BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22489_g2_i1 len=361 path=[1:0-106 108:107-114 116:115-142
144:143-176 178:177-214 216:215-236 238:237-360]

Length=361
                                                                      Score     E

emb|CDP18638.1|  unnamed protein product                                108   2e-25   
emb|CDP18639.1|  unnamed protein product                                107   2e-25   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    107   3e-25   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    105   2e-24   
gb|AAK27968.1|AF242372_1  cysteine protease                             105   2e-24   Ipomoea batatas [batate]
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                105   2e-24   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                105   2e-24   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                104   4e-24   
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        103   8e-24   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    103   9e-24   
gb|AAL14199.1|  cysteine proteinase precursor                           102   1e-23   Ipomoea batatas [batate]
emb|CDP18644.1|  unnamed protein product                                102   1e-23   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    102   1e-23   
emb|CDP18645.1|  unnamed protein product                                102   3e-23   
emb|CDP20741.1|  unnamed protein product                              99.0    3e-23   
dbj|BAD29959.1|  cysteine protease                                      101   4e-23   Daucus carota [carrots]
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like      98.6    7e-23   
ref|XP_004506025.1|  PREDICTED: vignain-like                            100   9e-23   
ref|XP_009609440.1|  PREDICTED: ananain-like                          97.8    1e-22   
ref|XP_008811650.1|  PREDICTED: vignain-like                            100   1e-22   
ref|NP_001275606.1|  fruit bromelain-like precursor                     100   1e-22   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                       99.8    1e-22   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  99.8    2e-22   
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                  99.8    2e-22   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg           99.8    2e-22   
dbj|BAF46311.1|  cysteine proteinase precursor                        99.8    2e-22   Ipomoea nil [qian niu]
gb|AFW76903.1|  hypothetical protein ZEAMMB73_202256                  96.7    2e-22   
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                      99.0    3e-22   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...  98.6    4e-22   
gb|AFP73348.1|  cysteine protease                                     98.6    4e-22   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  98.6    4e-22   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...  98.6    4e-22   
emb|CDP18641.1|  unnamed protein product                              98.6    4e-22   
gb|AHA62776.1|  papain-like cysteine protease                         98.6    5e-22   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like            98.2    5e-22   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                 98.2    6e-22   
gb|AHA62772.1|  papain-like cysteine protease                         98.2    7e-22   
ref|XP_006362436.1|  PREDICTED: vignain-like                          98.2    7e-22   
ref|XP_009606934.1|  PREDICTED: zingipain-2                           97.8    7e-22   
gb|AHA62773.1|  papain-like cysteine protease                         97.8    9e-22   
ref|NP_001066557.2|  Os12g0273800                                     96.3    9e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AHA62774.1|  papain-like cysteine protease                         97.4    1e-21   
ref|XP_002522560.1|  cysteine protease, putative                      94.7    1e-21   Ricinus communis
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like      97.4    1e-21   
gb|EAY97106.1|  hypothetical protein OsI_19029                        97.4    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004234254.1|  PREDICTED: zingipain-2-like                      97.4    1e-21   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg           97.4    1e-21   
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg           97.4    1e-21   
ref|XP_002525123.1|  cysteine protease, putative                      97.4    1e-21   Ricinus communis
ref|XP_009774375.1|  PREDICTED: fruit bromelain-like                  95.5    1e-21   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...  97.4    1e-21   
gb|ABA97421.1|  Vignain precursor, putative                           97.1    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg           97.1    1e-21   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  97.1    1e-21   
ref|XP_009775922.1|  PREDICTED: zingipain-2                           97.1    2e-21   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg              96.7    2e-21   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  97.1    2e-21   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...  97.1    2e-21   
ref|XP_003526232.1|  PREDICTED: vignain-like                          96.7    2e-21   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...  96.7    2e-21   Vitis vinifera
ref|XP_006367780.1|  PREDICTED: ananain-like                          96.7    2e-21   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...  96.7    2e-21   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...  96.7    2e-21   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like      96.7    2e-21   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like            96.7    2e-21   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...  96.7    2e-21   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                      96.7    3e-21   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g           96.3    3e-21   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                       96.3    3e-21   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g           96.3    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006360707.1|  PREDICTED: vignain-like                          96.3    3e-21   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g           95.9    4e-21   
ref|XP_002522559.1|  cysteine protease, putative                      95.9    4e-21   Ricinus communis
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg              95.9    4e-21   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           95.9    4e-21   
ref|XP_010061449.1|  PREDICTED: zingipain-1-like                      95.9    5e-21   
gb|AFP73357.1|  cysteine protease                                     95.5    5e-21   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  95.5    5e-21   
gb|AFP73326.1|  cysteine protease                                     95.5    5e-21   
ref|XP_009617814.1|  PREDICTED: zingipain-2-like                      95.5    5e-21   
gb|AFP73358.1|  cysteine protease                                     95.5    5e-21   
emb|CBI21976.3|  unnamed protein product                              95.5    6e-21   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g           95.5    6e-21   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g           95.5    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...  95.5    6e-21   
ref|XP_008391525.1|  PREDICTED: fruit bromelain-like                  92.4    6e-21   
ref|NP_001233949.1|  phytophthora-inhibited protease 1                95.1    7e-21   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...  94.7    7e-21   
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg           95.1    8e-21   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...  95.1    8e-21   Vitis vinifera
gb|AFP73362.1|  cysteine protease                                     95.1    8e-21   
gb|AFP73327.1|  cysteine protease                                     95.1    8e-21   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  95.1    8e-21   
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg           95.1    8e-21   
gb|AFP73359.1|  cysteine protease                                     95.1    9e-21   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like            94.7    9e-21   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      94.7    9e-21   
gb|AFP73355.1|  cysteine protease                                     94.7    1e-20   
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg           94.7    1e-20   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140        94.7    1e-20   Sorghum bicolor [broomcorn]
ref|XP_003527350.1|  PREDICTED: vignain-like                          94.7    1e-20   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      94.7    1e-20   
gb|AFP73334.1|  cysteine protease                                     94.7    1e-20   
ref|XP_002531151.1|  cysteine protease, putative                      94.7    1e-20   Ricinus communis
gb|AFP73368.1|  cysteine protease                                     94.7    1e-20   
gb|AFP73317.1|  cysteine protease                                     94.7    1e-20   
gb|AFP73352.1|  cysteine protease                                     94.4    1e-20   
gb|AFP73363.1|  cysteine protease                                     94.4    1e-20   
gb|AFP73318.1|  cysteine protease                                     94.4    1e-20   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  97.4    1e-20   
gb|AFP73370.1|  cysteine protease                                     94.4    1e-20   
ref|XP_006652104.1|  PREDICTED: vignain-like                          94.4    1e-20   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...  94.4    1e-20   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1          94.4    1e-20   
ref|XP_006592467.1|  PREDICTED: vignain-like                          94.4    1e-20   
emb|CAN64655.1|  hypothetical protein VITISV_005140                   94.4    1e-20   Vitis vinifera
emb|CBI21972.3|  unnamed protein product                              94.0    2e-20   
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      94.4    2e-20   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      94.4    2e-20   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      94.4    2e-20   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 93.2    2e-20   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          94.0    2e-20   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            94.0    2e-20   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...  94.0    2e-20   Vitis vinifera
dbj|BAD29955.1|  cysteine protease                                    94.4    2e-20   Daucus carota [carrots]
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            94.0    2e-20   
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                  94.0    2e-20   
gb|KHN28095.1|  Thiol protease                                        94.0    2e-20   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          94.0    2e-20   
ref|XP_009798360.1|  PREDICTED: zingipain-2-like                      94.0    2e-20   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g           94.0    2e-20   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           94.0    2e-20   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g           93.6    2e-20   
ref|XP_010042857.1|  PREDICTED: actinidain-like                       90.5    2e-20   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                      94.0    2e-20   
gb|KCW76121.1|  hypothetical protein EUGRSUZ_D00498                   92.8    2e-20   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170        93.6    3e-20   Sorghum bicolor [broomcorn]
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2           93.6    3e-20   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       93.6    3e-20   
gb|AFP73356.1|  cysteine protease                                     93.6    3e-20   
gb|AAM19208.1|AF493233_1  cysteine protease                           93.6    3e-20   Solanum pennellii
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      93.6    3e-20   
dbj|BAF56427.1|  cysteine proteinase                                  93.6    3e-20   Lotus japonicus
emb|CBI21973.3|  unnamed protein product                              93.6    3e-20   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           93.6    3e-20   
gb|KHN13721.1|  Vignain                                               93.6    3e-20   
gb|EMT04560.1|  Vignain                                               92.8    3e-20   
gb|KHN32069.1|  Vignain                                               93.6    3e-20   
gb|KHN08187.1|  Thiol protease SEN102                                 93.2    3e-20   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                      93.6    3e-20   
gb|AFP73349.1|  cysteine protease                                     93.2    3e-20   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg              93.2    3e-20   
ref|XP_006592465.1|  PREDICTED: vignain-like                          93.2    3e-20   
gb|AFP73360.1|  cysteine protease                                     93.2    3e-20   
ref|XP_003557016.1|  PREDICTED: vignain-like                          93.2    3e-20   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1           93.2    3e-20   
gb|AFP73351.1|  cysteine protease                                     93.2    3e-20   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...  93.2    3e-20   Vitis vinifera
gb|AFP73369.1|  cysteine protease                                     93.2    3e-20   
emb|CAN70559.1|  hypothetical protein VITISV_032465                   93.2    3e-20   Vitis vinifera
gb|AFP73320.1|  cysteine protease                                     93.2    3e-20   
gb|AFP73340.1|  cysteine protease                                     93.2    3e-20   
gb|AFP73330.1|  cysteine protease                                     93.2    3e-20   
gb|AFP73364.1|  cysteine protease                                     93.2    3e-20   
gb|AFP73329.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73321.1|  cysteine protease                                     93.2    4e-20   
ref|XP_004232967.2|  PREDICTED: zingipain-2                           93.2    4e-20   
gb|AFP73365.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73331.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73328.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73312.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73311.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73316.1|  cysteine protease                                     93.2    4e-20   
emb|CBI21975.3|  unnamed protein product                              92.8    4e-20   
gb|AFP73338.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73323.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73319.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73315.1|  cysteine protease                                     93.2    4e-20   
gb|AAM19207.1|AF493232_1  cysteine protease                           93.2    4e-20   Solanum pimpinellifolium [currant tomato]
gb|AFP73333.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73324.1|  cysteine protease                                     93.2    4e-20   
gb|AFP73314.1|  cysteine protease                                     93.2    4e-20   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      93.2    4e-20   
ref|XP_010059348.1|  PREDICTED: zingipain-2-like                      93.2    4e-20   
ref|XP_002525124.1|  cysteine protease, putative                      93.2    4e-20   Ricinus communis
gb|AFP73367.1|  cysteine protease                                     93.2    4e-20   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                   92.8    4e-20   
gb|AFP73332.1|  cysteine protease                                     93.2    4e-20   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830        92.8    4e-20   Sorghum bicolor [broomcorn]
gb|AFP73313.1|  cysteine protease                                     93.2    4e-20   
ref|XP_004975182.1|  PREDICTED: vignain-like                          93.2    4e-20   
ref|XP_007048796.1|  Senescence-associated gene 12                    93.2    4e-20   
gb|AFP73335.1|  cysteine protease                                     93.2    4e-20   
ref|XP_004975183.1|  PREDICTED: vignain-like                          93.2    4e-20   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...  93.2    4e-20   Vitis vinifera
gb|EMT20796.1|  Vignain                                               93.6    4e-20   
gb|AFP73342.1|  cysteine protease                                     93.2    4e-20   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like            92.8    4e-20   
gb|AFP73347.1|  cysteine protease                                     92.8    4e-20   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840        92.8    4e-20   Sorghum bicolor [broomcorn]
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                      92.8    4e-20   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                      92.8    5e-20   
gb|AFP73322.1|  cysteine protease                                     92.8    5e-20   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...  92.8    5e-20   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           92.8    5e-20   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                   92.8    5e-20   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           92.8    5e-20   
emb|CAE03344.2|  OSJNBb0005B05.11                                     92.8    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052232.2|  Os04g0203500                                     92.8    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003527388.1|  PREDICTED: vignain-like                          92.8    5e-20   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410        92.8    5e-20   Sorghum bicolor [broomcorn]
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                      92.8    5e-20   
ref|XP_002531152.1|  cysteine protease, putative                      92.8    6e-20   Ricinus communis
emb|CAH66275.1|  OSIGBa0147O06.5                                      92.8    6e-20   Oryza sativa [red rice]
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                      92.8    6e-20   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  95.1    6e-20   
ref|XP_007048792.1|  Senescence-associated gene 12                    92.4    6e-20   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                      92.4    6e-20   
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                      92.4    6e-20   
ref|XP_002522572.1|  cysteine protease, putative                      92.4    6e-20   Ricinus communis
ref|XP_006592475.1|  PREDICTED: vignain-like                          92.4    6e-20   
gb|AFV30165.1|  cysteine proteinase                                   92.4    6e-20   
gb|KHN27797.1|  Thiol protease SEN102                                 92.4    6e-20   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                      92.4    6e-20   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g           92.4    6e-20   
ref|XP_007132882.1|  hypothetical protein PHAVU_011G1328001g          89.7    7e-20   
ref|XP_003539970.1|  PREDICTED: vignain-like                          92.4    7e-20   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...  92.4    7e-20   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                   92.4    7e-20   
ref|XP_002522571.1|  cysteine protease, putative                      92.4    7e-20   Ricinus communis
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                      92.4    8e-20   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  92.0    8e-20   
ref|XP_008246197.1|  PREDICTED: vignain-like                          92.0    8e-20   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            92.0    8e-20   
ref|XP_008228922.1|  PREDICTED: vignain-like                          92.0    9e-20   
dbj|BAF56428.1|  cysteine proteinase                                  92.0    9e-20   Lotus japonicus
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg           92.0    9e-20   
dbj|BAF56430.1|  cysteine proteinase                                  92.0    9e-20   Lotus japonicus
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          91.3    9e-20   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  92.0    1e-19   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg           92.0    1e-19   
ref|XP_003612210.1|  Cysteine proteinase                              92.0    1e-19   
ref|XP_006362426.1|  PREDICTED: vignain-like                          91.7    1e-19   
ref|XP_003539770.1|  PREDICTED: vignain-like                          91.7    1e-19   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      91.7    1e-19   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                      92.0    1e-19   
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                   91.7    1e-19   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg           91.7    1e-19   
ref|XP_010469398.1|  PREDICTED: ervatamin-B-like                      91.7    1e-19   
gb|AFP73361.1|  cysteine protease                                     91.7    1e-19   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                      91.7    1e-19   
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                 91.7    1e-19   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                      91.3    2e-19   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...  91.3    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            91.3    2e-19   
gb|KCW45396.1|  hypothetical protein EUGRSUZ_L00916                   91.3    2e-19   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      91.3    2e-19   
ref|XP_006360708.1|  PREDICTED: vignain-like                          91.3    2e-19   
ref|XP_010040204.1|  PREDICTED: fruit bromelain-like                  90.9    2e-19   
gb|KCW73671.1|  hypothetical protein EUGRSUZ_E02263                   91.3    2e-19   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            91.3    2e-19   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        91.3    2e-19   
gb|KHN12137.1|  Thiol protease                                        91.3    2e-19   
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                 90.9    2e-19   
gb|AGT16936.1|  vignain-like protein                                  91.3    2e-19   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...  91.3    2e-19   Vitis vinifera
gb|KDP23191.1|  hypothetical protein JCGZ_00324                       90.9    2e-19   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                      90.9    2e-19   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            90.9    2e-19   
gb|AFP73325.1|  cysteine protease                                     90.9    2e-19   
ref|XP_002523448.1|  cysteine protease, putative                      90.9    2e-19   Ricinus communis
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                   90.9    2e-19   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like            90.9    3e-19   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg           90.9    3e-19   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                      91.7    3e-19   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like            90.5    3e-19   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                      90.5    3e-19   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_003539989.1|  PREDICTED: vignain-like                          90.5    3e-19   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                      90.5    3e-19   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 93.6    4e-19   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g           90.5    4e-19   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                      90.5    4e-19   
ref|XP_004301219.1|  PREDICTED: fruit bromelain-like                  88.2    4e-19   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  90.1    4e-19   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                   90.1    4e-19   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                      90.5    4e-19   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                      90.1    4e-19   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                      90.1    4e-19   
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                      90.1    4e-19   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g           90.1    4e-19   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      90.1    4e-19   
ref|XP_002523447.1|  cysteine protease, putative                      90.1    4e-19   
ref|XP_002519955.1|  cysteine protease, putative                      90.1    4e-19   
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      90.1    4e-19   
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       90.1    4e-19   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           90.1    5e-19   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                      90.1    5e-19   
gb|AHA62778.1|  RCR3-like cysteine protease                           90.1    5e-19   
ref|XP_009352952.1|  PREDICTED: fruit bromelain-like                  90.1    5e-19   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...  90.1    5e-19   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg           90.1    5e-19   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                      90.1    5e-19   
ref|XP_010056876.1|  PREDICTED: zingipain-2-like                      90.1    5e-19   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      90.1    5e-19   
ref|XP_008225326.1|  PREDICTED: actinidain-like                       89.7    5e-19   
ref|XP_010523123.1|  PREDICTED: ervatamin-B-like                      90.1    5e-19   
ref|XP_003596314.1|  Cysteine proteinase                              89.7    5e-19   
ref|XP_003540013.1|  PREDICTED: vignain-like                          89.7    5e-19   
emb|CAL64936.1|  putative cysteine protease 8                         89.7    6e-19   
dbj|BAF56429.1|  cysteine proteinase                                  89.7    6e-19   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           89.7    6e-19   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...  89.7    6e-19   
ref|XP_009359967.1|  PREDICTED: vignain-like                          89.7    6e-19   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg           89.7    6e-19   
emb|CDP05747.1|  unnamed protein product                              89.7    6e-19   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                89.7    6e-19   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...  89.7    7e-19   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                      89.7    7e-19   
ref|XP_009361500.1|  PREDICTED: vignain-like                          89.4    7e-19   
gb|EEC84514.1|  hypothetical protein OsI_31214                        89.7    7e-19   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g           89.7    7e-19   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            89.4    8e-19   
ref|XP_003527349.1|  PREDICTED: vignain-like                          89.4    8e-19   
ref|XP_003556992.1|  PREDICTED: vignain-like                          89.4    8e-19   
ref|XP_006362428.1|  PREDICTED: vignain-like                          89.4    9e-19   
ref|XP_010040202.1|  PREDICTED: zingipain-2-like                      89.4    9e-19   
ref|XP_010509794.1|  PREDICTED: ervatamin-B-like                      89.4    9e-19   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                      89.4    9e-19   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                      89.4    9e-19   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                   89.4    1e-18   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                      89.0    1e-18   
ref|XP_010094328.1|  Fruit bromelain                                  89.0    1e-18   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  90.1    1e-18   
gb|KDO77829.1|  hypothetical protein CISIN_1g037516mg                 89.0    1e-18   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                      89.0    1e-18   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  89.0    1e-18   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                      89.0    1e-18   
gb|AAA50755.1|  cysteine proteinase                                   89.0    1e-18   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                      89.0    1e-18   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                   88.6    1e-18   
ref|XP_006306115.1|  hypothetical protein CARUB_v10011567mg           88.6    1e-18   
ref|XP_006468205.1|  PREDICTED: actinidain-like                       88.6    1e-18   
gb|KCW74081.1|  hypothetical protein EUGRSUZ_E02719                   85.9    1e-18   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160        88.6    1e-18   
ref|XP_002513120.1|  cysteine protease, putative                      89.0    2e-18   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        88.6    2e-18   
ref|XP_006582264.1|  PREDICTED: vignain-like                          88.6    2e-18   
gb|KHN08873.1|  Vignain                                               88.2    2e-18   
ref|XP_006582263.1|  PREDICTED: vignain-like                          88.2    2e-18   
ref|XP_007213224.1|  hypothetical protein PRUPE_ppb014952mg           87.8    2e-18   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      88.2    2e-18   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...  88.2    2e-18   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                      88.6    2e-18   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1               88.2    2e-18   
ref|XP_010413778.1|  PREDICTED: ervatamin-B-like                      88.2    2e-18   
ref|XP_006388354.1|  hypothetical protein POPTR_0213s002201g          84.0    2e-18   
ref|XP_010059000.1|  PREDICTED: ervatamin-C-like                      88.2    2e-18   
ref|XP_007048674.1|  Senescence-associated gene 12                    88.2    2e-18   
ref|XP_007217611.1|  hypothetical protein PRUPE_ppa016402mg           85.5    2e-18   
ref|XP_003527331.1|  PREDICTED: vignain-like                          88.2    2e-18   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  88.2    2e-18   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850        87.8    2e-18   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                      88.2    2e-18   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  88.2    3e-18   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           87.4    3e-18   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  87.8    3e-18   
ref|XP_010059005.1|  PREDICTED: fruit bromelain-like                  87.0    3e-18   
gb|EMT15489.1|  Thiol protease SEN102                                 87.8    3e-18   
gb|KHN27806.1|  Vignain                                               87.4    3e-18   
ref|XP_010058970.1|  PREDICTED: zingipain-2-like                      87.8    3e-18   
ref|XP_003637753.1|  Cysteine proteinase                              87.4    3e-18   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                      87.4    3e-18   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...  87.8    3e-18   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                      87.4    4e-18   
ref|XP_003599736.1|  Cysteine proteinase                              87.4    4e-18   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           87.4    4e-18   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                      87.4    4e-18   
ref|XP_010059006.1|  PREDICTED: ervatamin-C-like                      87.4    4e-18   
gb|KCW74082.1|  hypothetical protein EUGRSUZ_E02720                   87.4    4e-18   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                      87.4    4e-18   
ref|XP_009352794.1|  PREDICTED: fruit bromelain                       84.3    4e-18   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                      87.4    4e-18   
ref|XP_010499431.1|  PREDICTED: zingipain-2-like                      87.4    4e-18   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                   88.2    4e-18   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                      87.4    5e-18   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g           87.4    5e-18   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  87.0    5e-18   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  87.0    5e-18   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           87.4    5e-18   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                      87.0    6e-18   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                      87.0    6e-18   
ref|XP_008353751.1|  PREDICTED: actinidain-like                       86.3    6e-18   
gb|ACU23533.1|  unknown                                               85.9    6e-18   
gb|ADV74756.1|  cysteine protease                                     87.0    6e-18   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg           87.0    6e-18   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg           87.0    6e-18   
ref|XP_009365508.1|  PREDICTED: vignain-like                          88.6    7e-18   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                      86.7    7e-18   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           86.7    7e-18   
gb|KCW74085.1|  hypothetical protein EUGRSUZ_E02726                   84.3    7e-18   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  86.7    7e-18   
ref|XP_010059009.1|  PREDICTED: ervatamin-C-like                      86.7    8e-18   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g           86.7    8e-18   
ref|XP_004290089.1|  PREDICTED: vignain-like                          86.7    8e-18   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      86.3    8e-18   
ref|XP_010521644.1|  PREDICTED: ervatamin-B-like                      86.7    8e-18   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           86.7    8e-18   
ref|XP_003538185.1|  PREDICTED: vignain-like                          86.7    9e-18   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g           86.3    9e-18   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           86.7    9e-18   
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  87.0    9e-18   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg           86.3    9e-18   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                      86.3    1e-17   
gb|EMT29822.1|  Vignain                                               86.3    1e-17   
ref|XP_004297571.1|  PREDICTED: vignain-like                          86.3    1e-17   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  86.3    1e-17   
gb|EMT14655.1|  hypothetical protein F775_52509                       86.3    1e-17   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                 86.3    1e-17   
gb|AAR92154.1|  putative cysteine protease 1                          86.3    1e-17   
ref|XP_006852527.1|  hypothetical protein AMTR_s00021p00178980        86.3    1e-17   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg           86.3    1e-17   
ref|XP_009797968.1|  PREDICTED: vignain-like                          86.3    1e-17   
gb|AFK44139.1|  unknown                                               86.3    1e-17   
gb|EEE66441.1|  hypothetical protein OsJ_22818                        85.9    1e-17   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...  86.3    1e-17   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  85.9    1e-17   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  85.9    1e-17   
gb|KDP21086.1|  hypothetical protein JCGZ_21557                       84.0    1e-17   
ref|XP_003607647.1|  Cysteine proteinase                              85.9    1e-17   
ref|XP_004489011.1|  PREDICTED: vignain-like                          85.9    1e-17   
ref|XP_006306520.1|  hypothetical protein CARUB_v10012525mg           86.3    1e-17   
ref|XP_006469128.1|  PREDICTED: vignain-like                          85.9    1e-17   
ref|XP_007050065.1|  Senescence-associated gene 12                    85.9    1e-17   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           85.9    1e-17   
ref|XP_010059013.1|  PREDICTED: zingipain-2-like                      85.9    1e-17   
emb|CAD40112.2|  OSJNBa0035O13.5                                      85.9    1e-17   
dbj|BAC06931.1|  putative cysteine proteinase                         85.9    1e-17   
gb|EAY93078.1|  hypothetical protein OsI_14879                        85.9    1e-17   
gb|EEC81394.1|  hypothetical protein OsI_24614                        85.9    1e-17   
ref|XP_010045989.1|  PREDICTED: vignain-like                          85.1    2e-17   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  85.9    2e-17   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                       85.9    2e-17   
gb|EYU28078.1|  hypothetical protein MIMGU_mgv1a009081mg              85.9    2e-17   
ref|XP_010059003.1|  PREDICTED: ervatamin-C-like                      85.5    2e-17   
ref|XP_008340724.1|  PREDICTED: vignain-like                          85.5    2e-17   
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like        87.0    2e-17   
gb|KCW74080.1|  hypothetical protein EUGRSUZ_E02718                   85.5    2e-17   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                      85.5    2e-17   
ref|XP_010042854.1|  PREDICTED: chymopapain-like                      84.7    2e-17   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...  85.5    2e-17   
ref|XP_010059083.1|  PREDICTED: zingipain-2-like                      85.5    2e-17   
ref|XP_006362434.1|  PREDICTED: fruit bromelain-like                  85.5    2e-17   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg           85.5    2e-17   
emb|CDY17221.1|  BnaA05g09670D                                        85.5    2e-17   
ref|XP_006296429.1|  hypothetical protein CARUB_v10025609mg           84.7    2e-17   
ref|XP_010059002.1|  PREDICTED: ananain-like                          83.2    2e-17   
gb|KCW74086.1|  hypothetical protein EUGRSUZ_E02727                   85.5    2e-17   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg           85.1    2e-17   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           85.1    2e-17   
ref|XP_006469011.1|  PREDICTED: vignain-like                          85.1    3e-17   
ref|XP_006449484.1|  hypothetical protein CICLE_v10017947mg           85.1    3e-17   
gb|KHN27807.1|  KDEL-tailed cysteine endopeptidase CEP1               84.3    3e-17   
gb|KCW74077.1|  hypothetical protein EUGRSUZ_E02715                   84.7    3e-17   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...  85.5    3e-17   
gb|AAP32196.1|  cysteine protease 8                                   85.1    3e-17   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g           85.1    3e-17   
ref|XP_006281547.1|  hypothetical protein CARUB_v10027648mg           85.1    3e-17   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1               84.7    3e-17   
gb|AES64014.2|  papain family cysteine protease                       84.3    3e-17   
gb|ABF70145.1|  cysteine protease, putative                           85.1    3e-17   
gb|AAP32195.1|  cysteine protease 5                                   84.7    3e-17   
ref|XP_002449458.1|  hypothetical protein SORBIDRAFT_05g013840        85.1    3e-17   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g           84.7    3e-17   
gb|KCW74094.1|  hypothetical protein EUGRSUZ_E02741                   84.3    3e-17   
gb|KCW45401.1|  hypothetical protein EUGRSUZ_L00921                   84.7    4e-17   
ref|XP_002466439.1|  hypothetical protein SORBIDRAFT_01g007820        84.7    4e-17   
gb|KDO77830.1|  hypothetical protein CISIN_1g043883mg                 84.7    4e-17   
gb|KCW74260.1|  hypothetical protein EUGRSUZ_E02907                   85.1    4e-17   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      84.7    4e-17   
gb|KHN33935.1|  KDEL-tailed cysteine endopeptidase CEP1               84.3    4e-17   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  86.3    4e-17   
ref|XP_006467666.1|  PREDICTED: vignain-like                          84.7    4e-17   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                      84.7    4e-17   
gb|KHN27801.1|  Vignain                                               84.3    4e-17   
ref|XP_010040207.1|  PREDICTED: ervatamin-B-like                      84.7    4e-17   
ref|XP_008354173.1|  PREDICTED: actinidain-like                       83.6    4e-17   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1               84.3    4e-17   
ref|XP_009349242.1|  PREDICTED: vignain-like                          86.3    4e-17   
ref|XP_003593764.1|  Cysteine proteinase                              84.0    5e-17   
ref|XP_010057075.1|  PREDICTED: ervatamin-B-like                      84.3    5e-17   
dbj|BAB13759.1|  cysteine proteinase                                  84.3    5e-17   
gb|AAP32198.1|  cysteine protease 12                                  84.3    5e-17   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                      84.3    5e-17   
ref|XP_003593763.1|  Cysteine proteinase                              84.3    6e-17   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g           84.0    6e-17   



>emb|CDP18638.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATAR+L E SL  +HE+WM  HGR YKDEAEKAKRF IFKE V++IE FNKA N+SY 
Sbjct  22   SQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKETVEYIEAFNKAGNKSYV  81

Query  292  LGTNKFTDLTKEEF  333
            LG N+F DLT EEF
Sbjct  82   LGINRFADLTNEEF  95



>emb|CDP18639.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATAR+L E SL  +HE+WM  HGR YKDEAEKAKRF IFKE V++IE FNKA N+SY 
Sbjct  22   SQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKETVEYIEAFNKAGNKSYV  81

Query  292  LGTNKFTDLTKEEF  333
            LG N+F DLT EEF
Sbjct  82   LGINRFADLTNEEF  95



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            ATAR+L + S++ RHE WM  HGR YKD+ EKAKRF IFKENV++I+ FN+A  R YKL 
Sbjct  24   ATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFKIFKENVEYIQSFNEAGTRPYKLA  83

Query  298  TNKFTDLTKEEFQTT  342
             NKF DLT EEFQ +
Sbjct  84   VNKFADLTNEEFQAS  98



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATARTL + S++ +HE+W+   GR YKD+AEKAKRF+IFKENV++I+ FN+A  R YK
Sbjct  22   SQATARTLPDASMVEKHEQWIAQFGRVYKDDAEKAKRFNIFKENVEYIQSFNEAGARPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT EEFQ +
Sbjct  82   LAINKFADLTNEEFQAS  98



>gb|AAK27968.1|AF242372_1 cysteine protease [Ipomoea batatas]
Length=339

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            LAT+RTL ++ +++RHE+WM  +GR YK EAEK KRF+IFKENV++IE FNKA  + YKL
Sbjct  22   LATSRTLSDSLMVVRHEQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPYKL  81

Query  295  GTNKFTDLTKEEFQTT  342
            G N F DLT +EF+ +
Sbjct  82   GINAFADLTNQEFKAS  97



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATARTL   S++ RHE+WM  +GRTYK++AEKAKR++IFK+NV++I+  N+A+ R+YK
Sbjct  23   SQATARTLPNASMVERHEQWMVQYGRTYKNDAEKAKRYNIFKDNVEYIQSVNEAETRTYK  82

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT EEFQ +
Sbjct  83   LAINKFADLTNEEFQAS  99



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATARTL + S++ RHE+WM  +GRTYK++AEKAKRF+IFK+NV++I+  N+ + R+YK
Sbjct  27   SQATARTLPDASIVERHEQWMVQYGRTYKNDAEKAKRFNIFKDNVEYIQSVNETETRAYK  86

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT EEFQ +
Sbjct  87   LAINKFADLTNEEFQAS  103



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATARTL +TS++ RHE+WM  +GRTYK++AEKA RF+IFK+NV++I+  N+A+ R+YK
Sbjct  8    SQATARTLPDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFKDNVEYIQSVNEAETRTYK  67

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DL  EEFQ +
Sbjct  68   LAINKFADLKHEEFQAS  84



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            AT+R L+  S+L RHE+WM+ HGR YKD+ EKAKRF+IFKENV FI+ FN     SY+LG
Sbjct  24   ATSRDLQVYSMLERHEKWMSNHGRVYKDDVEKAKRFNIFKENVDFIDSFNNDATHSYQLG  83

Query  298  TNKFTDLTKEEFQTTM  345
             NKF DLT EEFQ+ +
Sbjct  84   LNKFADLTNEEFQSMV  99



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATARTL + +++ +HE+WM   GR YKD+AEK+KRF IFKENV++IE FN+A  R Y 
Sbjct  22   SQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIFKENVEYIESFNEAGARPYT  81

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT EEFQ +
Sbjct  82   LAINKFADLTNEEFQAS  98



>gb|AAL14199.1| cysteine proteinase precursor [Ipomoea batatas]
 gb|AAK15148.2| cysteine proteinase-like protein [Ipomoea batatas]
Length=341

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            LAT+RTL ++ +++RHE+WM  +GR Y++E EK KRF+IFKENV++IE FNKA  + YKL
Sbjct  24   LATSRTLSDSLMVVRHEQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPYKL  83

Query  295  GTNKFTDLTKEEFQTT  342
            G N F DLT +EF+ +
Sbjct  84   GINAFADLTNQEFKAS  99



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
              AR L + +++ R+E+WM+LHGR YKD AEK +RF IFK+NV+FIE FN+A NR YKLG
Sbjct  18   GAARNLNDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFKDNVEFIESFNRAGNRPYKLG  77

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  78   INQFADLTNEEF  89



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            AC S ATARTL E ++  RHE+WM  HGR YK+ AEK +RF IFK NV+FIE FN A N 
Sbjct  20   ACASHATARTLTEMTMAERHEQWMVRHGRVYKESAEKERRFQIFKANVEFIESFN-AGNS  78

Query  283  SYKLGTNKFTDLTKEEFQ  336
             YKLG N+F DLT EEF+
Sbjct  79   KYKLGVNQFADLTNEEFK  96



>emb|CDP18645.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            RTL + +++ RHE+WM+LHGR Y D+AEK +RF IFK+NV+FIE FN+A  R YKLG N+
Sbjct  22   RTLNDEAMVERHEQWMSLHGRVYTDDAEKERRFQIFKKNVEFIEAFNQAGKRPYKLGVNQ  81

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  82   FADLTNEEFKAS  93



>emb|CDP20741.1| unnamed protein product, partial [Coffea canephora]
Length=165

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S AT+R+L E  +  +HE+WM  HGR YKD+AEKA R+  FKENV FI  FNKA NR YK
Sbjct  22   SQATSRSLNEAPMTEKHEQWMAQHGRVYKDDAEKADRYKTFKENVNFIASFNKAGNRPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            L  N+F DLT EEF+  
Sbjct  82   LDINQFADLTNEEFRAA  98



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   101 bits (252),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+RTL E S+  RHE+WM  +GR YKDEAEK+ RF IF +NVKFIE+FNK   
Sbjct  37   GAWACQATSRTLPEASMFERHEQWMIQYGRVYKDEAEKSVRFQIFMDNVKFIEEFNKDGR  96

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKL  N+F D T EEFQ +
Sbjct  97   QSYKLAVNEFADQTNEEFQAS  117



>ref|XP_006471123.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=179

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQ  336
            +YKLGTN+F+DLT EEF+
Sbjct  83   TYKLGTNEFSDLTNEEFR  100



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+LE+ SLL R+E+WMT +G+ YK   EKA R+ IFKENV+FIE FNK  N+ YKLG N
Sbjct  27   ARSLEDASLLERYEQWMTQNGKVYKGSQEKALRYQIFKENVQFIEAFNKGGNKPYKLGIN  86

Query  304  KFTDLTKEEFQT  339
            +F DLT EEF+T
Sbjct  87   QFADLTNEEFKT  98



>ref|XP_009609440.1| PREDICTED: ananain-like [Nicotiana tomentosiformis]
Length=172

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  100  GACESLATARTLEETSLLL--RHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKA  273
            G  +S ATAR L+   L +  RHE WM  HGR YKDEAEK KR  IFKEN++FIE  N+A
Sbjct  18   GMYKSHATARNLQPAELSVSERHELWMARHGRVYKDEAEKGKRLMIFKENMQFIESVNRA  77

Query  274  DNRSYKLGTNKFTDLTKEEF  333
             N SYKLG N+F D+T EEF
Sbjct  78   GNLSYKLGINEFADITSEEF  97



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            AC S ATARTL E ++  RHE+WM   GR Y+D AEK +R+ IFK NV+ IE FN A N 
Sbjct  20   ACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKSNVELIESFN-AGNS  78

Query  283  SYKLGTNKFTDLTKEEFQTTM  345
             YKLG N+F DLT EEF+  M
Sbjct  79   KYKLGVNQFADLTNEEFRAMM  99



>ref|NP_001275606.1| fruit bromelain-like precursor [Solanum tuberosum]
 gb|AHA62777.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TAR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYK
Sbjct  23   SQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSYK  82

Query  292  LGTNKFTDLTKEEF  333
            LG N+F D+T EEF
Sbjct  83   LGVNEFADITSEEF  96



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G C     +R+L E SL  RHE WM  H R YKD  EK  RF IF+ENVKFIE FNKA N
Sbjct  2    GLCACQGWSRSLYEASLEERHEIWMAQHERVYKDATEKEMRFQIFRENVKFIESFNKAGN  61

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N FTDLT +EF+ +
Sbjct  62   KSYKLGINAFTDLTNKEFRAS  82



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            AC S ATARTL E ++  RHE+WM   GR Y+D AEK +R+ IFK NV+ IE FN A N 
Sbjct  20   ACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFKANVELIESFN-AGNS  78

Query  283  SYKLGTNKFTDLTKEEFQTTM  345
             YKLG N+F DLT EEF+  M
Sbjct  79   KYKLGVNQFADLTNEEFKAMM  99



>ref|XP_006362429.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TAR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYK
Sbjct  23   SQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSYK  82

Query  292  LGTNKFTDLTKEEF  333
            LG N+F D+T EEF
Sbjct  83   LGINEFADITSEEF  96



>ref|XP_006446541.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
 gb|ESR59781.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
Length=346

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R  IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVAKHEQWMAQHGRTYKDELEKAMRLKIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            +YKLGTN+F+DLT EEF+ +
Sbjct  83   TYKLGTNEFSDLTNEEFRAS  102



>dbj|BAF46311.1| cysteine proteinase precursor [Ipomoea nil]
Length=339

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            LAT+RTL ++ + +RHE+WM  +GR YK+E EK KR++IFKENV++IE FNKA  + YKL
Sbjct  22   LATSRTLLDSLMAVRHEQWMAQYGRVYKNEVEKTKRYNIFKENVEYIESFNKAGTKPYKL  81

Query  295  GTNKFTDLTKEEF  333
            G N F DLT +EF
Sbjct  82   GINAFADLTNKEF  94



>gb|AFW76903.1| hypothetical protein ZEAMMB73_202256 [Zea mays]
Length=151

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L E+++++ RHE+WM  + R YKD AEKA+RF +FK NVKFIE FN   NR
Sbjct  18   CGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNTGGNR  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF+TT  N+
Sbjct  78   KFWLGINQFADLTNDEFRTTKTNK  101



>ref|XP_004232961.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=341

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            +AR L+  S+L RHE+WM+ HGR YKD+ EKA+R  IFKENV+FIE FN     SY+LG 
Sbjct  26   SARDLQVYSMLERHEKWMSHHGRVYKDDVEKAERLKIFKENVEFIEAFNNDAAHSYQLGV  85

Query  301  NKFTDLTKEEFQTTM  345
            NKF DLT EEFQ+ +
Sbjct  86   NKFADLTNEEFQSMV  100



>ref|XP_006470292.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQT  339
            +YKLGTN+F+DLT EEF+ 
Sbjct  83   TYKLGTNEFSDLTNEEFRA  101



>gb|AFP73348.1| cysteine protease [Solanum lycopersicoides]
Length=343

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TAR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYK
Sbjct  23   SQTTARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYK  82

Query  292  LGTNKFTDLTKEEFQT  339
            LG N+F D+T EEF T
Sbjct  83   LGINEFADITSEEFLT  98



>ref|XP_006470294.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO38136.1| hypothetical protein CISIN_1g019063mg [Citrus sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQT  339
            +YKLGTN+F+DLT EEF+ 
Sbjct  83   TYKLGTNEFSDLTNEEFRA  101



>ref|XP_006470293.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470295.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQT  339
            +YKLGTN+F+DLT EEF+ 
Sbjct  83   TYKLGTNEFSDLTNEEFRA  101



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A  R L E S++ +HE+WM  +GR YK+EAEK  R+ IFKENV+FIE FNKA  +SYK
Sbjct  22   SQAVCRNLNEASMIEKHEQWMAQNGRVYKNEAEKGNRYKIFKENVEFIESFNKAGTKSYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N+F DLT  EF+  
Sbjct  82   LGINQFADLTNVEFRAA  98



>gb|AHA62776.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TAR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFI+  NKA N SYK
Sbjct  23   SQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIDSINKAGNLSYK  82

Query  292  LGTNKFTDLTKEEF  333
            LG N+F D+T EEF
Sbjct  83   LGINEFADITSEEF  96



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            LA     ++++++ RHE+WM  HGR YKD+AEKA+RF +FK NVKFIE FN A NR + L
Sbjct  22   LAARELSDDSAMVARHEQWMAQHGRLYKDDAEKARRFEVFKTNVKFIETFNAAGNRKFWL  81

Query  295  GTNKFTDLTKEEFQTTMLNE  354
            G N+F DLT +EF+ T  N+
Sbjct  82   GVNQFADLTNDEFRATKTNK  101



>gb|KDO55227.1| hypothetical protein CISIN_1g019112mg [Citrus sinensis]
Length=346

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R  IFK+N+++IE  NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLTIFKQNLEYIEKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            +YKLGTN+F+DLT EEF+ +
Sbjct  83   TYKLGTNEFSDLTNEEFRAS  102



>gb|AHA62772.1| papain-like cysteine protease [Solanum stoloniferum]
Length=343

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TAR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYK
Sbjct  23   SQTTARSQPKLSVSERHEQWMSRHGRVYKDEVEKRERFMIFKENMKFIESINKAGNLSYK  82

Query  292  LGTNKFTDLTKEEF  333
            LG N+F D+T EEF
Sbjct  83   LGINEFADITSEEF  96



>ref|XP_006362436.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR L+  S+L RHE+WM+ HGR YKD+ EKA+R  IFKENV FIE FN     SY+LG N
Sbjct  27   ARDLQVYSMLERHEKWMSHHGRVYKDDVEKAERLKIFKENVDFIESFNNDAVHSYQLGVN  86

Query  304  KFTDLTKEEFQTTM  345
            KF DLT EEFQ+ +
Sbjct  87   KFADLTNEEFQSMV  100



>ref|XP_009606934.1| PREDICTED: zingipain-2 [Nicotiana tomentosiformis]
Length=339

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  100  GACESLATARTLEETSLLL--RHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKA  273
            G  +S ATAR L+   L +  RHE WM  HGR YKDEAEK KR  IFKEN++FIE  N+A
Sbjct  18   GMYKSHATARNLQPAELSVSERHELWMARHGRVYKDEAEKGKRLMIFKENMQFIESVNRA  77

Query  274  DNRSYKLGTNKFTDLTKEEF  333
             N SYKLG N+F D+T EEF
Sbjct  78   GNLSYKLGINEFADITSEEF  97



>gb|AHA62773.1| papain-like cysteine protease [Solanum demissum]
 gb|AHA62775.1| papain-like cysteine protease [Solanum verrucosum]
Length=344

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
             AR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG 
Sbjct  27   AARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSYKLGI  86

Query  301  NKFTDLTKEEF  333
            N+F D+T EEF
Sbjct  87   NEFADITSEEF  97



>ref|NP_001066557.2| Os12g0273800 [Oryza sativa Japonica Group]
 dbj|BAF29576.2| Os12g0273800 [Oryza sativa Japonica Group]
Length=210

 Score = 96.3 bits (238),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  115  LATARTLE-ETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            +A AR L  + ++  RHERWM  HGR YKD AEKA+R  +FK NV FIE FN      Y 
Sbjct  28   VAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW  87

Query  292  LGTNKFTDLTKEEFQTTMLNEE  357
            LG N+F DLT EEF+ TM N +
Sbjct  88   LGVNQFADLTSEEFKATMTNSK  109



>gb|AHA62774.1| papain-like cysteine protease [Solanum demissum]
Length=344

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE+WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  28   ARSQPKLSVSERHEQWMSRHGRVYKDEVEKGERFMIFKENMKFIESINKAGNLSYKLGIN  87

Query  304  KFTDLTKEEF  333
            +F D+T EEF
Sbjct  88   EFADITSEEF  97



>ref|XP_002522560.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39860.1| cysteine protease, putative [Ricinus communis]
Length=160

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S A +R L + ++  RHE WM  +GR YKD AEK +RF IFKENV+FIE FNKA N
Sbjct  29   GLWASQAWSRLLYDATINERHEMWMAKYGRVYKDRAEKEERFKIFKENVEFIESFNKAGN  88

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            ++YKL  N+F DLT EEF+T+
Sbjct  89   KAYKLSINEFADLTNEEFRTS  109



>ref|XP_006490014.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495221.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=344

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK KRF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  115  LATARTLE-ETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            +A AR L  + ++  RHERWM  HGR YKD AEKA+R  +FK NV FIE FN      Y 
Sbjct  28   VAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW  87

Query  292  LGTNKFTDLTKEEFQTTMLNEE  357
            LG N+F DLT EEF+ TM N +
Sbjct  88   LGVNQFADLTSEEFKATMTNSK  109



>ref|XP_004234254.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=346

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  136  EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNKFTD  315
            + TS++ +HE WM  HGRTYK++ EKAKR +IF +NVKFIE FN  D++SYKLG NKFTD
Sbjct  30   DSTSMVEKHESWMARHGRTYKNDIEKAKRLNIFTKNVKFIESFNNNDSKSYKLGINKFTD  89

Query  316  LTKEEF  333
            LT EEF
Sbjct  90   LTSEEF  95



>ref|XP_006432601.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
 gb|ESR45841.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
Length=344

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK KRF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>ref|XP_006432617.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
 ref|XP_006494213.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495364.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR45857.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
Length=344

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK KRF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C   A +R L E  +  RHE+WM  HG+ YKD+ EK +RF IFK NV FIE FN A N+S
Sbjct  21   CADQAASRELHELEMTGRHEKWMAKHGKVYKDDKEKLRRFQIFKSNVVFIESFNTAGNKS  80

Query  286  YKLGTNKFTDLTKEEFQT  339
            Y LG NKF DLT EEF+ 
Sbjct  81   YMLGINKFADLTNEEFRA  98



>ref|XP_009774375.1| PREDICTED: fruit bromelain-like, partial [Nicotiana sylvestris]
Length=201

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S  T+R L E S++ +HE WM   GR Y+D+AEKAKR  IFK+NV +IE  NKA  
Sbjct  72   GMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKDNVDYIESVNKAGI  131

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            R YKLG N+F DLT EEF+ T
Sbjct  132  RPYKLGINEFADLTNEEFRAT  152



>ref|XP_003578721.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=349

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN-R  282
            C ++ +AR L + +++ RHE+WM  HGR YKD AEKA+RF  F+ NV FIE FN A N R
Sbjct  19   CSTVLSARELGDAAMVERHEQWMAQHGRVYKDGAEKARRFEAFRNNVVFIESFNAAGNRR  78

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+FTDLT +EF+ T  N+
Sbjct  79   KFWLGVNQFTDLTNDEFRATKTNK  102



>gb|ABA97421.1| Vignain precursor, putative [Oryza sativa Japonica Group]
 gb|EEE62878.1| hypothetical protein OsJ_17681 [Oryza sativa Japonica Group]
Length=350

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  115  LATARTLE-ETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            +A AR L  + ++  RHERWM  HGR YKD AEKA+R  +FK NV FIE FN      Y 
Sbjct  28   VAAARELGGDAAMAARHERWMAQHGRVYKDAAEKARRLEVFKANVAFIESFNAGGKNRYW  87

Query  292  LGTNKFTDLTKEEFQTTMLNEE  357
            LG N+F DLT EEF+ TM N +
Sbjct  88   LGVNQFADLTSEEFKATMTNSK  109



>ref|XP_006432594.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
 gb|ESR45834.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
Length=344

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK KRF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L E+++++ RHE+WM  + R YKD AEKA+RF +FK NVKFIE FN   NR
Sbjct  18   CGAALAARDLNEDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNTGGNR  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF+TT  N+
Sbjct  78   KFWLGINQFADLTNDEFRTTKTNK  101



>ref|XP_009775922.1| PREDICTED: zingipain-2 [Nicotiana sylvestris]
Length=338

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  100  GACESLATARTLE-ETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKAD  276
            G  +S ATAR L+ E S+  RHE WM  HGR YKDEAEK KR  IFKEN++FIE  N+A 
Sbjct  18   GMYKSHATARNLQPELSVSERHELWMARHGRVYKDEAEKGKRLVIFKENMQFIESINRAG  77

Query  277  NRSYKLGTNKFTDLTKEEF  333
            N SYKLG N+F D+T +EF
Sbjct  78   NLSYKLGINEFADITSDEF  96



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S +TARTL   S++ +HE+WM  +GRTYKD+AEKA R+ IFK+NV++I+  ++A+NR+YK
Sbjct  4    SQSTARTLPHKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAENRTYK  63

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT +EF+ +
Sbjct  64   LAINKFADLTSDEFKAS  80



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S AT+R L ETS++ +H++WMT  GR YKD+ EKAKRF IFK+N ++I+ FNKA  + YK
Sbjct  22   SQATSRGLYETSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFKDNTEYIDSFNKAGTKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            L  N+F DLT EEF+ T
Sbjct  82   LDINEFADLTNEEFRAT  98



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            AT+R L ETS++ +HE+WMT  GR YK++ EKAKRF IFK+N+ +I+ FNKA  +SYKL 
Sbjct  25   ATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFKDNIDYIDSFNKAGTKSYKLD  84

Query  298  TNKFTDLTKEEFQTT  342
             N+F DLT +EF+ T
Sbjct  85   INEFADLTNDEFRAT  99



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T RTL++ S+  RHE+WMT +G+ YKD  E+ KRF +FKENV +IE FN A N+SYKLG
Sbjct  25   VTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRVFKENVNYIEAFNNAANKSYKLG  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT +EF
Sbjct  85   INQFADLTNKEF  96



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S A +RTL E S+  RHE WM L+GRTYKD AEK +RF IFKENV++IE  N A N
Sbjct  16   GVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKENVEYIESVNSAGN  75

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            R YKL  N+F D T EEF+ +
Sbjct  76   RRYKLSINEFADQTNEEFKAS  96



>ref|XP_006367780.1| PREDICTED: ananain-like [Solanum tuberosum]
Length=348

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  100  GACESLATARTLEETSLLL-RHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKAD  276
            G   S  T R L++ S +L +HE WM  HGR Y+++ EKAKR +IFK+NVKFIE FN   
Sbjct  19   GMYASQVTCRNLQDPSSMLEKHESWMARHGRAYENDIEKAKRLNIFKKNVKFIESFNNNG  78

Query  277  NRSYKLGTNKFTDLTKEEF  333
            +RSYKLG NKF+DLT EEF
Sbjct  79   SRSYKLGINKFSDLTSEEF  97



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TARTL + + +  HE+WM   GR YKDEAEK+KRF IFKENV++I  FN+A  R Y+
Sbjct  22   SQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYR  81

Query  292  LGTNKFTDLTKEEF  333
            L  NKF DLT EEF
Sbjct  82   LAINKFADLTNEEF  95



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S  TARTL + + +  HE+WM   GR YKDEAEK+KRF IFKENV++I  FN+A  R Y+
Sbjct  22   SQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKENVEYIRSFNEAAARPYR  81

Query  292  LGTNKFTDLTKEEF  333
            L  NKF DLT EEF
Sbjct  82   LAINKFADLTNEEF  95



>ref|XP_006470296.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=347

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++I   NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQT  339
            +YKLGTN+F+DLT EEF+ 
Sbjct  83   TYKLGTNEFSDLTNEEFRA  101



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query  121  TARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             ARTL ++++++ RHE+WM  + R YKD AEKA+RF +FK NVKFIE FN A NR + LG
Sbjct  23   AARTLSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNAAGNRKFWLG  82

Query  298  TNKFTDLTKEEFQTTMLNE  354
             N+F DLT +EF+ T  N+
Sbjct  83   VNQFADLTNDEFRATKTNK  101



>ref|XP_006470291.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
Length=346

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +1

Query  106  CES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S + + R++ E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++I   NK  NR
Sbjct  23   CASQVVSGRSMHEPSIVEKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNR  82

Query  283  SYKLGTNKFTDLTKEEFQT  339
            +YKLGTN+F+DLT EEF+ 
Sbjct  83   TYKLGTNEFSDLTNEEFRA  101



>ref|XP_009793843.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=371

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  100  GACESLATARTLE-ETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKAD  276
            G  +S ATAR L+ E S+  RHE WM  HGR YKDEAEK KR  IFKEN++FIE  N+A 
Sbjct  50   GMYKSHATARNLQPELSVSERHELWMARHGRVYKDEAEKGKRLMIFKENMQFIESINRAG  109

Query  277  NRSYKLGTNKFTDLTKEEF  333
            N SYKLG N++ D+T +EF
Sbjct  110  NLSYKLGINEYADITSDEF  128



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  I+ FN    
Sbjct  19   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  79   KSYKLGVNQFADLTNEEFKAS  99



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S A AR+L++ S+  RHE WM  +GR YKD  EK  R+ IFKENV+ IE FNKA  +
Sbjct  20   ALASQAIARSLQDASMYERHEDWMAQNGRVYKDANEKEIRYKIFKENVERIESFNKAGGK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKLG N+F DLT EEF+T+
Sbjct  80   SYKLGINQFADLTNEEFKTS  99



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S + ARTL++ S+  RHE+WM  +GR YKD+AEK  R++IFKENV  I+ FN    
Sbjct  19   GAWPSKSAARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DL+ EEF+ +
Sbjct  79   KSYKLGVNQFADLSNEEFKAS  99



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S AT+R L ETS++ +HE+WMT  GR YKD+ EKAKRF+IFK+N K+I   NKA  + YK
Sbjct  22   SQATSRGLYETSMVQKHEQWMTHFGRVYKDDVEKAKRFNIFKDNTKYINSVNKAGIKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            L  N+F DLT EEF+ T
Sbjct  82   LDINEFADLTNEEFRAT  98



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  I+ FN    
Sbjct  19   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  79   KSYKLGVNQFADLTNEEFKAS  99



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S + +R+L E S+ LRH+ WMT +GR YK   EK KRF IFKENV+FIE FN   N+ YK
Sbjct  22   SQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIFKENVEFIESFNNNGNKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N FTDLT EEF+ +
Sbjct  82   LGINAFTDLTNEEFRAS  98



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S +TARTL   S++ +HE+WM   GRTYKD+AEKA R+ IFK+NV++I+  ++A N +YK
Sbjct  4    SQSTARTLPNKSMIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQNVEYIQSVDEAQNWTYK  63

Query  292  LGTNKFTDLTKEEFQTT  342
            L  NKF DLT EEFQ +
Sbjct  64   LAINKFADLTNEEFQAS  80



>ref|XP_007132817.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
 gb|ESW04811.1| hypothetical protein PHAVU_011G127000g [Phaseolus vulgaris]
Length=340

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C S   +R + E S+  RHE+WM  +GRTYKD AEK KRF IFK+NV+FIE FN A N+ 
Sbjct  20   CSSQVMSRNIHEASISQRHEQWMKQYGRTYKDAAEKQKRFLIFKDNVQFIEFFNTAGNKP  79

Query  286  YKLGTNKFTDLTKEEF  333
            YKLG N   D T EEF
Sbjct  80   YKLGINHLADQTNEEF  95



>ref|XP_010061449.1| PREDICTED: zingipain-1-like [Eucalyptus grandis]
 gb|KCW68390.1| hypothetical protein EUGRSUZ_F02043 [Eucalyptus grandis]
Length=340

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A+ RTL E+++  +HE+WM  +GRTYKD+ EK KR  IFK+N++FIEDFN + NR++KLG
Sbjct  25   ASVRTLHESNIAEQHEQWMAQYGRTYKDQEEKEKRRAIFKKNLQFIEDFNASGNRTFKLG  84

Query  298  TNKFTDLTKEEF  333
             N+F+DLT EEF
Sbjct  85   INQFSDLTDEEF  96



>gb|AFP73357.1| cysteine protease [Solanum habrochaites]
Length=344

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T EEF
Sbjct  87   EFADITSEEF  96



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S ATAR + +  +  RHE+WM  +GR YKD  EK +RF IFK+N  +IE  N+A N
Sbjct  16   GVWVSGATARGIADVPMSTRHEQWMAQYGRVYKDAVEKERRFQIFKDNSNYIESVNRAGN  75

Query  280  RSYKLGTNKFTDLTKEEFQTTMLN  351
            R YKLG N+F D+T EEF+ + L 
Sbjct  76   RKYKLGLNQFADMTNEEFKASHLG  99



>gb|AFP73326.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENIKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_009617814.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=340

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDF-NKAD  276
            G   S  T+R ++  S+L +HE WM+ HGRTYK+EAEK KR +IFKENVKFIE F N   
Sbjct  19   GMSTSQVTSRNIQALSMLEKHESWMSSHGRTYKNEAEKEKRLNIFKENVKFIESFNNNGT  78

Query  277  NRSYKLGTNKFTDLTKEEF  333
             + YKLG N F DLT EEF
Sbjct  79   KKPYKLGINAFADLTAEEF  97



>gb|AFP73358.1| cysteine protease, partial [Solanum habrochaites]
Length=345

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T EEF
Sbjct  87   EFADITSEEF  96



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF T+
Sbjct  80   SYKLSINEFADLTNEEFGTS  99



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  I+ FN    
Sbjct  19   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  79   KSYKLGVNQFADLTNEEFKAS  99



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  I+ FN    
Sbjct  19   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  79   KSYKLGVNQFADLTNEEFKAS  99



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  I+ FN    
Sbjct  19   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARIDAFNSQTG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  79   KSYKLGVNQFADLTNEEFKAS  99



>ref|XP_008391525.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=147

 Score = 92.4 bits (228),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S AT+RTL E S+  +HE+WM   GR Y+D AEK +RFHIFK NV+F+E FN    
Sbjct  17   GTLASQATSRTLYEXSIAAKHEQWMEEFGRVYQDSAEKERRFHIFKNNVEFVEKFNSEGK  76

Query  280  RSYKLGTNKFTDLTKEEF  333
            + YKL  N+F+D+T EEF
Sbjct  77   KXYKLSINQFSDMTHEEF  94



>ref|NP_001233949.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
 gb|ABG23376.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
Length=345

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            + T+R L+E S+L RHE WM  HGR YKD+ EK  RF  FKENV+FIE FNK   + YKL
Sbjct  26   IVTSRNLKELSMLERHENWMVHHGRVYKDDIEKEHRFKTFKENVEFIESFNKNGTQRYKL  85

Query  295  GTNKFTDLTKEEFQTTMLN  351
              NK+ DLT EEF T+ + 
Sbjct  86   AVNKYADLTTEEFTTSFMG  104



>ref|XP_011009181.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=276

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S +TARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  ++ FN    
Sbjct  39   GAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARVDAFNSQTG  98

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  99   KSYKLGVNQFADLTNEEFKAS  119



>ref|XP_006421532.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
 gb|ESR34772.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
Length=343

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK  RF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF T+
Sbjct  80   SYKLSINEFADLTNEEFGTS  99



>gb|AFP73362.1| cysteine protease [Solanum chilense]
Length=344

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  E S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73327.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  E S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S ATAR + +  +  RHE+WM  +GR YKD  EK +RF IFK+N  +IE  N+A N
Sbjct  16   GVWVSAATARGIADVPISTRHEQWMARYGRVYKDAVEKERRFQIFKDNHNYIESVNRAGN  75

Query  280  RSYKLGTNKFTDLTKEEFQTTMLN  351
            R YKLG N+F D+T EEF+ + L 
Sbjct  76   RKYKLGLNQFADMTNEEFKASHLG  99



>ref|XP_006421530.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
 gb|ESR34770.1| hypothetical protein CICLE_v10005334mg [Citrus clementina]
Length=344

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK  RF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>gb|AFP73359.1| cysteine protease, partial [Solanum chilense]
Length=345

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  E S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPELSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +1

Query  121  TARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             AR L ++++++ RHE+WM  + R YKD AEKA+RF +FK NVKFIE FN A NR + LG
Sbjct  23   AARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFKANVKFIESFNAAGNRKFWLG  82

Query  298  TNKFTDLTKEEFQTTMLNE  354
             N+F DLT +EF+ T  N+
Sbjct  83   VNQFADLTNDEFRATKTNK  101



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A AR + +  +  RHE+WM  +GR YKD AEK +RF IFK+N  +IE  N+A NR YKLG
Sbjct  20   AMARGIADVPMSTRHEQWMAQYGRVYKDAAEKERRFQIFKDNCNYIESVNRAGNRKYKLG  79

Query  298  TNKFTDLTKEEFQTTMLN  351
             N+F D+T EEF+ + L 
Sbjct  80   LNQFADMTNEEFKASHLG  97



>gb|AFP73355.1| cysteine protease [Solanum pennellii]
Length=344

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_006421528.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
 gb|ESR34768.1| hypothetical protein CICLE_v10006884mg [Citrus clementina]
Length=323

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
               R+L E S++ +HE+WM  HGRTYKD+ EK  RF IFKEN+++IE  N+  NR+YKLG
Sbjct  25   VAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFKENLEYIEKANEEANRTYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
            TN+F+DLT EEF+ +
Sbjct  85   TNEFSDLTNEEFRAS  99



>ref|XP_002446131.1| hypothetical protein SORBIDRAFT_06g002140 [Sorghum bicolor]
 gb|EES10459.1| hypothetical protein SORBIDRAFT_06g002140 [Sorghum bicolor]
Length=328

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C S+  AR L + +++ RHE WM  +GR YKD AEKA+RF +FK+NV F+E FN   N  
Sbjct  18   CSSVLAARELSDAAMVERHENWMVEYGRVYKDAAEKARRFQVFKDNVAFVESFNTNKNNK  77

Query  286  YKLGTNKFTDLTKEEFQ  336
            + LG N+F DLT EEF+
Sbjct  78   FWLGVNQFADLTTEEFK  94



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
              +RTL++ S+  RHE+WM  +G+ YKD  EK KRF +FKENV +IE FN A N+ YKLG
Sbjct  25   VASRTLQDASMYERHEQWMARYGKVYKDPEEKEKRFRVFKENVNYIEAFNNAANKPYKLG  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTSEEF  96



>ref|XP_008368206.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=344

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S AT+RTL E S+  +HE+WM   GR Y+D AEK +RFHIFK NV+F+E FN    
Sbjct  17   GTLASQATSRTLYEASIAAKHEQWMEKFGRVYQDSAEKERRFHIFKNNVEFVEKFNSEGK  76

Query  280  RSYKLGTNKFTDLTKEEF  333
            ++Y+LG N+F+D+T EEF
Sbjct  77   KTYELGVNRFSDMTYEEF  94



>gb|AFP73334.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S A ARTL++ S+  +HE WM+  GR Y D  EK  R+ IFKENV+ IE FNKA  
Sbjct  19   GALVSQAMARTLQDASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKENVQRIESFNKASG  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+T+
Sbjct  79   KSYKLGINQFADLTNEEFKTS  99



>gb|AFP73368.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73317.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73352.1| cysteine protease [Solanum corneliomuelleri]
Length=344

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73363.1| cysteine protease [Solanum chilense]
Length=344

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73318.1| cysteine protease [Solanum peruvianum]
 gb|AFP73375.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            T+R L E S++ +HE+WM   GR Y+D+AEKAKRF+IFK+NV +IE  NK+  R YKL  
Sbjct  487  TSRELNEASMVQKHEKWMARFGRVYRDDAEKAKRFNIFKDNVDYIESINKSGMRPYKLSI  546

Query  301  NKFTDLTKEEFQTT  342
            N F DLT EEF+ T
Sbjct  547  NGFADLTNEEFRAT  560



>gb|AFP73370.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            AR+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   ARSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  106  CESLATARTL--EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            C ++  AR L  ++ ++  RHERWM  +GR YKD AEKA+RF +FK NV FIE FN    
Sbjct  18   CSAVLAARELGDDDAAMAARHERWMAQYGRVYKDAAEKARRFEVFKANVAFIESFNGGGG  77

Query  280  RSYKLGTNKFTDLTKEEFQTTMLNE  354
            R + LG N+F DLT  EF+ T  N+
Sbjct  78   RKFWLGVNQFADLTNYEFRATNTNK  102



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S ATAR L E ++  RHE+WM+ HGR Y D AEK +RF IFK NV+ IE FN A N  YK
Sbjct  23   SHATARMLSEMTMHERHEQWMSQHGRVYGDSAEKERRFQIFKANVELIESFN-AGNSKYK  81

Query  292  LGTNKFTDLTKEEFQTTM  345
            LG N+F DLT EEF+  M
Sbjct  82   LGVNQFADLTIEEFKAMM  99



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  118  ATARTLEETSLL-LRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            AT+R+L++ S L +RHE WM+ HG  YKD  EKAKRF IFKENV  IE FN+A  + YKL
Sbjct  28   ATSRSLQDASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFKENVARIEAFNRAAIKPYKL  87

Query  295  GTNKFTDLTKEEFQT  339
            G NKF DLT EEF T
Sbjct  88   GINKFADLTNEEFIT  102



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T RTL++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL 
Sbjct  25   VTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S A AR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA N+
Sbjct  20   AWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRYKIFKDNVARIESFNKAMNK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR+L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S  T+R L E S++ +HE WM   GR Y+D+AEKAKR  IFK NV +IE  NKA  
Sbjct  18   GMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFKNNVDYIESVNKAGI  77

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            R YKLG N+F DLT EEF+ T
Sbjct  78   RPYKLGINEFADLTNEEFRAT  98



>ref|XP_006492717.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|KDO63019.1| hypothetical protein CISIN_1g018968mg [Citrus sinensis]
Length=348

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +1

Query  103  ACES-LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            +C S + ++R+  E S++  HE+WM  HGR+YKDE EK  RF IFKEN+++IE  NK  N
Sbjct  27   SCASQVVSSRSTHEQSVVEMHEKWMAQHGRSYKDELEKEMRFKIFKENLEYIEKANKEGN  86

Query  280  RSYKLGTNKFTDLTKEEFQ  336
            R+YKLGTN+F+DLT +EF+
Sbjct  87   RTYKLGTNRFSDLTNDEFR  105



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G C SL T+RTL E S+  +HE+WM+ +GR YKD+ +KAKR   FK+N+++IE  NK   
Sbjct  18   GLCISLVTSRTLYEASITEKHEQWMSQYGRVYKDDTKKAKRLETFKQNLEYIESTNKDVT  77

Query  280  RSYKLGTNKFTDLTKEEFQ  336
            R+YKLG N+F D+T EEF+
Sbjct  78   RTYKLGINQFADMTNEEFK  96



>gb|KDO37366.1| hypothetical protein CISIN_1g048025mg, partial [Citrus sinensis]
Length=246

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  133  LEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNKFT  312
            + E S++ +HE+WM  HGRTYKDE EKA R +IFK+N+++I   NK  NR+YKLGTN+F+
Sbjct  1    MHEPSIVAKHEQWMAQHGRTYKDELEKAMRLNIFKQNLEYIGKANKEGNRTYKLGTNEFS  60

Query  313  DLTKEEFQTT  342
            DLT EEF+ +
Sbjct  61   DLTNEEFRAS  70



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +1

Query  100  GACESLATARTLEE--TSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKA  273
            G   +LA  R L E   S+  RHE+WM  +GRTYKD++EK KRF IFK NV++IE  NKA
Sbjct  18   GMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNVEYIESVNKA  77

Query  274  DNRSYKLGTNKFTDLTKEEFQTT  342
             N+ YKLG N+F D T EEF+ +
Sbjct  78   GNKPYKLGINEFADQTNEEFRAS  100



>ref|XP_006582267.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S    R L ETS+  RHE+WMT +G+ YKD AEK KRF IFK+NV+FIE FN   N+ YK
Sbjct  22   SQVMCRKLHETSMRERHEQWMTEYGKVYKDAAEKEKRFQIFKDNVEFIESFNADGNKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N   DLT EEF+ +
Sbjct  82   LGVNHLADLTVEEFKAS  98



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR+L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   SLA AR+L E S+   H++WM  +GR YK   EK +R  IF+EN+K+I+ FNKA+N
Sbjct  19   GVLASLAAARSLNEASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKYIQTFNKANN  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            + YKLG N+F DLT EEF T+
Sbjct  79   KPYKLGVNEFADLTNEEFTTS  99



>ref|XP_003526207.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=336

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S    R L ETS+  RHE+WMT +G+ YKD AEK KRF IFK+NV+FIE FN   N+ YK
Sbjct  22   SQVMCRKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N   DLT EEF+ +
Sbjct  82   LGVNHLADLTVEEFKAS  98



>ref|XP_006362435.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C  + T+R L+E S+L RHE+WM  HGR YKD+ EK  RF  FKENV+FIE FN+     
Sbjct  22   CPFIVTSRDLKELSMLERHEKWMAHHGRVYKDDIEKEHRFKTFKENVEFIESFNQNGTLR  81

Query  286  YKLGTNKFTDLTKEEFQTTMLN  351
            YKL  NK+ DLT EEF  + + 
Sbjct  82   YKLAINKYADLTTEEFTASFMG  103



>gb|KHN28095.1| Thiol protease [Glycine soja]
Length=336

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S    R L ETS+  RHE+WMT +G+ YKD AEK KRF IFK+NV+FIE FN   N+ YK
Sbjct  22   SQVMCRKLHETSMRERHEQWMTEYGKVYKDAAEKDKRFQIFKDNVEFIESFNADGNKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N   DLT EEF+ +
Sbjct  82   LGVNHLADLTVEEFKAS  98



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +1

Query  100  GACESLATARTLEE--TSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKA  273
            G   +LA  R L E   S+  RHE+WM  +GRTYKD++EK KRF IFK NV++IE  NKA
Sbjct  18   GMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFKSNVEYIESVNKA  77

Query  274  DNRSYKLGTNKFTDLTKEEFQTT  342
             N+ YKLG N+F D T EEF+ +
Sbjct  78   GNKPYKLGINEFADQTNEEFRAS  100



>ref|XP_009798360.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=341

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDF-NKAD  276
            G  ES  T+R ++E S+L +HE WM  HGRTYK+E EK KR +IFKENVKFIE F N   
Sbjct  19   GMYESQVTSRNIQELSMLEKHELWMANHGRTYKNEEEKEKRLNIFKENVKFIESFNNNGI  78

Query  277  NRSYKLGTNKFTDLTKEEF  333
             + YK+G N F DLT EEF
Sbjct  79   KKPYKIGINAFADLTAEEF  97



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C   A ARTL++ S+  RHE+WM  HG+ Y D +EK +++ IFKENV+ IE FN A N+ 
Sbjct  20   CALEANARTLQDASMRERHEQWMVTHGKLYLDSSEKEQKYQIFKENVQRIEAFNNAGNKP  79

Query  286  YKLGTNKFTDLTKEEFQT  339
            YKLG N+F DLT EEF+ 
Sbjct  80   YKLGINQFADLTNEEFKA  97



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            T+RTL++ S+  RHE WMT +GR YKD  E+ KR  IFKENV +IE FN A N+ YKL  
Sbjct  26   TSRTLQDASMNERHEEWMTRYGRVYKDPPEREKRLRIFKENVNYIEAFNNAANKPYKLAV  85

Query  301  NKFTDLTKEEF  333
            N+F DLT EEF
Sbjct  86   NQFADLTNEEF  96



>ref|XP_007132814.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
 gb|ESW04808.1| hypothetical protein PHAVU_011G126700g [Phaseolus vulgaris]
Length=333

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S   +R L ETSL  RHE WM  +G+ YKD AEK KRF IFK+NV+FIE FN   N+ YK
Sbjct  22   SQVMSRKLHETSLRERHENWMQEYGKVYKDAAEKEKRFLIFKDNVEFIESFNAVGNKPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT +EF+ +
Sbjct  82   LGVNHFADLTVQEFKAS  98



>ref|XP_010042857.1| PREDICTED: actinidain-like [Eucalyptus grandis]
Length=133

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            + RTL E+++  +HE+WM  +GRTYKD+ EK KR  IFK++++FIEDFN + NR++KLG 
Sbjct  26   SVRTLHESNIAEQHEQWMAQYGRTYKDQGEKEKRRAIFKKHLQFIEDFNASGNRTFKLGI  85

Query  301  NKFTDLTKEEF  333
            N+F+DLT +EF
Sbjct  86   NQFSDLTDDEF  96



>ref|XP_009352948.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=364

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S AT+RTL + S+  +HE+WM  HGR Y+D AEK +RF IFK NV+F+E FN   N
Sbjct  17   GTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKDRRFQIFKNNVEFVEKFNSEGN  76

Query  280  RSYKLGTNKFTDLTKEEF  333
             +Y L  N+F+D+T +EF
Sbjct  77   MTYSLRINRFSDMTYDEF  94



>gb|KCW76121.1| hypothetical protein EUGRSUZ_D00498 [Eucalyptus grandis]
Length=249

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YK+  N
Sbjct  27   CRPLEEEQLLKQHEEWMAIHGRVYKDSVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVN  86

Query  304  KFTDLTKEEFQTT  342
            KF DLT EEF+ +
Sbjct  87   KFADLTNEEFRAS  99



>ref|XP_002446135.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
 gb|EES10463.1| hypothetical protein SORBIDRAFT_06g002170 [Sorghum bicolor]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C S+  AR L + +++ RHE WM  +GR YKD AEKA+RF +FK+NV F+E FN   N  
Sbjct  18   CSSVLAARELSDAAMVERHENWMVEYGRVYKDAAEKARRFEVFKDNVAFVESFNTNKNNK  77

Query  286  YKLGTNKFTDLTKEEFQT  339
            + LG N+F DLT EEF+ 
Sbjct  78   FWLGINQFADLTIEEFKA  95



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A++R L E S++ +H +WM   GR YKD+AEKAKR  IFKEN ++I+  NKA  R YK
Sbjct  12   SRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYK  71

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT EEF+ T
Sbjct  72   LGINDFADLTNEEFRAT  88



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  46   MAFNYHfklvvlaalfllGACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRF  225
            MA N  +  + LA +F+LGA  S A AR+L++ S+  RHE+WM  +G+ YKD  EK  R 
Sbjct  1    MALNTQYPRISLALIFILGALASQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRR  60

Query  226  HIFKENVKFIEDFNKADNRSYKLGTNKFTDLTKEEFQTT  342
             IFK NV+ IE FNKA  + YKLG N+F DLT EEF+T+
Sbjct  61   KIFKRNVERIESFNKAGGKPYKLGINQFADLTNEEFKTS  99



>gb|AFP73356.1| cysteine protease [Solanum pennellii]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AAM19208.1|AF493233_1 cysteine protease [Solanum pennellii]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S AT+RTL + S+  +HE+WM  HGR Y+D AEK +RFHIFK NV+F+E FN   N
Sbjct  17   GTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKERRFHIFKNNVEFVEKFNSEGN  76

Query  280  RSYKLGTNKFTDLTKEEF  333
             +Y L  N+F+D+T +EF
Sbjct  77   MTYSLCINRFSDMTYDEF  94



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             ++RTL++ S+  RHE+WM  +G+ YKD  EK KRF+IF+ENVK+IE  N A N+ YKLG
Sbjct  25   VSSRTLQDASMHERHEQWMARYGKVYKDLQEKEKRFNIFQENVKYIEASNNAGNKPYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
             N+FTDLT +EF  T
Sbjct  85   VNQFTDLTNKEFIAT  99



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A++R L E S++ +H +WM   GR YKD+AEKAKR  IFKEN ++I+  NKA  R YK
Sbjct  4    SRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYK  63

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT EEF+ T
Sbjct  64   LGINDFADLTNEEFRAT  80



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            T R+L++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL  
Sbjct  9    TCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLAI  68

Query  301  NKFTDLTKEEF  333
            N+F DLT EEF
Sbjct  69   NQFADLTNEEF  79



>gb|EMT04560.1| Vignain [Aegilops tauschii]
Length=258

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S+  AR L ++ S++ RHE WM  +GR YKD+AEKA+RF +FK NV FI+ FN A N 
Sbjct  18   CSSVLAARELSDDLSMVARHESWMVQYGRVYKDDAEKAQRFGVFKANVGFIKSFN-AKNL  76

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT EEF+ T  N+
Sbjct  77   KFYLGVNQFADLTNEEFKATKANK  100



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T R+L++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL 
Sbjct  8    VTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLA  67

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  68   INQFADLTNEEF  79



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T R+L++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL 
Sbjct  8    VTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLA  67

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  68   INQFADLTNEEF  79



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YKL  NK
Sbjct  28   RPLEEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKLAVNK  87

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  88   FADLTNEEFRAS  99



>gb|AFP73349.1| cysteine protease [Solanum chmielewskii]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            AC+  ATART  + S++  HE+WM  +GR YK++AEKA R+ IFK NV++I+  N A+ R
Sbjct  3    ACDR-ATARTTPDASMVKMHEKWMVQNGRVYKNDAEKAFRYKIFKANVEYIQSSNNAETR  61

Query  283  SYKLGTNKFTDLTKEEFQTT  342
             YKL  NKF DLT EEFQ +
Sbjct  62   PYKLAVNKFADLTNEEFQAS  81



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T R+L++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL 
Sbjct  25   VTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>gb|AFP73360.1| cysteine protease [Solanum chilense]
Length=345

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T R+L++ S+  RHE+WMT +G+ YKD  E+ KRF IFKENV +IE FN A N+ YKL 
Sbjct  25   VTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKENVNYIEAFNNAANKRYKLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A++R L E S++ +H +WM   GR YKD+AEKAKR  IFKEN ++I+  NKA  R YK
Sbjct  22   SRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKENAEYIDSVNKAGIRPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT EEF+ T
Sbjct  82   LGINDFADLTNEEFRAT  98



>gb|AFP73351.1| cysteine protease [Solanum corneliomuelleri]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>gb|AFP73369.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARXLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>gb|AFP73320.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73340.1| cysteine protease [Solanum peruvianum]
 gb|AFP73345.1| cysteine protease [Solanum peruvianum]
 gb|AFP73346.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73330.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73364.1| cysteine protease [Solanum peruvianum]
 gb|AFP73366.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73329.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73321.1| cysteine protease [Solanum peruvianum]
 gb|AFP73336.1| cysteine protease [Solanum peruvianum]
 gb|AFP73341.1| cysteine protease [Solanum peruvianum]
 gb|AFP73343.1| cysteine protease [Solanum peruvianum]
 gb|AFP73344.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_004232967.2| PREDICTED: zingipain-2 [Solanum lycopersicum]
 gb|AAM19209.1|AF493234_1 cysteine protease [Solanum lycopersicum]
 gb|AFP73353.1| cysteine protease [Solanum lycopersicum]
Length=345

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73365.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73331.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73328.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73312.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73311.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73316.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>gb|AFP73338.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73323.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73319.1| cysteine protease [Solanum peruvianum]
 gb|AFP73337.1| cysteine protease [Solanum peruvianum]
 gb|AFP73339.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73315.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AAM19207.1|AF493232_1 cysteine protease [Solanum pimpinellifolium]
 gb|AFP73350.1| cysteine protease [Solanum pimpinellifolium]
 gb|AFP73354.1| cysteine protease [Solanum lycopersicum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73333.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73324.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|AFP73314.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S A AR + +  +L RHE+WM  +GR YKD AEK +RF IF+ N ++IE  N+A +
Sbjct  4    GVWVSGAMARGIADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFRGNYEYIESINRAGD  63

Query  280  RSYKLGTNKFTDLTKEEFQTTMLN  351
            R YKLG N+F D+T EEF+ + L 
Sbjct  64   RKYKLGLNQFADMTNEEFKASRLG  87



>ref|XP_010059348.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74683.1| hypothetical protein EUGRSUZ_E03413 [Eucalyptus grandis]
Length=352

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            + RTL E+++  +HE+WM  HGRTYKD+ EK KR  IFK++++FIEDFN + NR++KLG 
Sbjct  26   SVRTLHESNIAEQHEQWMAQHGRTYKDQEEKEKRRAIFKKHLQFIEDFNASGNRTFKLGI  85

Query  301  NKFTDLTKEEF  333
            N+F+DLT +EF
Sbjct  86   NQFSDLTDDEF  96



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A+ R L E++++ RHE+WM  HG+ YKD+ EK +RF IFK NV+FIE  N A N SY LG
Sbjct  25   ASTRELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFKNNVEFIESSNAAGNNSYMLG  84

Query  298  TNKFTDLTKEEFQTT  342
             N+F DLT EEF+ +
Sbjct  85   INRFADLTNEEFRAS  99



>gb|AFP73367.1| cysteine protease [Solanum peruvianum]
 gb|AFP73373.1| cysteine protease [Solanum peruvianum]
 gb|AFP73374.1| cysteine protease [Solanum peruvianum]
 gb|AFP73376.1| cysteine protease [Solanum peruvianum]
 gb|AFP73377.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A AR L E S+  RHE+WM  HGR YK + EK +RF IFK NV+FIE FN+ + R YK
Sbjct  8    SQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPYK  67

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT +EF+ T
Sbjct  68   LGINGFADLTNDEFKAT  84



>gb|AFP73332.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKVERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_002436840.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
 gb|EER88207.1| hypothetical protein SORBIDRAFT_10g009830 [Sorghum bicolor]
Length=328

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L ++++++ RHE+WM  + R YKD  EKA+RF +FK NVKFIE FN   NR
Sbjct  18   CGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANVKFIESFNAGGNR  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF+ T  N+
Sbjct  78   KFWLGVNQFADLTNDEFRATKTNK  101



>gb|AFP73313.1| cysteine protease [Solanum peruvianum]
 gb|AFP73371.1| cysteine protease [Solanum peruvianum]
 gb|AFP73372.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKVERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_004975182.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C S+  AR L + +++ RHE+WM  +GR YKD AEKA+RF +FK+NV FIE FN A N  
Sbjct  18   CSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVFKDNVAFIESFN-AGNTK  76

Query  286  YKLGTNKFTDLTKEEFQTTMLNE  354
            + L  N+F DLT +EF+ T  N+
Sbjct  77   FWLAVNQFADLTNDEFRATKANK  99



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+RTL++ S+  RHE+WM  +GR Y D  E+ +RF+IFKENV  I+ FN+A +
Sbjct  21   GALVCEATSRTLQDASMYERHEQWMARYGRVYHDNNEREQRFNIFKENVAHIDSFNRAKD  80

Query  280  RSYKLGTNKFTDLTKEEF  333
            + YKLG N+F DLT EEF
Sbjct  81   KPYKLGVNQFADLTNEEF  98



>gb|AFP73335.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKVERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_004975183.1| PREDICTED: vignain-like [Setaria italica]
Length=338

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C S+  AR L + +++ RHE+WM  +GR YKD AEKA+RF +FK+NV FIE FN A N  
Sbjct  18   CSSILAARELSDAAMVERHEKWMVEYGRVYKDTAEKAQRFEVFKDNVAFIESFN-AGNTK  76

Query  286  YKLGTNKFTDLTKEEFQTTMLNE  354
            + L  N+F DLT +EF+ T  N+
Sbjct  77   FWLAVNQFADLTNDEFRATKANK  99



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S ATAR L E S+  RHE WM  +GR YKD  EK+KR+ IFK+NV  IE FNKA ++
Sbjct  20   AWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIESFNKAMDK  79

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKL  N+F DLT EEF+ +
Sbjct  80   SYKLSINEFADLTNEEFRAS  99



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C S+  AR L ++ S++ RHERWM  + R YKD  EKA RF +FK NV FIE FN A+NR
Sbjct  73   CSSVLAARELNDDLSMVARHERWMVQYNRVYKDTTEKAHRFEVFKANVGFIESFN-AENR  131

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+FTDLT EEF+ T  N+
Sbjct  132  KFYLGINQFTDLTNEEFKATKANK  155



>gb|AFP73342.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKVERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  121  TARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             AR L ++++++ RHE+WM  + R YKD AEKA+RF +F  NVKFIE FN A NR + LG
Sbjct  23   AARALSDDSAMVARHEQWMAQYSRVYKDAAEKARRFEVFNANVKFIESFNAAGNRKFWLG  82

Query  298  TNKFTDLTKEEFQTTMLNE  354
             N+F DLT +EF+ T  N+
Sbjct  83   VNQFADLTNDEFRATKTNK  101



>gb|AFP73347.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_002436841.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
 gb|EER88208.1| hypothetical protein SORBIDRAFT_10g009840 [Sorghum bicolor]
Length=328

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L ++++++ RHE+WM  + R YKD  EKA+RF +FK NVKFIE FN   NR
Sbjct  18   CGAALAARDLNDDSAMVARHEQWMVQYSRVYKDTTEKARRFEVFKANVKFIESFNAGGNR  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF+ T  N+
Sbjct  78   KFWLGVNQFADLTNDEFRATKTNK  101



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S A AR L E S+  RHE+WM  HGR YK + EK +RF IFK NV+FIE FN+ + R YK
Sbjct  22   SQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFKNNVEFIESFNENNTRPYK  81

Query  292  LGTNKFTDLTKEEFQTT  342
            LG N F DLT +EF+ T
Sbjct  82   LGINGFADLTNDEFKAT  98



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YK+  NK
Sbjct  28   RPLEEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNK  87

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  88   FADLTNEEFRAS  99



>gb|AFP73322.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFKEN+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKVERFMIFKENMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S + ARTL +  +  RHE+WMT +GR YKD+ E+A R+ IFKENV  ++ FN    
Sbjct  39   GAWPSKSIARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKENVARVDAFNSQTG  98

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+ +
Sbjct  99   KSYKLGVNQFADLTNEEFKAS  119



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            T+RTL++TS+  RH  WMT +GR YKD  E+ KR  IFKENV +IE FN A N+ YKL  
Sbjct  26   TSRTLQDTSMNERHAEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLAV  85

Query  301  NKFTDLTKEEF  333
            N+F DLT EEF
Sbjct  86   NQFADLTNEEF  96



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YK+  NK
Sbjct  28   RPLEEEQLLKQHEEWMAIHGRVYKDTVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNK  87

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  88   FADLTNEEFRAS  99



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T+RTL++ S+  RHE WMT +GR YKD  E+ KR  IFKENV +IE FN A N+ YKL 
Sbjct  25   VTSRTLQDASMNERHEEWMTRYGRVYKDPQEREKRLRIFKENVNYIEAFNNAANKPYKLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>emb|CAE03344.2| OSJNBb0005B05.11 [Oryza sativa Japonica Group]
 gb|EAZ29753.1| hypothetical protein OsJ_13812 [Oryza sativa Japonica Group]
Length=323

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C ++  AR L ++ ++  RHERWM  +GR YKD+AEKA+RF +FK NV FIE FN A N 
Sbjct  18   CSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIESFN-AGNH  76

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF++T  N+
Sbjct  77   KFWLGVNQFADLTNDEFRSTKTNK  100



>ref|NP_001052232.2| Os04g0203500 [Oryza sativa Japonica Group]
 dbj|BAF14146.2| Os04g0203500 [Oryza sativa Japonica Group]
Length=336

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C ++  AR L ++ ++  RHERWM  +GR YKD+AEKA+RF +FK NV FIE FN A N 
Sbjct  18   CSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIESFN-AGNH  76

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF++T  N+
Sbjct  77   KFWLGVNQFADLTNDEFRSTKTNK  100



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T RTL++ S+  RH +WM  + + YKD  E+ KRF IFKENV +IE FN ADN+SYKL 
Sbjct  25   VTCRTLQDASMYERHAQWMARYAKVYKDPQEREKRFRIFKENVNYIETFNSADNKSYKLD  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L ++++++ RHE+WM  + R YKD  EKA+RF +FK NVKFIE FN   NR
Sbjct  18   CGAALAARDLNDDSAMVARHEQWMAQYNRVYKDATEKAQRFEVFKANVKFIESFNAGGNR  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF+ T  N+
Sbjct  78   KFWLGVNQFADLTNDEFRATKTNK  101



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YK+  NK
Sbjct  28   RPLEEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVNK  87

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  88   FADLTNEEFRAS  99



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S A ARTL++ S+  +HE WMT   R Y D  EK  R+ IFKENV+ IE FNKA  
Sbjct  19   GALASQAIARTLQDASIHEKHEEWMTRFKRVYSDAKEKEIRYKIFKENVQRIESFNKASE  78

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            +SYKLG N+F DLT EEF+T+
Sbjct  79   KSYKLGINQFADLTNEEFKTS  99



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +1

Query  106  CESLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C ++  AR L ++ ++  RHERWM  +GR YKD+AEKA+RF +FK NV FIE FN A N 
Sbjct  18   CSAVLAARELSDDAAMAARHERWMAQYGRMYKDDAEKARRFEVFKANVAFIESFN-AGNH  76

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF++T  N+
Sbjct  77   KFWLGVNQFADLTNDEFRSTKTNK  100



>ref|XP_010052198.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76120.1| hypothetical protein EUGRSUZ_D00497 [Eucalyptus grandis]
Length=345

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKENVK I  FN   +  YK+  N
Sbjct  27   CRPLEEEHLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENVKRINAFNNGKDVGYKMAVN  86

Query  304  KFTDLTKEEFQTT  342
            KF DLT EEF+ +
Sbjct  87   KFADLTNEEFRAS  99



>ref|XP_008340275.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=660

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G   S AT+RTL E S+  +HE+WM   GR Y+D AEK +RFHIFK NV+F+E FN    
Sbjct  17   GTLASQATSRTLYEASIAAKHEQWMEKFGRVYQDSAEKERRFHIFKNNVEFVEKFNSEGK  76

Query  280  RSYKLGTNKFTDLTKEEF  333
            ++Y+LG N+F+D+T EEF
Sbjct  77   KTYELGVNRFSDMTYEEF  94


 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            +L T  +    S+  +HE+WM   GR Y+D AEK +RFHIFK NV+F+E FN    + YK
Sbjct  340  TLGTLASQATFSIAAKHEQWMEKFGRVYQDSAEKERRFHIFKNNVEFVEKFNSEGKKKYK  399

Query  292  LGTNKFTDLTKEEF  333
            L  N+F+D+T EEF
Sbjct  400  LSINQFSDMTHEEF  413



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+RTL++ S+  RHE+WM  +GR Y+D  E+ +RF+IFKENV  I+ FN+A +
Sbjct  21   GALVCEATSRTLQDASMYERHEQWMARYGRVYQDNNEREQRFNIFKENVARIDSFNRAKD  80

Query  280  RSYKLGTNKFTDLTKEEF  333
            + YKLG N+F DLT +EF
Sbjct  81   KPYKLGVNQFADLTNDEF  98



>ref|XP_010054318.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=343

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R LEE  LL +HE W+ +HGR YKD AEKAKR+ IFKENVK I  FN   +  YK+  N
Sbjct  27   CRPLEEKQLLKQHEEWVAIHGRVYKDVAEKAKRYEIFKENVKHINAFNNGKDLGYKMAVN  86

Query  304  KFTDLTKEEFQTT  342
            KF DLT EEF+ +
Sbjct  87   KFADLTNEEFRAS  99



>ref|XP_010054324.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76138.1| hypothetical protein EUGRSUZ_D00514 [Eucalyptus grandis]
Length=339

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  115  LATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKL  294
            LA  RTL E S+  +HE+W+T HGR Y D  EK KR  IF  NV+FIEDFN+A NR++KL
Sbjct  23   LAAFRTLHEASIEQKHEQWITKHGRIYADSEEKGKRLEIFANNVRFIEDFNRAGNRTFKL  82

Query  295  GTNKFTDLTKEEF  333
            G N F+D T +EF
Sbjct  83   GLNAFSDKTVDEF  95



>ref|XP_002522572.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39872.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  112  SLATARTL-EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSY  288
            S A  R L +E ++  +HE+WM  HGRTY+D+ EK +RFHIFK+N+K IE+FN A NR+Y
Sbjct  21   SQAMPRPLIDEDAVAEKHEQWMARHGRTYQDDEEKERRFHIFKKNLKHIENFNNAFNRTY  80

Query  289  KLGTNKFTDLTKEEFQTT  342
            KLG N F DLT EEF  T
Sbjct  81   KLGLNHFADLTDEEFLAT  98



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            +R L ETS+  RHE+WM  +G+ YKD AEK KRF IFK NV+FIE FN A N+ YKLG N
Sbjct  26   SRKLHETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIESFNAAANKPYKLGVN  85

Query  304  KFTDLTKEEFQTT  342
               DLT EEF+ +
Sbjct  86   HLADLTVEEFKAS  98



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             ++RTL++ S+  RHE+WM  +GR YKD  EK KRF IFKENV +IE  N A ++ YKLG
Sbjct  25   VSSRTLQDASMQERHEQWMARYGRVYKDLQEKEKRFSIFKENVNYIEASNNAGDKPYKLG  84

Query  298  TNKFTDLTKEEFQTT  342
             N+F DLT EEF  T
Sbjct  85   VNQFADLTNEEFIAT  99



>gb|KHN27797.1| Thiol protease SEN102 [Glycine soja]
Length=335

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
            +R L ETS+  RHE+WM  +G+ YKD AEK KRF IFK NV+FIE FN A N+ YKLG N
Sbjct  26   SRKLHETSMRERHEQWMAEYGKVYKDAAEKEKRFLIFKHNVEFIESFNAAANKPYKLGVN  85

Query  304  KFTDLTKEEFQTT  342
               DLT EEF+ +
Sbjct  86   HLADLTVEEFKAS  98



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  RTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNK  306
            R LEE  LL +HE WM +HGR YKD  EKAKR+ IFKEN+K I  FN   +  YK+  NK
Sbjct  28   RPLEEEQLLKQHEEWMAIHGRVYKDAVEKAKRYEIFKENIKRINAFNNGKDVGYKMAVNK  87

Query  307  FTDLTKEEFQTT  342
            F DLT EEF+ +
Sbjct  88   FADLTNEEFRAS  99



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             + RTL++ S+  RHE+WMT + R YKD  EK KRF IFKENVK+IE FN A N++Y L 
Sbjct  25   VSCRTLQDASMHERHEQWMTRYSRVYKDPEEKEKRFRIFKENVKYIEAFNNAANKAYNLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>ref|XP_007132882.1| hypothetical protein PHAVU_011G1328001g, partial [Phaseolus vulgaris]
 gb|ESW04876.1| hypothetical protein PHAVU_011G1328001g, partial [Phaseolus vulgaris]
Length=146

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T+RTL++ S+  RHE WM  + R YKD  EK KRF IFK+N+ +IE FN A N+ YKL 
Sbjct  25   VTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFRIFKQNMNYIEAFNNAANKPYKLA  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
             T+RTL++ S+  RHE WM  + + YKD  E+ KRF IFKENV +IE FN A N+ YKLG
Sbjct  25   VTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKENVNYIEAFNNAANKPYKLG  84

Query  298  TNKFTDLTKEEF  333
             N+F DLT EEF
Sbjct  85   INQFADLTNEEF  96



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S + ARTL++ S+  RHE+WM  +GR YKD+AEK  R++IFKENV  I+ FN    +
Sbjct  45   AWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKENVARIDAFNSQTGK  104

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKLG N+F DL+ EEF+ +
Sbjct  105  SYKLGVNQFADLSNEEFKAS  124



>gb|KCW76118.1| hypothetical protein EUGRSUZ_D00495 [Eucalyptus grandis]
Length=355

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R LEE  LL +HE W+ +HGR YKD AEKAKR+ IFKENVK I  FN   +  YK+  N
Sbjct  39   CRPLEEKQLLKQHEEWVAIHGRVYKDVAEKAKRYEIFKENVKHINAFNNGKDLGYKMAVN  98

Query  304  KFTDLTKEEFQTT  342
            KF DLT EEF+ +
Sbjct  99   KFADLTNEEFRAS  111



>ref|XP_002522571.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39871.1| cysteine protease, putative [Ricinus communis]
Length=343

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  157  RHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTNKFTDLTKEEFQ  336
            +HE+WM  HGRTY D AEK +RF IFK N+ +IE+FNKA N++YKLG NKF+DL++EEF 
Sbjct  39   KHEQWMARHGRTYHDNAEKERRFQIFKNNLDYIENFNKAFNKTYKLGLNKFSDLSEEEFV  98

Query  337  TT  342
            TT
Sbjct  99   TT  100



>ref|XP_010059344.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74668.1| hypothetical protein EUGRSUZ_E03399 [Eucalyptus grandis]
Length=340

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            + RTL E+++  +HE+WM  +GRTYKD+ EK KR  IFK++++FIEDFN + NR++KLG 
Sbjct  26   SVRTLHESNIAEQHEQWMAQYGRTYKDQGEKEKRRAIFKKHLQFIEDFNASGNRTFKLGI  85

Query  301  NKFTDLTKEEF  333
            N+F+DLT +EF
Sbjct  86   NQFSDLTDDEF  96



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            A  S + ARTL++ S+  RHE+WM  +GR YKD AEK  R++IFK NV  I++FN    +
Sbjct  19   AWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDNAEKETRYNIFKANVARIDEFNSQTGK  78

Query  283  SYKLGTNKFTDLTKEEFQTT  342
            SYKLG N+F DL+ EEF+ +
Sbjct  79   SYKLGVNQFADLSNEEFKAS  98



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+R+L++ S+  R+E+WMT +GR Y D  EK  RF IFKENV FIE  N   N
Sbjct  3    GAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVN  62

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            + YKLG N+F DLT EEF+ +
Sbjct  63   KPYKLGVNQFADLTNEEFKAS  83



>ref|XP_006582266.1| PREDICTED: thiol protease SEN102-like [Glycine max]
Length=341

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  112  SLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYK  291
            S    R L +TSL  RHE WM  +G+ YKD AEK KRF IFK+NV+FIE FN A N+ YK
Sbjct  22   SQVMPRKLHQTSLRERHENWMAEYGKMYKDAAEKEKRFQIFKDNVEFIESFNAAGNKPYK  81

Query  292  LGTNKFTDLTKEEFQ  336
            LG N   DLT EEF+
Sbjct  82   LGVNHLADLTLEEFK  96



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+R+L++ S+  R+E+WMT +GR Y D  EK  RF IFKENV FIE  N   N
Sbjct  3    GAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVN  62

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            + YKLG N+F DLT EEF+ +
Sbjct  63   KPYKLGVNQFADLTNEEFKAS  83



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A ARTLE+ SL  RHE+WMT +G+ Y D  EK  R +IFKENV+ IE FN A N+ YKLG
Sbjct  25   ANARTLEDVSLKERHEQWMTQYGKVYTDSYEKELRSNIFKENVQRIEAFNNAGNKPYKLG  84

Query  298  TNKFTDLTKEEFQT  339
             N+F DLT EEF+ 
Sbjct  85   INQFADLTNEEFKA  98



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+R+L++ S+  R+E+WMT +GR Y D  EK  RF IFKENV FIE  N   N
Sbjct  3    GAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVN  62

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            + YKLG N+F DLT EEF+ +
Sbjct  63   KPYKLGVNQFADLTNEEFKAS  83



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A ARTLE+ S+  RHE+WM  +G+ YKD  EK  R  IFKENV+ IE FN A N+SYKLG
Sbjct  25   ANARTLEDASMHERHEQWMAQYGKVYKDSYEKELRSKIFKENVQRIEAFNNAGNKSYKLG  84

Query  298  TNKFTDLTKEEFQT  339
             N+F DLT EEF+ 
Sbjct  85   INQFADLTNEEFKA  98



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  106  CESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            C    T+RTL++ S+  RHE WM  + R YKD  EK KRF IFK+N+ +IE FN A N+ 
Sbjct  21   CALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFKIFKQNMNYIEAFNNAANKP  80

Query  286  YKLGTNKFTDLTKEEF  333
            YKL  N+F DLT EEF
Sbjct  81   YKLAINQFADLTNEEF  96



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  103  ACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            AC+   T R L+E S+  RHE+WM   G+ Y D AEK +RF IFK+NV++IE FN A N+
Sbjct  21   ACQ--VTPRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFKDNVEYIESFNTAGNK  78

Query  283  SYKLGTNKFTDLTKEEFQ  336
             YKL  NKF DLT EE +
Sbjct  79   PYKLSVNKFADLTNEELK  96



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA    AT+R+L++ S+  R+E+WMT +GR Y D  EK  RF IFKENV FIE  N   N
Sbjct  16   GAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKENVAFIESSNNDVN  75

Query  280  RSYKLGTNKFTDLTKEEFQTT  342
            + YKLG N+F DLT EEF+ +
Sbjct  76   KPYKLGVNQFADLTNEEFKAS  96



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR-SYKL  294
             T+RTL++ S+  RHERWM  +G+ YKD  E+ KRF IF EN+K+IE FN  DN  SYKL
Sbjct  25   VTSRTLQDGSMHERHERWMNHYGKVYKDHQEREKRFKIFTENMKYIEAFNNGDNNESYKL  84

Query  295  GTNKFTDLTKEEF  333
            G N+F DLT EEF
Sbjct  85   GINQFADLTNEEF  97



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            AT+R L E S++ +HE+WM   GR Y+D+ EKAKRF+IFK+N  +IE  NKA  R YKL 
Sbjct  24   ATSRDLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFKDNFDYIESINKAGMRPYKLR  83

Query  298  TNKFTDLTKEEFQTT  342
             N F DLT EEF+ T
Sbjct  84   INGFADLTNEEFRAT  98



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  118  ATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLG  297
            A  RTLE+ S+  RHE+WM  HG+ YKD  EK  R+ IF++NVK IE FN A N+S+KLG
Sbjct  25   ANTRTLEDASMHERHEQWMAQHGKVYKDHHEKELRYKIFQQNVKGIEGFNNAGNKSHKLG  84

Query  298  TNKFTDLTKEEFQT  339
             N+F DLT+EEF+ 
Sbjct  85   VNQFADLTEEEFKA  98



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +1

Query  106  CESLATARTLEETSLLL-RHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNR  282
            C +   AR L + S+++ RHE+WM  + R YKD +EKA+RF +FK NV+FIE FN   N 
Sbjct  18   CGAAMAARDLSDDSVMVARHEQWMAQYSRVYKDASEKARRFEVFKANVQFIESFNAGGNN  77

Query  283  SYKLGTNKFTDLTKEEFQTTMLNE  354
             + LG N+F DLT +EF++T  N+
Sbjct  78   KFWLGVNQFADLTNDEFRSTKTNK  101



>ref|XP_009594088.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=356

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            G C    T+R L+E S+  RHE+W+  HGR YKDE EK + F IFKENV+FIE FN+   
Sbjct  27   GICSFKVTSRDLQEASMQERHEKWIVRHGREYKDEIEKERHFRIFKENVEFIESFNQNGT  86

Query  280  RSYKLGTNKFTDLTKEEF  333
            + YKL  NK+ DLT E+F
Sbjct  87   QRYKLAINKYADLTTEDF  104



>gb|KCW74661.1| hypothetical protein EUGRSUZ_E03389 [Eucalyptus grandis]
Length=340

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  TARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGT  300
            + RTL E+++  +HE+WM  +GRTYKD+ EK KR  IFK++++FIEDFN + NR++KLG 
Sbjct  26   SVRTLHESNIAEQHEQWMAKYGRTYKDQGEKEKRRAIFKKHLQFIEDFNASGNRTFKLGI  85

Query  301  NKFTDLTKEEF  333
            N+F+DLT +EF
Sbjct  86   NQFSDLTDDEF  96



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  100  GACESLATARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADN  279
            GA  S AT+R+L++ S+  RHE+WMT +GR Y D  EK KRF IFKENV +IE  N   +
Sbjct  22   GAWSSEATSRSLQDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFKENVAYIESSNADTS  81

Query  280  RSYKLGTNKFTDLTKEEF  333
            + YKL  N+FTDLT EEF
Sbjct  82   KPYKLRVNQFTDLTNEEF  99



>ref|XP_010469398.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=346

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  112  SLATARTL--EETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRS  285
            S AT+RT+  + TSL+ +HERWM    R Y+DE EK  R  +FK+NVKFIEDFNK  N+S
Sbjct  22   SQATSRTVTFQATSLVDKHERWMARFARVYRDELEKQMRRDVFKKNVKFIEDFNKKGNKS  81

Query  286  YKLGTNKFTDLTKEEF  333
            YKLG N+F D T EEF
Sbjct  82   YKLGVNEFADWTNEEF  97



>gb|AFP73361.1| cysteine protease [Solanum chilense]
Length=344

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  124  ARTLEETSLLLRHERWMTLHGRTYKDEAEKAKRFHIFKENVKFIEDFNKADNRSYKLGTN  303
             R+  + S+  RHE WM+ HGR YKDE EK +RF IFK+N+KFIE  NKA N SYKLG N
Sbjct  27   GRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKKNMKFIESVNKAGNLSYKLGMN  86

Query  304  KFTDLTKEEF  333
            +F D+T +EF
Sbjct  87   EFADITSQEF  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518329882422