   DGALFGLMLPFVKRAPKVSFKKPIGSVSVSGHKFV-------------------------  321

Query  649   IASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVN  470
                      GSRNG  PIFLWYSL+ KG  GLQK+ Q+C+  A + + +L  AGI AMVN
Sbjct  322   ---------GSRNGHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVN  372

Query  469   DNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG  290
             + S TVVFERP D +F+ +WQL+C  ++AHV+VMP V  E + +F N+L+Q+R  W+R+G
Sbjct  373   ELSSTVVFERPHDEEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDG  432

Query  289   P-QPPCLEDDLGSHNCYCPLHK  227
               QP C+   +G  NC C +H+
Sbjct  433   KCQPRCIASAVGHENCLCFIHR  454



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   462 bits (1190),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 298/442 (67%), Gaps = 43/442 (10%)
 Frame = -2

Query  1534  GSFKNGDFVENKKMKIAAPPARKNMHITVAEPRSKDD-----EARLKCTLGKFLDTISQR  1370
             G  +NG   EN +  I        M + V+EP   D+     EA +   L K+  ++++R
Sbjct  90    GEAQNG--TENGERNIVLGRNIHTMCLEVSEPDIDDEVTGEREAYMASVLAKYKKSLTER  147

Query  1369  INYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEI  1190
               YH+GYP N+ +D Y  L+ L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+
Sbjct  148   TKYHLGYPYNLDFD-YEALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEL  206

Query  1189  EKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTM  1010
             EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS+ESHYSVFKAARMYRME   I+T+
Sbjct  207   EKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASEESHYSVFKAARMYRMECVKIDTL  266

Query  1009  INGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHC  830
              +GE+D DD ++KLL +K KPAI+NV IGTT KG +D+LD++IK +EE G+S+D FYIHC
Sbjct  267   CSGEIDCDDFKAKLLCHKDKPAIVNVNIGTTVKGAVDDLDLVIKKIEEAGFSRDSFYIHC  326

Query  829   DAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEY  650
             D AL GL++PF+K  PK+SFKKPIGSV++SGHKF+                         
Sbjct  327   DGALFGLMLPFVKRAPKVSFKKPIGSVSVSGHKFV-------------------------  361

Query  649   IASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVN  470
                      GSRNG  PIFLWYSL+ KG  GLQK+ Q+C+  A + + +L  AGI AMVN
Sbjct  362   ---------GSRNGHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVN  412

Query  469   DNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREG  290
             + S TVVFERP D +F+ +WQL+C  ++AHV+VMP V  E + +F N+L+Q+R  W+R+G
Sbjct  413   ELSSTVVFERPHDEEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDG  472

Query  289   P-QPPCLEDDLGSHNCYCPLHK  227
               QP C+   +G  NC C +H+
Sbjct  473   KCQPRCIASAVGHENCLCFIHR  494



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   457 bits (1175),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 293/401 (73%), Gaps = 2/401 (0%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             + +A L   +  +  TI++    ++GYP N  ++ Y  LAPL+++HLNN GDPF+ ++  
Sbjct  46    ETDANLDAIIAHYAQTITKYNMRNLGYPTNQDFN-YEALAPLLQFHLNNAGDPFLGSSFS  104

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              +S  FEV VLDWFA+LWEIEK+EYWGY+T GGTEGNLHGIL GRE  P+GILY S++SH
Sbjct  105   LNSMAFEVSVLDWFAKLWEIEKNEYWGYVTTGGTEGNLHGILAGREQLPDGILYTSQDSH  164

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLD  890
             YS+ K A+MYRM+   ++++++GE+D   L + LL +K KPAIIN+ IGTT KGG+D+LD
Sbjct  165   YSIAKIAKMYRMKCVKVDSLLSGEIDCVQLEASLLAHKDKPAIINLNIGTTLKGGIDDLD  224

Query  889   VIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMP  710
             ++I+TL +CG+++D FYIHCD AL G+++PF+K  P+ISFKKPI SVTISGHKFLGCP P
Sbjct  225   LVIQTLNKCGFTRDRFYIHCDGALFGIMLPFIKQAPRISFKKPIDSVTISGHKFLGCPSP  284

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCV  530
             CG+ +TR   ++ +SR+V+ IAS DATI+GSR G  PIFLWY+L  +G  GL+ +   C+
Sbjct  285   CGVLITRLKYMNALSRDVDIIASRDATITGSRCGHAPIFLWYALKKRGLIGLENEVHECI  344

Query  529   ETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPE  350
               A +L + L+ AGI AM+N  S  VVFERP D  F RRW L+  ++ AHV+V+  V  E
Sbjct  345   MKAHYLLNLLRDAGIGAMLNKFSNIVVFERPLDDHFTRRWNLASNKNTAHVVVLKHVTVE  404

Query  349   AIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
              +D+F  +  ++++ WY+ E  QPPC+ +D+GS NC C +H
Sbjct  405   MLDSFVREFTEKQSIWYKDEQFQPPCIANDVGSRNCACSIH  445



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase [Chlamydomonas reinhardtii]
Length=375

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 198/376 (53%), Positives = 288/376 (77%), Gaps = 2/376 (1%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             +++ EA++   +G ++  +++R ++H+GYP N+ +D Y  L  L +Y +NN GDPF+E+ 
Sbjct  1     TQEREAQIAEMIGSYMKKLAERTHHHMGYPYNLDFD-YGLLEGLTKYSINNLGDPFIESN  59

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                HS++FEVGVL+WFA LWEI+++EYWGYIT  GTEGNLHGIL+GRE  P+G++YAS E
Sbjct  60    YGVHSREFEVGVLNWFARLWEIDEEEYWGYITTCGTEGNLHGILVGRENFPDGVMYASSE  119

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             SHYSVFKAARMYRME E + T+ +GE++YDDL++ L+ N GKPAI+NV IGTT KG +D+
Sbjct  120   SHYSVFKAARMYRMEAEKVPTLESGEINYDDLKAALVKNAGKPAILNVNIGTTVKGAVDD  179

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFL-KNVPKISFKKPIGSVTISGHKFLGC  719
             LD +++ L+E GY++D FYIHCD AL G+++PFL ++ P ++F+KPIGSV++SGHKF+G 
Sbjct  180   LDRVLEVLKEAGYTEDRFYIHCDGALFGMMMPFLSRDAPMVTFRKPIGSVSVSGHKFVGA  239

Query  718   PMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQ  539
             P+PCG+ +TR   +  +S +VEY+ S DATI GSRNG  P++LWY+L+ KG  G+++D +
Sbjct  240   PVPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRNGHAPVYLWYTLTRKGYDGMRRDVE  299

Query  538   RCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGV  359
             +C+  A  L+  L++AGI  M+N+ S TVVFERP +  F+R+WQL+C  ++AHV+VMP +
Sbjct  300   KCMRNAHVLQQMLESAGIRTMLNELSNTVVFERPKEEAFVRKWQLACEGEIAHVVVMPNI  359

Query  358   APEAIDNFFNDLVQER  311
               E ++ F  D VQ R
Sbjct  360   TVEKLEEFVADYVQSR  375



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   452 bits (1162),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/400 (52%), Positives = 292/400 (73%), Gaps = 7/400 (2%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             +  A+L   +  +  T++Q+I++ +GYP N  +D Y  LAPL+ +H+NN GDPFM ++  
Sbjct  39    ETHAKLDEIITHYEGTLNQKISHFLGYPTNQNFD-YDALAPLLHFHINNAGDPFMGSSYG  97

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              +S DFE+ VLDWFA+LWEI+K EYWGY+T GGTEGNLHGIL+GRE  P+GILY S++SH
Sbjct  98    VNSTDFEISVLDWFAKLWEIKKGEYWGYVTTGGTEGNLHGILIGREKFPDGILYTSQDSH  157

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLD  890
             YS+FK AR+YRM+   + T+INGE+D  DL++ LL +K KPAIIN+ IG+T KG +DN+D
Sbjct  158   YSIFKIARIYRMQCIKVGTLINGEIDCADLKTLLLAHKDKPAIINLNIGSTMKGAIDNID  217

Query  889   VIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMP  710
             ++I+TLEE G+ +D FYIHCD AL G+++PFL+  P I+FKK IGS+TISGHKFLGCP+P
Sbjct  218   MVIETLEERGFPRDRFYIHCDGALFGMMLPFLEQAPSITFKKSIGSITISGHKFLGCPIP  277

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCV  530
             CG+ +TR   I+ + ++VE I S D TISGSR+G   IF+WY+L  KG  GL+ +  +C+
Sbjct  278   CGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHASIFIWYALQKKGLLGLENEVHKCI  337

Query  529   ETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPE  350
               A +L+ +L+ AGI  M+N+ S TVVFE+P D +FIR+W L+   D+AHV+VM  V  E
Sbjct  338   MNACYLKRKLRDAGICTMLNEYSNTVVFEKPLDCEFIRKWNLAYEGDIAHVVVMQHVTVE  397

Query  349   AIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
              +D+F ++ ++ R        +P CL D +G+ NC C LH
Sbjct  398   MLDSFVDEFIKTRLR------KPLCLADKIGAENCTCILH  431



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   448 bits (1153),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 210/394 (53%), Positives = 279/394 (71%), Gaps = 42/394 (11%)
 Frame = -2

Query  1405  TLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEV  1226
              L ++  ++ +R  +H+GYP N+ ++ Y  L+ L  + +NN GDPF+E+    HS+ FEV
Sbjct  4     VLARYRRSLVERTKHHLGYPYNLDFE-YGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  62

Query  1225  GVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAAR  1046
             GVLDWFA LW++EKDEYWGYITN GTEGNLHGIL+GREV P+GILYAS++SHYSVFKAAR
Sbjct  63    GVLDWFARLWDLEKDEYWGYITNCGTEGNLHGILVGREVFPDGILYASRDSHYSVFKAAR  122

Query  1045  MYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEE  866
             MYRM+   ++T+++GE+D  D   KLL NK KPAIINV IGTT KG +D+LD++I+TLE+
Sbjct  123   MYRMDCVKVDTLVSGEIDCADFGRKLLENKDKPAIINVNIGTTVKGAVDDLDLVIETLEK  182

Query  865   CGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRK  686
              G+ +D FYIHCD AL GL++PF+K  P++SFKKPIGSV++SGHKF+GCPMPCG+Q+TR 
Sbjct  183   SGF-KDRFYIHCDGALFGLMMPFVKQAPRVSFKKPIGSVSVSGHKFVGCPMPCGVQITR-  240

Query  685   SLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRD  506
                                                   KG  G QK+ Q+C+  A +L+D
Sbjct  241   --------------------------------------KGYRGFQKEVQKCLRNAHYLKD  262

Query  505   RLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             RL+ AGISAM+N+ S TVVFERP D +F+RRWQL+C   ++HV+VMP V  + +D F N+
Sbjct  263   RLKDAGISAMLNELSSTVVFERPKDEEFVRRWQLACEGGISHVVVMPSVNVDKLDTFLNE  322

Query  325   LVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             LV++R TWY+EG  Q PC+  D+G  NC C LHK
Sbjct  323   LVEKRVTWYQEGKCQSPCIAADVGQENCLCTLHK  356



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 285/366 (78%), Gaps = 2/366 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             +G ++  +++R ++H+GYP N+ +D Y  L  L +Y +NN GDPF+E+    HS++FEVG
Sbjct  86    IGNYMKKLAERTHHHMGYPYNLDFD-YGLLEGLTKYSINNLGDPFIESNYGVHSREFEVG  144

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VL+WFA LWEI+++EYWGYIT  GTEGNLHGIL+GRE  P+GI+YAS ESHYSVFKAARM
Sbjct  145   VLNWFARLWEIDEEEYWGYITTCGTEGNLHGILVGRENFPDGIMYASAESHYSVFKAARM  204

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YRM+ E I+T+ +GE++Y++L++ L+ N+GKPA++N+ IGTT KG +D++D +++ L+E 
Sbjct  205   YRMQAEKISTLESGEINYEELKTALIANQGKPAVLNLNIGTTVKGAVDDVDRVLEVLKEA  264

Query  862   GYSQDEFYIHCDAALSGLIVPFL-KNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRK  686
             GYS+D+F+IHCD AL G+++PFL ++ P ++F+KPIGSV++SGHKF+G P+PCG+ +TR 
Sbjct  265   GYSEDQFFIHCDGALFGMMMPFLRRDAPMVTFRKPIGSVSVSGHKFVGAPVPCGVVITRF  324

Query  685   SLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRD  506
               +  +S +VEY+ S DATI GSRNG  PI+LWY+L+ KG  G+++D +RC+  A  L+ 
Sbjct  325   KHVMALSSDVEYLNSRDATIMGSRNGHAPIYLWYTLTRKGYEGMRRDVERCMRNAHVLKQ  384

Query  505   RLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
              L++AGI  M+N+ S TVVFERP +  F+R+WQL+C  D+AHV+VMP +  E ++ F  D
Sbjct  385   MLESAGIRTMLNELSNTVVFERPKEEAFVRKWQLACEGDIAHVVVMPNITVEKLEEFVAD  444

Query  325   LVQERA  308
              VQ RA
Sbjct  445   YVQSRA  450



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/401 (52%), Positives = 289/401 (72%), Gaps = 2/401 (0%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             + +A L   + ++ +TI++    ++GYP N  ++ Y  LAPL  +HLNN GDPF+ ++  
Sbjct  49    EKDANLDAIIARYAETINKYNLRNLGYPTNQDFN-YDKLAPLFHFHLNNAGDPFVGSSFS  107

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              +S  FEV VLDWFA LW I+  EYWGY+T GG+EGNLHGIL+GRE  P+GILY S+ESH
Sbjct  108   LNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGILVGREQFPDGILYTSQESH  167

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLD  890
             YS+FK ARMYRM    + ++ +GE+D   L + LL +K KPAIIN+ IGTT KGG+D+LD
Sbjct  168   YSIFKIARMYRMHCVKVGSLFSGEIDCVQLEASLLSHKDKPAIINLNIGTTMKGGIDDLD  227

Query  889   VIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMP  710
             ++I+TL++CG+++D FYIHCD AL G+++PF+K   K+SFKKPIGSVTISGHKFLGCP P
Sbjct  228   LVIQTLKKCGFTRDRFYIHCDGALFGIMLPFIKQALKVSFKKPIGSVTISGHKFLGCPSP  287

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCV  530
             CG+ +TR   +  ISR+V  IAS DATI+GSR G  PIFLWY+L  +G  GL+ +   C+
Sbjct  288   CGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLWYALKKRGLIGLENEVHECI  347

Query  529   ETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPE  350
               A +L + L+ AGI AM+N+ S  VVFERP D DF R W L+C  ++AHV+V+  V+ E
Sbjct  348   MKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWNLACSGNIAHVVVLQHVSVE  407

Query  349   AIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
              +D F ++ +++R+ W + E  +P C+ +D+GS NC C +H
Sbjct  408   MLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  448



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 277/375 (74%), Gaps = 7/375 (2%)
 Frame = -2

Query  1354  GYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEY  1175
             GYP N  +D Y  LAPL+ +H+NN GDPFM ++   +S DFE+ VLDWFA+LWEI+K EY
Sbjct  88    GYPTNQNFD-YDALAPLLHFHINNAGDPFMGSSYGVNSTDFEISVLDWFAKLWEIKKGEY  146

Query  1174  WGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEM  995
             WGY+T GGTEGNLHGIL+GRE  P+GILY S++SHYS+FK AR+YRM+   + T+INGE+
Sbjct  147   WGYVTTGGTEGNLHGILIGREKFPDGILYTSQDSHYSIFKIARIYRMQCIKVGTLINGEI  206

Query  994   DYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALS  815
             D  DL++ LL +K KPAIIN+ IG+T KG +DN+D++I+TLEE G+ +D FYIHCD AL 
Sbjct  207   DCADLKTLLLAHKDKPAIINLNIGSTMKGAIDNIDMVIETLEERGFPRDRFYIHCDGALF  266

Query  814   GLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVD  635
             G+++PFL+  P I+FKK IGS+TISGHKFLGCP+PCG+ +TR   I+ + ++VE I S D
Sbjct  267   GMMLPFLEQAPSITFKKSIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRD  326

Query  634   ATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSIT  455
              TISGSR+G   IF+WY+L  KG  GL+ +  +C+  A +L+ +L+ AGI  M+N+ S T
Sbjct  327   TTISGSRSGHASIFIWYALQKKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNT  386

Query  454   VVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPC  275
             VVFE+P D +FIR+W L+   D+AHV+VM  V  E +D+F ++ ++ R        +P C
Sbjct  387   VVFEKPLDCEFIRKWNLAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRLR------KPLC  440

Query  274   LEDDLGSHNCYCPLH  230
             L D +G+ NC C LH
Sbjct  441   LADKIGAENCTCILH  455



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   443 bits (1140),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 284/401 (71%), Gaps = 8/401 (2%)
 Frame = -2

Query  1423  EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR-YHLNNCGDPFMENTVDF  1247
             +A +   L  F   +  R  +H+GYP N+ +D +A+LAP ++   +NN GDPF+E+    
Sbjct  72    QAEVARLLAGFRRHLEDRSAHHLGYPYNLDFD-FASLAPFLQGLCINNLGDPFVESNYGV  130

Query  1246  HSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHY  1067
             HS+  EV VLDWFA LW++   +YWGY+T+ GTEGNLHG+L+GREV P+G++YAS +SHY
Sbjct  131   HSRPLEVAVLDWFARLWDLGPGDYWGYVTSCGTEGNLHGLLVGREVFPDGVMYASADSHY  190

Query  1066  SVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDV  887
             SVF+AARMYR+    + T+++GEMD DD  +KL+ N   PAI+NV IGTT KG +D+LD 
Sbjct  191   SVFRAARMYRVRCVKVGTLVSGEMDCDDFEAKLMHNTNSPAIVNVNIGTTVKGAIDDLDK  250

Query  886   IIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKP-IGSVTISGHKFLGCPMP  710
             II TL++CG+  D FYIHCD AL+GLI+PFLK  P+++F+KP IGSV++SGHKFLGCP+P
Sbjct  251   IISTLQKCGF-HDRFYIHCDGALAGLIIPFLKQAPRVTFRKPGIGSVSVSGHKFLGCPVP  309

Query  709   CGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCV  530
             CG+ +TR+     +S +V+YI+S DATI+GSRNG  P+FLW +L+ KGR G++ D  RC+
Sbjct  310   CGVVITRREHAAVLSTDVDYISSRDATITGSRNGHAPLFLWCALNAKGRRGIRDDVHRCL  369

Query  529   ETATHLRDRLQAAGISAM-VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
               A  L  RL+ AG+SA  +N  SITVV ERP D  F+R+WQLSC   +AHV+VMP V  
Sbjct  370   RNARFLARRLRDAGVSAARLNPLSITVVLERPRDEAFVRKWQLSCQGGVAHVVVMPNVGV  429

Query  352   EAIDNFFNDLVQERATWYREGPQ---PPCLEDDLGSHNCYC  239
             + I +F  DL  +R  WY  G      PC+  D+G  NC C
Sbjct  430   DKIASFVEDLAAKRRIWYPHGEGLRVGPCVAKDIGQENCLC  470



>gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   442 bits (1138),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 275/383 (72%), Gaps = 1/383 (0%)
 Frame = -2

Query  1456  ITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCG  1277
             + V E   ++ EAR++  +  +   +  R ++H+GYP N+ +D Y  L  L ++ +NN G
Sbjct  76    MEVGELGQEELEARVRQVIEDYRQKLEDRTDHHMGYPYNLDFD-YGPLEGLQKFCINNLG  134

Query  1276  DPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEG  1097
             DPF+E+    HS++FE+GVL WFA LWEIE+DE+WGY+TN GTEGNLHGIL+GRE  P+G
Sbjct  135   DPFIESNYGVHSREFEIGVLQWFARLWEIEEDEFWGYVTNCGTEGNLHGILVGRETLPDG  194

Query  1096  ILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTT  917
             +LY+S ESHYSVFKAARMYRME   +  +  GE+DYD LR+ L  N  KPAI+N+ IGTT
Sbjct  195   VLYSSAESHYSVFKAARMYRMEAVKVGVLGTGEIDYDHLRACLAANADKPAILNLNIGTT  254

Query  916   FKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISG  737
              +G +D++D ++  L + G+ +D FYIHCD AL G+++PF+K  P ++FKKPIGSV++SG
Sbjct  255   VRGAVDDVDRVLAILADLGFGEDRFYIHCDGALFGMMIPFVKRAPMVTFKKPIGSVSVSG  314

Query  736   HKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAG  557
             HKF+G P+PCG+ MTR   I  +S +VEY+ S DATI GSRNG  PI++WY+ + KG  G
Sbjct  315   HKFVGAPVPCGVVMTRLKHIQALSTDVEYLNSRDATIMGSRNGHAPIYMWYTFTRKGYEG  374

Query  556   LQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHV  377
             L+KD +RC+  A  LR  L+ AG+   +N+ S TVVFERP D DF+RRWQL+C  D+AHV
Sbjct  375   LRKDVERCLRNAHLLRSMLERAGVVTSLNELSSTVVFERPADEDFVRRWQLACQGDIAHV  434

Query  376   IVMPGVAPEAIDNFFNDLVQERA  308
             +VMP +    ++ F  +L+  RA
Sbjct  435   VVMPNITVAKLERFVTELIAVRA  457



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   437 bits (1123),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 202/383 (53%), Positives = 269/383 (70%), Gaps = 7/383 (2%)
 Frame = -2

Query  1375  QRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELW  1196
              R   + GYP+N  +D +  +   +   LNN GDPFME     HSK FE+ VLDWFA LW
Sbjct  62    SRTRRNAGYPINFEFD-FGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEIAVLDWFARLW  120

Query  1195  EIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGIN  1016
             E+ KD+YWGY+T+GGTEGN+HG+L+GRE+ PEGI+Y S +SHYS+FKAA+MYR++   I+
Sbjct  121   ELPKDQYWGYVTSGGTEGNMHGLLVGRELFPEGIIYTSCDSHYSIFKAAKMYRVQCIKID  180

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+ +GEMDY D R KLL N   PAI+NV IGTT KG +D+LD ++  LE CG++ + FYI
Sbjct  181   TLFSGEMDYADFRRKLLQNTRSPAIVNVNIGTTMKGAVDDLDEVVMILENCGFA-NRFYI  239

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLI-HNISRN  659
             HCD+AL GL++PF+K  PK++FKKPIGS+ ISGHKF+GCP+PCG+ +TR   I H +S N
Sbjct  240   HCDSALVGLMMPFIKQAPKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTN  299

Query  658   VEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISA  479
             +EYI+S D TI+GSRNG  PIFLWY+L   G  GL K  + C++ A +L  RL+  G+S 
Sbjct  300   IEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSV  359

Query  478   MVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWY  299
              +N  SITVVFERP D  F+R+WQL+C   +AHV+VMP V+ E I+ F  +  + R   +
Sbjct  360   FLNALSITVVFERPNDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALH  419

Query  298   REGPQPPCLEDDLGSHNCYCPLH  230
                 Q  C+  D+   NC C LH
Sbjct  420   ----QDKCVAGDVSQENCLCSLH  438



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   434 bits (1116),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 274/386 (71%), Gaps = 10/386 (3%)
 Frame = -2

Query  1456  ITVAEPRSKDDE---ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLN  1286
             + V EP   D E   AR+   +  + + +  R ++H+GYP N+ +D Y  L  L +Y +N
Sbjct  68    LPVLEPGELDKEELEARINKVIDDYKEKLQLRTDHHMGYPYNLDFD-YGPLEGLQKYCIN  126

Query  1285  NCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVH  1106
             N GDPF+E+    HS++FE+GVL WFA LWEIE D++WGYITN GTEGNLHGIL+GRE  
Sbjct  127   NLGDPFIESNYGVHSREFEIGVLQWFARLWEIEVDDFWGYITNCGTEGNLHGILVGREAL  186

Query  1105  PEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTI  926
             P+GILYAS+E+HYS+FKA RMYRM+   + T+ +GE+DYD+L+  L  N  +PAIIN+ I
Sbjct  187   PDGILYASRETHYSIFKAGRMYRMDAVKVGTLDSGEIDYDELQGHLAANAARPAIININI  246

Query  925   GTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVT  746
             GTT KG +D+LD       E GY++D F+IHCD AL G+++PF+K  P ++FKKPIGS++
Sbjct  247   GTTVKGAVDDLD------RETGYTEDRFFIHCDGALFGMMIPFVKRAPMVTFKKPIGSIS  300

Query  745   ISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             +SGHKF+G P+PCG+ MTR   I  +S +VEY+ S DATI GSRNG  PI++WY+ + KG
Sbjct  301   VSGHKFVGSPVPCGVVMTRLRYIKGVSSDVEYLNSRDATIMGSRNGHAPIYMWYTFTRKG  360

Query  565   RAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDM  386
               GL+KD ++C+  A  L+  L  AG+  M+N+ S TVVFERP +  F+R+WQL+C  D+
Sbjct  361   YEGLRKDVEKCLRNAHLLKSMLDTAGVRTMLNELSSTVVFERPREESFVRKWQLACEGDI  420

Query  385   AHVIVMPGVAPEAIDNFFNDLVQERA  308
             AHV+VMP +    ++ F  +LV+ RA
Sbjct  421   AHVVVMPNITIRKLETFVQELVESRA  446



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score =   428 bits (1101),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 253/316 (80%), Gaps = 1/316 (0%)
 Frame = -2

Query  1171  GYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMD  992
             GYITN GTEGNLHGIL+GREV P+GILYAS+ESHYS+FKAARMYRME E + T+ +GE+D
Sbjct  5     GYITNCGTEGNLHGILVGREVLPDGILYASRESHYSIFKAARMYRMECEKVETLNSGEID  64

Query  991   YDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSG  812
              DD ++KLL ++ KPAIINV IGTT KG +D+LD++I+ LEE G+SQD FYIH D AL G
Sbjct  65    CDDFKAKLLRHQDKPAIINVNIGTTVKGAVDDLDLVIQKLEEAGFSQDRFYIHVDGALFG  124

Query  811   LIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDA  632
             L++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNVE +AS DA
Sbjct  125   LMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDA  184

Query  631   TISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITV  452
             TI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A + +DRL  AGI AM+N+ S TV
Sbjct  185   TIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTV  244

Query  451   VFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPC  275
             VFERP D +FIR+WQL+C  ++AHV+VMP V  E +D+F N+LVQ+RATW+ +G  QP C
Sbjct  245   VFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYC  304

Query  274   LEDDLGSHNCYCPLHK  227
             +  D+G ++C C  HK
Sbjct  305   IASDVGENSCLCAQHK  320



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   433 bits (1114),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 266/372 (72%), Gaps = 1/372 (0%)
 Frame = -2

Query  1423  EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFH  1244
             E+RL   +  + + +  R ++H+GYP N+ +D Y  L  L R+ +NN GDPF+E+    H
Sbjct  87    ESRLSEVIQSYKNKLEHRTHHHMGYPYNLDFD-YGPLECLQRFCINNLGDPFIESNYGVH  145

Query  1243  SKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYS  1064
             S++FE+GVL WFA LWEIE ++ WGY+TN GTEGNLHGILLGRE  P G+LY+S  SHYS
Sbjct  146   SREFEIGVLHWFASLWEIEAEDMWGYVTNCGTEGNLHGILLGRETLPGGVLYSSAASHYS  205

Query  1063  VFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVI  884
             VFKAARMYRM+ E +    +GE+DY+     L  N+G+PAI+NV IGTT +G +D+LD +
Sbjct  206   VFKAARMYRMDAERLPAQDSGELDYEAFGRALRQNRGRPAIVNVNIGTTVRGAVDDLDRV  265

Query  883   IKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCG  704
             I  L   GY++DEFYIHCD AL G+++PF+   P ++F+KPIGSV++SGHKF+G PMPCG
Sbjct  266   IAELAAAGYAEDEFYIHCDGALFGMMLPFVSATPMVTFRKPIGSVSVSGHKFVGAPMPCG  325

Query  703   IQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVET  524
             + MTR   +  +S  VEY+ S DATI GSRNG  PI+LWY+L+ KG  G++KD +RC+  
Sbjct  326   VVMTRLRYVEALSSEVEYLNSRDATIMGSRNGHAPIYLWYTLARKGLVGMRKDVERCLRN  385

Query  523   ATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAI  344
             A  L+D LQ AG+ A +N  S TVVFERP D  F+RRWQL+C  D+AHVIVMP +    +
Sbjct  386   AHLLKDMLQRAGVGASLNPLSSTVVFERPADPAFVRRWQLACEGDIAHVIVMPNITVAKL  445

Query  343   DNFFNDLVQERA  308
             + F  +L+  RA
Sbjct  446   EKFVKELLACRA  457



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/409 (49%), Positives = 278/409 (68%), Gaps = 10/409 (2%)
 Frame = -2

Query  1432  KDDEA------RLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDP  1271
             KD++A      R+   L  F   + +R  YH+GYP N+  D    +     +H+NN GDP
Sbjct  33    KDEQAATQRRLRIDNLLVNFRKQLQERSAYHLGYPFNLELD-VGPVIQFQNFHVNNIGDP  91

Query  1270  FMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGIL  1091
             FME+    HS+ FEV VLDWFA  WE+ KD+ WGY+T+GGTEGNLHG+L+GRE+ P+GI+
Sbjct  92    FMESNYGIHSRKFEVAVLDWFANFWELPKDQSWGYVTSGGTEGNLHGLLVGRELFPDGII  151

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             YASK+SHYSVFKAA+MYR +   I+T I GEM+YDD   KLL N G+PAI+NV IGTT +
Sbjct  152   YASKDSHYSVFKAAKMYRAQCIKISTSIYGEMNYDDFSYKLLQNSGRPAIVNVNIGTTMR  211

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             GG+D++D +I+TL+ CG+    FYIHCD AL GL++PF+K  PK++FKK IGS+++SGHK
Sbjct  212   GGVDDVDEVIRTLKTCGFDS-RFYIHCDGALGGLMLPFIKQEPKLTFKKSIGSISVSGHK  270

Query  730   FLGCPMPCGIQMTR-KSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGL  554
              LGCP PCG+ + R K +   +S N+EY+AS DATI+GSRNG  PI +WY+L   G  G+
Sbjct  271   LLGCPTPCGVVVNRLKDINLVMSTNIEYVASRDATITGSRNGHAPIIMWYTLKCLGYNGI  330

Query  553   QKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVI  374
             +     C+  A +L   L+  G+S ++N  S TV+FERP D  F+R+WQL+C  ++AHV+
Sbjct  331   RMKVTTCIRKAEYLEFLLKKKGVSTLLNPGSSTVIFERPKDEVFVRKWQLACEGNLAHVV  390

Query  373   VMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLH  230
             VMP V+   +  F ++L + R     +     PC+  D+G  NC C LH
Sbjct  391   VMPNVSIRHLFRFVDELAENRYIMLHDKEISTPCVAADIGPGNCMCNLH  439



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   424 bits (1089),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 260/347 (75%), Gaps = 3/347 (1%)
 Frame = -2

Query  1351  YPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYW  1172
             YP N+ +D ++ L  L R+ +NN GDPF+E+    HS++FE+GVL WFA LWEI++DEYW
Sbjct  8     YPYNLDFD-FSALEGLQRFSINNLGDPFIESNYGVHSREFEIGVLQWFARLWEIDQDEYW  66

Query  1171  GYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMD  992
             GYITN GTEGNLHGIL+GRE  P+GILYAS E+HYSVFKAARMYRM+   ++T+  GEMD
Sbjct  67    GYITNCGTEGNLHGILVGRENLPDGILYASHETHYSVFKAARMYRMD--SLDTLETGEMD  124

Query  991   YDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSG  812
             YD LRS L  N  +PAI+NV  GTT KG +D+LD ++  L E GYS+D FYIH D AL G
Sbjct  125   YDHLRSVLAANSARPAILNVNCGTTVKGAVDDLDRVLDILRETGYSEDRFYIHVDGALFG  184

Query  811   LIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDA  632
             +++PF+K  P++SF+KPIGSV++SGHKF+G P+PCG+ +TR+  +  +S +VEY+ S DA
Sbjct  185   MMMPFIKKAPRVSFRKPIGSVSVSGHKFIGAPVPCGVVITRQKYVAALSNDVEYLNSRDA  244

Query  631   TISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITV  452
             TI GSRNG  PI++W++L+ KG  G++KD +RC+  A  L+  L+ AG+  M+N+ S TV
Sbjct  245   TIMGSRNGHAPIYMWFTLTRKGYEGMRKDVERCLRNALVLKSMLEQAGVKVMLNELSSTV  304

Query  451   VFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQER  311
             VFERP +  F+R+WQL+C  ++AHV+VMP V    ++ F  DL+  R
Sbjct  305   VFERPREEAFVRKWQLACEGEVAHVVVMPNVHMAILEEFVADLIASR  351



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   416 bits (1069),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 259/362 (72%), Gaps = 1/362 (0%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L  +   + ++ + H GYP N++Y+H   L   M+Y +NN GDPF+ +    HS+ FE  
Sbjct  4     LASYDKLLKRKSSVHFGYPYNLMYNH-EELYEFMKYSINNLGDPFITSNYGVHSRQFECS  62

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+D+FA+LW+ E D YWGY+T  GTEGNLHGILL RE HP+GILY+S+E+HYSVFKAAR 
Sbjct  63    VIDFFAKLWKAEPDSYWGYVTTCGTEGNLHGILLARECHPDGILYSSRETHYSVFKAARY  122

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YRM+ + I T+  GE+DYD L+S++  N+ +P IINV IGTT KG +DNLD I++ L+  
Sbjct  123   YRMDAKAIPTLPMGEIDYDALQSEIAKNRDRPVIINVNIGTTVKGAVDNLDRILRILKTL  182

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
             G  ++ F+IHCD AL  +++PF+   P++SF+KPI S+ +SGHK LGCPMPCGI +TRK 
Sbjct  183   GIPRERFHIHCDGALFAMMMPFVDWAPEVSFQKPIDSIAVSGHKMLGCPMPCGIALTRKE  242

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  + + ++Y+ SVD TI GSRNG   ++LWYSL  KG AG+++D   C+ETA +LRD+
Sbjct  243   HVKKVEQKIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIAGIKRDVVHCMETAQYLRDK  302

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             +  AG++  +ND S TVV ERP D  FI+RWQL+C  D+AHV+VMP V    ID F  +L
Sbjct  303   ITEAGLTCRLNDLSSTVVLERPMDDAFIKRWQLACEEDIAHVVVMPNVTRFKIDKFVEEL  362

Query  322   VQ  317
             V+
Sbjct  363   VE  364



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   414 bits (1065),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 255/355 (72%), Gaps = 1/355 (0%)
 Frame = -2

Query  1381  ISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAE  1202
             +  + + H GYP N+++D Y  LA  M+Y +NN GDPF+ +    HS+ FEV V+D+FA+
Sbjct  11    LQSKSSVHFGYPYNLMFD-YTELAQFMKYSINNLGDPFVPSNYGVHSRQFEVAVIDFFAK  69

Query  1201  LWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEG  1022
             LW++E D YWGY+T  GTEGNLHGILL RE  P+GILY S+E+HYSVFKAAR YRME + 
Sbjct  70    LWKMETDSYWGYVTTSGTEGNLHGILLAREKFPDGILYTSQETHYSVFKAARYYRMECQS  129

Query  1021  INTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEF  842
             I T+  GE+DYD L   +  N+ KP I+NV IGTT KG +DNLD I++ L+     +++F
Sbjct  130   IPTLPMGEIDYDCLSEAIARNRDKPVILNVNIGTTVKGAVDNLDRILRILQSLQIPREQF  189

Query  841   YIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISR  662
             YIHCD AL  L++PF++  P++SF+KPI S+ +SGHK LGCPMPCG+ ++RK  + N+ +
Sbjct  190   YIHCDGALFALMMPFVEFAPEVSFRKPIDSIAVSGHKMLGCPMPCGVALSRKEHVKNLEQ  249

Query  661   NVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGIS  482
             +++Y+ SVD TI GSRNG   ++LWYSL  KG  G+++D   C+ETA +L+D L A G++
Sbjct  250   HIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIGGIKRDVMHCMETARYLKDALTAKGLT  309

Query  481   AMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQ  317
               +ND S TVV ERP D D ++RWQL+C  D+AHV+VMP V    ID F  +L+Q
Sbjct  310   CRLNDLSSTVVLERPMDDDLVKRWQLACEEDIAHVVVMPNVTRYKIDLFVEELMQ  364



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   438 bits (1126),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/417 (50%), Positives = 289/417 (69%), Gaps = 18/417 (4%)
 Frame = -2

Query  1429  DDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVD  1250
             + +A L   + ++ +TI++    ++GYP N  ++ Y  LAPL  +HLNN GDPF+ ++  
Sbjct  49    EKDANLDAIIARYAETINKYNLRNLGYPTNQDFN-YDKLAPLFHFHLNNAGDPFVGSSFS  107

Query  1249  FHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESH  1070
              +S  FEV VLDWFA LW I+  EYWGY+T GG+EGNLHGIL+GRE  P+GILY S+ESH
Sbjct  108   LNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGILVGREQFPDGILYTSQESH  167

Query  1069  YSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIG-----------  923
             YS+FK ARMYRM    + ++ +GE+D   L + LL +K KPAIIN+ IG           
Sbjct  168   YSIFKIARMYRMHCVKVGSLFSGEIDCVQLEASLLSHKDKPAIINLNIGLLCIIHVFENY  227

Query  922   -----TTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
                  TT KGG+D+LD++I+TL++CG+++D FYIHCD AL G+++PF+K   K+SFKKPI
Sbjct  228   IYSHWTTMKGGIDDLDLVIQTLKKCGFTRDRFYIHCDGALFGIMLPFIKQALKVSFKKPI  287

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSL  578
             GSVTISGHKFLGCP PCG+ +TR   +  ISR+V  IAS DATI+GSR G  PIFLWY+L
Sbjct  288   GSVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLWYAL  347

Query  577   STKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSC  398
               +G  GL+ +   C+  A +L + L+ AGI AM+N+ S  VVFERP D DF R W L+C
Sbjct  348   KKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWNLAC  407

Query  397   VRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR-EGPQPPCLEDDLGSHNCYCPLH  230
               ++AHV+V+  V+ E +D F ++ +++R+ W + E  +P C+ +D+GS NC C +H
Sbjct  408   SGNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  464



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/404 (49%), Positives = 265/404 (66%), Gaps = 36/404 (9%)
 Frame = -2

Query  1438  RSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMEN  1259
             + +DD A L   L  F + + +R  + IGYP+N  +D +  +   +   LNN GDPFME 
Sbjct  31    KRQDDMANL---LATFKEHLQERSAHSIGYPINFEFD-FGPVIEFLNMRLNNAGDPFMEC  86

Query  1258  TVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASK  1079
                 HSK FE+ VLDWFA LWE+ KD+YWGY+T+GGTEGN+HG+L+GRE+ PEGI+Y S 
Sbjct  87    NYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRELFPEGIIYTSC  146

Query  1078  ESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMD  899
             +SHYS+FKAA+MYR++   I+T+ +                          GTT KG +D
Sbjct  147   DSHYSIFKAAKMYRVQCIKIDTLFS--------------------------GTTMKGAVD  180

Query  898   NLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGC  719
             +LD II  LE CG++ + FYIHCD+AL GL++PF+K  PK++FKKPIGS+ ISGHKF+GC
Sbjct  181   DLDEIIMILENCGFA-NRFYIHCDSALVGLMMPFIKQAPKLTFKKPIGSICISGHKFIGC  239

Query  718   PMPCGIQMTRKSLI-HNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDA  542
             P+PCG+ +TR   I H +S N+EYI+S D TI+GSRNG  PIFLWY+L   G  GL K  
Sbjct  240   PIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTV  299

Query  541   QRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPG  362
             + C++ A +L  RL+  G+S  +N  SITVVFERP D  F+R+WQL+C   +AHV+VMP 
Sbjct  300   ENCLKNAQYLALRLREMGVSVFLNALSITVVFERPKDETFVRKWQLACQGKIAHVVVMPN  359

Query  361   VAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
             V+ E I+ F  +  + R T +    Q  C+  D+G  NC C LH
Sbjct  360   VSLERINMFLEEFTKSRITLH----QDKCVAGDVGQENCLCSLH  399



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 276/423 (65%), Gaps = 24/423 (6%)
 Frame = -2

Query  1468  KNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHL  1289
             KN +  + E  S  D       L ++   I +R  +H GYP N+ Y+H   L+P +RY +
Sbjct  21    KNFNFVINENLSTQD------ILDQYKKHIEERTYHHFGYPYNLSYNH-EELSPFLRYSV  73

Query  1288  NNCGDPFMENTVDFHSKDFEVGVLDWFAELWEI------------EKDEYWGYITNGGTE  1145
             NN GDPF+E+    HS+ FE  VL++FA+LW+I              DEYWGY+TN GTE
Sbjct  74    NNLGDPFVESNYGVHSRAFEQSVLEFFAKLWKIGPCEDKDNTKNWSHDEYWGYVTNCGTE  133

Query  1144  GNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLL  965
             GNL+GILLGRE  P+ +L +S+ESHYSV KAA++YRM    + T+  GE+DY     +L+
Sbjct  134   GNLYGILLGREQFPDAVLVSSRESHYSVSKAAKLYRMPEIRVPTLFTGEIDYAIFEQELI  193

Query  964   LNKGK-PAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKN  788
              N+ K P ++NV IGTT KG +DNLD I++  +  GY++DEF+IHCD AL  LI+PF++ 
Sbjct  194   KNRKKRPIVMNVNIGTTVKGAVDNLDTILEIFKRTGYTEDEFFIHCDGALFALILPFIEE  253

Query  787   VPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNG  608
               +++F KPIGS+++SGHKF+GCPMPCG+ +TRK  +  +  +++Y+ SVD TI GSRNG
Sbjct  254   ALEVNFTKPIGSISVSGHKFMGCPMPCGVTITRKRYVETLKSHIDYLNSVDTTIMGSRNG  313

Query  607   LTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDR  428
                ++LW +L  KG  G   DA++C+E A ++   L+ AG+  ++ND+S T+V ERP D 
Sbjct  314   QASLYLWLTLRKKGTEGFASDARKCLENAKYMIKLLKEAGVGCLLNDHSNTIVLERPMDE  373

Query  427   DFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHN  248
             +F+++WQL+C   +AH IVMP V+ + I++F ND ++ R    +  P   C+   +G  +
Sbjct  374   EFVKKWQLACEGTVAHCIVMPNVSKQKIEDFVNDYLESR----KSHPADLCIAKHIGPVH  429

Query  247   CYC  239
             C C
Sbjct  430   CLC  432



>gb|EYU40386.1| hypothetical protein MIMGU_mgv1a026369mg, partial [Erythranthe 
guttata]
Length=300

 Score =   387 bits (995),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 230/298 (77%), Gaps = 2/298 (1%)
 Frame = -2

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             R++ P+GILYASKESHYS+FKA+RMYRME + I+T+I GE++  +LR KL LNK KPAI+
Sbjct  1     RDLLPDGILYASKESHYSIFKASRMYRMECQIIDTLITGEINCTELREKLFLNKDKPAIV  60

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPI  758
             NV IGTTFKGG+DNLD+IIKTLEECG+S D FYIHCDAAL+GLI PFL+  PK+SFKKPI
Sbjct  61    NVNIGTTFKGGVDNLDLIIKTLEECGFSHDRFYIHCDAALNGLISPFLEYGPKLSFKKPI  120

Query  757   GSVTISGHKFLGCPMPCGIQMTRKSLI-HNISRNVEYIASVDATISGSRNGLTPIFLWYS  581
              S+++S HK LG  +PCG+ MTRK  I +N+S NVEYI ++D TISGSRNG  PIF+WY 
Sbjct  121   RSISVSAHKLLGSSIPCGVLMTRKGRITNNLSENVEYIDTLDTTISGSRNGHAPIFIWYG  180

Query  580   LSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLS  401
             L  KGR+GL  +  +C+  A +LRD  + AGISAM+N++SI VVFERP  R+FI  WQLS
Sbjct  181   LKMKGRSGLHTEVNKCLTNAKYLRDGFKNAGISAMLNESSIVVVFERPLSREFIDYWQLS  240

Query  400   CVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLH  230
              +  MAHV+VMP V  + +D+F +DLVQ R  WY  G  QP CL +++G  NC C +H
Sbjct  241   LLEKMAHVVVMPHVTVKMLDDFLDDLVQNREIWYGNGKVQPLCLAEEIGVSNCACLVH  298



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   379 bits (972),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 239/355 (67%), Gaps = 32/355 (9%)
 Frame = -2

Query  1291  LNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGRE  1112
             LNN GDPFME     HSK FE+ VLDWFA LWE+ KD+YWGY+T+GGTEGN+HG+L+GRE
Sbjct  3     LNNAGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLLVGRE  62

Query  1111  VHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINV  932
             + PEGI+Y S +SHYS+FKAA+MYR++   I+T+ +                        
Sbjct  63    LFPEGIIYTSCDSHYSIFKAAKMYRVQCIKIDTLFS------------------------  98

Query  931   TIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGS  752
               GTT KG +D+LD ++  LE CG++ + FYIHCD+AL GL++PF+K  PK++FKKPIGS
Sbjct  99    --GTTMKGAVDDLDEVVMILENCGFA-NRFYIHCDSALVGLMMPFIKQAPKLTFKKPIGS  155

Query  751   VTISGHKFLGCPMPCGIQMTRKSLI-HNISRNVEYIASVDATISGSRNGLTPIFLWYSLS  575
             + ISGHKF+GCP+PCG+ +TR   I H +S N+EYI+S D TI+GSRNG  PIFLWY+L 
Sbjct  156   ICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFLWYALK  215

Query  574   TKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCV  395
               G  GL K  + C++ A +L  RL+  G+S  +N  SITVVFERP D  F+R+WQL+C 
Sbjct  216   RIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKWQLACQ  275

Query  394   RDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYCPLH  230
               +AHV+VMP V+ E I+ F  +  + R   +    Q  C+  D+   NC C LH
Sbjct  276   GKIAHVVVMPNVSLERINMFLEEFTKSRIALH----QDKCVAGDVSQENCLCSLH  326



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   400 bits (1028),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 256/365 (70%), Gaps = 20/365 (5%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             LG F   + +R  +H+G+P++   D    LA    +H+NN GDPF+E+    HS+ FE  
Sbjct  629   LGHFRQHLQERSAHHLGHPLSQKLD-VGPLAQFQHFHINNIGDPFVESNYGIHSRQFEYA  687

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VLDWFA LWEI KD+YWGY+TNGG+EGN  G+L+GRE++PEGI+YAS++SHYS+FKAA+M
Sbjct  688   VLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLLVGRELYPEGIIYASQDSHYSIFKAAKM  747

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YR++   I+T  +GEM YD  R+KLL N  +PAI+NV IGTT KG +D+LD II TLE C
Sbjct  748   YRVQCIKIDTSFSGEMRYDHFRTKLLENARRPAIVNVNIGTTVKGAIDDLDEIISTLENC  807

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
             G+ +D FYIHCD AL+GL++PF+K  PK++F KPIGS+++SGHK LGCP PCG+ + R  
Sbjct  808   GF-RDRFYIHCDGALAGLMLPFIKQAPKVTFIKPIGSISVSGHKLLGCPTPCGVVINRLK  866

Query  682   LIHNI-SRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRD  506
              I  + S N+EYIAS D TISGSRNG +PIFLWY L + G                    
Sbjct  867   DIDVLKSTNIEYIASNDVTISGSRNGQSPIFLWYKLKSMG-----------------YEV  909

Query  505   RLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             RL+  GISA +N  SI V+FE+P D  F+++WQL+C  ++AHV+VMP V+ E +  F  +
Sbjct  910   RLRNVGISAFMNSKSIIVIFEKPKDEMFMQKWQLACAGNVAHVVVMPHVSFEMLGIFVEE  969

Query  325   LVQER  311
             L ++R
Sbjct  970   LAEKR  974



>ref|XP_004364837.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   384 bits (987),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/414 (43%), Positives = 266/414 (64%), Gaps = 5/414 (1%)
 Frame = -2

Query  1477  PARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             P   ++ +T  E      +A +  T   + D +++R  YH GYP N+ +D+   L   M 
Sbjct  262   PDTHDLFLTADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDN-EHLHSFMN  320

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             Y  NN GD F+ +  + H++ FE+GVLD+FA+LW+I +++YWGY+T+ GTEGNLHG+LL 
Sbjct  321   YSCNNLGDCFVASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLLLA  380

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             RE  P GILYAS+ESHYSVFKAAR YRM+   + ++ +GE+DY  L   +  N   P I+
Sbjct  381   RECLPTGILYASRESHYSVFKAARYYRMQSVCVPSLYSGEIDYAALEESIAANLDVPVIL  440

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS-FKKP  761
             ++ IGTT KG +DN+D ++  L      ++ F+IHCD ALSGL++P ++N   ++ F +P
Sbjct  441   SLNIGTTVKGAIDNVDRVLAILARLNIPRERFHIHCDGALSGLMLPLMENATVVADFTRP  500

Query  760   IGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYS  581
             I S+++SGHKF+GCPMP G+ + RK  +  + +++ Y+ S D TI GSRNG  P+F+W +
Sbjct  501   IDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMWNT  560

Query  580   LSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLS  401
             +  KG++G  KD  +C+  A  L  RL+ AG+S+M+N  S TVVFERP +  F+++WQL+
Sbjct  561   IQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQLA  620

Query  400   CVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYC  239
             C  ++AH IVMP +  E I  F  +L+  R     +G    C+   +G  NC C
Sbjct  621   CEGNIAHAIVMPNITEEKIVVFVTELLASRKA---QGTCDKCVAMHIGRANCLC  671



>gb|EFW43925.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   384 bits (987),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/414 (43%), Positives = 266/414 (64%), Gaps = 5/414 (1%)
 Frame = -2

Query  1477  PARKNMHITVAEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMR  1298
             P   ++ +T  E      +A +  T   + D +++R  YH GYP N+ +D+   L   M 
Sbjct  271   PDTHDLFLTADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDN-EHLHSFMN  329

Query  1297  YHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLG  1118
             Y  NN GD F+ +  + H++ FE+GVLD+FA+LW+I +++YWGY+T+ GTEGNLHG+LL 
Sbjct  330   YSCNNLGDCFVASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLLLA  389

Query  1117  REVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAII  938
             RE  P GILYAS+ESHYSVFKAAR YRM+   + ++ +GE+DY  L   +  N   P I+
Sbjct  390   RECLPTGILYASRESHYSVFKAARYYRMQSVCVPSLYSGEIDYAALEESIAANLDVPVIL  449

Query  937   NVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKIS-FKKP  761
             ++ IGTT KG +DN+D ++  L      ++ F+IHCD ALSGL++P ++N   ++ F +P
Sbjct  450   SLNIGTTVKGAIDNVDRVLAILARLNIPRERFHIHCDGALSGLMLPLMENATVVADFTRP  509

Query  760   IGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYS  581
             I S+++SGHKF+GCPMP G+ + RK  +  + +++ Y+ S D TI GSRNG  P+F+W +
Sbjct  510   IDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMWNT  569

Query  580   LSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLS  401
             +  KG++G  KD  +C+  A  L  RL+ AG+S+M+N  S TVVFERP +  F+++WQL+
Sbjct  570   IQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQLA  629

Query  400   CVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYREGPQPPCLEDDLGSHNCYC  239
             C  ++AH IVMP +  E I  F  +L+  R     +G    C+   +G  NC C
Sbjct  630   CEGNIAHAIVMPNITEEKIVVFVTELLASRKA---QGTCDKCVAMHIGRANCLC  680



>gb|EAZ18332.1| hypothetical protein OsJ_33863 [Oryza sativa Japonica Group]
Length=446

 Score =   372 bits (955),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/365 (50%), Positives = 245/365 (67%), Gaps = 37/365 (10%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             LG F   + +R  +H+G+P++   D    LA    +H+NN GDPF+E+    HS+ FE  
Sbjct  52    LGHFRQHLQERSAHHLGHPLSQKLD-VGPLAQFQHFHINNIGDPFVESNYGIHSRQFEYA  110

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VLDWFA LWEI KD+YWGY+TNGG+EGN  G+L+GRE++PEGI+YAS++SHYS+FKAA+M
Sbjct  111   VLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLLVGRELYPEGIIYASQDSHYSIFKAAKM  170

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             YR++   I+T  +GEM YD  R+KLL N  +PAI+NV IGTT KG +D+LD II TLE C
Sbjct  171   YRVQCIKIDTSFSGEMRYDHFRTKLLENARRPAIVNVNIGTTVKGAIDDLDEIISTLENC  230

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
             G+ +D FYIHCD AL+GL++PF+K  PK++F KPIGS+++SGHK LGCP PCG+ + R  
Sbjct  231   GF-RDRFYIHCDGALAGLMLPFIKQAPKVTFIKPIGSISVSGHKLLGCPTPCGVVINRLK  289

Query  682   LIHNI-SRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRD  506
              I  + S N+EYIAS D TISGSRN                                   
Sbjct  290   DIDVLKSTNIEYIASNDVTISGSRNV----------------------------------  315

Query  505   RLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             RL+  GISA +N  SI V+FE+P D  F+++WQL+C  ++AHV+VMP V+ E +  F  +
Sbjct  316   RLRNVGISAFMNSKSIIVIFEKPKDEMFMQKWQLACAGNVAHVVVMPHVSFEMLGIFVEE  375

Query  325   LVQER  311
             L ++R
Sbjct  376   LAEKR  380



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   366 bits (939),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 238/353 (67%), Gaps = 45/353 (13%)
 Frame = -2

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             IGYP N+ +D ++ +A    + +NN GDPF+E+    HS+ FEV VLDWFA LWE+++D+
Sbjct  21    IGYPYNLDFD-FSVMAQFQSFSINNLGDPFIESNYGVHSRQFEVAVLDWFACLWELQQDQ  79

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             YWGYITN GTEGNLHG+L+GRE+ P+GI+Y  +ESHYSVFKA                  
Sbjct  80    YWGYITNCGTEGNLHGLLVGRELFPDGIIYTFRESHYSVFKA------------------  121

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
                                     GTT KG +D+LD II  L ECG+ Q+ FYIHCD AL
Sbjct  122   ------------------------GTTVKGAIDDLDRIISILVECGF-QNRFYIHCDGAL  156

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             +GL++PF++  PK++F KPIGSV++SGHKF+GCP+PCG+ +TR   +  +S ++EY++S 
Sbjct  157   AGLMMPFIRQAPKVTFTKPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSR  216

Query  637   DATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSI  458
             DATI GSRNG  P++LWY+L+ KG  G++K+ Q+C+  A HL +RL+  G+SA +N+ S 
Sbjct  217   DATIMGSRNGHAPMYLWYTLNKKGYKGIRKEVQKCLRNAHHLANRLKEMGVSASLNELSS  276

Query  457   TVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWY  299
             TVVFERP D  F+ +WQL+C   +AHV+VMP +  E +D+F  +LV  RA W+
Sbjct  277   TVVFERPQDETFVHKWQLACESSIAHVVVMPNIDVEKLDDFVEELVARRA-WH  328



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 ref|YP_001865119.1| histidine decarboxylase [Nostoc punctiforme PCC 73102]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/371 (47%), Positives = 250/371 (67%), Gaps = 5/371 (1%)
 Frame = -2

Query  1420  ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHS  1241
             +++   L  FL  I QR  +H GYP N+  D Y+ +     + LNN GDP++E     HS
Sbjct  3     SKVAKELADFLLQIEQRSQFHAGYPYNLSCD-YSAIGKFFNHLLNNAGDPYIEPDFGLHS  61

Query  1240  KDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSV  1061
             + FE  VL +FA L++I ++++WGY+T GGTEGNL+GI L RE++P GILY+S++SHYS+
Sbjct  62    RKFEQEVLSFFAHLYKIPENQFWGYVTAGGTEGNLYGIFLAREIYPNGILYSSQDSHYSI  121

Query  1060  FKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVII  881
              KAA+++R++   +N+ INGEM+YD     L  N+  PAIIN+ IGTT KG +DNLD ++
Sbjct  122   PKAAKLFRIQHNVVNSQINGEMNYDHFEQLLSENRRYPAIINLNIGTTVKGAIDNLDKVL  181

Query  880   KTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGI  701
             + LE       ++YIHCDAALSGLI+PFL   P+++F+KPI SV IS  KF+G P+PCG+
Sbjct  182   EILERNQIK--DYYIHCDAALSGLILPFLDGAPQVNFQKPIDSVAISA-KFIGSPLPCGV  238

Query  700   QMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETA  521
              +T+K  +  +   +EYI S D TI GSRNG TP+ LWY++ T+G  GL K+A+ C+  A
Sbjct  239   VLTKKKWVEKVETEIEYIGSKDTTILGSRNGHTPLILWYAVQTRGYDGLAKEAKTCIHNA  298

Query  520   THLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAID  341
              +L  +LQ      M+N+ S TVVF++P  R  I++WQL+   + AH+IVM  +  E ID
Sbjct  299   QYLFQQLQIREYPCMLNNFSNTVVFQKPSQR-LIKKWQLAVFENWAHMIVMQNIVREKID  357

Query  340   NFFNDLVQERA  308
              F N+L+ E+ 
Sbjct  358   IFINELLLEQG  368



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 ref|YP_007048917.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 249/361 (69%), Gaps = 5/361 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L  F   I QR  +H GYP N+  D +  +     + LNN GDP++E     HS+ FE  
Sbjct  9     LAIFWQQIEQRSQFHAGYPYNLSCD-FTCINKFFSFLLNNAGDPYIEPNFGLHSRKFEQE  67

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VL +FA+L++I ++E+WGY+T GGTEGNL+GILL RE++P+GILY+S++SHYS+ KAAR+
Sbjct  68    VLSFFAQLYKIPENEFWGYVTAGGTEGNLYGILLAREIYPDGILYSSQDSHYSIAKAARL  127

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
             + ++ + IN+ INGE+ Y+ L   +  N  KP II++ IGTT KG +D+LD I++ L+  
Sbjct  128   FGVQHQVINSQINGEISYEYLSQAIQQNSHKPVIISLNIGTTVKGAIDDLDKILEILKR-  186

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
              +   ++YIHCDAALSG+I+PFL + P+I+F+KPI SV ISG KF+G P+PCG+ +T+K 
Sbjct  187   -HQIKDYYIHCDAALSGMILPFLDHAPQINFQKPIDSVAISG-KFIGSPIPCGVVLTKKK  244

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  +   +EYI S D TI GSRNG TP+ LWY+L TKG  G  ++A+ C++ A +L  +
Sbjct  245   WVEKVETMIEYIGSKDTTILGSRNGHTPLILWYALKTKGYEGFAQEAKTCIQNAQYLFQQ  304

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             LQ      M+N  S TVVF++ P++  I++WQL+ + + AH+IVM  +  + ID F N+L
Sbjct  305   LQLREYPCMLNKFSNTVVFQK-PNQVLIKKWQLATLDNFAHLIVMQNIDRQKIDTFVNEL  363

Query  322   V  320
             V
Sbjct  364   V  364



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/357 (47%), Positives = 241/357 (68%), Gaps = 4/357 (1%)
 Frame = -2

Query  1393  FLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLD  1214
             FL  + +R  +  GYP N+ YD Y  L  L  + LNN GDP++E+     S+ +E  VLD
Sbjct  4     FLKELEKRREFATGYPYNLSYD-YTPLLNLFNFTLNNLGDPYVESNYAIDSRKYEQEVLD  62

Query  1213  WFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRM  1034
             +FA L+++  D+ WGYIT+ GTEGNL+GI LGREV+P+GILY+S++SHYSV KAAR++R+
Sbjct  63    FFANLYKLPDDDSWGYITSCGTEGNLYGIWLGREVYPDGILYSSEDSHYSVAKAARLFRI  122

Query  1033  EVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYS  854
             E   +N+   GE++YD     +  N  +P IIN+ IGTT KG +DNLDV++  L+     
Sbjct  123   EHVVVNSQPTGEIEYDHFEEMIQQNSRRPIIINLNIGTTMKGAIDNLDVVLNILKRN--Q  180

Query  853   QDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIH  674
               +FYIHCDAALSG+++PF+ N P+++F KPI S+ ISGHKF+G P+ CG+ +TRK  ++
Sbjct  181   IQDFYIHCDAALSGMMLPFVANAPQVNFTKPISSIAISGHKFIGSPLVCGVVLTRKEFVN  240

Query  673   NISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQA  494
              I  +++YI S D TI GSRNG  P+FLWY+L  K   GL K+ + C+E + +L + LQ 
Sbjct  241   KIETSIDYIGSKDTTILGSRNGHAPLFLWYALKKKDYQGLAKEVEFCLENSQYLFNNLQL  300

Query  493   AGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
                  M+N+ S TVVF++PP +  +++WQL+   D AH++VM  +    ID F  DL
Sbjct  301   LNYPCMLNNFSNTVVFKKPPIQ-LVKKWQLATQGDWAHMVVMQNINRHKIDTFITDL  356



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 257/371 (69%), Gaps = 9/371 (2%)
 Frame = -2

Query  1414  LKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFM-ENTVDFHSK  1238
             +   L  FL+ ++Q++ ++ GY  N+ +D Y+ L   +RY++NN GDPF+ +  V  H+K
Sbjct  1     MDTLLNDFLEQMTQQVEFNAGYSENLAFD-YSRLWHFLRYNINNAGDPFIYDKFVKSHAK  59

Query  1237  DFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVF  1058
             +FE   L WFA+L+E++   +WGY+T GG+EGN++G+ LGRE +P+ + YASK+SHYS+ 
Sbjct  60    EFEQKSLQWFAQLYELQN--HWGYVTTGGSEGNIYGLFLGRERYPDSVFYASKDSHYSIV  117

Query  1057  KAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIK  878
             KAAR+ R+    I++ +NGE+DYD L  +L  ++ + AI+N+ +GTT KG +D ++ ++ 
Sbjct  118   KAARLLRIPYTPIDSQLNGEIDYDQLERELSAHRHQSAILNLNLGTTMKGAIDRIERVVD  177

Query  877   TLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKK-PIGSVTISGHKFLGCPMPCGI  701
              L+    +Q  F++HCDAAL G+++PF+ + PKISF+  PIGS+ +SGHKF+G P+  GI
Sbjct  178   ILKRVNITQ--FHLHCDAALGGMLLPFIDSAPKISFQDYPIGSIAVSGHKFIGSPIHFGI  235

Query  700   QMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETA  521
              +TR+  +  I + +EY+ + D TI+GSR GL  +FLWY+++T+G+    ++   C+E A
Sbjct  236   VLTRREYVQKIGKRIEYLGTDDTTITGSRCGLNALFLWYAIATRGQK-FAREVVTCLENA  294

Query  520   THLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAID  341
              +LRDRLQ  G + ++ND SITV F++PP +    +WQL+   ++AHV+VM  ++ + I+
Sbjct  295   QYLRDRLQQIGYNPLLNDFSITVAFKKPPAK-VCDKWQLAIEGNLAHVVVMQHISTQKIN  353

Query  340   NFFNDLVQERA  308
                +DL+Q +A
Sbjct  354   ELIDDLLQAQA  364



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 247/375 (66%), Gaps = 11/375 (3%)
 Frame = -2

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             PR  D    +   L +    +++     IGYP N+ +D YA L P  +Y+LNN GDPF+E
Sbjct  3     PRLVDKNTSV--ILKRLQQHLAKSTKLSIGYPANLDFD-YALLLPFFQYYLNNVGDPFVE  59

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
                  HSK+FE   + WFA+L+E+E  EYWGY+T+GGTEGNL+GI LGRE++P+ ILY+S
Sbjct  60    GNFALHSKEFERQCISWFAQLYELE--EYWGYLTSGGTEGNLYGIFLGRELNPDAILYSS  117

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
              ++HYSV KAAR+ ++    I +  NGE++Y+ L  +L   K + AIIN+ +GTT KG +
Sbjct  118   SDTHYSVAKAARLLKIPHVVICSQFNGEINYEHLEYELSQRKHQSAIININLGTTMKGAV  177

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKK-PIGSVTISGHKFL  725
             DN++ II+ +E  G     +YIHCD AL G+++PF+K  PKISF+  PIGS+++SGHKF+
Sbjct  178   DNIERIIEIVERVGV---RYYIHCDGALGGMLIPFIKGAPKISFRDYPIGSISVSGHKFI  234

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             G P+  GI +TR+  ++ I  +VEYI S D TI GSR+G+  + LWY++ T+     QK+
Sbjct  235   GSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGIAALLLWYAIQTRSHH-FQKE  293

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
                C++ A +LRDRL       ++ND S TVVF++ P  +  R+WQL+   + AHV+VM 
Sbjct  294   VASCLQNARYLRDRLLEINYHPLLNDFSTTVVFDK-PGIELCRKWQLATEENFAHVVVMQ  352

Query  364   GVAPEAIDNFFNDLV  320
              ++ + ID F  +L+
Sbjct  353   HISTQKIDLFIQNLL  367



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/375 (44%), Positives = 252/375 (67%), Gaps = 11/375 (3%)
 Frame = -2

Query  1441  PRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFME  1262
             PR  D    +   L +    I++     IGYP N+ +D Y  L P  +Y+LNN GDPF++
Sbjct  3     PRLVDKNTSV--ILKRLQQHIAKCTKLSIGYPANLNFD-YTLLLPFFQYYLNNAGDPFID  59

Query  1261  NTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYAS  1082
                  +SK+FE   ++WFA+L+E+E  EYWGY+TNGGTEGNL+ I LGRE++P+ ILY+S
Sbjct  60    GNFALNSKEFERQCINWFAQLYELE--EYWGYLTNGGTEGNLYSIFLGRELNPDAILYSS  117

Query  1081  KESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGM  902
             +++HYS+ KAAR+ ++    I + +NGE++Y+ L  +L   K + AIIN+ +GTT KG +
Sbjct  118   RDTHYSIAKAARLLKIPHVVICSQLNGEINYEHLEYELSQRKQQSAIININLGTTMKGAV  177

Query  901   DNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKK-PIGSVTISGHKFL  725
             DN++ II+ ++  G     FYIHCD AL G+++PF+K  PKISF+  PIGS+++SGHKF+
Sbjct  178   DNIERIIEIVQRVGV---RFYIHCDGALGGMLLPFIKEAPKISFRDYPIGSISVSGHKFI  234

Query  724   GCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             G P+  GI +TR+  ++ I  +VEYI S D TI GSR+G+T + LWY++ T+ +   QK+
Sbjct  235   GSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGITALLLWYAIQTRSQH-FQKE  293

Query  544   AQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMP  365
                C++ A +LRDRL       ++ND S TVVF++ P  +  R+WQL+  +++AH++VM 
Sbjct  294   VASCLQNARYLRDRLLERNYHPLLNDFSTTVVFDK-PGIELCRKWQLATEQNLAHIVVMQ  352

Query  364   GVAPEAIDNFFNDLV  320
              ++ + ID F  +L+
Sbjct  353   HISTQKIDLFIQNLL  367



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   336 bits (861),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/363 (44%), Positives = 246/363 (68%), Gaps = 9/363 (2%)
 Frame = -2

Query  1405  TLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEV  1226
             +L +    I++   + IGYP N+ +D Y  L P  +Y+LNN GDPF+E     HSK+FE 
Sbjct  13    SLKRLQQHIAECAKHSIGYPANLDFD-YTLLLPFFQYNLNNAGDPFVEGNFALHSKEFER  71

Query  1225  GVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAAR  1046
               L+WFA+L+E+E  EYWGY+T+GGTEGN++G+ LGRE++P+ ILY+S+++HYSV KAAR
Sbjct  72    QSLNWFAQLYELE--EYWGYLTSGGTEGNIYGMFLGRELYPDAILYSSRDTHYSVAKAAR  129

Query  1045  MYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEE  866
             + ++    I +  NGE++Y+ L  +L   K + AIIN+ +GTT KG +DN++ II   + 
Sbjct  130   LLKIPHVVICSQFNGEINYEHLEYELSQRKQQSAIININLGTTMKGAVDNIERIIDITQR  189

Query  865   CGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKK-PIGSVTISGHKFLGCPMPCGIQMTR  689
                 +  FYIHCD AL G+++PF++  PKISF+  PIGS+++SGHKF+G P+  GI +TR
Sbjct  190   L---EIRFYIHCDGALGGMLLPFIQEAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTR  246

Query  688   KSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLR  509
             +  +  I  +VEYI S D TI GSR+GL  + LWY++ T+ +    ++   C++ A +LR
Sbjct  247   QPYVKKIETSVEYIGSKDMTILGSRSGLAALLLWYAIQTRNQQ-FHREVATCLQNARYLR  305

Query  508   DRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFN  329
             DRL       ++ND S TVVF++ PD +  R+WQL+   ++AH++VM  ++ + ID F +
Sbjct  306   DRLLEINYHPLLNDFSTTVVFDK-PDIELCRKWQLATEGNLAHIVVMQHISTQKIDQFID  364

Query  328   DLV  320
             +L+
Sbjct  365   NLL  367



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 248/364 (68%), Gaps = 9/364 (2%)
 Frame = -2

Query  1408  CTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFE  1229
              +L K  + I++     IGYP N+ +D Y  L P  +Y+LNN GDPF+E     HSK+FE
Sbjct  12    ASLKKLQEHIAKCTKQSIGYPANLDFD-YTVLLPFFQYYLNNVGDPFVEGNFALHSKEFE  70

Query  1228  VGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAA  1049
                ++WFA+L+E+E  EYWGY+T+GGTEGNL+GI LGRE++P+ ILY+S ++HYSV KAA
Sbjct  71    RQCINWFAQLYELE--EYWGYLTSGGTEGNLYGIFLGRELYPDAILYSSSDTHYSVAKAA  128

Query  1048  RMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLE  869
             R+ ++    I +  NGE++Y+ L  +L   K + AIIN+ +GTT KG +DN++ II+ +E
Sbjct  129   RLLKIPHVVIRSQFNGEINYEHLEYELSQRKQQSAIININLGTTMKGAVDNIERIIEIIE  188

Query  868   ECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKK-PIGSVTISGHKFLGCPMPCGIQMT  692
               G     FYIHCD AL  +++PF+K  PKISF++ PIGS+++SGHKF+G P+  GI +T
Sbjct  189   RVGV---RFYIHCDGALGAMLLPFIKKAPKISFQEYPIGSISVSGHKFIGSPITYGIVLT  245

Query  691   RKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHL  512
             R+  ++ I  ++EYI S D TI GSR+G+  + LWY++ T+ +   QK+   C++ A +L
Sbjct  246   RQPYVNKIETSIEYIGSQDTTILGSRSGIAALLLWYAIRTRSQH-FQKEVASCLQNARYL  304

Query  511   RDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFF  332
             RDRL       ++ND SITVVF++ P  +  R+WQL+   ++AHV+VM  ++ + ID F 
Sbjct  305   RDRLLEINYHPLLNDFSITVVFDK-PGIELCRKWQLATEENLAHVVVMQHISSQKIDLFI  363

Query  331   NDLV  320
              +L+
Sbjct  364   RNLL  367



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/347 (46%), Positives = 241/347 (69%), Gaps = 9/347 (3%)
 Frame = -2

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             IGYPVN+ +D Y  L P ++Y+LNN GDPF+E     HSK+FE   L+WFA+L+E+E  E
Sbjct  29    IGYPVNLDFD-YTLLLPFLQYNLNNVGDPFVEGNFALHSKEFERQSLNWFAQLYELE--E  85

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             YWGY+T+GGTEGNL+G+ LGRE++P+ +LY+S+++HYSV KAAR+ ++    I +  NGE
Sbjct  86    YWGYLTSGGTEGNLYGMFLGRELYPDAVLYSSRDTHYSVAKAARLLKIPHVVICSQFNGE  145

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             ++Y+ L  +L   K + AIIN+ +GTT KG +DN++ I   ++     +  FYIHCD AL
Sbjct  146   INYEHLEYELSQRKQQSAIININLGTTMKGAVDNIERINDIIQRL---RIRFYIHCDGAL  202

Query  817   SGLIVPFLKNVPKISFKK-PIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIAS  641
              G+++PF++  PKISF+  PIGS+++SGHKF+G P+  GI +TR+  +  I  +VEYI S
Sbjct  203   GGMLLPFIQEAPKISFRDYPIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGS  262

Query  640   VDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
              D TI GSR+GL  +FLWY++ T+ +    K+   C++ A +LRDRL       ++ND S
Sbjct  263   KDMTILGSRSGLAALFLWYAIQTRSQH-FHKEVANCLQNARYLRDRLLEINYHPLLNDFS  321

Query  460   ITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLV  320
              TVVF++P   +  R+WQL+   ++AH++VM  ++ + ID F ++L+
Sbjct  322   TTVVFDKPAI-ELCRKWQLATQGNIAHIVVMQHISTQKIDQFIDNLL  367



>ref|XP_009600053.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=219

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1126  LLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKP  947
             L  RE+HP GI+YASK+SHYS+FKAARMYRME+E INT++NGE+DY DLRSKLLLNK KP
Sbjct  11    LCRRELHPTGIIYASKDSHYSIFKAARMYRMEIETINTLVNGEIDYADLRSKLLLNKNKP  70

Query  946   AIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFK  767
             AIIN+ IGTTFKG +D+LD++++ L++CGYS D +YIHCDAAL GLIVPF+++V  I+FK
Sbjct  71    AIININIGTTFKGAIDDLDLVLQILQKCGYSNDRYYIHCDAALYGLIVPFIQHVKTITFK  130

Query  766   KPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLW  587
             KPIGSV+ISGHKFLGCPMPCGIQ+TRKS I ++S  +EYIASVDATISGSRNGL PIFLW
Sbjct  131   KPIGSVSISGHKFLGCPMPCGIQITRKSYITSLSTKIEYIASVDATISGSRNGLAPIFLW  190

Query  586   YSLSTKGRAGLQKDAQRCVETATH  515
             YSL  KGRAGLQ+DA+ C E   +
Sbjct  191   YSLCMKGRAGLQQDAKMCNENQCY  214



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 205/281 (73%), Gaps = 20/281 (7%)
 Frame = -2

Query  1066  SVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDV  887
             S+FKAARMYRME E + T+ +GE+D DD ++KLL ++ KPAIINV IGTT KG +D+LD+
Sbjct  123   SIFKAARMYRMECEKVETLSSGEIDCDDFKAKLLRHQDKPAIINVNIGTTVKGAVDDLDL  182

Query  886   IIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPC  707
             +I+ LEE G+SQD FYIH D AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPMPC
Sbjct  183   VIQKLEEAGFSQDRFYIHVDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPC  242

Query  706   GIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVE  527
             G+Q+TR   I+ +SRNVEY+AS DATI                      G QK+ Q+C+ 
Sbjct  243   GVQITRLEHINGLSRNVEYLASRDATID-------------------HGGFQKEVQKCLR  283

Query  526   TATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEA  347
              A + +DRL  AGI AM+N+ S TVVFERP D +FIR+WQL+C  ++AHV+VMP V  E 
Sbjct  284   NAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEK  343

Query  346   IDNFFNDLVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             +D+F N+LVQ+RATW+ +G  QP C+  D+G ++C C  HK
Sbjct  344   LDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  384



>gb|AFA36595.1| putative serine decarboxylase, partial [Lolium perenne]
Length=245

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 191/246 (78%), Gaps = 1/246 (0%)
 Frame = -2

Query  1039  RMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECG  860
             RME   ++T I+GE+D  D   KL+ NK KPAIINV IGTT KG +D+LD++IKTLEE G
Sbjct  1     RMECVKVDTHISGEIDCSDFERKLMQNKDKPAIINVNIGTTVKGAVDDLDLVIKTLEESG  60

Query  859   YSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSL  680
             + +D FYIHCD AL GL++PF+K   K++FKKPIGSV++SGHKF+GCPMPCG+Q+TR   
Sbjct  61    F-KDRFYIHCDGALFGLMIPFVKKAAKVTFKKPIGSVSVSGHKFVGCPMPCGVQVTRLKH  119

Query  679   IHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRL  500
             I+ +S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL
Sbjct  120   INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNQKGYRGFQKEVQKCLRNAHYLKDRL  179

Query  499   QAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLV  320
              AAGI AM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VMP V  + +D F  +LV
Sbjct  180   NAAGIGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLRELV  239

Query  319   QERATW  302
             ++RA W
Sbjct  240   EKRAVW  245



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 199/274 (73%), Gaps = 14/274 (5%)
 Frame = -2

Query  1045  MYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEE  866
             MYRME E + T+ +GE+D DD ++KLL ++ KPAIINV IGTT KG +D+LD++I+ LEE
Sbjct  1     MYRMECEKVETLSSGEIDCDDFKAKLLRHQDKPAIINVNIGTTVKGAVDDLDLVIQKLEE  60

Query  865   CGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRK  686
              G+SQD FYIH D AL GL++PF+K  PK++FKKPIGSV++SGHKF+GCPMPCG+  T  
Sbjct  61    AGFSQDRFYIHVDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGMWNT--  118

Query  685   SLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRD  506
                         +  +  +I GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A + +D
Sbjct  119   -----------LLLGMRLSIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAYYFKD  167

Query  505   RLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             RL  AGI AM+N+ S TVVFERP D +FIR+WQL+C  ++AHV+VMP V  E +D+F N+
Sbjct  168   RLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNE  227

Query  325   LVQERATWYREGP-QPPCLEDDLGSHNCYCPLHK  227
             LVQ+RATW+ +G  QP C+  D+G ++C C  HK
Sbjct  228   LVQKRATWFEDGTFQPYCIASDVGENSCLCAQHK  261



>gb|EMT14424.1| Histidine decarboxylase [Aegilops tauschii]
Length=440

 Score =   325 bits (833),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 221/318 (69%), Gaps = 17/318 (5%)
 Frame = -2

Query  1351  YPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYW  1172
             YP N+ +D ++ L     + +NN G PF+E+    HS+ FEV VLDWFA LW I++DEYW
Sbjct  133   YPFNLDFD-FSVLDQFQSFSINNLGGPFIESNYGVHSRRFEVAVLDWFARLWNIQQDEYW  191

Query  1171  GYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMD  992
             GYIT GGTEGNLHG+L+GRE+  +GI+YAS +SHYSVFKAARMYR+E   I+T+++GEM+
Sbjct  192   GYITTGGTEGNLHGLLVGREIFRDGIIYASCDSHYSVFKAARMYRVECVKIDTLVSGEMN  251

Query  991   YDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSG  812
               D +SKLL+N G+PAI+NV IGTT KG +D+LD II+TLE+CG+ +D FYIHCD AL+G
Sbjct  252   CADFKSKLLMNAGRPAIVNVNIGTTVKGAIDDLDNIIRTLEKCGF-RDRFYIHCDGALAG  310

Query  811   LIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDA  632
             L++PF+K V  +  +   G +  +  K          +   +  +H +S  +       +
Sbjct  311   LMMPFIKQVGGVDIRTK-GDIRQTYWK----------REHLRPQVHVMSSTMWR----GS  355

Query  631   TISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITV  452
             TI GSRNG +P+FLWY+L+ KG  G+QK+ ++C+  A HL  RL+  G+SA +ND S TV
Sbjct  356   TIMGSRNGHSPLFLWYTLNKKGYKGIQKEVEKCMRNAHHLTSRLREKGVSAFLNDLSSTV  415

Query  451   VFERPPDRDFIRRWQLSC  398
             VFER  D  F+ +WQL+C
Sbjct  416   VFERSRDESFMHKWQLAC  433



>gb|EJK75470.1| hypothetical protein THAOC_02802 [Thalassiosira oceanica]
Length=474

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/294 (50%), Positives = 208/294 (71%), Gaps = 4/294 (1%)
 Frame = -2

Query  1426  DEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDF  1247
             DE+ +  +  K L    ++ + H GYP N++Y+H   L   M+Y +NN GDPF+ +    
Sbjct  183   DESEILSSYDKLL---RRKSSVHFGYPYNLMYNH-EELYEFMKYSINNLGDPFITSNYGV  238

Query  1246  HSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHY  1067
             HS+ FE  V+D+FA LW++E+D YWGY+T  GTEGNLHGILL RE HP+G+LY+S+E+HY
Sbjct  239   HSRQFECSVIDFFARLWKMEEDSYWGYVTTCGTEGNLHGILLARECHPDGVLYSSRETHY  298

Query  1066  SVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDV  887
             S+FKAAR YRM+ + I T+  GE+DYD L +++  N+ +P IINV IGTT KG +DNLD 
Sbjct  299   SIFKAARYYRMDAKAIPTLPMGEIDYDALAAEIEKNRDRPVIINVNIGTTVKGAVDNLDR  358

Query  886   IIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPC  707
             I++ L      +D F+IH D AL  +++PF+   P++SF+KPI S+ +SGHK LGCPMPC
Sbjct  359   ILRILNTLKIPRDRFHIHIDGALFAMMMPFVDWAPELSFEKPIDSIAVSGHKMLGCPMPC  418

Query  706   GIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKD  545
             GI ++RK  +  + + ++Y+ SVD TI GSRNG   ++LWYSL  KG AG+++D
Sbjct  419   GIALSRKEHVKKVEQRIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGVAGIKRD  472



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 189/265 (71%), Gaps = 11/265 (4%)
 Frame = -2

Query  1024  GINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDE  845
             G++ + N +     +++KLL  +G          TT+KG +D++D+I++ LE CGYS D 
Sbjct  89    GVDLVKNVQDKVKSIQAKLLAAQG----------TTYKGAIDDVDMILQILENCGYSNDR  138

Query  844   FYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNIS  665
             FYIHCDAAL GLIVPF+ +   I+FKK IGS+++SGHKFLGC M CG+Q+TRK+ I  IS
Sbjct  139   FYIHCDAALYGLIVPFINHAKIITFKKSIGSISVSGHKFLGCSMLCGVQITRKTYIATIS  198

Query  664   RNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGI  485
             + VEYIAS+D TISGSRNGL PIFLWYSLS KG  GLQ+ A+ C E A +L+DRL  AGI
Sbjct  199   KRVEYIASIDNTISGSRNGLAPIFLWYSLSMKGHVGLQQHAKMCYENARYLKDRLHKAGI  258

Query  484   SAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERAT  305
             SAM+N+ S  VVFERP D  FIRRWQLSC RD AHV+VMPG   E IDNFF DL+QER  
Sbjct  259   SAMLNELSNIVVFERPCDDKFIRRWQLSCTRDTAHVVVMPGTTKEIIDNFFKDLMQEREK  318

Query  304   WYREGPQPPCLEDDLGSHNCYCPLH  230
             W       PCL DD+GS NC C  H
Sbjct  319   WCGI-TLAPCLADDIGSQNCLCSYH  342



>gb|KHN17002.1| Histidine decarboxylase [Glycine soja]
Length=500

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 192/238 (81%), Gaps = 2/238 (1%)
 Frame = -2

Query  1273  PFMENTVDF--HSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPE  1100
             PF+E    F  +S  FEV VL+WF  LWEI+K+EYWGY+T GGTEGNLHGIL+GRE  P+
Sbjct  204   PFVEQGSSFSLNSTTFEVCVLNWFTNLWEIKKNEYWGYVTTGGTEGNLHGILVGREQLPD  263

Query  1099  GILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGT  920
             GILY S++SHYS+FK ARMYRM+   ++T+ +GE+D  +L+  +L +K KPAIIN+ IGT
Sbjct  264   GILYTSQDSHYSIFKIARMYRMKCMKVSTLTSGEIDCVNLKDLVLTHKDKPAIINLNIGT  323

Query  919   TFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTIS  740
             T KG +D+LD++I+TLEECG+++D FYIHCD AL G+++PF+K  P+I+FKKPIGSVT+S
Sbjct  324   TMKGAIDDLDLVIQTLEECGFTRDRFYIHCDGALFGMMLPFVKQAPRITFKKPIGSVTVS  383

Query  739   GHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKG  566
             GHKFLGCP+PCGI +TR   I+ +S+NVE IAS DATI+GSR G  PIFLW++L+  G
Sbjct  384   GHKFLGCPIPCGIAITRLEYINALSKNVEIIASRDATITGSRCGHAPIFLWWNLACNG  441


 Score =   259 bits (661),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 166/224 (74%), Gaps = 1/224 (0%)
 Frame = -2

Query  1414  LKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKD  1235
             +K  L    D  + R++  +GYP N  ++ Y TLA L+ +HLNN GDPF+ ++   +S  
Sbjct  1     MKSLLLTMQDCTNDRLSCTLGYPTNQNFN-YDTLASLLHFHLNNAGDPFLGSSFSLNSTR  59

Query  1234  FEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFK  1055
             FEV VLDWFA LWEIEK++YWGY+T GGTEGNLHGIL+GRE  P+GILY S++SHYS+FK
Sbjct  60    FEVCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGILVGREQLPDGILYTSQDSHYSIFK  119

Query  1054  AARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKT  875
              ARMYRM+   ++T+++GE++  DL++ LL +K KPAIIN+ IGTT KGG+D+LD++I+T
Sbjct  120   IARMYRMQCMKVSTLVSGEINCVDLKALLLAHKDKPAIINLNIGTTMKGGVDDLDLVIQT  179

Query  874   LEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTI  743
             L+ECG+++D FYIHCD AL G+++PF++     S       V +
Sbjct  180   LQECGFTRDRFYIHCDGALFGMMLPFVEQGSSFSLNSTTFEVCV  223



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   311 bits (796),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/336 (46%), Positives = 221/336 (66%), Gaps = 7/336 (2%)
 Frame = -2

Query  1327  HYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGT  1148
             +Y+ +   M++HLNN GDP+  +    +S + E  VLD+FA+ W +E +EYWGYIT+ GT
Sbjct  4     NYSDMHETMKFHLNNVGDPYRGSNYRINSMEIEKDVLDFFAKHWHVE-EEYWGYITSSGT  62

Query  1147  EGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKL  968
             EGN+ G+ +GRE  PEGILY SK+SHYS+FK AR++RM+ + +N+  NGEMDY +    +
Sbjct  63    EGNMEGLYIGRERFPEGILYLSKDSHYSIFKIARLFRMKFQVVNSRENGEMDYTEFEQLI  122

Query  967   LLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKN  788
               N G PAIIN  IGTT KG +D++  I + L +      EF+IH D AL G ++P++ N
Sbjct  123   QQNAGVPAIINANIGTTMKGAVDDIGKIAEILTKY---NTEFHIHADGALMGFVLPYIYN  179

Query  787   VPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNG  608
                +SFK+ I S+ ISGHKFLG P PCG+ +T K     I   ++YI SVD TI GSRNG
Sbjct  180   --NLSFKRHINSIAISGHKFLGTPFPCGVFVTEKKFRSLIENRIDYIDSVDDTILGSRNG  237

Query  607   LTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDR  428
               P+FL + ++ K   G ++D  RC+  A  L +R+Q+ GI A +ND SITV+F RP + 
Sbjct  238   HAPLFLKHIITVKQNKGFKEDVFRCLYLAQWLVNRMQSLGIDAWMNDLSITVIFPRPAEI  297

Query  427   DFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLV  320
               ++RWQL+   +++HV+VMP V  E ++ F  + +
Sbjct  298   -VVKRWQLASNGNLSHVVVMPHVTQEMLEVFLKEYL  332



>dbj|BAH97114.1| amino acid decarboxylase [Naegleria fowleri]
Length=307

 Score =   305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 205/307 (67%), Gaps = 23/307 (7%)
 Frame = -2

Query  1300  RYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEI------------EKDEYWGYITN  1157
             RY ++N GDPF+E+    HS+ FE  VL +FA+LW+I              DEYWGY+TN
Sbjct  1     RYGIDNLGDPFVESNYGVHSRAFEQSVLQFFAKLWKIGPCPDEANAQNWSHDEYWGYVTN  60

Query  1156  GGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLR  977
              GTEGNL+GILLGRE  P+ +L +S+ESHYSV KAA++YRM    + T+  GE+DY  L 
Sbjct  61    CGTEGNLYGILLGREQFPDAVLVSSRESHYSVSKAAKLYRMPEIRVPTLYTGEIDYAILE  120

Query  976   SKLLLN-----------KGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHC  830
              +L+ N           K +P ++NV IGTT KG +DNLD I+   +  GY++DEF+IHC
Sbjct  121   KELIRNREETEDLSQGKKKRPVVMNVNIGTTVKGAVDNLDTILDIFKRTGYTEDEFFIHC  180

Query  829   DAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEY  650
             D AL  LI+PF++   +++F KP+GS+++SGHKF+GCPMPCG+ +TRK  +  +  +++Y
Sbjct  181   DGALFALILPFIEEALEVNFTKPVGSISVSGHKFMGCPMPCGVTITRKRYVETLKSHIDY  240

Query  649   IASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVN  470
             + SVD TI GSRNG   ++LW +L  KG  G  KDA++C+  A ++   L+ AG+  ++N
Sbjct  241   LNSVDTTIMGSRNGQASLYLWLTLRKKGTEGFAKDARKCLGNAKYMEQLLRDAGVGCLLN  300

Query  469   DNSITVV  449
              +S T+V
Sbjct  301   PHSNTIV  307



>gb|KFF73912.1| histidine decarboxylase [Chryseobacterium sp. P1-3]
Length=383

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/369 (41%), Positives = 229/369 (62%), Gaps = 4/369 (1%)
 Frame = -2

Query  1423  EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFH  1244
             +AR +  L  F++ I ++  + IGYP    +D Y  L  L +Y + N GDPF+E+    +
Sbjct  2     KAREQKKLINFINVIKEKSTFSIGYPFARDFD-YTELYDLFQYPIANVGDPFIESNYAVN  60

Query  1243  SKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYS  1064
             S + E  V+ +FA L+   KD Y GY+T+GG+EGNL+G+ + RE++PE I+Y S E+HYS
Sbjct  61    SFEIEREVIQFFAGLFRAPKDNYSGYVTSGGSEGNLYGLYIAREIYPEAIVYHSSEAHYS  120

Query  1063  VFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVI  884
             + K  R+  +    I     GEMDY+ L   +  ++  P II   IGTT     D++  I
Sbjct  121   ITKNIRLLNLRSVEIQADSKGEMDYNALEQSIEQHRHLPVIIIANIGTTMTEAKDDIPTI  180

Query  883   IKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCG  704
              + L++C  S + +YIHCDAALSG  +P L++ P+  FK  I S+  SGHKF+G P+PCG
Sbjct  181   RQILKKC--SIESYYIHCDAALSGAYLPLLEDDPRFDFKNGIDSIACSGHKFIGSPVPCG  238

Query  703   IQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVET  524
             I + +K+    + + + YI S D TI+GSRNG +P+FLWY++   GR G+   AQ+ +  
Sbjct  239   IAIVKKNYKERLGQYISYIGSQDTTIAGSRNGHSPVFLWYAVKKLGREGMLLRAQQSLSM  298

Query  523   ATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAI  344
             A +++ RL+   I    N+N+ITVVF +P D+   R+WQL+     AH+I MPG++   I
Sbjct  299   AIYVQRRLEENNIFCFRNENAITVVFSKPDDQ-LCRKWQLATKNGYAHLICMPGISKNII  357

Query  343   DNFFNDLVQ  317
             D+FFNDL++
Sbjct  358   DDFFNDLLK  366



>ref|WP_036288070.1| histidine decarboxylase, partial [Methylocystis sp. ATCC 49242]
Length=376

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 217/360 (60%), Gaps = 4/360 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L +  D +  R    IGYP N  +D Y  L     + LNN GDPF +N    ++ +FE  
Sbjct  21    LDRLHDELQARAATMIGYPTNFCFD-YPELERFHAFSLNNVGDPFDDNLYGLNTHEFERE  79

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+++FA+L+ I+K  YWGY+TNGGTEGN++G+ L RE+ P G++Y S+++HYSV K   +
Sbjct  80    VIEFFAQLYHIQKPNYWGYVTNGGTEGNMYGLYLAREICPNGVVYFSEDTHYSVMKIVHV  139

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               M+   + +  NGEM YDDL   L  N+ KPAI+   IGTT KG +D+L  I   L + 
Sbjct  140   LNMKHIVLRSQENGEMRYDDLSDMLRFNRDKPAILLANIGTTMKGAIDDLGRIRAALHDN  199

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                    YIHCDAAL+G+ +PF+K+ P   F     S+ +SGHKF+G P P G+ + R++
Sbjct  200   AIHH--HYIHCDAALAGMTLPFMKDAPAFDFAAGADSIAVSGHKFIGMPTPSGVVVARRN  257

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  +   +EYI + D TISGSRNGL+ + LW ++   GR G +   + C++   +   R
Sbjct  258   NVERVKSAIEYIGASDTTISGSRNGLSTLMLWRAIHALGRKGFEARVRACLDQTQYALAR  317

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L   G  A  N  S  VV +RPP ++ +R+WQL+   ++AH+I+MP V P  ID F +DL
Sbjct  318   LAGVGWPAWANRCSNIVVLKRPP-QEIVRKWQLAVKDELAHIILMPHVGPAQIDAFVDDL  376



>ref|WP_002682709.1| PLP-dependent enzyme, glutamate decarboxylase [Beggiatoa alba]
 gb|EIJ41099.1| PLP-dependent enzyme, glutamate decarboxylase [Beggiatoa alba 
B18LD]
Length=382

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 231/382 (60%), Gaps = 11/382 (3%)
 Frame = -2

Query  1447  AEPRSKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPF  1268
             AEP     +A + C L  FLD I+  +   +GYP+N   D +  L  L+   L+N G+P+
Sbjct  3     AEPAP---QATIACRLQAFLDHIT-TLPASLGYPLNTQLDVH-LLQDLLSQPLHNVGNPW  57

Query  1267  MENTVDFHSKDFEVGVLDWFAELWEIEKDE-YWGYITNGGTEGNLHGILLGREVHPEGIL  1091
              +++    S  FE  VL   A L+E    E   GYIT+GGTEGNL+G+ L RE +P GIL
Sbjct  58    TDHSRRHPSHVFEREVLQALAVLYEFPNTETVAGYITSGGTEGNLYGLYLAREKYPTGIL  117

Query  1090  YASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFK  911
             Y S ESHYSV K+A + R+  + I T   GE+DY  L + L      PAI+ + IGTT K
Sbjct  118   YFSCESHYSVRKSAHLLRVPFQEIATQAQGELDYQALATAL--QPEHPAILLLNIGTTMK  175

Query  910   GGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHK  731
             G +DNL++++  L+  G    +FYIHCDAAL G+ +PF+      +F+ PI S++ISGHK
Sbjct  176   GAIDNLEMVLSILQAKGI--QDFYIHCDAALFGMTLPFIPQATYPTFRYPIQSLSISGHK  233

Query  730   FLGCPMPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQ  551
             FLG PMPCGI + R  ++ NI+R + YI ++D T+SG RNG TPI LWY+L  KG  GLQ
Sbjct  234   FLGAPMPCGIVLCRPQMVANIARPINYIDTIDTTLSGCRNGHTPIILWYALQLKGYTGLQ  293

Query  550   KDAQRCVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIV  371
              +  +C+  A +L  +LQA       + +SI VV ++PP +  I +WQL+   D AH++V
Sbjct  294   AEVAQCLAHAQYLEQQLQAMHYPCFRHPHSIIVVLKKPP-QVCIEKWQLAVDGDWAHIVV  352

Query  370   MPGVAPEAIDNFFNDLVQERAT  305
             M  V  + +D F  DL    AT
Sbjct  353   MQQVQQKILDQFLTDLRDNLAT  374



>gb|AFK28253.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28255.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28258.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28259.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28263.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28268.1| putative serine decarboxylase, partial [Helianthus deserticola]
 gb|AFK28274.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28275.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28276.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28278.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28280.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28284.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28285.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28286.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28288.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28289.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28290.1| putative serine decarboxylase, partial [Helianthus neglectus]
Length=239

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 189/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28260.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 189/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    P++SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APRVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WYR
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYR  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGRANCLCEL  239



>gb|AFK28264.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28265.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28266.1| putative serine decarboxylase, partial [Helianthus paradoxus]
Length=239

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL  AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTGAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28270.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGETDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>ref|WP_026815498.1| histidine decarboxylase [Armatimonadetes bacterium JGI 0000077-K19]
Length=374

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/363 (42%), Positives = 219/363 (60%), Gaps = 4/363 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L  FL  I +     IGYP +  YDH   LAP MRY LNN GDPF ++    ++ +FE  
Sbjct  12    LAAFLTKIERLTPTFIGYPCSQDYDH-TNLAPFMRYSLNNVGDPFADSIYRENTFEFERD  70

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+ +F      E+   WGY+T GGTEGNL+G+ LGRE+ P+G++Y S+ +HYSV K  R+
Sbjct  71    VVRFFQRHLRAEEGSTWGYVTAGGTEGNLYGLYLGRELFPDGVVYYSEHTHYSVAKIVRV  130

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
                    I    NGEMDYDDL   L L +  P II   IGTT  G +D+L  I + L++ 
Sbjct  131   LGARSIMIRGQDNGEMDYDDLYETLKLRRDVPPIIMANIGTTMHGAVDSLPRISQMLKDL  190

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
               ++   YIH DAALSG+I+P++++     F   I S+ +SGHKF+G PMPCG+ + R+ 
Sbjct  191   AITR--HYIHADAALSGMILPYVEDPQPFGFDAGIDSIAVSGHKFIGAPMPCGVALARRR  248

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  ++R+VEY+  +D TI+GSRN ++P+ +W ++   G  GL++  QR +ETA +   +
Sbjct  249   NVDRVARSVEYVGCMDTTIAGSRNAISPLVMWSAIERWGEDGLRRRVQRSIETADYAIQQ  308

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
                 GI A  + NS+TVVF RP   + I RWQ++  RD+AH+I MP V    +D    D+
Sbjct  309   FAQHGIEAWRHRNSVTVVFPRPGG-EVIDRWQIAPSRDIAHIITMPHVTRAMVDCAVADV  367

Query  322   VQE  314
              Q 
Sbjct  368   AQS  370



>ref|WP_038170807.1| histidine decarboxylase [Verrucomicrobium sp. BvORR106]
Length=395

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 230/386 (60%), Gaps = 12/386 (3%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             S  D  RL   L + L+++  R   +IGYP N  +D +  L P + Y +NN GDPF    
Sbjct  17    SSADRQRLDA-LQERLESLRPR---NIGYPCNQNFD-FEDLFPFLSYSINNVGDPFGSTN  71

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                +++DFE  VL  FA L     D +WGY+T GGTEGN++G+ + RE+ P+GI Y S++
Sbjct  72    YRLNTQDFERDVLAEFARLTHAPVDGWWGYVTAGGTEGNMYGLYVARELFPDGICYFSED  131

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             +HYSV K  R+       + +  NGEMDY DLR  L +++  P II   IGTT KG +DN
Sbjct  132   THYSVAKILRLQHTRNIMLKSQPNGEMDYSDLRETLRIHRDVPPIIFANIGTTMKGAVDN  191

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCP  716
             L  I   L+E   +    Y+H DAALSG+I+PF+ +     F     S+ ISGHKFLG P
Sbjct  192   LHKIRAILDELAITNA--YLHADAALSGMILPFVADPQPWDFAGGADSIAISGHKFLGSP  249

Query  715   MPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQR  536
             +PCG+ + RK  +  ++R++EY+ ++D TI+GSR+ +TP+FLW+ L T    G++    R
Sbjct  250   LPCGVVLARKQHVERVARSIEYVGALDTTIAGSRSAITPLFLWHRLRTLRVEGIKDLVHR  309

Query  535   CVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVA  356
             C+E + +  ++L AAGI A  + NS+TVVF RPP    + +W ++ ++D+ H+IVMP V 
Sbjct  310   CLELSQYAVEKLNAAGIPAWRHKNSVTVVFPRPP-ASVMAKWIIAPMKDIGHMIVMPHVT  368

Query  355   PEAIDNFFNDLVQERATWYREGPQPP  278
                ID F  D     A+  R  P  P
Sbjct  369   QAIIDEFVADF----ASALRPAPVAP  390



>gb|AFK28277.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 189/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++R+ WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRSVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>ref|WP_014680343.1| histidine decarboxylase [Solitalea canadensis]
 ref|YP_006256292.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
 gb|AFD07116.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=388

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/373 (41%), Positives = 225/373 (60%), Gaps = 8/373 (2%)
 Frame = -2

Query  1432  KDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTV  1253
             +DD  RL      ++    +R  + IGYP+   +D Y+ L PL+   LNN GDP +++T 
Sbjct  7     EDDHNRLH----DYMQKAEERAKHFIGYPIARDFD-YSELYPLLSLPLNNVGDPLVDSTY  61

Query  1252  DFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKES  1073
             D +S+  E  VL +FAEL+   ++ +WGY+TNGG+EGNL+G+ + RE+ P GI+Y S+ +
Sbjct  62    DLNSRSLEQEVLAFFAELFNAPENNWWGYVTNGGSEGNLYGLYVARELFPNGIVYYSEAT  121

Query  1072  HYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNL  893
             HYSV K  ++  +    I T  NGEMDY+DLR  L +++ +P I+   IGTT     D+L
Sbjct  122   HYSVQKNIQLLNLRSIVIRTQENGEMDYEDLRQMLQMHRDQPVIMLANIGTTMTEAKDDL  181

Query  892   DVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPM  713
               I K L +        YIHCDAAL+G     LK  P   F     S+ ISGHKF+G P+
Sbjct  182   GEIQKILRDLAIKN--HYIHCDAALAGTYSALLKMKPGFDFTYGADSIAISGHKFIGSPI  239

Query  712   PCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRC  533
             PCG+ + +K+    I R+V YI +VD TI+GSRNG +PIFLWY++   G+ GL+  A  C
Sbjct  240   PCGLVLVKKNYKERIGRSVPYIGTVDTTITGSRNGHSPIFLWYAIKKLGKEGLKHRALTC  299

Query  532   VETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP  353
             +  A +  D+LQA G+ A  N +++T+VF +P  +    RWQ++   + +H+I MPG+  
Sbjct  300   LALAGYAIDQLQAIGVKAWRNPDALTIVFPKPSIK-LRNRWQIATENEWSHIICMPGITK  358

Query  352   EAIDNFFNDLVQE  314
               ID F  +L  +
Sbjct  359   YQIDEFVAELAAD  371



>gb|AFK28273.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+ +RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIGKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28267.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  +  D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKSDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28256.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G+    FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFI-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28281.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28282.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28283.1| putative serine decarboxylase, partial [Helianthus debilis]
Length=239

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++R  WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRGVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28271.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++R  WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRVVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28262.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS D TI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDTTIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28287.1| putative serine decarboxylase, partial [Helianthus bolanderi]
Length=239

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 189/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+V+P +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVVPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28254.1| putative serine decarboxylase, partial [Helianthus argophyllus]
Length=239

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRN 
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNX  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28291.1| putative serine decarboxylase, partial [Helianthus niveus]
Length=239

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI A 
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAT  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDRLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28279.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++    YI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFTGRS-YI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>ref|WP_011533709.1| histidine decarboxylase [Pseudomonas entomophila]
 ref|YP_608112.1| histidine decarboxylase [Pseudomonas entomophila L48]
 sp|Q1IAK7.1|DCHS_PSEE4 RecName: Full=Histidine decarboxylase; Short=HDC [Pseudomonas 
entomophila L48]
 emb|CAK15310.1| Histidine decarboxylase [Pseudomonas entomophila L48]
Length=403

 Score =   298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 235/375 (63%), Gaps = 7/375 (2%)
 Frame = -2

Query  1435  SKDDEARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENT  1256
             S  D+ARL     +F +   +   ++IGYP N  ++ YA L   +R+ +NNCGD      
Sbjct  4     SSADQARLD----QFWEHCLKNQYFNIGYPENADFN-YAQLHRFLRFSINNCGDWAEPGN  58

Query  1255  VDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKE  1076
                +S DFE  V+ +FAEL+ I  +E WGY+TNGGTEGN+ G  L RE+ P G LY SK+
Sbjct  59    YLLNSFDFEKDVMAYFAELFSIPLEESWGYVTNGGTEGNMFGCYLARELFPTGTLYYSKD  118

Query  1075  SHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDN  896
             +HYSV K  ++ R++   + ++ NGE+DYDDL +K+  ++ +  II V +GTT +G +DN
Sbjct  119   THYSVAKIVKLLRIDCRAVESLPNGEIDYDDLMAKIAADQEQHPIIFVNVGTTMRGAIDN  178

Query  895   LDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCP  716
             +  I + LEE G  ++++Y+H DAALSG+I+PF+ N    +F   + S+ +SGHK +G P
Sbjct  179   IATIQQRLEEVGIPREDYYLHADAALSGMILPFVDNPQPFNFADGVDSICVSGHKMIGSP  238

Query  715   MPCGIQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQR  536
             +PCGI + ++  +  IS +V+YI + D TISGSRNG TP+ +W +L +   A  ++  + 
Sbjct  239   IPCGIVVAKRENVERISVDVDYIRANDKTISGSRNGHTPMMMWAALRSHSPAQWRRRVRH  298

Query  535   CVETATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVA  356
              + +A +  DRLQAAGI A  +DNSITVVF  P  R   R++ L+   D AH+I  P   
Sbjct  299   SLNSAQYAVDRLQAAGIDAWRHDNSITVVFPCPSSR-IARKYCLATSGDTAHLITTPHHQ  357

Query  355   PEA-IDNFFNDLVQE  314
              ++ ID   ++++ E
Sbjct  358   DKSMIDALIDEVIAE  372



>gb|AFK28272.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 186/262 (71%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQTTRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI A 
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAT  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++ HV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNITHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28257.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 187/262 (71%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE  ++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESEFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+ +++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNEFIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28269.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 188/262 (72%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL GL++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGLMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV+VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PP +  D+G  NC C L
Sbjct  218   DGKRKPPRVASDIGQANCLCEL  239



>gb|AFK28261.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 187/262 (71%), Gaps = 24/262 (9%)
 Frame = -2

Query  1015  TMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYI  836
             T+I+GE+D +D R+KL L+K KPAIIN                   TLEE G++   FYI
Sbjct  1     TLISGEIDCEDFRAKLSLHKDKPAIIN-------------------TLEESGFT-GRFYI  40

Query  835   HCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNV  656
             HCD AL G ++PF    PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +SRNV
Sbjct  41    HCDGALFGPMMPF---APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNV  97

Query  655   EYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAM  476
             EY+AS DATI GSRNG  P+FLWY+L+ KG  G QK+ Q+C+  A +LR RL +AGI AM
Sbjct  98    EYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAM  157

Query  475   VNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATWYR  296
             +N+ S TVVFERP D +F R+WQL+C  ++AHV VMP +  + +D+F N+L+++RA WY+
Sbjct  158   LNELSSTVVFERPQDEEFTRKWQLACQGNIAHVAVMPNITIDKLDDFVNELIEKRAVWYK  217

Query  295   EGP-QPPCLEDDLGSHNCYCPL  233
             +G  +PPC+  D+G  NC C L
Sbjct  218   DGKRKPPCVASDIGQANCLCEL  239



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 223/366 (61%), Gaps = 4/366 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L +   +I       +GYPV+  +D Y+ L P +++ LNN GDPF E+T    S+  E  
Sbjct  11    LEELYHSIKSTTQNFLGYPVSKDFD-YSELMPFLQFPLNNLGDPFSESTYRVDSRAMERE  69

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+++FA L+   +++ WGY+TNGG+EGNL+ + + RE+HP+G++Y S+ +HYS+ K   +
Sbjct  70    VVNFFARLFRAHENDIWGYVTNGGSEGNLYSLYVARELHPKGMVYFSEATHYSIQKNVTL  129

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    + ++ NGEMDYDDL+  +  N+ +PAI+   IGTT     DN   I   LE+ 
Sbjct  130   LNINYVIVKSLPNGEMDYDDLKEAIGYNRHRPAIVVANIGTTMTEAKDNTKKIKGILEDM  189

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                 ++ YIH DAAL+G   PF+   P+  F+  I S++ISGHKF+G PMP G+ + +K 
Sbjct  190   AI--EKHYIHADAALAGGFAPFVTPRPQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKD  247

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I+R + YI S DATI+GSRNG TP+FLWY++   G  G +K  +  +  A++  ++
Sbjct  248   NRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENK  307

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L+  GI A  N N+IT+VF   P  + I +WQL+     +H+I MP V+ E ID+F  D+
Sbjct  308   LKDLGIEAWRNPNAITIVFP-APSTEIIDKWQLATENGQSHIICMPNVSYEQIDSFIADI  366

Query  322   VQERAT  305
               E  T
Sbjct  367   EVEMCT  372



>ref|WP_014680621.1| histidine decarboxylase [Solitalea canadensis]
 ref|YP_006256570.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
 gb|AFD07394.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=376

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 223/365 (61%), Gaps = 10/365 (3%)
 Frame = -2

Query  1390  LDTISQRINYH----IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L+ + Q+I  +    +GYPV+  +D Y+ L  L++Y +NN GDPF + T    S++ E  
Sbjct  12    LEALRQKIKENSQNSLGYPVSKDFD-YSELFELLKYPVNNIGDPFADCTYSVDSREMERE  70

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VL++FAE++  +K+++WGY+TNGG+EGN++G+ + RE+HP+G++Y S  +HYSV K   +
Sbjct  71    VLEFFAEVFRAQKNDWWGYVTNGGSEGNMYGLYMARELHPKGMVYYSAATHYSVHKNLHL  130

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               M    I    NGE+DY+DL + + +N+  P II   IGTT     D++  I   L + 
Sbjct  131   LDMPNIVIRAQKNGEIDYEDLSNTIRMNRHMPVIIMANIGTTMTEAKDDITKIKAILNDA  190

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                   +YIHCD ALSG + PFL   P   F     S+ ISGHKF+G P+P G+ + +KS
Sbjct  191   AIQN--YYIHCDGALSGTMSPFLNPRPAFDFADGADSIAISGHKFIGSPIPSGVLLVKKS  248

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I R+V YI S+D TI+GSRNG +P+FLWY++ T G  G +K     +  A +  +R
Sbjct  249   HRDRIGRSVAYIGSLDTTITGSRNGHSPLFLWYAIKTLGLEGFKKRVDHSLSVAAYAENR  308

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             L++ G+ A  N N+ITVVF +P   + +R +WQL+  R ++H+I MP V    ID    D
Sbjct  309   LKSIGLDAWRNQNAITVVFPQP--HEIVRKKWQLASERGLSHIICMPNVTESQIDELILD  366

Query  325   LVQER  311
             + + R
Sbjct  367   IEKYR  371



>dbj|GAL64497.1| histidine decarboxylase [Algibacter lectus]
Length=377

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/352 (43%), Positives = 218/352 (62%), Gaps = 6/352 (2%)
 Frame = -2

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             +GYPV   +D Y+ L   ++Y +NN GDPF ENT    + + E  V+++FAEL+  +   
Sbjct  24    LGYPVAQDFD-YSRLNEFLKYPINNVGDPFEENTYKVQTHEMECEVVEFFAELFRADPKN  82

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             +WGY+TNGG+E NL+G+ L RE++P+ ++Y S+ +HYSV K   +  +    I +  NGE
Sbjct  83    HWGYVTNGGSESNLYGLYLARELYPKAMVYFSESTHYSVKKNIHLLNIPSITIRSQENGE  142

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             +DY+DL + L  N+ KPAII  T GTT     D++  + K L++    QD  YIHCDAAL
Sbjct  143   IDYEDLENTLQFNRHKPAIILTTFGTTMMEAKDDVSKVKKILKKLAI-QDH-YIHCDAAL  200

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             SG    F++      FK    S++ISGHKF+G P P G+ +T++SL   I+R + YI S+
Sbjct  201   SGSYGAFIEPRIPFDFKDGADSISISGHKFIGSPFPSGVIITKRSLRDRIARGISYIGSL  260

Query  637   DATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDNSI  458
             D TI+GSRNG +P+FLWY++   G  GL K  Q  +ETA + ++ L   GI A  N  SI
Sbjct  261   DTTITGSRNGHSPLFLWYAIKKMGIEGLAKRFQHSLETAEYCKNELIKQGIKAWTNPGSI  320

Query  457   TVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERAT  305
             TVVF  P   D I+ +WQL+   D+ H+I MP V    ID F  D+V E++T
Sbjct  321   TVVF--PKVSDAIKGKWQLATDDDITHIICMPNVTKSQIDEFVKDIVLEKST  370



>ref|WP_033002296.1| histidine decarboxylase, partial [Vibrio campbellii]
Length=376

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/378 (41%), Positives = 227/378 (60%), Gaps = 6/378 (2%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L +F+  I+ +    +GYP++  +D Y  L  L+ Y LNN GDPF ++T    S++FE  
Sbjct  1     LDRFIQDINDKSTSFMGYPISTDFD-YQQLTELINYPLNNLGDPFAKSTWQVDSREFECE  59

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+++FA+L+   +D++WGY+TNG TE NL+ + L RE++P+GI Y SKE+HYSV K   +
Sbjct  60    VIEFFAKLFRAPEDDWWGYVTNGSTEANLYALYLARELYPKGICYFSKETHYSVAKNLHL  119

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               M    I +   G +DYDDLR KL  N+  PAII    GTT     D++  I   LEE 
Sbjct  120   LNMPHIMIQSDDKGVIDYDDLREKLEDNQDLPAIIFSNSGTTMTEAKDDIKKIRIILEEL  179

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
               S++  YIH D+AL G I PFL   P   F+    SV++SGHKF+G P+PCG+ + RKS
Sbjct  180   SISKN--YIHSDSALCGAINPFLTPRPSFDFEDGADSVSLSGHKFIGSPVPCGVIIARKS  237

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
              +  I+R++ YI  +D TISGSRNG TP+ LW++++  G  G++K     +  A +   +
Sbjct  238   NVDRIARSIAYIGCLDTTISGSRNGFTPMVLWHAINCLGIDGIKKRVFHSLSIAEYTEKK  297

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             L+  GI A  N NSITVVF  P   +FI+ ++QL+      H+I MP +    IDNF  +
Sbjct  298   LKNIGIKAWRNPNSITVVF--PEVSEFIKNKYQLATANGQTHIICMPNMKTSDIDNFILE  355

Query  325   LVQERATWYREGPQPPCL  272
             L +     +R+    PCL
Sbjct  356   LHKNIKNTFRDEMSTPCL  373



>ref|WP_028889574.1| histidine decarboxylase [Tenacibaculum ovolyticum]
Length=371

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 221/363 (61%), Gaps = 4/363 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             + +  + IS+  N  +GYP+   +  Y   AP +   +NN GDP  ++T+   +KD E  
Sbjct  4     IDQIYNRISENTNTFLGYPLAKDFS-YKEFAPFLDLCINNVGDPESDSTLAIDTKDQERE  62

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
              + +FA++      E WGY+TNGGTEGNL+G+ L RE +P+ ++Y S+ +HYSV K   +
Sbjct  63    CISFFADILSSNTKETWGYVTNGGTEGNLYGLYLARESYPDAVVYYSESTHYSVKKNLHL  122

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    + +  NGEMDYDDL   L+L + KPAI  + IGTT    +D LD + + +++ 
Sbjct  123   LNINNIVVRSQDNGEMDYDDLEQILMLRRDKPAIFFLNIGTTMTEAVDKLDEVKRIIKK-  181

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
              Y+  ++YIHCDAA  G I PF+   PK  F + + S+ ISGHKF+G P+PCGI M ++ 
Sbjct  182   -YAIKDYYIHCDAAFLGTIAPFVTPKPKFDFAEGVDSIAISGHKFIGGPIPCGIVMVKRK  240

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I+ +V Y+ ++D TI+GSRNGLTP+FLW  +   G+ GL+   +   E A +L   
Sbjct  241   HRDRIANSVSYVGTLDTTITGSRNGLTPLFLWAFIKKHGKEGLKNRVKESQELAAYLEVE  300

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L   G+ A  N+ ++TVV E+P  ++  +++QL+   ++AHVI MPG+  E ++ F  DL
Sbjct  301   LNKIGVKAWRNNEALTVVLEKPS-KEICKKYQLASEENIAHVICMPGIKKEQLNIFLEDL  359

Query  322   VQE  314
              +E
Sbjct  360   KKE  362



>ref|WP_025146293.1| histidine decarboxylase [Sphingobacterium sp. H1ai]
Length=377

 Score =   291 bits (745),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 221/370 (60%), Gaps = 4/370 (1%)
 Frame = -2

Query  1423  EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFH  1244
             +A+ +  L   L+ +  +    +GYPV+  +D Y  LA  ++Y +NN GDPF+ +T    
Sbjct  7     QAKDQEVLNDLLEKVKVQTELFLGYPVSKDFD-YQALADFLKYPMNNLGDPFVTSTYGVG  65

Query  1243  SKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYS  1064
             S++ E  V+ +FAEL+    D +WGY+TNGG+EGNL+G+ L RE+HP+G++Y S+ +HYS
Sbjct  66    SRELEKEVVQFFAELFRAPADNWWGYVTNGGSEGNLYGLYLARELHPKGMVYYSEATHYS  125

Query  1063  VFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVI  884
             V K   +  M    I T  NGE+DY+DL   + +N+  P II   IGTT     D++  I
Sbjct  126   VQKNLHLLNMGNIVIRTQENGEIDYEDLEHTIRMNRHMPVIIMANIGTTMTEARDDVAKI  185

Query  883   IKTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCG  704
                L+        +YIH DAALSG     ++  P   F+    S+ ISGHKF G PMPCG
Sbjct  186   KTILKRLAIQH--YYIHADAALSGTYSALIEPRPAFDFEDGADSIAISGHKFFGSPMPCG  243

Query  703   IQMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVET  524
             + + +KS    I+R+V YI SVD TI+GSRNG +P+FLW+++   G AGL+  A   + T
Sbjct  244   VVVAKKSNRDRIARSVAYIGSVDTTITGSRNGHSPLFLWHTIKRLGLAGLKARAMYSLAT  303

Query  523   ATHLRDRLQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAI  344
             A +  ++L+  GI+A  N N+ITV F   P     ++WQL+  +  +H+I MP V+   I
Sbjct  304   AAYTEEKLKEMGIAAWRNPNAITVNFP-TPSAPICKKWQLAAEQGNSHIICMPNVSEAHI  362

Query  343   DNFFNDLVQE  314
             + F NDL  E
Sbjct  363   NLFINDLKAE  372



>ref|WP_013663956.1| histidine decarboxylase [Sphingobacterium sp. 21]
 ref|YP_004315898.1| histidine decarboxylase [Sphingobacterium sp. 21]
 gb|ADZ77228.1| Histidine decarboxylase [Sphingobacterium sp. 21]
Length=380

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 216/363 (60%), Gaps = 4/363 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L  ++    +R  Y +GYP+   +D Y+ L PL++  LNN GDP +E+T D +S+  E  
Sbjct  11    LTNYMQRAEERAAYFLGYPIARDFD-YSDLYPLLKLPLNNIGDPLVESTYDLNSRSLEQE  69

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             VL +FA+L+    D +WGY+TNGG+EGNL+G+ + RE++P GI+Y S+ +HYSV K  ++
Sbjct  70    VLAFFADLFRAPADNWWGYVTNGGSEGNLYGLYVARELYPNGIVYYSEATHYSVQKNIQL  129

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    I T   GEMDY DL   L +++ +PAII   IGTT     D+L  I   L   
Sbjct  130   LNLRSIVIRTDERGEMDYSDLAQMLHMHRDQPAIIFANIGTTMTEAKDDLVEIKSRLRMA  189

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                   +YIHCDAAL+G+    L   P   F     S+ ISGHKF+G P+PCG+ + +++
Sbjct  190   AIKN--YYIHCDAALAGVYSALLNLKPGFDFGYGADSLAISGHKFIGSPIPCGLVLVKRN  247

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I + + YI +VD TI+GSRNG +P FLWY++   GR GLQ+ A   +  AT+L  +
Sbjct  248   YKERIGKAIPYIGTVDTTITGSRNGHSPAFLWYAIKKLGREGLQRRAAESLTMATYLESQ  307

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L   GI A  N ++ITVVF   P +   ++WQL+     +HV+ MPGV    +D F  D+
Sbjct  308   LLDRGIQAWRNPSAITVVFPE-PSKHLRQKWQLATENGCSHVVCMPGVEKTQLDEFLKDM  366

Query  322   VQE  314
              ++
Sbjct  367   QED  369



>ref|XP_003593130.1| Histidine decarboxylase [Medicago truncatula]
Length=311

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 179/236 (76%), Gaps = 9/236 (4%)
 Frame = -2

Query  1468  KNMHIT---VAEPRSKDD-----EARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATL  1313
             +N+H T   V EP + D+     +A +   L ++  ++++R  YH+GYP N+ +D Y  L
Sbjct  65    RNIHTTCLEVTEPEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFD-YGAL  123

Query  1312  APLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLH  1133
             + L  + +NN GDPF+E+    HS+ FEVGVLDWFA LWE+EK+EYWGYITN GTEGNLH
Sbjct  124   SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLH  183

Query  1132  GILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKG  953
             GIL+GREV P+GILYAS+ESHYS+FKAARMYRME E + T+ +GE+D DD ++KLL ++ 
Sbjct  184   GILVGREVLPDGILYASRESHYSIFKAARMYRMECEKVETLNSGEIDCDDFKAKLLRHQD  243

Query  952   KPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAALSGLIVPFLKNV  785
             KPAIINV IGTT KG +D+LD++I+ LEE G+SQD FYIH D AL GL++PF+K V
Sbjct  244   KPAIINVNIGTTVKGAVDDLDLVIQKLEEAGFSQDRFYIHVDGALFGLMMPFVKRV  299



>ref|WP_034760693.1| histidine decarboxylase [Chryseobacterium sp. OV259]
Length=376

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/369 (41%), Positives = 221/369 (60%), Gaps = 6/369 (2%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L   L  I +     +GYPV+  +D Y+ L P   Y +NN GDPF ++T    + + E  
Sbjct  12    LDHLLQKIEKASELFLGYPVSKDFD-YSELYPFFNYPINNLGDPFEDSTYKVQTHEMERE  70

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+D+FAEL+     +YWGY+TNGG+E NL+G+ + RE+ P+ ++Y S+ +HYSV K   +
Sbjct  71    VVDFFAELFRANPKDYWGYVTNGGSESNLYGLYIARELFPKAMVYFSESTHYSVKKNIHL  130

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    I    NGE+DY+DL + L  N+ KPAI+  T GTT K   D++  + K  ++ 
Sbjct  131   LNIPSIVIRAQENGEIDYEDLENTLQFNRHKPAIVLTTFGTTMKEAKDDVSKVKKIFKKL  190

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                QD  YIHCDAALSG    F++      FK    S++ISGHKF+G P+P G+ +T+++
Sbjct  191   AI-QDH-YIHCDAALSGSYGAFMEPRSPFDFKDGADSISISGHKFIGSPIPSGVIITKRT  248

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
             L   I++ V YI S+D TI+GSRNG + +FLWY++   G  GL+K     +E A + + +
Sbjct  249   LRDKIAKGVSYIGSLDTTITGSRNGHSSLFLWYAVKNMGIEGLKKRYLHSMEVAQYCKSK  308

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAIDNFFND  326
             L   GI A  N+ +ITVVF  P   D I+ +WQL+   D+ H+I MP V  E ID F  D
Sbjct  309   LIELGIEAWTNEGAITVVF--PKTSDAIKEKWQLATEEDLTHLICMPNVTKEQIDEFIKD  366

Query  325   LVQERATWY  299
             LV+++   Y
Sbjct  367   LVKDKEVIY  375



>ref|WP_034238501.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=373

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 223/366 (61%), Gaps = 4/366 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L +   +I       +GYPV+  +D Y+ L P +++ LNN GDPF E+T    S+  E  
Sbjct  11    LEELYHSIKSTTQNFLGYPVSKDFD-YSELMPFLQFPLNNLGDPFSESTYRVDSRAMERE  69

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+++FA L+   +++ WGY+TNGG+EGNL+ + + RE++P+G++Y S+ +HYS+ K   +
Sbjct  70    VVNFFAGLFRAHENDIWGYVTNGGSEGNLYSLYVARELYPKGMVYFSEATHYSIQKNVTL  129

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    + ++ NGEMDY+DL+  +  N+ +PAI+   IGTT     DN   I   LE+ 
Sbjct  130   LNINYVIVKSLPNGEMDYNDLKEAIGYNRHRPAIVVANIGTTMTEAKDNTKKIKGILEDM  189

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                 ++ YIH DAAL+G   PF+   P+  F+  I S++ISGHKF+G PMP G+ + +K 
Sbjct  190   AI--EKHYIHADAALAGGFAPFVTPRPQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKD  247

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I+R + YI S DATI+GSRNG TP+FLWY++   G  G +K  +  +  A++  ++
Sbjct  248   NRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENK  307

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L+  GI A  N N+IT+VF   P  + I +WQL+     +H+I MP V+ E IDNF  D+
Sbjct  308   LKNLGIEAWRNPNAITIVFP-APSTEIIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  366

Query  322   VQERAT  305
               E  T
Sbjct  367   EVEMCT  372



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/366 (40%), Positives = 223/366 (61%), Gaps = 4/366 (1%)
 Frame = -2

Query  1402  LGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVG  1223
             L +   +I       +GYPV+  +D Y+ L P +++ LNN GDPF E+T    S+  E  
Sbjct  15    LEELYHSIKSTTQNFLGYPVSKDFD-YSELMPFLQFPLNNLGDPFSESTYRVDSRAMERE  73

Query  1222  VLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARM  1043
             V+++FA L+   +++ WGY+TNGG+EGNL+ + + RE++P+G++Y S+ +HYS+ K   +
Sbjct  74    VVNFFAGLFRAHENDIWGYVTNGGSEGNLYSLYVARELYPKGMVYFSEATHYSIQKNVTL  133

Query  1042  YRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEEC  863
               +    + ++ NGEMDY+DL+  +  N+ +PAI+   IGTT     DN   I   LE+ 
Sbjct  134   LNINYVIVKSLPNGEMDYNDLKEAIGYNRHRPAIVVANIGTTMTEAKDNTKKIKGILEDM  193

Query  862   GYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKS  683
                 ++ YIH DAAL+G   PF+   P+  F+  I S++ISGHKF+G PMP G+ + +K 
Sbjct  194   AI--EKHYIHADAALAGGFAPFVTPRPQFDFEDGIDSISISGHKFIGSPMPSGVVIVKKD  251

Query  682   LIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDR  503
                 I+R + YI S DATI+GSRNG TP+FLWY++   G  G +K  +  +  A++  ++
Sbjct  252   NRDRIARRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENK  311

Query  502   LQAAGISAMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDL  323
             L+  GI A  N N+IT+VF   P  + I +WQL+     +H+I MP V+ E IDNF  D+
Sbjct  312   LKNLGIEAWRNPNAITIVFP-APSTEIIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  370

Query  322   VQERAT  305
               E  T
Sbjct  371   EVEMCT  376



>ref|WP_036985757.1| histidine decarboxylase, partial [Pseudomonas mosselii]
Length=378

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 217/351 (62%), Gaps = 3/351 (1%)
 Frame = -2

Query  1363  YHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEK  1184
             +++GYP +  +D Y+ L   MR+ +NNCGD    +    +S DFE  V+ +FAEL+ I  
Sbjct  24    FNVGYPESADFD-YSLLHRFMRFSINNCGDWNEPSNYLLNSFDFEREVMRFFAELFHIPF  82

Query  1183  DEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMIN  1004
             ++ WGY+TNGGTEGN+ G  L RE+ P+  LY SK++HYSV K  R+ R++ + + +  N
Sbjct  83    EDSWGYVTNGGTEGNMFGCYLARELFPDATLYYSKDTHYSVAKIVRLLRIKAQVVESQAN  142

Query  1003  GEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDA  824
             GEMDYDDL +++  +  +  II   IGTT +G  DN+  I + L + G  ++++Y+H DA
Sbjct  143   GEMDYDDLVARITADGERHPIIFANIGTTLRGATDNIATIQQRLAQAGIRREDYYLHADA  202

Query  823   ALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIA  644
             ALSG+I+PF+ N    SF   I S+ +SGHK +G PMPCGI + R+  +  IS  ++YI+
Sbjct  203   ALSGMILPFVDNPEPYSFADGIDSICVSGHKMIGSPMPCGIVVARRHNVERISVEIDYIS  262

Query  643   SVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDN  464
             + D TISGSRNG TP+ +W +L ++ R       QRC++ A H  DRL+AAGI A  N N
Sbjct  263   ARDQTISGSRNGHTPLMMWAALCSRSREDWSARIQRCLDLAQHAVDRLRAAGIEAWRNPN  322

Query  463   SITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEA-IDNFFNDLVQE  314
             SITVVF   P     +R  L+   D AH+I          ID   ++L+ +
Sbjct  323   SITVVFP-CPSASVWKRHCLATSGDTAHLITTAHHQDSTQIDALLDELIAD  372



>ref|WP_038863593.1| histidine decarboxylase [Vibrio campbellii]
Length=386

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/384 (41%), Positives = 228/384 (59%), Gaps = 6/384 (2%)
 Frame = -2

Query  1420  ARLKCTLGKFLDTISQRINYHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHS  1241
             A+ +  L +F+  I+ +    +GYP++  +D Y  L  L+ Y LNN GDPF ++T    S
Sbjct  5     AQKQLKLDRFIQDINDKSTSFMGYPISTDFD-YQQLTELINYPLNNLGDPFAKSTWQVDS  63

Query  1240  KDFEVGVLDWFAELWEIEKDEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSV  1061
             ++FE  V+++FA+L+   +D++WGY+TNG TE NL+ + L RE++P+GI Y SKE+HYSV
Sbjct  64    REFECEVIEFFAKLFRAPEDDWWGYVTNGSTEANLYALYLARELYPKGICYFSKETHYSV  123

Query  1060  FKAARMYRMEVEGINTMINGEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVII  881
              K   +  M    I +   G +DYDDLR KL  N+  PAII    GTT     D++  I 
Sbjct  124   AKNLHLLNMPHIMIQSDDKGVIDYDDLREKLEDNQDLPAIIFSNSGTTMTEAKDDIKKIR  183

Query  880   KTLEECGYSQDEFYIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGI  701
               LEE   S++  YIH D+AL G I PFL   P   F+    SV++SGHKF+G P+PCG+
Sbjct  184   IILEELSISKN--YIHSDSALCGAINPFLTPRPSFDFEDGADSVSLSGHKFIGSPVPCGV  241

Query  700   QMTRKSLIHNISRNVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETA  521
              + RKS +  I+R++ YI  +D TISGSRNG TP+ LW++++  G  G++K     +  A
Sbjct  242   IIARKSNVDRIARSIAYIGCLDTTISGSRNGFTPMVLWHAINCLGIDGIKKRVFHSLSIA  301

Query  520   THLRDRLQAAGISAMVNDNSITVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAI  344
              +   +L+  GI A  N NSITVVF  P   +FI+ ++QL+      H+I MP +    I
Sbjct  302   EYTEKKLKKIGIKAWRNPNSITVVF--PEVSEFIKNKYQLATANGQTHIICMPNMKTSDI  359

Query  343   DNFFNDLVQERATWYREGPQPPCL  272
             DNF  +L +     +      PCL
Sbjct  360   DNFILELHKNIKNTFSGEMSTPCL  383



>dbj|GAL81626.1| histidine decarboxylase [Algibacter lectus]
Length=378

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 219/353 (62%), Gaps = 7/353 (2%)
 Frame = -2

Query  1357  IGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEKDE  1178
             +GYPV   +D Y+ L   ++Y +NN GDPF ENT    + + E  V+++FAEL+  +   
Sbjct  24    LGYPVAQDFD-YSRLNEFLKYPINNVGDPFEENTYKVQTHEMECEVVEFFAELFRADPKN  82

Query  1177  YWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMINGE  998
             +WGY+TNGG+E NL+G+ L RE++P+ ++Y S+ +HYSV K   +  +    I +  NGE
Sbjct  83    HWGYVTNGGSESNLYGLYLARELYPKAMVYFSESTHYSVKKNIHLLNIPSITIRSQENGE  142

Query  997   MDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDAAL  818
             +DY+DL + L  N+ KPAII  T GTT     D++  + K L++    QD  YIHCDAAL
Sbjct  143   IDYEDLENTLQFNRHKPAIILTTFGTTMMEAKDDVSKVKKILKKLAI-QDH-YIHCDAAL  200

Query  817   SGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIASV  638
             SG    F++      FK    S++ISGHKF+G P P G+ +T++SL   I+R + YI S+
Sbjct  201   SGSYGAFIEPRIPFDFKDGADSISISGHKFIGSPFPSGVIITKRSLRDRIARGISYIGSL  260

Query  637   DATISGSRNGLTPIFLWYSLSTKGR-AGLQKDAQRCVETATHLRDRLQAAGISAMVNDNS  461
             D TI+GSRNG +P+FLWY++   G  AGL K  Q  +ETA + ++ L   GI A  N  S
Sbjct  261   DTTITGSRNGHSPLFLWYAIKKMGGIAGLAKRFQHSLETAEYCKNELIKQGIKAWTNPGS  320

Query  460   ITVVFERPPDRDFIR-RWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERAT  305
             ITVVF  P   D I+ +WQL+   D+ H+I MP V    ID F  D+V E++T
Sbjct  321   ITVVF--PKVSDAIKGKWQLATDDDITHIICMPNVTKSQIDEFVKDIVLEKST  371



>gb|AIS17429.1| histidine decarboxylase [Pseudomonas rhizosphaerae]
Length=408

 Score =   290 bits (742),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/351 (41%), Positives = 223/351 (64%), Gaps = 3/351 (1%)
 Frame = -2

Query  1363  YHIGYPVNIVYDHYATLAPLMRYHLNNCGDPFMENTVDFHSKDFEVGVLDWFAELWEIEK  1184
             ++IGYP N  +D Y+ L   +R+ +NNCGD    +    +S DFE  V+ +FA+L+EI +
Sbjct  24    FNIGYPENADFD-YSALERFLRFSINNCGDWSEHSNYVLNSFDFEKEVMAYFADLFEIPR  82

Query  1183  DEYWGYITNGGTEGNLHGILLGREVHPEGILYASKESHYSVFKAARMYRMEVEGINTMIN  1004
             ++ WGY+TNGGTEGN+ G  L RE+ P+G LY SK++HYSV K  ++ R++   +N +  
Sbjct  83    EDSWGYVTNGGTEGNMFGCYLARELFPDGTLYYSKDTHYSVAKIVKLLRIKCRAVNALPT  142

Query  1003  GEMDYDDLRSKLLLNKGKPAIINVTIGTTFKGGMDNLDVIIKTLEECGYSQDEFYIHCDA  824
             GE+DYDDL +K+  +  +  II   IGTT +G +D++ VI + L++ G ++ ++Y+H DA
Sbjct  143   GEIDYDDLLAKIAADGERHPIIFANIGTTMRGAVDDIAVIQQRLQDAGIARRDYYLHADA  202

Query  823   ALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISRNVEYIA  644
             ALSG+I+PF+      +F   I S+ +SGHK +G P+PCGI + ++  +  IS  V+YI+
Sbjct  203   ALSGMILPFVDAPQPFTFADGIDSICVSGHKMIGSPIPCGIVVAKRRNVARISVEVDYIS  262

Query  643   SVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGISAMVNDN  464
             + D TISGSRNG TP+ +W +L +   A  ++  +R +  A +  +RLQA G+ A  N N
Sbjct  263   ASDKTISGSRNGHTPMIMWAALRSHSSAQWRRRVERSLAAAQYAVNRLQAGGVKAWRNPN  322

Query  463   SITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAP-EAIDNFFNDLVQE  314
             SITVVF   P  D  R++ L+   D AH+I  P      AID   ++++ +
Sbjct  323   SITVVFP-CPSADIARKYGLATSGDTAHLITTPHHRDNRAIDALIDEVIAD  372



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  841  YIHCDAALSGLIVPFLKNVPKISFKKPIGSVTISGHKFLGCPMPCGIQMTRKSLIHNISR  662
            YIHCD AL GL++PF+K  PK+SFKKPIGSV++SGHKF+GCPMPCG+Q+TR   I+ +S 
Sbjct  1    YIHCDGALFGLMIPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSS  60

Query  661  NVEYIASVDATISGSRNGLTPIFLWYSLSTKGRAGLQKDAQRCVETATHLRDRLQAAGIS  482
            NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+ Q+C+  A +L+DRL+ AGI 
Sbjct  61   NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIG  120

Query  481  AMVNDNSITVVFERPPDRDFIRRWQLSCVRDMAHVIVMPGVAPEAIDNFFNDLVQERATW  302
            AM+N+ S TVVFERP D +F+RRWQL+C  ++AHV+VMP V  + +D F N+L ++RATW
Sbjct  121  AMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATW  180

Query  301  YREGP-QPPCLEDDLGSHNCYCPLHK  227
            Y++G  QPPCL  D+G  NC C +HK
Sbjct  181  YQDGSCQPPCLAKDVGEENCLCSIHK  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5156615493492