BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22489_g1_i1 len=189 path=[843:0-53 897:54-188]

Length=189
                                                                      Score     E

ref|XP_002522571.1|  cysteine protease, putative                      80.5    2e-16   Ricinus communis
ref|XP_006362436.1|  PREDICTED: vignain-like                          75.5    2e-14   
ref|XP_010686290.1|  PREDICTED: zingipain-2-like                      75.1    2e-14   
ref|XP_010045989.1|  PREDICTED: vignain-like                          73.9    3e-14   
ref|XP_010686292.1|  PREDICTED: zingipain-2-like                      74.7    3e-14   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  73.6    7e-14   
ref|XP_004308225.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  73.9    7e-14   
ref|XP_008811650.1|  PREDICTED: vignain-like                          72.8    1e-13   
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                      73.2    1e-13   
emb|CBI30671.3|  unnamed protein product                              72.4    2e-13   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...  72.4    2e-13   Vitis vinifera
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      72.4    2e-13   
ref|XP_007025398.1|  Senescence-associated gene 12                    72.4    2e-13   
emb|CDP18641.1|  unnamed protein product                              72.4    2e-13   
ref|XP_006652104.1|  PREDICTED: vignain-like                          72.0    3e-13   
ref|XP_010686291.1|  PREDICTED: zingipain-2-like                      71.6    4e-13   
ref|NP_001052232.2|  Os04g0203500                                     71.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975184.1|  PREDICTED: vignain-like                          71.2    5e-13   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          71.2    6e-13   
ref|XP_006367780.1|  PREDICTED: ananain-like                          71.2    6e-13   
ref|XP_004234254.1|  PREDICTED: zingipain-2-like                      70.9    7e-13   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  72.4    7e-13   
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like      69.3    7e-13   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like            70.9    7e-13   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410        70.9    8e-13   Sorghum bicolor [broomcorn]
gb|AAM34401.1|AF377947_7  putative cysteine proteinase                70.9    8e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  70.9    8e-13   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like            70.9    8e-13   
gb|EMT00387.1|  Fruit bromelain                                       70.9    8e-13   
gb|EMT20796.1|  Vignain                                               71.2    9e-13   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                   69.7    1e-12   
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                      70.1    1e-12   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...  70.1    1e-12   
gb|EAY93078.1|  hypothetical protein OsI_14879                        70.1    1e-12   Oryza sativa Indica Group [Indian rice]
emb|CAH66233.1|  H0825G02.10                                          70.1    1e-12   Oryza sativa [red rice]
emb|CAD40112.2|  OSJNBa0035O13.5                                      70.1    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ54544.1|  cysteine proteinase                                   67.4    1e-12   Malus domestica [apple tree]
gb|EMT08349.1|  hypothetical protein F775_43327                       69.7    1e-12   
ref|XP_004981743.1|  PREDICTED: cysteine proteinase EP-B 1-like       70.1    1e-12   
gb|AHA62778.1|  RCR3-like cysteine protease                           70.1    1e-12   
gb|AGT16936.1|  vignain-like protein                                  70.1    2e-12   
gb|KHN10462.1|  Vignain                                               70.1    2e-12   
ref|XP_008669676.1|  PREDICTED: ervatamin-B-like                      70.1    2e-12   
emb|CAH66275.1|  OSIGBa0147O06.5                                      69.7    2e-12   Oryza sativa [red rice]
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          70.1    2e-12   
emb|CDP20741.1|  unnamed protein product                              68.2    2e-12   
ref|XP_003549830.2|  PREDICTED: vignain-like                          70.1    2e-12   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like              70.5    2e-12   
emb|CAE54307.1|  cysteine proteinase                                  69.7    2e-12   Gossypium hirsutum [American cotton]
gb|AER60490.1|  cysteine proteases                                    69.7    2e-12   
ref|XP_003526229.1|  PREDICTED: vignain-like                          68.6    3e-12   
gb|EEC84514.1|  hypothetical protein OsI_31214                        69.3    3e-12   Oryza sativa Indica Group [Indian rice]
gb|KHG00992.1|  Cysteinease RD21a -like protein                       69.7    3e-12   
ref|XP_009149742.1|  PREDICTED: zingipain-2-like                      69.3    3e-12   
ref|XP_006362426.1|  PREDICTED: vignain-like                          69.3    3e-12   
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                      69.7    3e-12   
ref|XP_006661542.1|  PREDICTED: fruit bromelain-like                  68.9    3e-12   
gb|AFK46775.1|  unknown                                               69.3    3e-12   
ref|XP_008225326.1|  PREDICTED: actinidain-like                       68.6    3e-12   
gb|KDO63024.1|  hypothetical protein CISIN_1g018958mg                 68.6    3e-12   
gb|ACU23533.1|  unknown                                               67.8    3e-12   Glycine max [soybeans]
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  68.9    3e-12   
gb|AFL46179.1|  INT9 protein                                          67.4    3e-12   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           69.3    3e-12   
gb|KHN38752.1|  Vignain                                               68.6    3e-12   
ref|XP_006651829.1|  PREDICTED: thiol protease SEN102-like            69.3    4e-12   
ref|XP_006378264.1|  hypothetical protein POPTR_0010s06080g           68.6    4e-12   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like            68.9    4e-12   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      68.9    4e-12   
gb|KHN05669.1|  Vignain                                               68.6    4e-12   
gb|AFK36701.1|  unknown                                               68.9    4e-12   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      68.9    4e-12   
ref|XP_008650514.1|  PREDICTED: vignain-like                          67.8    4e-12   
gb|AHA62774.1|  papain-like cysteine protease                         68.9    4e-12   
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like              69.7    4e-12   
ref|XP_002519955.1|  cysteine protease, putative                      68.6    4e-12   Ricinus communis
ref|NP_001275606.1|  fruit bromelain-like precursor                   68.9    4e-12   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  68.9    4e-12   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  68.6    4e-12   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  69.3    4e-12   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      68.6    5e-12   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                 68.6    5e-12   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...  68.6    5e-12   
ref|XP_002522559.1|  cysteine protease, putative                      68.6    5e-12   Ricinus communis
emb|CDY08128.1|  BnaA06g15980D                                        68.6    5e-12   
emb|CDY05926.1|  BnaC08g21030D                                        68.6    5e-12   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...  68.6    5e-12   
gb|AHA62776.1|  papain-like cysteine protease                         68.6    5e-12   
gb|EMT09279.1|  Thiol protease SEN102                                 68.2    5e-12   
gb|EMT20795.1|  Vignain                                               68.6    5e-12   
gb|AAO85377.1|  cysteine proteinase                                   65.5    5e-12   Triticum monococcum [einkorn wheat]
gb|EMT12294.1|  Vignain                                               68.6    5e-12   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...  68.6    6e-12   
gb|KDO63025.1|  hypothetical protein CISIN_1g018958mg                 68.6    6e-12   
gb|KHG18408.1|  Cysteinease RD21a -like protein                       68.9    6e-12   
ref|XP_006445658.1|  hypothetical protein CICLE_v10015798mg           68.6    6e-12   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg           68.6    6e-12   
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like        68.6    6e-12   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...  68.6    6e-12   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...  68.2    6e-12   
gb|EMT08022.1|  Vignain                                               68.2    7e-12   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                      68.6    7e-12   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...  68.2    7e-12   
ref|XP_003593765.1|  Cysteine proteinase                              68.6    7e-12   
dbj|BAF56428.1|  cysteine proteinase                                  68.2    7e-12   Lotus japonicus
gb|EMT33085.1|  Vignain                                               68.2    7e-12   
ref|XP_004501841.1|  PREDICTED: vignain-like                          68.6    7e-12   
gb|EMT29823.1|  Vignain                                               68.2    7e-12   
ref|XP_002525147.1|  cysteine protease, putative                      68.2    8e-12   Ricinus communis
gb|EEE70232.1|  hypothetical protein OsJ_30346                        68.9    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                      68.2    8e-12   
dbj|BAB70669.1|  cysteine proteinase                                  66.6    8e-12   Daucus carota [carrots]
ref|XP_003638507.1|  Cysteine proteinase                              68.2    8e-12   
ref|XP_009606934.1|  PREDICTED: zingipain-2                           68.2    8e-12   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...  67.8    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ85307.1|  unknown                                               68.2    9e-12   Medicago truncatula
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g           67.8    9e-12   
ref|XP_009388208.1|  PREDICTED: oryzain alpha chain-like              67.8    9e-12   
emb|CDY67777.1|  BnaUnng02560D                                        67.4    9e-12   
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like              68.6    9e-12   
gb|EMT15489.1|  Thiol protease SEN102                                 67.8    9e-12   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  67.8    9e-12   
emb|CDP18637.1|  unnamed protein product                              66.6    9e-12   
dbj|BAF56430.1|  cysteine proteinase                                  67.8    1e-11   Lotus japonicus
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  67.8    1e-11   
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                  67.8    1e-11   
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                68.6    1e-11   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like            67.8    1e-11   
dbj|BAJ95283.1|  predicted protein                                    67.8    1e-11   
emb|CAB09698.1|  cysteine proteinase                                  67.8    1e-11   Hordeum vulgare [barley]
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like            67.8    1e-11   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          66.6    1e-11   
gb|EMT29821.1|  Thiol protease SEN102                                 67.8    1e-11   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                      67.8    1e-11   
gb|EMT30386.1|  Fruit bromelain                                       66.2    1e-11   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           67.4    1e-11   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                      67.8    1e-11   
emb|CDY63262.1|  BnaCnng41770D                                        66.2    1e-11   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                      67.8    1e-11   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...  67.4    1e-11   Oryza sativa Indica Group [Indian rice]
gb|EMT01703.1|  Vignain                                               67.0    1e-11   
gb|EMT08019.1|  Vignain                                               67.0    1e-11   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like            67.4    1e-11   
gb|AFW86314.1|  hypothetical protein ZEAMMB73_546353                  66.2    1e-11   
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg           67.8    1e-11   
emb|CDP06286.1|  unnamed protein product                              67.0    1e-11   
ref|XP_006291447.1|  hypothetical protein CARUB_v10017584mg           67.4    1e-11   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                       67.4    1e-11   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           66.6    1e-11   
gb|KHN33968.1|  Vignain                                               66.2    1e-11   
gb|ABF70145.1|  cysteine protease, putative                           67.8    1e-11   Musa acuminata [banana]
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                67.4    1e-11   
ref|XP_003589400.1|  Cysteine protease                                66.2    1e-11   
ref|XP_007155505.1|  hypothetical protein PHAVU_003G207200g           67.8    1e-11   
ref|XP_003538185.1|  PREDICTED: vignain-like                          67.4    2e-11   
emb|CDX73758.1|  BnaC08g22450D                                        67.4    2e-11   
gb|AHA62773.1|  papain-like cysteine protease                         67.4    2e-11   
ref|XP_006280797.1|  hypothetical protein CARUB_v10026767mg           67.0    2e-11   
ref|XP_008221945.1|  PREDICTED: vignain-like                          67.4    2e-11   
gb|EAZ10092.1|  hypothetical protein OsI_32402                        67.4    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like              67.8    2e-11   
gb|EAY97106.1|  hypothetical protein OsI_19029                        67.4    2e-11   Oryza sativa Indica Group [Indian rice]
gb|KFK31525.1|  hypothetical protein AALP_AA6G123900                  67.0    2e-11   
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44             67.4    2e-11   
gb|AES59757.2|  papain family cysteine protease                       68.2    2e-11   
gb|AFP73348.1|  cysteine protease                                     67.0    2e-11   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...  67.0    2e-11   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...  67.0    2e-11   
prf||1910332A  Cys endopeptidase                                      67.4    2e-11
ref|XP_003589506.1|  Cysteine protease                                68.2    2e-11   
gb|KDO63015.1|  hypothetical protein CISIN_1g041011mg                 66.6    2e-11   
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like        67.8    2e-11   
ref|XP_006445818.1|  hypothetical protein CICLE_v10017565mg           66.6    2e-11   
gb|AAB37233.1|  cysteine proteinase                                   67.0    2e-11   Phalaenopsis sp. SM9108
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...  67.0    2e-11   Vigna mungo [urad dal]
ref|XP_002531151.1|  cysteine protease, putative                      67.0    2e-11   Ricinus communis
ref|XP_002466439.1|  hypothetical protein SORBIDRAFT_01g007820        67.0    2e-11   Sorghum bicolor [broomcorn]
ref|XP_006492751.1|  PREDICTED: xylem cysteine proteinase 1-like      67.0    2e-11   
gb|EMS48276.1|  Fruit bromelain                                       67.0    2e-11   
gb|KHG06908.1|  Vignain                                               67.0    2e-11   
emb|CAE03344.2|  OSJNBb0005B05.11                                     66.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      67.0    2e-11   
ref|XP_002463749.1|  hypothetical protein SORBIDRAFT_01g005350        67.4    2e-11   Sorghum bicolor [broomcorn]
ref|XP_004487579.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  67.0    2e-11   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...  67.0    2e-11   
gb|KHN13721.1|  Vignain                                               66.6    2e-11   
gb|KHN08187.1|  Thiol protease SEN102                                 66.6    2e-11   
gb|AFP73330.1|  cysteine protease                                     67.0    2e-11   
gb|AFP73315.1|  cysteine protease                                     67.0    2e-11   
ref|XP_002515048.1|  cysteine protease, putative                      67.0    2e-11   Ricinus communis
ref|NP_001233949.1|  phytophthora-inhibited protease 1                67.0    2e-11   
gb|AFP73367.1|  cysteine protease                                     67.0    2e-11   
gb|AFP73365.1|  cysteine protease                                     67.0    2e-11   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                      67.0    2e-11   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           67.0    2e-11   Populus trichocarpa [western balsam poplar]
gb|AAM19208.1|AF493233_1  cysteine protease                           66.6    2e-11   Solanum pennellii
gb|AAT34987.1|  putative cysteine protease                            67.0    2e-11   Gossypium hirsutum [American cotton]
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           66.6    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  66.6    2e-11   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                      67.0    2e-11   
ref|XP_008780645.1|  PREDICTED: vignain-like                          66.2    2e-11   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400        67.0    2e-11   
gb|AFP73324.1|  cysteine protease                                     67.0    2e-11   
gb|AFW67600.1|  cysteine protease 1                                   66.6    2e-11   
gb|AFP73356.1|  cysteine protease                                     66.6    2e-11   
ref|XP_003557016.1|  PREDICTED: vignain-like                          66.6    2e-11   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...  66.6    2e-11   
gb|KHN07749.1|  Vignain                                               66.2    2e-11   
gb|AFP73338.1|  cysteine protease                                     66.6    2e-11   
gb|AFP73319.1|  cysteine protease                                     66.6    2e-11   
ref|XP_010431171.1|  PREDICTED: senescence-specific cysteine prot...  65.1    2e-11   
gb|AAA92063.1|  cysteinyl endopeptidase                               67.0    2e-11   Vigna radiata [mung bean]
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...  67.0    2e-11   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...  66.6    3e-11   
gb|KHN32069.1|  Vignain                                               66.6    3e-11   
gb|KHN32068.1|  Vignain                                               66.2    3e-11   
ref|XP_006592467.1|  PREDICTED: vignain-like                          66.6    3e-11   
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                  66.6    3e-11   
ref|XP_006592465.1|  PREDICTED: vignain-like                          66.6    3e-11   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...  66.2    3e-11   
gb|ACU18368.1|  unknown                                               65.1    3e-11   Glycine max [soybeans]
gb|ACV52591.1|  phytophthora-inhibited protease 1-like protein        65.1    3e-11   Nicotiana benthamiana
ref|XP_003578656.1|  PREDICTED: ervatamin-B-like                      67.0    3e-11   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g           66.2    3e-11   
emb|CDX68527.1|  BnaC01g26050D                                        66.6    3e-11   
emb|CDP05747.1|  unnamed protein product                              66.6    3e-11   
ref|XP_010054326.1|  PREDICTED: zingipain-2-like                      67.0    3e-11   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g           66.6    3e-11   Populus trichocarpa [western balsam poplar]
gb|AFP73349.1|  cysteine protease                                     66.6    3e-11   
ref|XP_006291370.1|  hypothetical protein CARUB_v10017509mg           66.6    3e-11   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                      66.6    3e-11   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg           66.2    3e-11   
ref|XP_011005599.1|  PREDICTED: vignain-like                          66.6    3e-11   
ref|XP_009420878.1|  PREDICTED: vignain-like                          66.2    3e-11   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg           66.6    3e-11   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g           66.2    3e-11   
ref|NP_680113.3|  KDEL-tailed cysteine endopeptidase CEP2             66.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA06243.1|  pre-pro-TPE4A protein                                66.6    4e-11   Pisum sativum [garden pea]
dbj|BAJ85482.1|  predicted protein                                    66.2    4e-11   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g           66.2    4e-11   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                  67.0    4e-11   
ref|XP_007048796.1|  Senescence-associated gene 12                    66.2    4e-11   
ref|XP_010248729.1|  PREDICTED: vignain-like                          66.6    4e-11   
ref|NP_001104878.1|  maize insect resistance2 precursor               67.0    4e-11   Zea mays [maize]
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...  66.2    4e-11   
sp|P82474.1|CPGP2_ZINOF  RecName: Full=Zingipain-2; AltName: Full...  64.7    4e-11   Zingiber officinale [ginger]
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...  66.2    4e-11   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                      66.2    4e-11   
ref|XP_006592475.1|  PREDICTED: vignain-like                          66.2    4e-11   
ref|XP_002523447.1|  cysteine protease, putative                      66.2    4e-11   Ricinus communis
gb|AFW86315.1|  hypothetical protein ZEAMMB73_539008                  65.9    4e-11   
ref|XP_003526232.1|  PREDICTED: vignain-like                          66.2    4e-11   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      66.2    4e-11   
ref|XP_002321655.1|  hypothetical protein POPTR_0015s09900g           66.2    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003593763.1|  Cysteine proteinase                              66.2    4e-11   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                      66.2    4e-11   
gb|ACN27279.1|  unknown                                               65.1    4e-11   Zea mays [maize]
gb|AFP73358.1|  cysteine protease                                     66.2    4e-11   
ref|XP_007226517.1|  hypothetical protein PRUPE_ppa025615mg           66.2    4e-11   
gb|KDP31986.1|  hypothetical protein JCGZ_12447                       66.2    4e-11   
ref|XP_007025413.1|  Maternal effect embryo arrest 18                 67.4    4e-11   
ref|XP_009385160.1|  PREDICTED: vignain-like                          66.2    5e-11   
emb|CAA84378.1|  cysteine proteinase                                  66.2    5e-11   Vicia sativa [spring vetch]
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      65.9    5e-11   
ref|XP_006291442.1|  hypothetical protein CARUB_v10017578mg           65.9    5e-11   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  65.9    5e-11   
pdb|3P5W|A  Chain A, Actinidin From Actinidia Arguta Planch (Saru...  64.3    5e-11   
ref|XP_006362434.1|  PREDICTED: fruit bromelain-like                  65.9    5e-11   
ref|XP_007575741.1|  PREDICTED: cathepsin L1-like                     65.9    5e-11   
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  66.2    5e-11   
gb|EMT29822.1|  Vignain                                               65.9    5e-11   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      65.9    5e-11   
ref|XP_006445663.1|  hypothetical protein CICLE_v10015799mg           65.9    5e-11   
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...  66.6    5e-11   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...  64.7    5e-11   
ref|XP_008371737.1|  PREDICTED: vignain-like                          64.3    5e-11   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                   65.9    5e-11   
gb|AFW80235.1|  hypothetical protein ZEAMMB73_542371                  64.7    5e-11   
ref|XP_007025415.1|  Senescence-associated gene 12, putative          65.9    5e-11   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  65.9    5e-11   
gb|EJY87990.1|  Cathepsin L                                           65.9    5e-11   
ref|XP_004505502.1|  PREDICTED: vignain-like                          65.9    6e-11   
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...  65.9    6e-11   
ref|XP_009797968.1|  PREDICTED: vignain-like                          65.9    6e-11   
ref|XP_002877666.1|  hypothetical protein ARALYDRAFT_906213           65.5    6e-11   
gb|AFP73357.1|  cysteine protease                                     65.9    6e-11   
emb|CDY10188.1|  BnaC05g04310D                                        65.9    6e-11   
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...  66.6    6e-11   
ref|XP_009137125.1|  PREDICTED: zingipain-2                           65.9    6e-11   
emb|CAQ00115.1|  papain-like cysteine proteinase                      63.9    6e-11   
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  65.9    6e-11   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1          65.9    6e-11   
gb|AES64014.2|  papain family cysteine protease                       64.7    6e-11   
emb|CDY39574.1|  BnaCnng09430D                                        65.1    6e-11   
gb|AAW34134.1|  cysteine protease gp2a                                65.9    6e-11   
gb|AFP73351.1|  cysteine protease                                     65.9    6e-11   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  65.5    6e-11   
gb|KHN07963.1|  Vignain                                               65.1    6e-11   
gb|ABZ80399.1|  cathepsin L3                                          65.1    6e-11   
gb|AFP73311.1|  cysteine protease                                     65.9    6e-11   
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                  65.9    6e-11   
ref|XP_010102922.1|  hypothetical protein L484_018940                 65.9    6e-11   
gb|ABQ10200.1|  cysteine protease Cp2                                 65.9    6e-11   
ref|NP_001067630.1|  Os11g0255300                                     65.9    6e-11   
gb|KCW76140.1|  hypothetical protein EUGRSUZ_D00517                   65.5    6e-11   
gb|KHN33962.1|  Vignain                                               65.1    6e-11   
gb|KDO37366.1|  hypothetical protein CISIN_1g048025mg                 64.3    6e-11   
ref|XP_006857795.1|  hypothetical protein AMTR_s00061p00215070        65.5    6e-11   
ref|NP_001140922.1|  hypothetical protein                             65.9    6e-11   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g           65.5    6e-11   
gb|EAY80530.1|  hypothetical protein OsI_35710                        65.9    6e-11   
gb|AFP73322.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73321.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73317.1|  cysteine protease                                     65.5    7e-11   
ref|NP_001130503.1|  cysteine protease 1                              65.9    7e-11   
gb|KHN07750.1|  KDEL-tailed cysteine endopeptidase CEP1               65.1    7e-11   
gb|AFP73352.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73333.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73327.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73316.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73314.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73312.1|  cysteine protease                                     65.5    7e-11   
emb|CDP15086.1|  unnamed protein product                              65.9    7e-11   
ref|XP_006449486.1|  hypothetical protein CICLE_v10018236mg           65.1    7e-11   
gb|AFP73370.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73342.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73340.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73318.1|  cysteine protease                                     65.5    7e-11   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  65.5    7e-11   
gb|AFP73329.1|  cysteine protease                                     65.5    7e-11   
gb|AFP73323.1|  cysteine protease                                     65.5    7e-11   
emb|CDP18639.1|  unnamed protein product                              65.5    7e-11   
ref|XP_010059083.1|  PREDICTED: zingipain-2-like                      65.5    7e-11   
ref|XP_002522572.1|  cysteine protease, putative                      65.5    7e-11   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  65.5    7e-11   
ref|XP_006857796.1|  hypothetical protein AMTR_s00061p00215230        65.5    7e-11   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  65.5    7e-11   
gb|KHN13720.1|  Vignain                                               65.1    7e-11   
ref|XP_003593764.1|  Cysteine proteinase                              64.7    7e-11   
gb|EPS65491.1|  hypothetical protein M569_09284                       65.5    7e-11   
emb|CBI14901.3|  unnamed protein product                              64.7    7e-11   
ref|NP_001151278.1|  LOC100284911 precursor                           65.9    7e-11   
gb|KDP47124.1|  hypothetical protein JCGZ_22120                       64.3    7e-11   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...  65.5    7e-11   
gb|ACG38044.1|  vignain precursor                                     65.9    7e-11   
ref|XP_002446130.1|  hypothetical protein SORBIDRAFT_06g002130        64.7    8e-11   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g           65.5    8e-11   
gb|AFP73359.1|  cysteine protease                                     65.5    8e-11   
ref|XP_003556992.1|  PREDICTED: vignain-like                          65.5    8e-11   
ref|XP_008417614.1|  PREDICTED: cathepsin L1-like                     65.5    8e-11   
ref|XP_003527349.1|  PREDICTED: vignain-like                          65.5    8e-11   
ref|XP_006857794.1|  hypothetical protein AMTR_s00061p00214890        65.5    8e-11   
gb|AAW34135.1|  cysteine protease gp2b                                65.9    8e-11   
gb|AFP73364.1|  cysteine protease                                     65.5    8e-11   
ref|XP_002523448.1|  cysteine protease, putative                      65.5    8e-11   
gb|AFP73331.1|  cysteine protease                                     65.5    8e-11   
gb|AFP73328.1|  cysteine protease                                     65.5    8e-11   
ref|XP_004505500.1|  PREDICTED: vignain-like                          65.5    8e-11   
gb|AFP73368.1|  cysteine protease                                     65.5    8e-11   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           65.5    8e-11   
gb|KCW74260.1|  hypothetical protein EUGRSUZ_E02907                   65.5    8e-11   
dbj|GAA47436.1|  cathepsin L                                          63.9    8e-11   
gb|AIF75890.1|  cysteine protease                                     63.5    8e-11   
gb|AIF75886.1|  cysteine protease                                     63.5    8e-11   
emb|CDY48168.1|  BnaA06g16650D                                        65.5    8e-11   
gb|ABA97421.1|  Vignain precursor, putative                           65.5    8e-11   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...  65.5    8e-11   
emb|CDY00199.1|  BnaA06g21000D                                        63.9    8e-11   
tpg|DAA48694.1|  TPA: vignain                                         65.9    8e-11   
ref|XP_004974180.1|  PREDICTED: vignain-like                          65.5    8e-11   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg           65.5    8e-11   
gb|AFP73326.1|  cysteine protease                                     65.5    8e-11   
ref|XP_003562772.1|  PREDICTED: senescence-specific cysteine prot...  65.5    8e-11   
gb|AFP73362.1|  cysteine protease                                     65.5    9e-11   
gb|KCW45397.1|  hypothetical protein EUGRSUZ_L00917                   63.5    9e-11   
gb|AHY28815.1|  cysteine protease                                     62.0    9e-11   
gb|AFP73334.1|  cysteine protease                                     65.5    9e-11   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1               65.1    9e-11   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g           65.5    9e-11   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        65.1    9e-11   
gb|AIF75887.1|  cysteine protease                                     63.5    9e-11   
ref|XP_002306486.2|  hypothetical protein POPTR_0005s18520g           65.5    9e-11   
emb|CAA40073.1|  endopeptidase (EP-C1)                                65.5    9e-11   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           65.1    9e-11   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934  66.6    9e-11   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                      65.1    9e-11   
gb|AAM19207.1|AF493232_1  cysteine protease                           65.1    9e-11   
ref|XP_003539970.1|  PREDICTED: vignain-like                          65.1    9e-11   
ref|XP_003566880.1|  PREDICTED: ervatamin-C-like                      65.5    9e-11   
ref|XP_006658211.1|  PREDICTED: cysteine proteinase EP-B 1-like       65.1    9e-11   
ref|XP_009359967.1|  PREDICTED: vignain-like                          65.1    9e-11   
gb|ABZ80398.1|  cathepsin L3                                          64.7    9e-11   
gb|AAA50755.1|  cysteine proteinase                                   65.1    9e-11   
ref|XP_010866993.1|  PREDICTED: cathepsin S-like                      63.5    9e-11   
gb|ACJ84467.1|  unknown                                               63.9    9e-11   
ref|XP_004975183.1|  PREDICTED: vignain-like                          65.1    9e-11   
ref|XP_003539989.1|  PREDICTED: vignain-like                          65.1    1e-10   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           65.1    1e-10   
ref|XP_004975182.1|  PREDICTED: vignain-like                          65.1    1e-10   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           65.1    1e-10   
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg           65.5    1e-10   
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                      65.1    1e-10   
emb|CDY39575.1|  BnaCnng09440D                                        65.5    1e-10   
gb|AFP73363.1|  cysteine protease                                     65.1    1e-10   
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg           65.9    1e-10   
ref|XP_002875897.1|  hypothetical protein ARALYDRAFT_347926           65.1    1e-10   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g           64.7    1e-10   
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like        65.1    1e-10   
emb|CDY58055.1|  BnaA06g40240D                                        64.7    1e-10   
gb|KDP36750.1|  hypothetical protein JCGZ_08041                       65.1    1e-10   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
gb|AFP73361.1|  cysteine protease                                     65.1    1e-10   
gb|AFP73325.1|  cysteine protease                                     65.1    1e-10   
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                 65.1    1e-10   
ref|NP_001237199.1|  cysteine proteinase precursor                    65.1    1e-10   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...  65.1    1e-10   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
ref|XP_007044884.1|  Cysteine proteinases superfamily protein         65.9    1e-10   
ref|XP_009412837.1|  PREDICTED: vignain-like                          65.9    1e-10   
gb|EEC81394.1|  hypothetical protein OsI_24614                        65.1    1e-10   
gb|KDP23191.1|  hypothetical protein JCGZ_00324                       64.3    1e-10   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
dbj|BAC06931.1|  putative cysteine proteinase                         65.1    1e-10   
gb|EEE66441.1|  hypothetical protein OsJ_22818                        64.7    1e-10   
ref|XP_010274468.1|  PREDICTED: xylem cysteine proteinase 2-like ...  63.5    1e-10   
gb|AAW34136.1|  cysteine protease gp3a                                65.5    1e-10   
ref|XP_009101555.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
ref|XP_011034818.1|  PREDICTED: xylem cysteine proteinase 2-like      65.1    1e-10   
gb|ABZ69061.1|  cysteine protease                                     63.2    1e-10   
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like        65.1    1e-10   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g           65.1    1e-10   
ref|XP_006404155.1|  hypothetical protein EUTSA_v10010521mg           64.7    1e-10   
ref|XP_006376886.1|  hypothetical protein POPTR_0012s09270g           65.1    1e-10   
ref|XP_008451632.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
ref|XP_010037483.1|  PREDICTED: vignain-like                          65.1    1e-10   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g           64.7    1e-10   
ref|XP_006305193.1|  hypothetical protein CARUB_v10009557mg           65.1    1e-10   
dbj|BAG16376.1|  cysteine protease                                    64.7    1e-10   
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                      65.1    1e-10   
ref|XP_008357442.1|  PREDICTED: oryzain alpha chain-like              65.1    1e-10   
ref|XP_010054325.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  65.5    1e-10   
gb|KFM79650.1|  Cathepsin S                                           64.3    1e-10   
gb|ACR34737.1|  unknown                                               65.5    1e-10   
dbj|BAD08618.1|  cathepsin L preproprotein                            64.7    1e-10   
emb|CAQ00118.1|  papain-like cysteine proteinase                      63.2    1e-10   
ref|XP_002312656.2|  hypothetical protein POPTR_0008s18350g           65.1    1e-10   
ref|XP_006404274.1|  hypothetical protein EUTSA_v10010486mg           65.1    1e-10   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      64.7    1e-10   
gb|ACJ62261.1|  cysteine protease                                     63.5    1e-10   
gb|ACJ62234.1|  cysteine protease                                     63.5    1e-10   
gb|ACJ62292.1|  cysteine protease                                     63.5    1e-10   
gb|ABA33831.1|  cysteine protease Mir1                                63.5    1e-10   
ref|XP_003527388.1|  PREDICTED: vignain-like                          64.7    1e-10   
gb|ACJ62300.1|  cysteine protease                                     63.5    1e-10   
ref|XP_011040442.1|  PREDICTED: vignain-like                          64.7    1e-10   
ref|XP_011013690.1|  PREDICTED: vignain-like                          64.7    1e-10   
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like        65.5    1e-10   
gb|AFP73355.1|  cysteine protease                                     64.7    1e-10   
ref|NP_001151335.1|  cysteine protease 1                              63.5    1e-10   
gb|KCW74084.1|  hypothetical protein EUGRSUZ_E02723                   64.3    1e-10   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      64.7    1e-10   
ref|XP_005842020.1|  hypothetical protein GUITHDRAFT_63227            64.7    1e-10   
gb|AAR92154.1|  putative cysteine protease 1                          64.7    1e-10   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           64.7    1e-10   
ref|XP_003635767.1|  Cysteine proteinase                              64.7    1e-10   
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           64.7    1e-10   
gb|AAK63125.1|  putative cysteine protease                            62.0    1e-10   
ref|XP_003527350.1|  PREDICTED: vignain-like                          64.7    1e-10   
ref|XP_002531152.1|  cysteine protease, putative                      64.7    2e-10   
gb|ABK24495.1|  unknown                                               65.1    2e-10   
gb|AHY28814.1|  cysteine protease                                     62.8    2e-10   
gb|AHY28813.1|  cysteine protease                                     62.8    2e-10   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg           64.7    2e-10   
ref|XP_003608898.1|  Cysteine proteinase                              63.5    2e-10   
ref|XP_010274467.1|  PREDICTED: P34 probable thiol protease-like ...  63.9    2e-10   
ref|XP_006469011.1|  PREDICTED: vignain-like                          64.7    2e-10   
ref|XP_010557424.1|  PREDICTED: ervatamin-B-like                      64.7    2e-10   
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...  65.1    2e-10   
ref|XP_006469012.1|  PREDICTED: vignain-like                          64.7    2e-10   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                       64.7    2e-10   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg           64.7    2e-10   
gb|KHN33932.1|  KDEL-tailed cysteine endopeptidase CEP1               64.3    2e-10   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...  64.7    2e-10   
dbj|BAF46304.1|  cysteine proteinase precursor                        65.1    2e-10   
ref|XP_008392874.1|  PREDICTED: vignain-like                          64.7    2e-10   
ref|XP_006663940.1|  PREDICTED: thiol protease SEN102-like            64.7    2e-10   
gb|ADV74756.1|  cysteine protease                                     64.7    2e-10   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  64.7    2e-10   
ref|XP_003540013.1|  PREDICTED: vignain-like                          64.3    2e-10   
ref|XP_004555684.1|  PREDICTED: cathepsin L1-like                     64.3    2e-10   
gb|ABQ10202.1|  cysteine protease Cp4                                 65.1    2e-10   
ref|XP_008340724.1|  PREDICTED: vignain-like                          64.3    2e-10   
ref|XP_006467666.1|  PREDICTED: vignain-like                          64.3    2e-10   
gb|KCW74259.1|  hypothetical protein EUGRSUZ_E02906                   64.3    2e-10   
emb|CDP18638.1|  unnamed protein product                              64.3    2e-10   
ref|XP_009149828.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  64.7    2e-10   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  64.3    2e-10   
ref|XP_006830175.1|  hypothetical protein AMTR_s00374p00012080        64.3    2e-10   
gb|AAM73806.1|AF448505_1  cysteine proteinase                         64.3    2e-10   
ref|XP_008390108.1|  PREDICTED: vignain-like                          64.7    2e-10   



>ref|XP_002522571.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39871.1| cysteine protease, putative [Ricinus communis]
Length=343

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +1

Query  37   TLKPTYFFNK-SLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T+KPT+F N  + D+ P+S+DWRE+GVVT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  116  TVKPTFFSNYYNQDEVPESIDWRENGVVTSVKNQGECGCCWAFSAVAAVEGI  167



>ref|XP_006362436.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S  PKT     F  +S + +PDSL+WRE G VT +KDQGKCG CWAF+ VAAVEG+
Sbjct  106  SFLPKTSNLQSFSYESENSSPDSLNWREQGAVTPVKDQGKCGSCWAFSAVAAVEGL  161



>ref|XP_010686290.1| PREDICTED: zingipain-2-like [Beta vulgaris subsp. vulgaris]
Length=349

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F+++L   P SLDWRE G VT IKDQG+CGCCWAF+ VAAVEG+
Sbjct  131  FDQNLTDMPPSLDWREQGAVTPIKDQGQCGCCWAFSTVAAVEGL  174



>ref|XP_010045989.1| PREDICTED: vignain-like [Eucalyptus grandis]
 gb|KCW84693.1| hypothetical protein EUGRSUZ_B01513 [Eucalyptus grandis]
Length=255

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T      SLR  ++KP  F  +S+   P S+DWR+ G VT IKDQG+CGCCWAF+ VAA+
Sbjct  88   TGYKRSSSLRTASMKP--FQYESVTTIPSSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAM  145

Query  181  EGI  189
            EGI
Sbjct  146  EGI  148



>ref|XP_010686292.1| PREDICTED: zingipain-2-like [Beta vulgaris subsp. vulgaris]
Length=348

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F+++L   P SLDWRE G VT IKDQG+CGCCWAF+ VAAVEG+
Sbjct  130  FDQNLTDMPPSLDWREKGAVTPIKDQGQCGCCWAFSTVAAVEGL  173



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  4    MLNEEKSLRPKTLKPTYFFN-KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            M+N  K    KTLK T  F+ +++   P S+DWR  G VT IKDQG+CGCCWAF+ VAA+
Sbjct  98   MMNGFKPSTLKTLKATNVFSYENVTAVPSSMDWRAKGAVTPIKDQGQCGCCWAFSAVAAM  157

Query  181  EGI  189
            EGI
Sbjct  158  EGI  160



>ref|XP_004308225.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=358

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +1

Query  16   EKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            E  L  K   P    N + D  P S+DWREHG VT IKDQGKCG CWAF VVAAVEGI
Sbjct  117  EDQLSTKQSGPN---NTTSDDIPASIDWREHGAVTPIKDQGKCGACWAFTVVAAVEGI  171



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +1

Query  4    MLNEEKSLRPKTLKPTYFFN-KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            M+N  K    KTLK T  F  +++   P S+DWR  G VT IKDQG+CGCCWAF+ VAA+
Sbjct  98   MMNGFKPSTLKTLKATNVFRYENVTAVPTSMDWRAKGAVTPIKDQGQCGCCWAFSAVAAM  157

Query  181  EGI  189
            EGI
Sbjct  158  EGI  160



>ref|XP_004232961.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=341

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S  PKT     F  +S + +PDS +WRE G VT +KDQGKCG CWAF+ VAAVEG+
Sbjct  106  SFLPKTSNLQSFSYQSENSSPDSWNWREQGAVTPVKDQGKCGSCWAFSAVAAVEGL  161



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S RP++ + T F  +++   P S+DWR+ G VT IKDQG+CGCCWAF+ VAA+EG+
Sbjct  83   SSRPRSSEITSFRYENVAAVPSSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGV  138



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S RP++ + T F  +++   P S+DWR+ G VT IKDQG+CGCCWAF+ VAA+EG+
Sbjct  103  SSRPRSSEITSFRYENVAAVPSSMDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGV  158



>ref|XP_008368206.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=344

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SL   P S+DWRE G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  117  YKNLSLTDVPPSMDWREQGAVTPVKDQGRCGCCWAFSAVAAVEGI  161



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   LRPKTL-KPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            LRP T  K + F  +++   P S+DWR+ G VT+IKDQG+CGCCWAF+ VAA+EGI
Sbjct  101  LRPSTSSKKSSFRYENVAAVPSSMDWRKKGAVTNIKDQGQCGCCWAFSAVAAMEGI  156



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +PK  K T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  103  KPKECKGTLFRYENVSAVPAAMDWRKKGAVTGIKDQGQCGCCWAFSAVAATEGI  156



>ref|XP_006652104.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=342

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = +1

Query  10   NEEKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            N  K   P T++ PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+
Sbjct  99   NTNKGFIPSTVRVPTGFRYENVSIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAM  158

Query  181  EGI  189
            EGI
Sbjct  159  EGI  161



>ref|XP_010686291.1| PREDICTED: zingipain-2-like [Beta vulgaris subsp. vulgaris]
Length=353

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F+++L+  P SLDWRE G VT IK QG+CGCCWAF+ VAAVEG+
Sbjct  134  FDQNLNDMPPSLDWREKGAVTPIKYQGQCGCCWAFSTVAAVEGL  177



>ref|NP_001052232.2| Os04g0203500 [Oryza sativa Japonica Group]
 dbj|BAF14146.2| Os04g0203500 [Oryza sativa Japonica Group]
Length=336

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFFNKS--LDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K   P T + PT F N++  +D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA+EG
Sbjct  99   NKGFIPSTTRVPTGFRNENVNIDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEG  158

Query  187  I  189
            I
Sbjct  159  I  159



>ref|XP_004975184.1| PREDICTED: vignain-like [Setaria italica]
Length=340

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SLD  PDS+DWR  G VT IKDQG+CGCCWAF+ VA++EGI
Sbjct  114  YANVSLDDLPDSVDWRTKGAVTPIKDQGQCGCCWAFSTVASMEGI  158



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  16   EKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++S  P+ + P++ + +S+ + P S+DWR+ G VT +KDQG+CGCCWAF+ VAA+EGI
Sbjct  105  KRSPIPRPINPSFRY-ESVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI  161



>ref|XP_006367780.1| PREDICTED: ananain-like [Solanum tuberosum]
Length=348

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  10   NEEKSLRPKTLKPTY---FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            N+  S++ + L PT    F  ++    P  +DWR+ GVVT IKDQG+CGCCWAF+ +AA+
Sbjct  109  NKFSSIKSQKLSPTTISSFKYENTSDVPSEMDWRKSGVVTSIKDQGRCGCCWAFSAIAAL  168

Query  181  EG  186
            EG
Sbjct  169  EG  170



>ref|XP_004234254.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=346

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = +1

Query  22   SLRPKTLKPTY---FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            S++ + L PT    F  +++   P  +DWR+ GVVT IKDQG+CGCCWAF+ VAA+EG
Sbjct  111  SIKSQKLSPTTISSFKYENISDVPSEMDWRKSGVVTSIKDQGQCGCCWAFSAVAALEG  168



>ref|XP_008340275.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=660

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SL   P S+DWRE G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  117  YKNLSLTDVPPSMDWREQGAVTPVKDQGRCGCCWAFSAVAAVEGI  161


 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  67   SLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            SL   P S+DWR+   VT +K QG C CCWAF+ VAAVEGI
Sbjct  440  SLAAVPPSIDWRKQDAVTPVKYQGNCACCWAFSAVAAVEGI  480



>ref|XP_006471123.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=179

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQGHCGSCWAFSAVAAVEGI  167



>ref|XP_004973089.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K  +P  +K PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EG
Sbjct  100  NKGFKPSPMKVPTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEG  159

Query  187  I  189
            I
Sbjct  160  I  160



>ref|XP_002446222.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
 gb|EES10550.1| hypothetical protein SORBIDRAFT_06g005410 [Sorghum bicolor]
Length=340

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P  +K PT F   N S+D  P S+DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  101  KGFKPSPVKVPTGFRYENVSVDALPASIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>gb|AAM34401.1|AF377947_7 putative cysteine proteinase [Oryza sativa Japonica Group]
 gb|AAP68356.1| putative cysteine protease [Oryza sativa Japonica Group]
 gb|AAR87245.1| putative cysteine protease [Oryza sativa Japonica Group]
 gb|ABF98921.1| Papain family cysteine protease containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EAY91886.1| hypothetical protein OsI_13535 [Oryza sativa Indica Group]
Length=350

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  AP S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  128  NFSLAAAPQSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  170



>ref|XP_006470294.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
 gb|KDO38136.1| hypothetical protein CISIN_1g019063mg [Citrus sinensis]
Length=346

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IKDQG+CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKDQGQCGSCWAFSAVAAVEGI  167



>ref|XP_004974538.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P  +K PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  101  KGFKPSPMKVPTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>gb|EMT00387.1| Fruit bromelain [Aegilops tauschii]
Length=349

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N   D  PDS+DWR  G VT +K+QG CGCCWAFA VAA EG+
Sbjct  124  NAQFDSTPDSVDWRAAGAVTQVKNQGSCGCCWAFAAVAATEGL  166



>gb|EMT20796.1| Vignain [Aegilops tauschii]
Length=394

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  RP   + PT F   N SLD  P+++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  155  KGYRPSLERVPTGFRYENVSLDALPETIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  214



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T      SLR  ++KP  F  +S+   P S+DWR+ G VT IKDQG+CGC WAF+ VAA+
Sbjct  67   TGYKRSSSLRAASMKP--FQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWAFSAVAAM  124

Query  181  EGI  189
            EGI
Sbjct  125  EGI  127



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S  PKT     F  +S    PDS +WRE G VTD+KDQG+CG CWAF+ VAAVEGI
Sbjct  106  SFLPKTSNLQPFSYESKITIPDSWNWREKGAVTDVKDQGRCGSCWAFSAVAAVEGI  161



>ref|XP_010239696.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=341

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SLD  P S+DWR  G VT IKDQG+CGCCWAF+ VA+VEGI
Sbjct  115  YANVSLDALPASMDWRAKGAVTPIKDQGQCGCCWAFSTVASVEGI  159



>gb|EAY93078.1| hypothetical protein OsI_14879 [Oryza sativa Indica Group]
Length=339

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K   P T++ PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  100  KGFIPSTVRVPTTFRYENVSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGI  159



>emb|CAH66233.1| H0825G02.10 [Oryza sativa Indica Group]
Length=339

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K   P T++ PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  100  KGFIPSTVRVPTTFRYENVSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGI  159



>emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa Japonica Group]
 gb|EAZ29777.1| hypothetical protein OsJ_13835 [Oryza sativa Japonica Group]
Length=339

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K   P T++ PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  100  KGFIPSTVRVPTTFRYENVSIDTLPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGI  159



>gb|AAQ54544.1| cysteine proteinase [Malus domestica]
Length=98

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S    P S+DWR++G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  23   YENLSPTDVPPSIDWRDNGAVTPVKDQGRCGCCWAFSAVAAVEGI  67



>gb|EMT08349.1| hypothetical protein F775_43327 [Aegilops tauschii]
Length=322

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SLD  P S+DWR +G VT +KDQG+CGCCWAF+ VA++EGI
Sbjct  84   YANASLDDLPASVDWRTNGAVTPVKDQGQCGCCWAFSTVASMEGI  128



>ref|XP_004981743.1| PREDICTED: cysteine proteinase EP-B 1-like [Setaria italica]
Length=350

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  AP S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  128  NVSLADAPQSVDWRAMGAVTGVKDQGDCGCCWAFSAVAAVEGL  170



>gb|AHA62778.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=348

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             + K ++ ++  L   P S+DWR  G VT IKDQG CGCCWAFAVVAAVEG+
Sbjct  119  NSQKTSFSYDGDLADVPSSMDWRTMGAVTGIKDQGPCGCCWAFAVVAAVEGL  170



>gb|AGT16936.1| vignain-like protein [Saccharum hybrid cultivar R570]
Length=341

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P  +K PT F   N S+D  P S+DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  102  KGFKPSRVKVPTGFRYENVSVDVLPASVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>gb|KHN10462.1| Vignain [Glycine soja]
Length=361

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  +  R        F  +++D+ P S+DWR+ G VTD+KDQG+CG CWAF+ + AV
Sbjct  102  SKVNHHRMFRGTPRGNGTFMYQNVDRVPSSVDWRKKGAVTDVKDQGQCGSCWAFSTIVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>ref|XP_008669676.1| PREDICTED: ervatamin-B-like [Zea mays]
 tpg|DAA38581.1| TPA: hypothetical protein ZEAMMB73_156486 [Zea mays]
Length=347

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K   P  +K PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EG
Sbjct  107  NKGFNPNVVKVPTGFRYQNLSIDALPQTVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEG  166

Query  187  I  189
            I
Sbjct  167  I  167



>emb|CAH66275.1| OSIGBa0147O06.5 [Oryza sativa Indica Group]
Length=339

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K   P T + PT F   N ++D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  100  KGFIPSTTRVPTGFRYENVNIDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEGI  159



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +1

Query  16   EKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++S  P+ + P++ + +S+ + P S+DWR+ G VT +KDQG+CGCCWAF+ VAA+EG+
Sbjct  105  KRSPIPRPINPSFRY-ESVTKVPSSVDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGL  161



>emb|CDP20741.1| unnamed protein product, partial [Coffea canephora]
Length=165

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  ++++  P S+DWR+ G VT +KDQG+CGCCWAF+ VAA+EGI
Sbjct  113  FMYENVNAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGI  157



>ref|XP_003549830.2| PREDICTED: vignain-like [Glycine max]
Length=379

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  +  R        F  +++D+ P S+DWR+ G VTD+KDQG+CG CWAF+ + AV
Sbjct  120  SKVNHHRMFRGTPRGNGTFMYQNVDRVPSSVDWRKKGAVTDVKDQGQCGSCWAFSTIVAV  179

Query  181  EGI  189
            EGI
Sbjct  180  EGI  182



>ref|XP_010927504.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=468

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  64   KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +S D  PDS+DWRE G V D+KDQG CG CWAF+ VAAVEGI
Sbjct  136  RSSDDLPDSIDWREKGAVADVKDQGSCGSCWAFSTVAAVEGI  177



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T  +  + L    +  + + +++ D  PDS++WR+HG V+ +KDQG CG CWAF+ +AAV
Sbjct  110  TRTDPRRRLMKSKIPSSRYAHRAGDNLPDSVNWRDHGAVSRVKDQGSCGSCWAFSAIAAV  169

Query  181  EGI  189
            EGI
Sbjct  170  EGI  172



>gb|AER60490.1| cysteine proteases [Gossypium hirsutum]
Length=371

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T  +  + L    +  + + +++ D  PDS+DWR+HG V+ +KDQG CG CWAF+ +A V
Sbjct  109  TRTDPRRRLMKSKIPSSRYAHRAGDNLPDSVDWRDHGAVSPVKDQGSCGSCWAFSTIATV  168

Query  181  EGI  189
            EGI
Sbjct  169  EGI  171



>ref|XP_003526229.1| PREDICTED: vignain-like [Glycine max]
Length=284

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +R    + T F  +++   PDS+DWR+ G VT IK+QG CGCCWAF+ +AA EGI
Sbjct  48   MRFSNTRTTTFKYENVTVLPDSIDWRQKGAVTPIKNQGSCGCCWAFSAIAATEGI  102



>gb|EEC84514.1| hypothetical protein OsI_31214 [Oryza sativa Indica Group]
Length=348

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K   P T + PT F   N ++D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA+EG
Sbjct  99   NKGFIPSTTRVPTGFRYENVNIDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAMEG  158

Query  187  I  189
            I
Sbjct  159  I  159



>gb|KHG00992.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=375

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T  +  + L    +  + + +++ D  PDS++WR+HG V+ +KDQG CG CWAF+ +AAV
Sbjct  113  TRTDPRRRLMKSKIPSSRYAHRAGDNLPDSVNWRDHGAVSRVKDQGSCGSCWAFSAIAAV  172

Query  181  EGI  189
            EGI
Sbjct  173  EGI  175



>ref|XP_009149742.1| PREDICTED: zingipain-2-like [Brassica rapa]
Length=345

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +T K   F  +++++  +SLDWR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  110  ETDKTMSFRYENVNETGESLDWRQEGAVTSVKNQGQCGCCWAFSAVAAVEGI  161



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  10   NEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N  K   P     T FF      AP ++DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  100  NGYKMSSPHMSSKTTFFRYENVTAPATMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T      SLR  ++KP  F  +S+   P S+DWR+ G VT IKDQG+CGC WAF+ VAA+
Sbjct  122  TGYKRSSSLRAASMKP--FQYESVTAIPSSMDWRKKGAVTPIKDQGQCGCRWAFSAVAAM  179

Query  181  EGI  189
            EGI
Sbjct  180  EGI  182



>ref|XP_006661542.1| PREDICTED: fruit bromelain-like [Oryza brachyantha]
Length=307

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  46   PTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            P  +FN S D AP S+DWR  G VT++KDQG+CG CWAF+ VA VEGI
Sbjct  149  PQVYFNVS-DGAPASVDWRASGAVTEVKDQGQCGSCWAFSTVAVVEGI  195



>gb|AFK46775.1| unknown [Medicago truncatula]
Length=362

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T +N  +  R        F  ++  +AP S+DWR+ G VTD+KDQG+CG CWAF+ V AV
Sbjct  102  TKVNHHRMFRGTPRVSGTFMYENFTKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>ref|XP_008225326.1| PREDICTED: actinidain-like [Prunus mume]
Length=290

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R K L PT          P S+DWRE G VT IK+Q +CGCCWAF+ VAAVEGI
Sbjct  114  SFRYKDLSPT--------DVPPSIDWREKGAVTPIKNQLRCGCCWAFSAVAAVEGI  161



>gb|KDO63024.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=281

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R  T     + N S+   P SLDWR+ G VT IK+Q +CGCCWAFA VAAVEGI
Sbjct  117  SHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGI  172



>gb|ACU23533.1| unknown [Glycine max]
Length=208

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T  PT+ + +++   P +LDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  112  TRTPTFRY-ENMTAVPATLDWRQEGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>ref|XP_003578808.1| PREDICTED: senescence-specific cysteine protease SAG39 [Brachypodium 
distachyon]
Length=339

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +  K   PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  103  ISNKVRVPTGFMYENMSFDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGI  159



>gb|AFL46179.1| INT9 protein, partial [Solanum lycopersicum]
Length=189

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            S +  T   T F   S+ + P+S+DWR+ G VT +KDQG CGCCWAF+  AA+EG
Sbjct  58   SQQESTATTTSFKYDSVTEVPNSMDWRKRGSVTGVKDQGVCGCCWAFSAAAAIEG  112



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +R   +K T F  +++   P ++DWR+ G VT +KDQG+CGCCWAF+ VA+ EGI
Sbjct  107  MRSSIIKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVASAEGI  161



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  + T F  +++   P SLDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  75   KRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  126



>ref|XP_006651829.1| PREDICTED: thiol protease SEN102-like [Oryza brachyantha]
Length=389

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  AP  +DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  128  NFSLAAAPQGMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  170



>ref|XP_006378264.1| hypothetical protein POPTR_0010s06080g, partial [Populus trichocarpa]
 gb|ERP56061.1| hypothetical protein POPTR_0010s06080g, partial [Populus trichocarpa]
Length=300

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    MLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVE  183
            M N E  +     + T F ++     P S+DWR++G VT I+DQGKCG CWAF+ VAAVE
Sbjct  77   MTNHEFLMLNGPRQGTGFIHEGTSNLPSSVDWRKNGAVTSIRDQGKCGSCWAFSTVAAVE  136

Query  184  GI  189
            GI
Sbjct  137  GI  138



>ref|XP_004975180.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYF--FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K   P  +K PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  101  KGFNPNAVKVPTGFRYANVSTDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEGI  160



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S    P S+DWRE+G VT +KDQG+CGCCWAF+ V AVEGI
Sbjct  117  YENLSXTDVPQSIDWRENGAVTPVKDQGRCGCCWAFSAVTAVEGI  161



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  31   PKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             K  + T F  +++   P SLDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  81   SKRTRTTTFRYENVTAVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  133



>gb|AFK36701.1| unknown [Lotus japonicus]
Length=343

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  70   LDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L   P SLDWRE G VTD+K+QG CG CWAF+ VAAVEGI
Sbjct  124  LSDTPTSLDWREQGAVTDVKNQGNCGSCWAFSAVAAVEGI  163



>ref|XP_008659446.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=340

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K L+   +K PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  101  KGLKSSNMKIPTGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_008650514.1| PREDICTED: vignain-like [Zea mays]
 gb|AFW76901.1| hypothetical protein ZEAMMB73_101481 [Zea mays]
Length=232

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S+D  P ++DWR +G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  8    YENVSVDAIPATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGI  52



>gb|AHA62774.1| papain-like cysteine protease [Solanum demissum]
Length=344

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T LN    L P  +  T F    L  D  P +LDWRE G VT +K+QG+CGCCWAF+ V 
Sbjct  102  TGLNVPSYLSPSPMSSTEFKINDLSDDDIPSNLDWRESGAVTQVKNQGRCGCCWAFSAVG  161

Query  175  AVEG  186
            ++EG
Sbjct  162  SLEG  165



>ref|XP_010932205.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
 gb|ABR19828.1| cysteine proteinase [Elaeis guineensis]
Length=469

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R  T+    +  +S D  PDS+DWR+ G V D+KDQG CG CWAF+ +AAVEGI
Sbjct  123  RNSTVGSNRYRFRSSDDLPDSIDWRDKGAVVDVKDQGSCGSCWAFSTIAAVEGI  176



>ref|XP_002519955.1| cysteine protease, putative [Ricinus communis]
 gb|EEF42559.1| cysteine protease, putative [Ricinus communis]
Length=321

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  7    LNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            LN    L  +    TY   K   + P+S+DWR+HG VT IK+Q +CGCCWAF+  AAVEG
Sbjct  85   LNNFADLSHEEYVATYTARKMPVEVPESIDWRDHGAVTPIKNQYQCGCCWAFSAAAAVEG  144

Query  187  I  189
            I
Sbjct  145  I  145



>ref|NP_001275606.1| fruit bromelain-like precursor [Solanum tuberosum]
 gb|AHA62777.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T LN    L P  +  T F    L  D  P +LDWRE G VT +K+QG+CGCCWAF+ V 
Sbjct  101  TGLNVPSYLSPSPMSSTEFKINDLSDDDMPSNLDWRESGAVTQVKNQGRCGCCWAFSAVG  160

Query  175  AVEG  186
            ++EG
Sbjct  161  SLEG  164



>gb|AFW76902.1| hypothetical protein ZEAMMB73_056195 [Zea mays]
Length=340

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLKPTYFF---NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P   K +  F   N S+D  P ++DWR +G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  101  KGFKPSLDKVSTGFRYENVSVDAIPATIDWRTNGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_007021896.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY13421.1| Cysteine proteinases superfamily protein, putative [Theobroma 
cacao]
Length=333

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  82   PDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            P SLDWRE G VT +KDQG CGCCWAFA VAAVEGI
Sbjct  116  PTSLDWREKGAVTAVKDQGDCGCCWAFAAVAAVEGI  151



>gb|AFW86317.1| hypothetical protein ZEAMMB73_339067 [Zea mays]
Length=433

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K L+   +K PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EG
Sbjct  193  NKGLKSSNMKIPTGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEG  252

Query  187  I  189
            I
Sbjct  253  I  253



>ref|XP_008659445.1| PREDICTED: ervatamin-B-like [Zea mays]
 gb|AFW86316.1| hypothetical protein ZEAMMB73_635707 [Zea mays]
Length=340

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = +1

Query  7    LNEEKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAA  177
            +   K  +   +K PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA
Sbjct  97   IKTNKGFKSSNMKIPTGFRYENVSVDALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAA  156

Query  178  VEGI  189
             EGI
Sbjct  157  TEGI  160



>gb|KDO55227.1| hypothetical protein CISIN_1g019112mg [Citrus sinensis]
Length=346

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQGHCGSCWAFSAVAAVEGI  167



>ref|XP_006470293.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470295.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQGHCGSCWAFSAVAAVEGI  167



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 5/63 (8%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            +M + + S R K+     F  +++   P SLDWR  G VT IKDQG+CGCCWAF+ VAA+
Sbjct  105  SMSSHQSSYRTKS-----FRYENVTAVPPSLDWRTKGAVTHIKDQGQCGCCWAFSAVAAM  159

Query  181  EGI  189
            EGI
Sbjct  160  EGI  162



>emb|CDY08128.1| BnaA06g15980D [Brassica napus]
Length=345

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +T K   F  +++ +  +SLDWR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  110  ETDKTMSFRYENVSETGESLDWRQEGAVTSVKNQGQCGCCWAFSAVAAVEGI  161



>emb|CDY05926.1| BnaC08g21030D [Brassica napus]
Length=345

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +T K   F  +++ +  +SLDWR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  110  ETDKTMSFRYENVSETGESLDWRQEGAVTSVKNQGQCGCCWAFSAVAAVEGI  161



>ref|XP_006470292.1| PREDICTED: xylem cysteine proteinase 1-like isoform X2 [Citrus 
sinensis]
Length=346

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQGHCGSCWAFSAVAAVEGI  167



>gb|AHA62776.1| papain-like cysteine protease [Solanum tuberosum]
Length=344

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T LN    L P  +  T F    L  D  P +LDWRE G VT +K+QG+CGCCWAF+ V 
Sbjct  101  TGLNVPSYLSPSPMSSTEFKINDLSDDDMPSNLDWRESGAVTQVKNQGQCGCCWAFSAVG  160

Query  175  AVEG  186
            ++EG
Sbjct  161  SLEG  164



>gb|EMT09279.1| Thiol protease SEN102 [Aegilops tauschii]
Length=299

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N SLD  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  70   PTGFRYENVSLDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  119



>gb|EMT20795.1| Vignain [Aegilops tauschii]
Length=339

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P   + PT F   N SLD  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  100  KGYKPSLQRVPTGFRYENLSLDSLPAAVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  159



>gb|AAO85377.1| cysteine proteinase [Triticum monococcum]
 gb|AAO85378.1| cysteine proteinase [Triticum monococcum]
Length=91

 Score = 65.5 bits (158),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  35   NFSLADAAGSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  77



>gb|EMT12294.1| Vignain [Aegilops tauschii]
Length=342

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SLD  P S+DWR  G VT IKDQG+CGCCWAF+ VA++EGI
Sbjct  116  YANVSLDALPTSVDWRTKGAVTPIKDQGQCGCCWAFSTVASMEGI  160



>ref|XP_006470291.1| PREDICTED: xylem cysteine proteinase 1-like isoform X1 [Citrus 
sinensis]
Length=346

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S+  ++ +P+ F  +++   P S+DWRE G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SVSRQSSRPSTFKYQNVTDVPTSIDWREKGAVTHIKNQGHCGSCWAFSAVAAVEGI  167



>gb|KDO63025.1| hypothetical protein CISIN_1g018958mg [Citrus sinensis]
Length=348

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R  T     + N S+   P SLDWR+ G VT IK+Q +CGCCWAFA VAAVEGI
Sbjct  117  SHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGI  172



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + +++ D+ P+S DWR+HG VT +KDQG+CG CWAF+ +AAVEGI
Sbjct  120  YASRAGDRLPESFDWRDHGAVTPVKDQGRCGSCWAFSTIAAVEGI  164



>ref|XP_006445658.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
 gb|ESR58898.1| hypothetical protein CICLE_v10015798mg [Citrus clementina]
Length=348

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R  T     + N S+   P SLDWR+ G VT IK+Q +CGCCWAFA VAAVEGI
Sbjct  117  SHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGI  172



>ref|XP_006446541.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
 gb|ESR59781.1| hypothetical protein CICLE_v10015814mg [Citrus clementina]
Length=346

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            SL  ++ +P+ F  +++   P S+DWR+ G VT IK+QG CG CWAF+ VAAVEGI
Sbjct  112  SLSRQSSRPSTFKYQNVTDVPTSIDWRKKGAVTHIKNQGNCGSCWAFSAVAAVEGI  167



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ K     Y F  S D  P+S+DWR+ G V  IKDQG CG CWAF+ VAAVEGI
Sbjct  114  VKSKNASHRYVFRAS-DHVPESVDWRKKGAVAPIKDQGSCGSCWAFSTVAAVEGI  167



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K+ K + F   ++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  109  KSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K+ K + F   ++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  109  KSTKVSSFRYANVSAVPASMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGI  160



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  28   RPKTLKPTYF--FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R     PT F   N S D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA EGI
Sbjct  104  RNGARAPTRFKYNNVSTDALPAAVDWRTKGVVTPIKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_009397226.1| PREDICTED: zingipain-2-like [Musa acuminata subsp. malaccensis]
Length=365

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F + SL   PDS+DWR  G VT IKDQG CG CWAF VVAAVEGI
Sbjct  104  FRHGSLSSVPDSVDWRSKGAVTPIKDQGLCGSCWAFTVVAAVEGI  148



>ref|XP_003578807.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=339

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +  K   PT F   N S D  P S+DWR  G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  103  ISNKVRAPTGFSYENVSFDALPASIDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_003593765.1| Cysteine proteinase [Medicago truncatula]
 gb|AES64016.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            D  P + DWR+ G VTD+KDQG CGCCWAF+VVAAVEG
Sbjct  148  DDVPTNFDWRQQGAVTDVKDQGSCGCCWAFSVVAAVEG  185



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T  PT+ + + +   P SLDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  TRTPTFKY-EDVSSVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>gb|EMT33085.1| Vignain [Aegilops tauschii]
Length=342

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N SLD  P S+DWR  G VT IKDQG+CGCCWAF+ VA++EGI
Sbjct  116  YANVSLDALPTSVDWRTKGAVTPIKDQGQCGCCWAFSTVASMEGI  160



>ref|XP_004501841.1| PREDICTED: vignain-like [Cicer arietinum]
Length=362

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  +  R        F  + +++ P S+DWR+ G VTD+KDQG+CG CWAF+ V AV
Sbjct  102  SKVNHHRMFRGTPRGNGTFMYEKVNKVPSSVDWRKKGAVTDVKDQGRCGSCWAFSTVVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>gb|EMT29823.1| Vignain [Aegilops tauschii]
Length=339

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P   + PT F   N SLD  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  100  KGYKPSLQRVPTGFRYENLSLDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_002525147.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37274.1| cysteine protease, putative [Ricinus communis]
Length=347

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  82   PDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PD++DWRE+G VT IKDQG+CG CWAF+ VAAVEGI
Sbjct  130  PDAVDWRENGAVTPIKDQGQCGSCWAFSAVAAVEGI  165



>gb|EEE70232.1| hypothetical protein OsJ_30346 [Oryza sativa Japonica Group]
Length=443

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+P  +FN+S   AP S+DWR  G VT++KDQG+CG CWAF+ VA VEGI
Sbjct  35   LQPEVYFNESAG-APASVDWRASGAVTEVKDQGRCGSCWAFSTVAVVEGI  83



>ref|XP_008349211.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=345

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S    P S+DWR++G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  117  YENLSPTDXPXSIDWRDNGAVTPVKDQGRCGCCWAFSAVAAVEGI  161



>dbj|BAB70669.1| cysteine proteinase [Daucus carota]
Length=208

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  19   KSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +SLR    + T F +++    P S+DWR+HG VT IK+QG+CG CWAF+ +  VEGI
Sbjct  108  RSLRGDRAR-TGFMHENTKHLPSSVDWRKHGAVTPIKNQGRCGSCWAFSAIVGVEGI  163



>ref|XP_003638507.1| Cysteine proteinase [Medicago truncatula]
 gb|KEH35007.1| KDEL-tailed cysteine endopeptidase CEP1 [Medicago truncatula]
Length=362

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  7    LNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            +N  +  R        F  ++  +AP S+DWR+ G VTD+KDQG+CG CWAF+ V AVEG
Sbjct  104  VNHHRMFRGTPRVSGTFMYENFTKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEG  163

Query  187  I  189
            I
Sbjct  164  I  164



>ref|XP_009606934.1| PREDICTED: zingipain-2 [Nicotiana tomentosiformis]
Length=339

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYF-FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAA  177
            T LN    L    +  T F  N   D  P +LDWRE G VT++K QG CGCCWAF+ V A
Sbjct  102  TGLNMPSHLPSSPISSTEFKINDLTDDMPSNLDWREKGAVTEVKQQGHCGCCWAFSAVGA  161

Query  178  VEG  186
            +EG
Sbjct  162  LEG  164



>sp|Q7XWK5.2|SAG39_ORYSJ RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Japonica Group]
 emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa Japonica Group]
 gb|EAZ29764.1| hypothetical protein OsJ_13822 [Oryza sativa Japonica Group]
Length=339

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = +1

Query  7    LNEEKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAA  177
            +   K   P T + PT F   N ++D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA
Sbjct  96   MKTNKGFIPSTTRVPTGFRYENVNIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAA  155

Query  178  VEGI  189
            +EGI
Sbjct  156  MEGI  159



>gb|ACJ85307.1| unknown [Medicago truncatula]
 gb|AFK41815.1| unknown [Medicago truncatula]
Length=362

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  7    LNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            +N  +  R        F  ++  +AP S+DWR+ G VTD+KDQG+CG CWAF+ V AVEG
Sbjct  104  VNHHRMFRGTPRVSGTFMYENFTKAPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEG  163

Query  187  I  189
            I
Sbjct  164  I  164



>ref|XP_006384060.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
 gb|ERP61857.1| hypothetical protein POPTR_0004s05510g [Populus trichocarpa]
Length=339

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  + F +++L   P S+DWR+ G VT +KDQG CGCCWAF+ VAA+EGI
Sbjct  108  LMSSSFRHENLSAIPTSMDWRKAGAVTPVKDQGTCGCCWAFSAVAAIEGI  157



>ref|XP_009388208.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=343

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            D  PDS+DWRE G V  +KDQG CG CWAF+ +AAVEGI
Sbjct  139  DYLPDSIDWREKGAVVGVKDQGSCGSCWAFSTIAAVEGI  177



>emb|CDY67777.1| BnaUnng02560D [Brassica napus]
Length=307

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  31   PKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             +T K   F  +++ +  +SLDWR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  71   SETDKTMSFRYENVSETGESLDWRQEGAVTSVKNQGQCGCCWAFSAVAAVEGI  123



>ref|XP_008796668.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=473

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  64   KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +S D+ PDS+DWR+ G V ++KDQG CG CWAF+ VAAVEGI
Sbjct  140  RSSDELPDSIDWRDKGAVAEVKDQGSCGSCWAFSTVAAVEGI  181



>gb|EMT15489.1| Thiol protease SEN102 [Aegilops tauschii]
Length=340

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N SLD  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  PTGFRYENVSLDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  +++   PDS+DWR+ G VT +KDQG+CGCCWAF+ VAA+EGI
Sbjct  114  FRYENVSAVPDSMDWRKKGAVTPVKDQGQCGCCWAFSAVAAMEGI  158



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score = 66.6 bits (161),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  64   KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +++   P S+DWR+ G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  20   ENVSAVPASMDWRKKGAVTGIKDQGQCGCCWAFSAVAAMEGI  61



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T  PT+ + + +   P SLDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  TRTPTFKY-EHVTSVPASLDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_011005485.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=339

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  + F +++L   P S+DWR+ G VT +KDQG CGCCWAF+ VAA+EGI
Sbjct  108  LMSSSFRHENLSAIPPSMDWRKAGAVTPVKDQGSCGCCWAFSAVAAIEGI  157



>ref|XP_006362429.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T LN    L P  +  T F    L  D  P +LDWRE G VT +K+QG+CGCCWAF+ + 
Sbjct  101  TGLNVPSYLSPSPMSSTEFKINDLSDDDMPSNLDWRESGAVTQVKNQGQCGCCWAFSAIG  160

Query  175  AVEG  186
            ++EG
Sbjct  161  SLEG  164



>gb|ADP02219.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
Length=419

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  28   RPKTLKPTYF--FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R     PT F   N S D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA EGI
Sbjct  104  RNGARAPTRFKYNNVSTDALPAAVDWRTKGVVTPIKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_004974539.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  PTGFRYENVSIDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>dbj|BAJ95283.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  129  NFSLADAAGSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  171



>emb|CAB09698.1| cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=349

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  129  NFSLADAAGSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  171



>ref|XP_004974540.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  PTGFRYENVSIDALPATIDWRSKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +K T F  +++   P ++DWR+ G VT +KDQG+CGCCWAF+ VA+ EGI
Sbjct  112  IKTTTFKYENVTSVPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVASAEGI  161



>gb|EMT29821.1| Thiol protease SEN102 [Aegilops tauschii]
Length=339

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   KSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +P   + PT F   N SLD  P  +DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  100  KGYKPSLQRVPTRFRYENVSLDALPAIIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  159



>ref|XP_010448692.1| PREDICTED: zingipain-2-like [Camelina sativa]
Length=354

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            DQ P+S+DWR+ G V++IKDQG C  CWAF+ VAAVEGI
Sbjct  131  DQLPESVDWRQQGAVSEIKDQGNCNSCWAFSAVAAVEGI  169



>gb|EMT30386.1| Fruit bromelain [Aegilops tauschii]
Length=198

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +1

Query  46   PTYFFNKSLDQ---APDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            P    N S+ Q    PDS+DWR  G VT IKDQ  C CCWAFA VAA EG+
Sbjct  116  PVAAVNMSMAQFESTPDSVDWRAQGAVTQIKDQAACSCCWAFAAVAATEGL  166



>ref|XP_007211535.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
 gb|EMJ12734.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
Length=339

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 38/56 (68%), Gaps = 8/56 (14%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R + L PT       D  P S+DWRE G VT IKDQG CGCCWAF+VVAAVEGI
Sbjct  114  SFRYEDLSPT-------DVLP-SIDWREKGAVTPIKDQGPCGCCWAFSVVAAVEGI  161



>ref|XP_008345990.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=341

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL   P S+DWRE   VT +KDQG CGCCWAF+ VAAVEGI
Sbjct  119  NLSLTDVPPSIDWREQDAVTPVKDQGBCGCCWAFSAVAAVEGI  161



>emb|CDY63262.1| BnaCnng41770D [Brassica napus]
Length=248

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            DQ P+S+DWR+ G VT +KDQG C  CWAF+ VAAVEGI
Sbjct  132  DQLPESVDWRKEGAVTAVKDQGSCSSCWAFSSVAAVEGI  170



>ref|XP_009594088.1| PREDICTED: zingipain-2-like [Nicotiana tomentosiformis]
Length=356

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  16   EKSLRPKTLKPTYF-FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            + S + K+   T F ++  L   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA+EG
Sbjct  112  DTSFQQKSNATTSFKYDSQLTDIPLSMDWRKSGSVTGVKDQGQCGCCWAFSAVAAIEG  169



>sp|A2XQE8.1|SAG39_ORYSI RecName: Full=Senescence-specific cysteine protease SAG39; AltName: 
Full=Cysteine proteinase SAG39; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 39; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EAY93058.1| hypothetical protein OsI_14861 [Oryza sativa Indica Group]
Length=339

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
             K   P T + PT F   N ++D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA+EG
Sbjct  99   NKGFIPSTTRVPTGFRYENVNIDALPATVDWRTKGAVTPIKDQGQCGCCWAFSAVAAMEG  158

Query  187  I  189
            I
Sbjct  159  I  159



>gb|EMT01703.1| Vignain [Aegilops tauschii]
Length=307

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  85   NFSLADAAGSMDWRAMGAVTGVKDQGSCGCCWAFSAVAAVEGL  127



>gb|EMT08019.1| Vignain [Aegilops tauschii]
Length=309

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  28   RPKTLKPTYF--FNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R  +  PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  72   RSGSQAPTGFKYNNVSTDALPAAVDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  127



>ref|XP_004974541.1| PREDICTED: thiol protease SEN102-like [Setaria italica]
Length=340

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N S+D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  111  PTGFRYENVSIDALPATIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  160



>gb|AFW86314.1| hypothetical protein ZEAMMB73_546353 [Zea mays]
Length=233

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +1

Query  46   PTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PT F   N S D  P ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  4    PTGFRYENVSADALPTTIDWRTKGAVTPIKDQGQCGCCWAFSAVAATEGI  53



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ K     Y F K+ D+ P+S+DWRE G V  +KDQG CG CWAF+ VAAVEGI
Sbjct  124  MKSKVASQRYAF-KAGDELPESVDWREKGAVNPVKDQGSCGSCWAFSTVAAVEGI  177



>emb|CDP06286.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  +   F  +++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA+EGI
Sbjct  80   KVCESKSFMYENVSAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAAMEGI  131



>ref|XP_006291447.1| hypothetical protein CARUB_v10017584mg [Capsella rubella]
 gb|EOA24345.1| hypothetical protein CARUB_v10017584mg [Capsella rubella]
Length=340

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    MLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVE  183
            +L  E +    + K   F ++++ +  +S+DWR+ G VT +K+QG CGCCWAF+ VAAVE
Sbjct  100  LLVPEGTSSLDSYKTVSFRHENVSETGESMDWRQEGAVTSVKNQGHCGCCWAFSTVAAVE  159

Query  184  GI  189
            GI
Sbjct  160  GI  161



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  +++   P SLDWR  GVVT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  100  FKYENVTTIPSSLDWRSKGVVTPIKDQGQCGCCWAFSAVAAMEGI  144



>ref|XP_007132871.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
 gb|ESW04865.1| hypothetical protein PHAVU_011G131700g [Phaseolus vulgaris]
Length=270

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+ T F  +++   P ++DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  78   LRTTTFKYENVTAIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGI  127



>gb|KHN33968.1| Vignain [Glycine soja]
Length=237

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +R    + T F  +++   PDS+DWR+ G VT IK+QG CGCCW F+ +AA EGI
Sbjct  1    MRFSNTRTTTFKYENVTVLPDSIDWRQKGAVTPIKNQGSCGCCWPFSAIAATEGI  55



>gb|ABF70145.1| cysteine protease, putative [Musa acuminata]
Length=373

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F + SL   PDS+DWR  G VT +KDQG CG CWAF VVAAVEGI
Sbjct  112  FRHGSLSSVPDSVDWRSKGAVTPVKDQGLCGSCWAFTVVAAVEGI  156



>gb|ADP02218.1| Peptidase_C1 domain-containing protein [Triticum aestivum]
 gb|EMT08021.1| Vignain [Aegilops tauschii]
Length=341

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S+D  P ++DWR  GVVT IKDQG+CGCCWAF+ V A EGI
Sbjct  115  YSNVSIDALPTAVDWRTKGVVTPIKDQGQCGCCWAFSAVVATEGI  159



>ref|XP_003589400.1| Cysteine protease [Medicago truncatula]
 gb|AES59651.1| papain family cysteine protease [Medicago truncatula]
Length=267

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  49   TYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T +FN SLDQ P  +DWR  G VT +K Q  CG CWAFA +AA+EG+
Sbjct  39   TVYFNTSLDQIPKFVDWRTRGAVTSVKQQRGCGSCWAFATMAALEGL  85



>ref|XP_007155505.1| hypothetical protein PHAVU_003G207200g [Phaseolus vulgaris]
 gb|ESW27499.1| hypothetical protein PHAVU_003G207200g [Phaseolus vulgaris]
Length=423

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  +++D+ P S+DWR+ G VTD+KDQGKCG CWAF+ V AVEG+
Sbjct  183  FMYENVDRVPPSVDWRKKGAVTDVKDQGKCGSCWAFSTVVAVEGL  227



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T  PT+ + +++   P +LDWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  112  TRTPTFRY-ENMTAVPATLDWRQEGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>emb|CDX73758.1| BnaC08g22450D [Brassica napus]
Length=345

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +T K   F  +++ +  +SLDWR+ G V+ +K+QG+CGCCWAF+ VAAVEGI
Sbjct  110  ETDKTMSFRYENVSETGESLDWRQEGAVSSVKNQGQCGCCWAFSAVAAVEGI  161



>gb|AHA62773.1| papain-like cysteine protease [Solanum demissum]
 gb|AHA62775.1| papain-like cysteine protease [Solanum verrucosum]
Length=344

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T LN    L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V 
Sbjct  102  TGLNVPSYLSPSPMSSTEFKINDLSDDDMPSNLDWRESGAVTQVKYQGRCGCCWAFSAVG  161

Query  175  AVEG  186
            ++EG
Sbjct  162  SLEG  165



>ref|XP_006280797.1| hypothetical protein CARUB_v10026767mg [Capsella rubella]
 gb|EOA13695.1| hypothetical protein CARUB_v10026767mg [Capsella rubella]
Length=329

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + K   F ++++ +  +S+DWR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  109  SYKTVSFRHENVSETGESMDWRQEGAVTPVKNQGQCGCCWAFSAVAAVEGI  159



>ref|XP_008221945.1| PREDICTED: vignain-like [Prunus mume]
Length=361

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + + T F +++ D  P ++DWR++G VT++KDQGKCG CWAF+ V AVEGI
Sbjct  111  SRRETAFTHENTDNLPPNVDWRKNGAVTEVKDQGKCGSCWAFSTVVAVEGI  161



>gb|EAZ10092.1| hypothetical protein OsI_32402 [Oryza sativa Indica Group]
Length=382

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  43   KPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +P  +FN+S   AP S+DWR  G VT++KDQG+CG CWAF+ VA VEGI
Sbjct  146  QPEVYFNESAG-APASVDWRASGAVTEVKDQGRCGSCWAFSTVAVVEGI  193



>ref|XP_008796470.1| PREDICTED: oryzain alpha chain-like [Phoenix dactylifera]
Length=466

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R  T+    +  +S D  PDS+DWR+ G V ++KDQG CG CWAF+ VAAVEGI
Sbjct  120  RNSTVDSNRYRFRSGDDLPDSIDWRDKGAVAEVKDQGSCGSCWAFSTVAAVEGI  173



>gb|EAY97106.1| hypothetical protein OsI_19029 [Oryza sativa Indica Group]
Length=350

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S D  P S+DWR  G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  126  YENVSADALPASVDWRTKGAVTRIKDQGQCGCCWAFSAVAAMEGI  170



>gb|KFK31525.1| hypothetical protein AALP_AA6G123900 [Arabis alpina]
Length=341

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S  +  +S+DWR+ G VT +K+QGKCGCCWAF+ VAAVEGI
Sbjct  119  YENVSESETGESMDWRQEGAVTTVKNQGKCGCCWAFSAVAAVEGI  163



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ K     Y F    D+ P+S+DWRE G V  IK+QG CG CWAF+ VAAVEGI
Sbjct  119  VKSKNASRRYAFRAGDDELPESVDWRERGAVAPIKNQGTCGSCWAFSTVAAVEGI  173



>gb|AES59757.2| papain family cysteine protease [Medicago truncatula]
Length=550

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +1

Query  16   EKSLRPKTLKP-TYFFNKSLDQAPDSLDWREHGVVTDIKDQGK-CGCCWAFAVVAAVEGI  189
            + +L P+ L   T +FN SLDQ P S+DWRE GVVT IKDQ   CG CWAF  +A +EG+
Sbjct  33   DDNLSPEFLSSKTIYFNMSLDQIPKSVDWRERGVVTSIKDQTSWCGSCWAFTTMATLEGL  92



>gb|AFP73348.1| cysteine protease [Solanum lycopersicoides]
Length=343

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVA  174
            T +N    L P  +  T F    L  D  P +LDWRE G VT +K+QG+CGCCWAF+ V 
Sbjct  101  TGINIPSYLSPSPMSSTEFKINDLSDDDMPSNLDWRESGAVTQVKNQGQCGCCWAFSAVG  160

Query  175  AVEG  186
            ++EG
Sbjct  161  SLEG  164



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K  K + F   ++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  109  KASKVSSFRYANVTAVPTSMDWRQKGAVTGVKDQGQCGCCWAFSAVAATEGI  160



>ref|XP_003581047.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=343

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S+D  P S+DWR +G VT +KDQG+CGCCWAF+ VA++EGI
Sbjct  117  YANVSIDDLPASVDWRANGAVTPVKDQGQCGCCWAFSTVASMEGI  161



>prf||1910332A Cys endopeptidase
Length=362

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  K  R        F  + +   P S+DWR+ G VTD+KDQG+CG CWAF+ + AV
Sbjct  102  SKVNHHKMFRGSQHGSGTFMYEKVGSVPASVDWRKKGAVTDVKDQGQCGSCWAFSTIVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>ref|XP_003589506.1| Cysteine protease [Medicago truncatula]
Length=586

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +1

Query  16   EKSLRPKTLKP-TYFFNKSLDQAPDSLDWREHGVVTDIKDQGK-CGCCWAFAVVAAVEGI  189
            + +L P+ L   T +FN SLDQ P S+DWRE GVVT IKDQ   CG CWAF  +A +EG+
Sbjct  33   DDNLSPEFLSSKTIYFNMSLDQIPKSVDWRERGVVTSIKDQTSWCGSCWAFTTMATLEGL  92



>gb|KDO63015.1| hypothetical protein CISIN_1g041011mg [Citrus sinensis]
Length=313

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T + + F  ++L Q P S+DWRE G VT IK+QG C  CWAF+ VAAVEGI
Sbjct  88   TSQHSSFKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGI  138



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+ K     Y F +  DQ P S+DWRE G V+ IKDQG+CG CWAF+ +AAVEGI
Sbjct  129  LKMKVKSDRYLFREG-DQLPKSVDWREKGAVSHIKDQGQCGSCWAFSTIAAVEGI  182



>ref|XP_006445818.1| hypothetical protein CICLE_v10017565mg [Citrus clementina]
 gb|ESR59058.1| hypothetical protein CICLE_v10017565mg [Citrus clementina]
Length=314

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T + + F  ++L Q P S+DWRE G VT IK+QG C  CWAF+ VAAVEGI
Sbjct  89   TSQHSSFKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGI  139



>gb|AAB37233.1| cysteine proteinase [Phalaenopsis sp. SM9108]
Length=359

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = +1

Query  1    TMLNEEKSLR--PKTLKPTYFFNKSLDQA--PDSLDWREHGVVTDIKDQGKCGCCWAFAV  168
            + +N  +SLR   +      F  +SLD    P S+DWR+ G VT +KDQG+CG CWAF+ 
Sbjct  101  SRINHHRSLRGSRRGGATNSFMYQSLDSRSLPASIDWRQKGAVTAVKDQGQCGSCWAFST  160

Query  169  VAAVEGI  189
            VAAVEGI
Sbjct  161  VAAVEGI  167



>sp|P12412.1|CYSEP_VIGMU RecName: Full=Vignain; AltName: Full=Bean endopeptidase; AltName: 
Full=Cysteine proteinase; AltName: Full=Sulfhydryl-endopeptidase; 
Short=SH-EP; Contains: RecName: Full=Vignain-1; Contains: 
RecName: Full=Vignain-2; Flags: Precursor [Vigna mungo]
 emb|CAA33753.1| sulfhydryl-pre-endopeptidase (AA -20 to 342) [Vigna mungo]
 emb|CAA36181.1| sulfhydryl-endopeptidase [Vigna mungo]
Length=362

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  K  R        F  + +   P S+DWR+ G VTD+KDQG+CG CWAF+ + AV
Sbjct  102  SKVNHHKMFRGSQHGSGTFMYEKVGSVPASVDWRKKGAVTDVKDQGQCGSCWAFSTIVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  ++L  AP S+DWR+ G VT IKDQG+CG CWAF+ VAAVEGI
Sbjct  115  FRYENLTAAPSSMDWRKKGAVTAIKDQGQCGSCWAFSAVAAVEGI  159



>ref|XP_002466439.1| hypothetical protein SORBIDRAFT_01g007820 [Sorghum bicolor]
 gb|EER93437.1| hypothetical protein SORBIDRAFT_01g007820 [Sorghum bicolor]
Length=353

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG+CGCCWAF+ VAAVEG+
Sbjct  131  NFSLADAAQSVDWRAMGAVTGVKDQGECGCCWAFSAVAAVEGL  173



>ref|XP_006492751.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=346

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T + + F  ++L Q P S+DWRE G VT IK+QG C  CWAF+ VAAVEGI
Sbjct  121  TSQHSSFKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGI  171



>gb|EMS48276.1| Fruit bromelain [Triticum urartu]
Length=350

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  70   LDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             +  PDS+DWR  G VT +K+QG CGCCWAFA VAA EG+
Sbjct  127  FESTPDSVDWRAAGAVTQVKNQGSCGCCWAFAAVAATEGL  166



>gb|KHG06908.1| Vignain [Gossypium arboreum]
Length=361

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +   K  + K+     F  +++D+ P S+DWR+ G VT +KDQG+CG CWAF+ V AV
Sbjct  101  SKIKHHKMFQGKSRGAGSFMYENVDRVPPSVDWRQKGAVTAVKDQGQCGSCWAFSTVVAV  160

Query  181  EGI  189
            EGI
Sbjct  161  EGI  163



>emb|CAE03344.2| OSJNBb0005B05.11 [Oryza sativa Japonica Group]
 gb|EAZ29753.1| hypothetical protein OsJ_13812 [Oryza sativa Japonica Group]
Length=323

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +1

Query  16   EKSLRPKTLK-PTYFFNKS--LDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVE  183
             K   P T + PT F N++  +D  P ++DWR  GVVT IKDQG+CGCCWAF+ VAA+E
Sbjct  99   NKGFIPSTTRVPTGFRNENVNIDALPATMDWRTKGVVTPIKDQGQCGCCWAFSAVAAME  157



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  10   NEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N  K    + L  T  F  +   AP ++DWR  G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  102  NGYKMTSHQQLSKTTSFKYANVTAPATMDWRTKGAVTGIKDQGQCGCCWAFSAVAATEGI  161



>ref|XP_002463749.1| hypothetical protein SORBIDRAFT_01g005350 [Sorghum bicolor]
 gb|EER90747.1| hypothetical protein SORBIDRAFT_01g005350 [Sorghum bicolor]
Length=381

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            T  P + ++ + D  P S+DWR+HG VT +K+QG+CG CWAF+ V AVEGI
Sbjct  126  TAVPGFMYDDATD-VPRSVDWRQHGAVTAVKNQGRCGSCWAFSTVVAVEGI  175



>ref|XP_004487579.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Cicer 
arietinum]
Length=335

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  16   EKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +K LR +T   T F  +++ + P ++DWRE G VT IK+Q  CG CWAFA VAA+EGI
Sbjct  97   KKPLRIETETETEFRYENVTEVPATMDWRERGAVTPIKNQYDCGSCWAFATVAAIEGI  154



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  31   PKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PK+   + F   ++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  108  PKSSMFSSFRYANVTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGI  160



>gb|KHN13721.1| Vignain [Glycine soja]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  95   IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  144



>gb|KHN08187.1| Thiol protease SEN102 [Glycine soja]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  95   IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  144



>gb|AFP73330.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>gb|AFP73315.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>ref|XP_002515048.1| cysteine protease, putative [Ricinus communis]
 gb|EEF47602.1| cysteine protease, putative [Ricinus communis]
Length=359

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + + T F +++    P S+DWR+ G VT +KDQGKCG CWAF+ VAAVEGI
Sbjct  113  SRRQTGFAHENTSNLPSSIDWRKQGAVTGVKDQGKCGSCWAFSSVAAVEGI  163



>ref|NP_001233949.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
 gb|ABG23376.1| phytophthora-inhibited protease 1 [Solanum lycopersicum]
Length=345

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            S +  T   T F   S+ + P+S+DWR+ G VT +KDQG CGCCWAF+  AA+EG
Sbjct  111  SQQESTATTTSFKYDSVTEVPNSMDWRKRGSVTGVKDQGVCGCCWAFSAAAAIEG  165



>gb|AFP73367.1| cysteine protease [Solanum peruvianum]
 gb|AFP73373.1| cysteine protease [Solanum peruvianum]
 gb|AFP73374.1| cysteine protease [Solanum peruvianum]
 gb|AFP73376.1| cysteine protease [Solanum peruvianum]
 gb|AFP73377.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>gb|AFP73365.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>ref|XP_008225219.1| PREDICTED: ervatamin-C-like [Prunus mume]
Length=341

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 8/56 (14%)
 Frame = +1

Query  22   SLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            S R + L PT          P S+DWRE G V  IKDQG CGCCWAF+ VAAVEGI
Sbjct  114  SFRYEDLSPT--------DVPPSIDWREKGAVAPIKDQGSCGCCWAFSAVAAVEGI  161



>ref|XP_002305073.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
 gb|EEE85584.2| hypothetical protein POPTR_0004s05540g [Populus trichocarpa]
Length=340

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  + F  ++L   P S+DWR  G VT +KDQG CGCCWAF+ VAA+EGI
Sbjct  111  LMSSSFRYENLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGI  160



>gb|AAM19208.1|AF493233_1 cysteine protease [Solanum pennellii]
Length=337

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P+   + S D  P +LDWRE G VT +K+QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPINDLSDDDMPSNLDWRESGAVTQVKNQGQCGCCWAFSAVGSLEG  158



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQA-PDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  +  KPT F  +++  A P S+DWR+ G VT +K+QG+CGCCWAF+ VAA+EGI
Sbjct  107  LSSQITKPTPFRYENVSSALPVSVDWRKKGAVTPVKNQGQCGCCWAFSAVAAIEGI  162



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  + F  ++L   P S+DWR  G VT +KDQG CGCCWAF+ VAA+EGI
Sbjct  111  LMSSSFRYENLSDIPTSMDWRNDGAVTPVKDQGTCGCCWAFSTVAAIEGI  160



>ref|XP_003526208.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Glycine 
max]
Length=339

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    TMLN-EEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAA  177
            +++N ++K    +T   T F  +S+ + P ++DWR+ G VT IKDQG CG CWAF++VAA
Sbjct  97   SLINVQKKESGVETATETSFRYESITKIPVTMDWRKRGAVTPIKDQGNCGSCWAFSIVAA  156

Query  178  VEGI  189
            +EGI
Sbjct  157  IEGI  160



>ref|XP_008663073.1| PREDICTED: ervatamin-B-like [Zea mays]
Length=352

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +1

Query  28   RPKTLKPTY-FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R +T    + + N SLD  P S+DWR  G VT IK+QG+CGCCWAF+ VA++EG+
Sbjct  116  RSRTATTGFKYANVSLDDVPASVDWRTKGAVTPIKNQGECGCCWAFSAVASMEGV  170



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +1

Query  25   LRPKTLKPT--YFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             +PK ++ T   F   ++   P S+DWR  G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  50   FKPKPMRATGQNFGYANVTDVPPSVDWRSKGAVTPVKDQGQCGCCWAFSAVAATEGI  106



>ref|XP_006857797.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
 gb|ERN19264.1| hypothetical protein AMTR_s00061p00215400 [Amborella trichopoda]
Length=347

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  79   APDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            AP S+DWR+ G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  129  APASMDWRKKGAVTQVKDQGQCGCCWAFSAVAAVEGI  165



>gb|AFP73324.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>gb|AFW67600.1| cysteine protease 1 [Zea mays]
Length=341

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            N SL  A  S+DWR  G VT +KDQG CGCCWAF+ VAAVEG+
Sbjct  119  NFSLADAAQSVDWRAMGAVTGVKDQGACGCCWAFSAVAAVEGL  161



>gb|AFP73356.1| cysteine protease [Solanum pennellii]
Length=337

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P+   + S D  P +LDWRE G VT +K+QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPINDLSDDDMPSNLDWRESGAVTQVKNQGQCGCCWAFSAVGSLEG  158



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  112  IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  34   KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K+ K + F   ++   P S+DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  109  KSSKVSSFRYANVTAVPASMDWRKKGAVTGVKDQGQCGCCWAFSAVAATEGI  160



>gb|KHN07749.1| Vignain [Glycine soja]
Length=301

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  70   IRTTTFKFENVTATPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  119



>gb|AFP73338.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>gb|AFP73319.1| cysteine protease [Solanum peruvianum]
 gb|AFP73337.1| cysteine protease [Solanum peruvianum]
 gb|AFP73339.1| cysteine protease [Solanum peruvianum]
Length=344

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFIINDLSDDDMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEG  165



>ref|XP_010431171.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=184

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  37   TLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + +   F ++++ +  +S++WR+ G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  78   SYRTVSFRHENVSETGESMEWRQEGAVTPVKNQGQCGCCWAFSAVAAVEGI  128



>gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata]
Length=362

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  K  R        F  + +   P S+DWR+ G VTD+KDQG+CG CWAF+ V AV
Sbjct  102  SKVNHHKMFRGTQHGNGTFMYEKVGSVPASVDWRKKGAVTDVKDQGQCGSCWAFSTVVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>ref|XP_007047371.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX91528.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=384

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  19   KSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + ++ K     Y F ++ D  P+S+DWREHG V  +KDQG CG CWAF+ +AAVEGI
Sbjct  128  RVMKSKNPSQRYAF-RAGDSLPESVDWREHGSVNPVKDQGYCGSCWAFSTIAAVEGI  183



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  40   LKPTYFF--NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            LK T F   N SL  +P SLDWR+ G VT IK+Q  CGCCWAF+VVAA+EG
Sbjct  117  LKTTSFMHQNVSLRASPVSLDWRKKGAVTPIKNQASCGCCWAFSVVAAIEG  167



>gb|KHN32069.1| Vignain [Glycine soja]
Length=333

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  95   IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  144



>gb|KHN32068.1| Vignain [Glycine soja]
Length=309

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +R   +  T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  73   MRFSFITTTTFKYENVTALPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  127



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  112  IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>ref|XP_006362435.1| PREDICTED: fruit bromelain-like [Solanum tuberosum]
Length=344

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            ++L++++S+       T F   S+ + P S+DWR+ G VT+IKDQG CGCCWAF+ VAA+
Sbjct  107  SLLSQQESIAT----TTSFKYDSVTEVPFSMDWRKSGSVTEIKDQGVCGCCWAFSAVAAI  162

Query  181  EG  186
            EG
Sbjct  163  EG  164



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            ++ T F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  112  IRTTTFKYENVTAVPSTVDWRQKGAVTPIKDQGQCGCCWAFSAVAATEGI  161



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L  + F  ++L   P S+DWR    VT +KDQG+CGCCWAF+ VAA+EGI
Sbjct  76   LMSSSFRYENLSDIPTSMDWRNAEAVTPVKDQGRCGCCWAFSTVAAIEGI  125



>gb|ACU18368.1| unknown [Glycine max]
Length=227

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  7    LNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            +N  +  R        F  + +   P S+DWR+ G VTD+KDQG CG CWAF+ V AVEG
Sbjct  104  VNHHRMFRDMPRGNGTFMYEKVGSVPASVDWRKKGAVTDVKDQGHCGSCWAFSTVVAVEG  163

Query  187  I  189
            I
Sbjct  164  I  164



>gb|ACV52591.1| phytophthora-inhibited protease 1-like protein [Nicotiana benthamiana]
Length=193

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = +1

Query  16   EKSLRPKTLKPTYF-FNKSLDQAPDSLDWREHGVVTDIKDQGKC----GCCWAFAVVAAV  180
            + S + K+   T F ++  L   P S+DWRE G VT IKDQG+C    GCCWAF+ VAA+
Sbjct  28   DTSFQQKSNATTSFKYDSQLTDIPLSMDWRESGSVTGIKDQGRCGIFTGCCWAFSAVAAI  87

Query  181  EG  186
            EG
Sbjct  88   EG  89



>ref|XP_003578656.1| PREDICTED: ervatamin-B-like [Brachypodium distachyon]
Length=377

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +FN S   AP S+DWR  G VT++K+QG+CG CWAF+ VA VEGI
Sbjct  151  YFNVSTAGAPASVDWRAKGAVTEVKNQGRCGSCWAFSTVAVVEGI  195



>ref|XP_007132874.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
 gb|ESW04868.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
Length=329

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+ T F  +++   P ++DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  113  LRTTTFKYENVTAIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGI  162



>emb|CDX68527.1| BnaC01g26050D [Brassica napus]
Length=344

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F ++++ +  + LDWR  G VT +KDQG+CGCCWAF+ VAAVEGI
Sbjct  117  FRHENVSETGEDLDWRREGAVTSVKDQGQCGCCWAFSAVAAVEGI  161



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +1

Query  4    MLNEEKSLRP-----KTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAV  168
            M NEE   R       + K   F  +++   P SLDWRE G VT +K+QG CGCCWAF+ 
Sbjct  93   MTNEEFRARNGYKPFTSSKSASFRYENVTDVPSSLDWREEGAVTPVKNQGDCGCCWAFSA  152

Query  169  VAAVEGI  189
            VAA EG+
Sbjct  153  VAATEGV  159



>ref|XP_010054326.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
Length=419

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+PT F + ++   PDS+DW   G V  IKDQG CG CWAF+ VAA+E I
Sbjct  110  LRPTPFMHANITHVPDSMDWVAKGAVNAIKDQGPCGSCWAFSAVAAIESI  159



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L   + KP  F  +++   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA EGI
Sbjct  131  LSSSSTKP--FRYENVSAVPSTMDWRKKGAVTPIKDQGQCGCCWAFSAVAATEGI  183



>gb|AFP73349.1| cysteine protease [Solanum chmielewskii]
Length=344

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSL--DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            L P  +  T F    L  D  P +LDWRE G VT +K QG+CGCCWAF+ V ++EG
Sbjct  110  LSPSPMSSTEFKTNDLSDDDMPSNLDWRESGAVTQVKHQGQCGCCWAFSAVGSLEG  165



>ref|XP_006291370.1| hypothetical protein CARUB_v10017509mg [Capsella rubella]
 gb|EOA24268.1| hypothetical protein CARUB_v10017509mg [Capsella rubella]
Length=360

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  ++  + P S+DWRE G VT+IK+QGKCG CWAF+ VAAVEGI
Sbjct  118  FMYENASRVPPSVDWREKGAVTEIKNQGKCGSCWAFSTVAAVEGI  162



>ref|XP_009793843.1| PREDICTED: zingipain-2-like [Nicotiana sylvestris]
Length=371

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  61   NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            N   D  P +LDWRE G VT++K QG+CGCCWAF+ V A+EG
Sbjct  154  NDLTDDIPSNLDWREKGAVTEVKHQGQCGCCWAFSAVGALEG  195



>ref|XP_007214697.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
 gb|EMJ15896.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
Length=340

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R  + K T F  +++   P ++DWR  G VT +KDQG+CG CWAFA VAAVEGI
Sbjct  107  REYSTKTTSFKYENVTVVPSTMDWRSKGAVTPVKDQGQCGSCWAFAAVAAVEGI  160



>ref|XP_011005599.1| PREDICTED: vignain-like [Populus euphratica]
Length=360

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  25   LRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
             R   L    F   ++D+ P S+DWR+ G VT +KDQGKCG CWAF+ + AVEGI
Sbjct  108  FRGAPLGNGSFMYGNIDKVPASIDWRKKGAVTTVKDQGKCGSCWAFSTIVAVEGI  162



>ref|XP_009420878.1| PREDICTED: vignain-like [Musa acuminata subsp. malaccensis]
Length=339

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            T +    +LR       YF  K++     ++DWR+ G VT IKDQGKCG CWAF+ V +V
Sbjct  84   TRIRRRSTLRGSASLKGYFLYKNVTNVTPTVDWRQKGAVTAIKDQGKCGSCWAFSTVVSV  143

Query  181  EGI  189
            EGI
Sbjct  144  EGI  146



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +1

Query  22   SLRPKTLKPTYFF---NKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEG  186
            SL  ++   T  F   N S    P S+DWR  G VT IKDQG CGCCWAF+VVAA+EG
Sbjct  108  SLSSQSQTKTTLFRYQNVSSGALPTSIDWRTKGAVTPIKDQGSCGCCWAFSVVAAIEG  165



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  40   LKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            L+ T F  +++   P ++DWR+ G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  113  LRTTTFKYENVTTIPSTVDWRQKGAVTPVKDQGQCGCCWAFSAVAATEGI  162



>ref|NP_680113.3| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
 sp|Q9STL4.1|CEP2_ARATH RecName: Full=KDEL-tailed cysteine endopeptidase CEP2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB41164.1| cysteine endopeptidase-like protein [Arabidopsis thaliana]
 gb|AEE78403.1| KDEL-tailed cysteine endopeptidase CEP2 [Arabidopsis thaliana]
Length=361

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  31   PKTLKPTYFFN-KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            PK     + ++ ++L + P S+DWR+ G VT+IK+QGKCG CWAF+ VAAVEGI
Sbjct  111  PKRGSKQFMYDHENLSKLPSSVDWRKKGAVTEIKNQGKCGSCWAFSTVAAVEGI  164



>emb|CAA06243.1| pre-pro-TPE4A protein [Pisum sativum]
Length=360

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + ++  +  R  + +   F  +++   P S+DWR+ G VTD+KDQG+CG CWAF+ + AV
Sbjct  102  SKVSHHRMFRGMSNENGTFMYENVKNVPSSIDWRKKGAVTDVKDQGQCGSCWAFSTIVAV  161

Query  181  EGI  189
            EGI
Sbjct  162  EGI  164



>dbj|BAJ85482.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +1

Query  25   LRPKTLKPTYFFN---KSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            LRP+   P    N     L   PDS+DWR  G VT +K QG CG CWAFA VAA EG+
Sbjct  114  LRPEDSSPAAAVNVTDAQLQSTPDSVDWRARGAVTPVKHQGHCGSCWAFAAVAATEGL  171



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  19   KSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + L+ + +K T F  +++   P ++DWR+ G VT IKDQG+CG CWAF+ VAA EGI
Sbjct  104  RPLQTRPMKVTSFKYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGI  160



>gb|AFW57869.1| hypothetical protein ZEAMMB73_830006 [Zea mays]
Length=443

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +1

Query  28   RPKTLKPTY-FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            R +T    + + N SLD  P S+DWR  G VT IK+QG+CGCCWAF+ VA++EG+
Sbjct  116  RSRTATTGFKYANVSLDDVPASVDWRTKGAVTPIKNQGECGCCWAFSAVASMEGV  170



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  43   KPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            K T F  ++L   P ++DWR+ G VT IKDQG+CGCCWAF+ VAA+EG+
Sbjct  113  KATTFKYENLTALPSTVDWRKKGAVTPIKDQGQCGCCWAFSAVAAMEGV  161



>ref|XP_010248729.1| PREDICTED: vignain-like [Nelumbo nucifera]
Length=361

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    TMLNEEKSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAV  180
            + +N  K LR        F  +  D  P S+DWRE G VT +K+QG+CG CWAF+ V AV
Sbjct  103  SRVNHHKMLRGSRRGTGGFMYEKEDNLPPSVDWREKGAVTPVKNQGQCGSCWAFSTVVAV  162

Query  181  EGI  189
            EGI
Sbjct  163  EGI  165



>ref|NP_001104878.1| maize insect resistance2 precursor [Zea mays]
 gb|AAB88262.1| cysteine proteinase Mir2 [Zea mays]
Length=493

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            +Q PD++DWRE G V ++KDQG+CG CWAF+ VAAVEGI
Sbjct  162  EQLPDAVDWRERGAVAEVKDQGQCGGCWAFSAVAAVEGI  200



>ref|XP_003578813.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Brachypodium 
distachyon]
Length=339

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + N S+D  P ++DWR  G VT +KDQG+CGCCWAF+ VAA EGI
Sbjct  115  YENVSIDALPATIDWRTKGAVTPVKDQGQCGCCWAFSAVAATEGI  159



>sp|P82474.1|CPGP2_ZINOF RecName: Full=Zingipain-2; AltName: Full=Cysteine proteinase 
GP-II [Zingiber officinale]
 pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|B Chain B, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|C Chain C, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
 pdb|1CQD|D Chain D, The 2.1 Angstrom Structure Of A Cysteine Protease With 
Proline Specificity From Ginger Rhizome, Zingiber Officinale
Length=221

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  73   DQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            D  PDS+DWRE+G V  +K+QG CG CWAF+ VAAVEGI
Sbjct  1    DDLPDSIDWRENGAVVPVKNQGGCGSCWAFSTVAAVEGI  39



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  19   KSLRPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            + L+ + +K T F  +++   P ++DWR+ G VT IKDQG+CG CWAF+ VAA EGI
Sbjct  104  RPLQTRPMKVTSFEYENVTAVPATMDWRKKGAVTPIKDQGQCGSCWAFSTVAATEGI  160



>ref|XP_010035848.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW47319.1| hypothetical protein EUGRSUZ_K01106 [Eucalyptus grandis]
Length=336

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F  +++   P S+DWRE G VT +K+QG+CGCCWAF+ VAAVEGI
Sbjct  115  FKYENITAVPSSMDWREKGAVTPVKNQGQCGCCWAFSAVAAVEGI  159



>ref|XP_006592475.1| PREDICTED: vignain-like [Glycine max]
Length=336

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RPKTLKPTYFFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            RP  L  T F  +++   P ++DWR  G VT IKDQG+CG CWAF+ VAA EGI
Sbjct  104  RPYELSTTPFKYENVTAIPAAIDWRTKGAVTSIKDQGQCGSCWAFSTVAATEGI  157



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   FFNKSLDQAPDSLDWREHGVVTDIKDQGKCGCCWAFAVVAAVEGI  189
            F   ++   P S+DWR++G VT IKDQG+CGCCWAF+ VAA+EGI
Sbjct  116  FRYANVTAVPTSMDWRQNGAVTPIKDQGQCGCCWAFSAVAAMEGI  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524026180552