BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22481_g3_i2 len=3317 path=[6615:0-192 13323:193-358
@6808@!:359-3168 6250:3169-3316]

Length=3317
                                                                      Score     E

ref|XP_009594332.1|  PREDICTED: nardilysin isoform X1                  1501   0.0      
ref|XP_006339383.1|  PREDICTED: nardilysin-like                        1498   0.0      
ref|XP_009779932.1|  PREDICTED: nardilysin isoform X1                  1494   0.0      
gb|EYU46017.1|  hypothetical protein MIMGU_mgv1a000651mg               1490   0.0      
ref|XP_004231716.1|  PREDICTED: nardilysin isoform X1                  1487   0.0      
ref|XP_011080663.1|  PREDICTED: nardilysin isoform X1                  1481   0.0      
ref|XP_009594333.1|  PREDICTED: insulin-degrading enzyme isoform X2    1462   0.0      
ref|XP_009779934.1|  PREDICTED: insulin-degrading enzyme isoform X3    1453   0.0      
emb|CDP04048.1|  unnamed protein product                               1449   0.0      
ref|XP_011080664.1|  PREDICTED: insulin-degrading enzyme isoform X2    1442   0.0      
ref|XP_007208119.1|  hypothetical protein PRUPE_ppa000683mg            1413   0.0      
ref|XP_008241920.1|  PREDICTED: nardilysin-like                        1412   0.0      
gb|KDP45687.1|  hypothetical protein JCGZ_17294                        1388   0.0      
ref|XP_011021019.1|  PREDICTED: nardilysin                             1375   0.0      
ref|XP_006491927.1|  PREDICTED: insulin-degrading enzyme-like iso...   1373   0.0      
ref|XP_008384668.1|  PREDICTED: nardilysin-like                        1373   0.0      
ref|XP_010108478.1|  Insulin-degrading enzyme                          1373   0.0      
ref|XP_002319408.2|  insulin-degrading enzyme-related family protein   1373   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006432018.1|  hypothetical protein CICLE_v10000133mg            1370   0.0      
ref|XP_009374381.1|  PREDICTED: nardilysin-like isoform X1             1367   0.0      
ref|XP_009354801.1|  PREDICTED: nardilysin-like                        1367   0.0      
ref|XP_009779933.1|  PREDICTED: nardilysin isoform X2                  1366   0.0      
ref|XP_008354420.1|  PREDICTED: nardilysin-like                        1363   0.0      
emb|CBI15822.3|  unnamed protein product                               1361   0.0      
ref|XP_010650820.1|  PREDICTED: nardilysin isoform X1                  1360   0.0      
ref|XP_002276484.1|  PREDICTED: nardilysin isoform X2                  1360   0.0      Vitis vinifera
gb|KEH34462.1|  insulin-degrading enzyme                               1360   0.0      
ref|XP_004500358.1|  PREDICTED: nardilysin-like isoform X1             1353   0.0      
ref|XP_006491928.1|  PREDICTED: insulin-degrading enzyme-like iso...   1334   0.0      
ref|XP_010685975.1|  PREDICTED: nardilysin isoform X1                  1333   0.0      
ref|XP_009374382.1|  PREDICTED: insulin-degrading enzyme-like iso...   1329   0.0      
gb|KHN48410.1|  Insulin-degrading enzyme                               1327   0.0      
ref|XP_003552920.2|  PREDICTED: nardilysin-like                        1326   0.0      
ref|XP_010045418.1|  PREDICTED: nardilysin isoform X1                  1325   0.0      
gb|EPS63741.1|  hypothetical protein M569_11043                        1321   0.0      
gb|KHN04241.1|  Insulin-degrading enzyme                               1320   0.0      
ref|XP_010253096.1|  PREDICTED: nardilysin isoform X1                  1317   0.0      
ref|XP_010522008.1|  PREDICTED: insulin-degrading enzyme               1316   0.0      
ref|XP_004294732.1|  PREDICTED: insulin-degrading enzyme-like          1313   0.0      
ref|XP_007017077.1|  Insulinase (Peptidase family M16) family pro...   1306   0.0      
ref|XP_008465304.1|  PREDICTED: nardilysin                             1300   0.0      
ref|XP_010315799.1|  PREDICTED: nardilysin isoform X2                  1293   0.0      
ref|XP_010685976.1|  PREDICTED: insulin-degrading enzyme isoform X2    1292   0.0      
dbj|BAF01167.1|  hypothetical protein                                  1291   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_172173.2|  Insulinase (peptidase family M16) family protein     1290   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045419.1|  PREDICTED: insulin-degrading enzyme isoform X2    1289   0.0      
ref|XP_002892364.1|  metalloendopeptidase                              1288   0.0      
ref|XP_009110970.1|  PREDICTED: nardilysin-like                        1283   0.0      
ref|XP_006417870.1|  hypothetical protein EUTSA_v10006660mg            1283   0.0      
ref|XP_004150605.1|  PREDICTED: insulin-degrading enzyme-like          1281   0.0      
ref|XP_004165736.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...   1279   0.0      
ref|XP_010253097.1|  PREDICTED: insulin-degrading enzyme isoform X2    1275   0.0      
ref|XP_006303778.1|  hypothetical protein CARUB_v10012025mg            1274   0.0      
gb|KFK43001.1|  hypothetical protein AALP_AA1G066600                   1272   0.0      
ref|XP_009119013.1|  PREDICTED: insulin-degrading enzyme-like iso...   1264   0.0      
ref|XP_008782651.1|  PREDICTED: nardilysin                             1264   0.0      
ref|XP_010457845.1|  PREDICTED: insulin-degrading enzyme-like iso...   1263   0.0      
ref|XP_010457846.1|  PREDICTED: insulin-degrading enzyme-like iso...   1263   0.0      
ref|XP_009119014.1|  PREDICTED: nardilysin-like isoform X4             1263   0.0      
ref|XP_009119011.1|  PREDICTED: insulin-degrading enzyme-like iso...   1263   0.0      
ref|XP_010921136.1|  PREDICTED: nardilysin isoform X1                  1246   0.0      
ref|XP_010921138.1|  PREDICTED: insulin-degrading enzyme isoform X3    1244   0.0      
ref|XP_009119012.1|  PREDICTED: insulin-degrading enzyme-like iso...   1239   0.0      
gb|AAF63132.1|AC011001_2  Putative N-arginine dibasic convertase       1228   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007208116.1|  hypothetical protein PRUPE_ppa000686mg            1226   0.0      
ref|XP_009416319.1|  PREDICTED: nardilysin                             1220   0.0      
ref|XP_010921139.1|  PREDICTED: insulin-degrading enzyme isoform X4    1211   0.0      
ref|XP_006842457.1|  hypothetical protein AMTR_s00077p00061270         1208   0.0      
ref|XP_010921137.1|  PREDICTED: nardilysin isoform X2                  1183   0.0      
emb|CDY10234.1|  BnaC05g04770D                                         1182   0.0      
ref|XP_004984458.1|  PREDICTED: nardilysin-like                        1182   0.0      
gb|EAZ26839.1|  hypothetical protein OsJ_10755                         1181   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY89915.1|  hypothetical protein OsI_11464                         1181   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001050040.1|  Os03g0336300                                      1179   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467901.1|  hypothetical protein SORBIDRAFT_01g036110         1177   0.0      Sorghum bicolor [broomcorn]
emb|CDY54887.1|  BnaA10g27980D                                         1176   0.0      
ref|XP_008660178.1|  PREDICTED: nardilysin                             1175   0.0      
ref|XP_004500359.1|  PREDICTED: nardilysin-like isoform X2             1172   0.0      
ref|XP_003557963.1|  PREDICTED: nardilysin                             1169   0.0      
ref|XP_006651351.1|  PREDICTED: nardilysin-like                        1165   0.0      
dbj|BAJ95837.1|  predicted protein                                     1154   0.0      
ref|XP_007017078.1|  Insulinase (Peptidase family M16) family pro...   1135   0.0      
ref|XP_004296020.1|  PREDICTED: insulin-degrading enzyme-like          1121   0.0      
ref|XP_004300711.1|  PREDICTED: insulin-degrading enzyme-like          1115   0.0      
ref|XP_004296019.1|  PREDICTED: insulin-degrading enzyme-like          1113   0.0      
emb|CDY09948.1|  BnaC08g45030D                                         1106   0.0      
ref|XP_002518286.1|  conserved hypothetical protein                    1093   0.0      Ricinus communis
ref|XP_006579996.1|  PREDICTED: nardilysin-like                        1062   0.0      
ref|XP_007017079.1|  Insulinase (Peptidase family M16) family pro...   1043   0.0      
gb|KGN47209.1|  hypothetical protein Csa_6G205830                      1010   0.0      
gb|EMS55750.1|  Insulin-degrading enzyme                                989   0.0      
dbj|BAJ99118.1|  predicted protein                                      984   0.0      
gb|EMT16196.1|  Insulin-degrading enzyme                                984   0.0      
gb|AFW88451.1|  hypothetical protein ZEAMMB73_847713                    959   0.0      
ref|XP_001760214.1|  predicted protein                                  940   0.0      
ref|XP_002981869.1|  hypothetical protein SELMODRAFT_154839             854   0.0      
ref|XP_002985987.1|  hypothetical protein SELMODRAFT_157708             854   0.0      
gb|KDO49710.1|  hypothetical protein CISIN_1g0017301mg                  819   0.0      
gb|KDO49709.1|  hypothetical protein CISIN_1g0017301mg                  814   0.0      
ref|XP_010480372.1|  PREDICTED: insulin-degrading enzyme-like           813   0.0      
ref|XP_007146872.1|  hypothetical protein PHAVU_006G0775001g            778   0.0      
ref|XP_010501347.1|  PREDICTED: nardilysin-like                         769   0.0      
ref|XP_001760921.1|  predicted protein                                  695   0.0      
ref|XP_005650450.1|  hypothetical protein COCSUDRAFT_27509              642   0.0      
gb|AET00720.2|  insulin-degrading enzyme                                609   0.0      
gb|KFM22670.1|  Insulin-degrading enzyme                                605   0.0      
emb|CDY15592.1|  BnaA08g28760D                                          575   0.0      
ref|XP_008344802.1|  PREDICTED: nardilysin-like                         557   0.0      
ref|XP_007146874.1|  hypothetical protein PHAVU_006G0775000g            552   0.0      
gb|KDO49702.1|  hypothetical protein CISIN_1g0017302mg                  548   0.0      
gb|KDO49706.1|  hypothetical protein CISIN_1g0017302mg                  509   7e-168   
pdb|3CWW|A  Chain A, Crystal Structure Of Ide-Bradykinin Complex        529   4e-166   
pdb|3QZ2|A  Chain A, The Structure Of Cysteine-free Human Insulin...    528   1e-165   
pdb|4LTE|A  Chain A, Structure Of Cysteine-free Human Insulin Deg...    527   1e-165   
pdb|3HGZ|A  Chain A, Crystal Structure Of Human Insulin-Degrading...    526   2e-165   
pdb|2WBY|A  Chain A, Crystal Structure Of Human Insulin-Degrading...    526   3e-165   
pdb|3E4A|A  Chain A, Human Ide-Inhibitor Complex At 2.6 Angstrom ...    526   1e-164   
pdb|3E4Z|A  Chain A, Crystal Structure Of Human Insulin Degrading...    522   1e-163   
ref|XP_004076931.1|  PREDICTED: insulin-degrading enzyme-like           521   3e-163   
emb|CDX86509.1|  BnaC08g01940D                                          509   2e-162   
ref|XP_007108768.1|  PREDICTED: insulin-degrading enzyme isoform X2     516   2e-161   
ref|XP_009243901.1|  PREDICTED: insulin-degrading enzyme isoform X2     516   4e-161   
ref|XP_007471622.1|  PREDICTED: insulin-degrading enzyme isoform X2     516   5e-161   
ref|XP_003755319.1|  PREDICTED: insulin-degrading enzyme                516   5e-161   
gb|AGZ80855.1|  insulin-degrading protein enzyme 15b                    515   9e-161   
ref|XP_004794675.1|  PREDICTED: insulin-degrading enzyme isoform X4     514   1e-160   
ref|XP_007108767.1|  PREDICTED: insulin-degrading enzyme isoform X1     515   1e-160   
ref|XP_005698270.1|  PREDICTED: insulin-degrading enzyme isoform X2     514   2e-160   
ref|XP_004427886.1|  PREDICTED: insulin-degrading enzyme isoform 1      515   2e-160   
ref|XP_006733937.1|  PREDICTED: insulin-degrading enzyme isoform X2     514   2e-160   
ref|XP_004794674.1|  PREDICTED: insulin-degrading enzyme isoform X3     514   2e-160   
ref|XP_009008218.1|  PREDICTED: insulin-degrading enzyme isoform X2     514   2e-160   
ref|XP_007664274.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   2e-160   
ref|XP_007187555.1|  PREDICTED: insulin-degrading enzyme isoform X2     514   3e-160   
ref|XP_007664273.1|  PREDICTED: insulin-degrading enzyme isoform X1     513   3e-160   
ref|XP_005671342.1|  PREDICTED: insulin-degrading enzyme isoform X2     514   4e-160   
ref|XP_004794672.1|  PREDICTED: insulin-degrading enzyme isoform X1     514   4e-160   
ref|XP_004369990.1|  PREDICTED: insulin-degrading enzyme                514   4e-160   
ref|XP_008155132.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   5e-160   
ref|XP_008567216.1|  PREDICTED: insulin-degrading enzyme                512   5e-160   
ref|XP_004794673.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   6e-160   
ref|XP_006073753.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   7e-160   
ref|XP_005566008.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   7e-160   
ref|XP_010818077.1|  PREDICTED: insulin-degrading enzyme isoform X1     513   7e-160   
ref|XP_002821024.1|  PREDICTED: insulin-degrading enzyme isoform X1     513   8e-160   
ref|XP_009008219.1|  PREDICTED: insulin-degrading enzyme isoform X3     512   8e-160   
ref|XP_005269823.1|  PREDICTED: insulin-degrading enzyme isoform X1     513   9e-160   
ref|XP_009457216.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   9e-160   
ref|XP_005602422.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   1e-159   
ref|XP_010379622.1|  PREDICTED: insulin-degrading enzyme isoform X2     513   1e-159   
ref|XP_002908213.1|  nardilysin, putative                               514   1e-159   
ref|XP_007961754.1|  PREDICTED: insulin-degrading enzyme isoform X3     512   1e-159   
ref|XP_010969599.1|  PREDICTED: insulin-degrading enzyme                511   2e-159   
ref|XP_007471621.1|  PREDICTED: insulin-degrading enzyme isoform X1     512   2e-159   
ref|XP_010331579.1|  PREDICTED: insulin-degrading enzyme isoform X2     511   2e-159   
ref|XP_006183728.1|  PREDICTED: insulin-degrading enzyme isoform X1     511   2e-159   
ref|XP_005698269.1|  PREDICTED: insulin-degrading enzyme isoform X1     510   3e-159   
ref|XP_003904048.2|  PREDICTED: insulin-degrading enzyme                510   3e-159   
ref|XP_003994291.1|  PREDICTED: insulin-degrading enzyme                511   3e-159   
ref|XP_002916150.1|  PREDICTED: insulin-degrading enzyme-like           511   3e-159   
gb|ELR60073.1|  Insulin-degrading enzyme                                510   4e-159   
ref|XP_008694470.1|  PREDICTED: insulin-degrading enzyme                510   4e-159   
ref|XP_010379624.1|  PREDICTED: insulin-degrading enzyme isoform X3     510   4e-159   
ref|XP_009457217.1|  PREDICTED: insulin-degrading enzyme isoform X3     510   4e-159   
ref|XP_005884105.1|  PREDICTED: insulin-degrading enzyme                510   4e-159   
ref|XP_006880401.1|  PREDICTED: insulin-degrading enzyme isoform X2     511   4e-159   
ref|XP_006733936.1|  PREDICTED: insulin-degrading enzyme isoform X1     511   4e-159   
ref|XP_006073754.1|  PREDICTED: insulin-degrading enzyme isoform X3     510   4e-159   
ref|XP_005958915.1|  PREDICTED: insulin-degrading enzyme                510   4e-159   
ref|XP_006755157.1|  PREDICTED: insulin-degrading enzyme                510   4e-159   
gb|EGW00756.1|  Insulin-degrading enzyme                                509   5e-159   
ref|XP_002756448.1|  PREDICTED: insulin-degrading enzyme isoform X1     511   5e-159   Callithrix jacchus [common marmoset]
gb|EHH19229.1|  hypothetical protein EGK_19903                          510   5e-159   
ref|XP_008517845.1|  PREDICTED: nardilysin isoform X2                   511   5e-159   
ref|XP_006231375.1|  PREDICTED: insulin-degrading enzyme isoform X1     511   5e-159   
ref|XP_005566009.1|  PREDICTED: insulin-degrading enzyme isoform X3     509   5e-159   
ref|XP_010972589.1|  PREDICTED: insulin-degrading enzyme                511   5e-159   
ref|XP_006880400.1|  PREDICTED: insulin-degrading enzyme isoform X1     511   6e-159   
ref|XP_005225474.1|  PREDICTED: insulin-degrading enzyme isoform X2     509   6e-159   
ref|XP_004411034.1|  PREDICTED: insulin-degrading enzyme                511   6e-159   
ref|XP_003339995.2|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    511   6e-159   
ref|XP_006147699.1|  PREDICTED: insulin-degrading enzyme                509   7e-159   
ref|XP_004701130.1|  PREDICTED: insulin-degrading enzyme                510   7e-159   
ref|XP_007187554.1|  PREDICTED: insulin-degrading enzyme isoform X1     510   7e-159   
gb|AGZ80854.1|  insulin-degrading enzyme isoform 15a                    510   7e-159   
gb|ETI56709.1|  hypothetical protein F443_00882                         511   9e-159   
pdb|2G47|A  Chain A, Crystal Structure Of Human Insulin-Degrading...    509   1e-158   
ref|XP_005602424.1|  PREDICTED: insulin-degrading enzyme isoform X4     509   1e-158   
ref|XP_003783750.1|  PREDICTED: insulin-degrading enzyme                510   1e-158   
ref|XP_006831204.1|  PREDICTED: insulin-degrading enzyme                510   1e-158   
ref|XP_001925416.3|  PREDICTED: insulin-degrading enzyme isoformX1      510   1e-158   Sus scrofa [pigs]
ref|XP_005063707.1|  PREDICTED: insulin-degrading enzyme                510   1e-158   
ref|XP_008155131.1|  PREDICTED: insulin-degrading enzyme isoform X1     510   1e-158   
ref|XP_004279447.1|  PREDICTED: insulin-degrading enzyme isoform 1      509   1e-158   
ref|XP_005602423.1|  PREDICTED: insulin-degrading enzyme isoform X3     509   1e-158   
ref|XP_008061852.1|  PREDICTED: insulin-degrading enzyme                509   2e-158   
ref|XP_005352247.1|  PREDICTED: insulin-degrading enzyme                509   2e-158   
ref|NP_001069317.1|  insulin-degrading enzyme precursor                 509   2e-158   Bos taurus [bovine]
gb|ETP26470.1|  hypothetical protein F441_00858                         510   2e-158   
ref|XP_001501085.2|  PREDICTED: insulin-degrading enzyme isoform X1     509   2e-158   Equus caballus [domestic horse]
ref|NP_001245003.1|  insulin-degrading enzyme                           509   2e-158   
ref|XP_008890464.1|  hypothetical protein PPTG_00747                    510   2e-158   
ref|XP_007634397.1|  PREDICTED: insulin-degrading enzyme isoform X1     510   2e-158   
ref|XP_005566007.1|  PREDICTED: insulin-degrading enzyme isoform X1     509   2e-158   
ref|XP_003462437.1|  PREDICTED: insulin-degrading enzyme                509   2e-158   
ref|XP_010840502.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    509   2e-158   
ref|XP_507922.2|  PREDICTED: insulin-degrading enzyme isoform X1        509   2e-158   Pan troglodytes
gb|KFO29933.1|  Insulin-degrading enzyme                                508   2e-158   
pdb|2JG4|A  Chain A, Substrate-Free Ide Structure In Its Closed C...    508   2e-158   
ref|XP_007949454.1|  PREDICTED: insulin-degrading enzyme                509   2e-158   
ref|NP_004960.2|  insulin-degrading enzyme isoform 1                    509   2e-158   Homo sapiens [man]
ref|XP_006073752.1|  PREDICTED: insulin-degrading enzyme isoform X1     509   2e-158   
ref|XP_008758584.1|  PREDICTED: insulin-degrading enzyme isoform X4     508   3e-158   
ref|XP_008847842.1|  PREDICTED: insulin-degrading enzyme                509   3e-158   
gb|ETM02885.1|  hypothetical protein L917_00781                         509   3e-158   
ref|XP_004607424.1|  PREDICTED: insulin-degrading enzyme                508   3e-158   
ref|XP_003922440.2|  PREDICTED: insulin-degrading enzyme isoform X1     509   3e-158   
ref|XP_007961753.1|  PREDICTED: insulin-degrading enzyme isoform X2     509   3e-158   
ref|XP_010630400.1|  PREDICTED: insulin-degrading enzyme                508   4e-158   
ref|XP_010379621.1|  PREDICTED: insulin-degrading enzyme isoform X1     508   4e-158   
ref|XP_006231376.1|  PREDICTED: insulin-degrading enzyme isoform X2     508   4e-158   
ref|XP_008517844.1|  PREDICTED: nardilysin isoform X1                   511   4e-158   
gb|ETM56185.1|  hypothetical protein L914_00811                         509   4e-158   
gb|EDL41785.1|  insulin degrading enzyme                                507   4e-158   
gb|ETL49820.1|  hypothetical protein L916_00813                         509   4e-158   
ref|XP_005333788.1|  PREDICTED: insulin-degrading enzyme                508   4e-158   
ref|XP_004438604.1|  PREDICTED: nardilysin isoform 3                    510   5e-158   
ref|XP_004020338.1|  PREDICTED: insulin-degrading enzyme                509   5e-158   
ref|XP_006238562.1|  PREDICTED: nardilysin isoform X2                   509   5e-158   
ref|XP_004900702.1|  PREDICTED: insulin-degrading enzyme-like iso...    507   6e-158   
ref|XP_010379625.1|  PREDICTED: insulin-degrading enzyme isoform X4     504   6e-158   
ref|XP_005301342.1|  PREDICTED: insulin-degrading enzyme isoform X2     508   8e-158   
ref|XP_008948937.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    508   9e-158   
ref|XP_009814696.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    506   9e-158   
ref|XP_008500221.1|  PREDICTED: insulin-degrading enzyme isoform X1     507   1e-157   
ref|XP_007080310.1|  PREDICTED: insulin-degrading enzyme                510   1e-157   
ref|XP_008500222.1|  PREDICTED: insulin-degrading enzyme isoform X2     506   1e-157   
ref|XP_007961752.1|  PREDICTED: insulin-degrading enzyme isoform X1     508   1e-157   
ref|NP_037291.1|  insulin-degrading enzyme                              507   1e-157   Rattus norvegicus [brown rat]
ref|XP_005169585.1|  PREDICTED: insulin-degrading enzyme isoform X2     506   2e-157   
ref|XP_007459682.1|  PREDICTED: nardilysin isoform X3                   509   2e-157   
ref|NP_112419.3|  insulin-degrading enzyme                              507   2e-157   Mus musculus [mouse]
ref|XP_004915936.1|  PREDICTED: insulin-degrading enzyme isoform X2     506   2e-157   
ref|XP_009082009.1|  PREDICTED: insulin-degrading enzyme                505   2e-157   
ref|XP_007894712.1|  PREDICTED: insulin-degrading enzyme                506   2e-157   
ref|XP_004915937.1|  PREDICTED: insulin-degrading enzyme isoform X3     505   3e-157   
ref|XP_005301344.1|  PREDICTED: insulin-degrading enzyme isoform X4     505   3e-157   
ref|XP_002114736.1|  hypothetical protein TRIADDRAFT_28404              504   3e-157   Trichoplax adhaerens
gb|AAH23786.1|  Nrd1 protein                                            504   3e-157   Mus musculus [mouse]
ref|XP_005013668.1|  PREDICTED: insulin-degrading enzyme isoform X2     505   3e-157   
gb|AAH41675.1|  Insulin degrading enzyme                                506   3e-157   Mus musculus [mouse]
ref|XP_004438603.1|  PREDICTED: nardilysin isoform 2                    510   3e-157   
ref|XP_003409282.1|  PREDICTED: insulin-degrading enzyme                506   3e-157   
gb|KFY13297.1|  hypothetical protein V491_06446                         506   4e-157   
ref|XP_001491329.1|  PREDICTED: nardilysin isoform 2                    510   4e-157   Equus caballus [domestic horse]
ref|XP_009321601.1|  PREDICTED: insulin-degrading enzyme                505   4e-157   
dbj|BAG35668.1|  unnamed protein product                                506   5e-157   Homo sapiens [man]
ref|XP_010189995.1|  PREDICTED: insulin-degrading enzyme                504   5e-157   
ref|XP_004450056.1|  PREDICTED: insulin-degrading enzyme                506   5e-157   
ref|XP_009693895.1|  PREDICTED: insulin-degrading enzyme                504   5e-157   
ref|XP_005385882.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    505   5e-157   
pdb|3P7O|A  Chain A, Rat Insulin Degrading Enzyme (Insulysin) E11...    505   6e-157   
ref|XP_002939138.2|  PREDICTED: insulin-degrading enzyme isoform X1     505   6e-157   
ref|XP_005301343.1|  PREDICTED: insulin-degrading enzyme isoform X3     504   6e-157   
gb|EDL90380.1|  nardilysin, N-arginine dibasic convertase 1             509   6e-157   
ref|XP_010122920.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    504   7e-157   
ref|XP_006211100.1|  PREDICTED: insulin-degrading enzyme                505   8e-157   
ref|NP_001082994.1|  insulin-degrading enzyme                           504   8e-157   Danio rerio [leopard danio]
ref|XP_009484863.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    505   9e-157   
ref|NP_037125.1|  nardilysin precursor                                  509   1e-156   Rattus norvegicus [brown rat]
ref|XP_005301341.1|  PREDICTED: insulin-degrading enzyme isoform X1     504   1e-156   
ref|XP_005169584.1|  PREDICTED: insulin-degrading enzyme isoform X1     504   1e-156   
ref|XP_010144389.1|  PREDICTED: insulin-degrading enzyme                503   1e-156   
ref|XP_004680684.1|  PREDICTED: insulin-degrading enzyme                504   1e-156   
ref|XP_009896096.1|  PREDICTED: insulin-degrading enzyme                504   2e-156   
ref|XP_004438602.1|  PREDICTED: nardilysin isoform 1                    510   2e-156   
ref|XP_004273911.1|  PREDICTED: nardilysin isoform 3                    506   2e-156   
ref|XP_009523420.1|  hypothetical protein PHYSODRAFT_491157             506   2e-156   
dbj|BAF62161.1|  insulin-degrading enzyme                               503   2e-156   Danio rerio [leopard danio]
ref|XP_009276302.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    505   2e-156   
ref|XP_007129277.1|  PREDICTED: nardilysin isoform X2                   508   2e-156   
gb|KDR15953.1|  Insulin-degrading enzyme                                504   2e-156   
ref|XP_007053130.1|  PREDICTED: insulin-degrading enzyme                502   2e-156   
ref|XP_006926010.1|  PREDICTED: insulin-degrading enzyme                504   3e-156   
ref|XP_004942214.1|  PREDICTED: insulin-degrading enzyme isoform X6     503   3e-156   
ref|XP_009676076.1|  PREDICTED: insulin-degrading enzyme isoform X1     501   3e-156   
emb|CAA63696.1|  NRD2 convertase                                        509   3e-156   
ref|XP_009569049.1|  PREDICTED: insulin-degrading enzyme                502   3e-156   
ref|XP_006238561.1|  PREDICTED: nardilysin isoform X1                   509   3e-156   
ref|XP_006630449.1|  PREDICTED: insulin-degrading enzyme-like           502   4e-156   
ref|XP_005013667.1|  PREDICTED: insulin-degrading enzyme isoform X1     502   4e-156   
ref|XP_007459681.1|  PREDICTED: nardilysin isoform X2                   507   4e-156   
ref|XP_005991609.1|  PREDICTED: insulin-degrading enzyme isoform X4     502   4e-156   
ref|XP_005991608.1|  PREDICTED: insulin-degrading enzyme isoform X3     502   4e-156   
gb|KFQ40303.1|  Insulin-degrading enzyme                                501   4e-156   
ref|XP_009887090.1|  PREDICTED: insulin-degrading enzyme                502   4e-156   
sp|Q9JHR7.1|IDE_MOUSE  RecName: Full=Insulin-degrading enzyme; Al...    503   4e-156   
ref|XP_008428221.1|  PREDICTED: insulin-degrading enzyme isoform X2     503   5e-156   
ref|XP_004942216.1|  PREDICTED: insulin-degrading enzyme isoform X8     502   5e-156   
ref|XP_005507021.1|  PREDICTED: insulin-degrading enzyme                502   5e-156   
ref|XP_007164531.1|  PREDICTED: nardilysin isoform X3                   507   5e-156   
ref|XP_005991606.1|  PREDICTED: insulin-degrading enzyme isoform X1     503   6e-156   
ref|XP_009640221.1|  PREDICTED: insulin-degrading enzyme                502   7e-156   
ref|XP_007129276.1|  PREDICTED: nardilysin isoform X1                   508   7e-156   
gb|KFY21744.1|  hypothetical protein V493_07165                         503   7e-156   
gb|KFP07152.1|  Insulin-degrading enzyme                                501   7e-156   
ref|XP_005353622.1|  PREDICTED: nardilysin isoform X3                   506   7e-156   
ref|XP_007611043.1|  PREDICTED: nardilysin isoform X2                   506   7e-156   
ref|XP_003496543.1|  PREDICTED: nardilysin isoform X2                   506   7e-156   
ref|XP_007258746.1|  PREDICTED: insulin-degrading enzyme                502   8e-156   
ref|XP_005520692.1|  PREDICTED: insulin-degrading enzyme                501   8e-156   
ref|XP_005353621.1|  PREDICTED: nardilysin isoform X2                   507   9e-156   
ref|XP_006976705.1|  PREDICTED: insulin-degrading enzyme                502   9e-156   
ref|XP_005238991.1|  PREDICTED: insulin-degrading enzyme                501   9e-156   
gb|KFY65105.1|  hypothetical protein V496_02850                         503   1e-155   
ref|XP_006263572.1|  PREDICTED: insulin-degrading enzyme isoform X2     501   1e-155   
ref|XP_005144112.1|  PREDICTED: insulin-degrading enzyme                501   1e-155   
ref|XP_002191096.1|  PREDICTED: insulin-degrading enzyme                501   1e-155   
ref|XP_009457218.1|  PREDICTED: insulin-degrading enzyme isoform X4     500   1e-155   
gb|KFZ10720.1|  hypothetical protein V501_05070                         502   1e-155   
ref|XP_004942215.1|  PREDICTED: insulin-degrading enzyme isoform X7     501   1e-155   
ref|XP_002715146.1|  PREDICTED: nardilysin isoform X2                   506   1e-155   
ref|XP_010563219.1|  PREDICTED: insulin-degrading enzyme isoform X1     500   1e-155   
ref|XP_009464668.1|  PREDICTED: insulin-degrading enzyme                501   1e-155   
ref|XP_006029480.1|  PREDICTED: insulin-degrading enzyme isoform X3     501   1e-155   
ref|XP_006200541.1|  PREDICTED: nardilysin isoform X2                   506   1e-155   
ref|XP_006263573.1|  PREDICTED: insulin-degrading enzyme isoform X3     501   1e-155   
ref|XP_006768372.1|  PREDICTED: LOW QUALITY PROTEIN: nardilysin         506   1e-155   
ref|XP_010010062.1|  PREDICTED: insulin-degrading enzyme                501   2e-155   
ref|XP_009934009.1|  PREDICTED: insulin-degrading enzyme                501   2e-155   
ref|XP_003496544.1|  PREDICTED: nardilysin isoform X1                   507   2e-155   
ref|XP_007164529.1|  PREDICTED: nardilysin isoform X1                   507   2e-155   
ref|XP_009986141.1|  PREDICTED: insulin-degrading enzyme                500   2e-155   
gb|KFP96316.1|  Insulin-degrading enzyme                                500   2e-155   
gb|EFX87983.1|  hypothetical protein DAPPUDRAFT_305640                  500   2e-155   
ref|XP_006029481.1|  PREDICTED: insulin-degrading enzyme isoform X4     500   2e-155   
ref|XP_005398656.1|  PREDICTED: nardilysin isoform X2                   505   2e-155   
ref|XP_007459680.1|  PREDICTED: nardilysin isoform X1                   507   2e-155   
ref|XP_009582856.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    501   2e-155   
ref|XP_005432465.1|  PREDICTED: insulin-degrading enzyme                500   2e-155   
ref|XP_010713022.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    501   2e-155   
ref|XP_009998424.1|  PREDICTED: insulin-degrading enzyme                504   2e-155   
dbj|BAG61292.1|  unnamed protein product                                501   2e-155   
ref|XP_421686.4|  PREDICTED: insulin-degrading enzyme isoform X5        501   2e-155   
ref|XP_007611042.1|  PREDICTED: nardilysin isoform X1                   506   2e-155   
ref|XP_859649.1|  PREDICTED: nardilysin isoformX2                       505   2e-155   
gb|ETE73757.1|  Insulin-degrading enzyme                                500   2e-155   
gb|KFQ63048.1|  Insulin-degrading enzyme                                499   2e-155   
ref|XP_006029479.1|  PREDICTED: insulin-degrading enzyme isoform X2     500   2e-155   
ref|XP_008928133.1|  PREDICTED: insulin-degrading enzyme                500   3e-155   
ref|XP_006043806.1|  PREDICTED: nardilysin isoform X2                   505   3e-155   
ref|XP_008642030.1|  PREDICTED: insulin-degrading enzyme                499   3e-155   
ref|XP_005894790.1|  PREDICTED: nardilysin isoform X2                   505   3e-155   
tpg|DAA31209.1|  TPA: nardilysin-like                                   505   3e-155   
ref|XP_005048476.1|  PREDICTED: insulin-degrading enzyme                499   3e-155   
ref|XP_005566010.1|  PREDICTED: insulin-degrading enzyme isoform X4     499   3e-155   
ref|XP_505854.1|  YALI0F25091p                                          500   3e-155   
ref|XP_004273910.1|  PREDICTED: nardilysin isoform 2                    504   3e-155   
ref|XP_006263571.1|  PREDICTED: insulin-degrading enzyme isoform X1     500   3e-155   
ref|XP_002915767.1|  PREDICTED: nardilysin-like isoform 2               504   4e-155   
ref|XP_005417428.1|  PREDICTED: insulin-degrading enzyme                499   4e-155   
ref|XP_004632151.1|  PREDICTED: insulin-degrading enzyme                502   4e-155   
ref|XP_006029478.1|  PREDICTED: insulin-degrading enzyme isoform X1     500   4e-155   
ref|XP_006180311.1|  PREDICTED: nardilysin isoform X2                   504   4e-155   
ref|XP_004774539.1|  PREDICTED: nardilysin isoform X2                   504   4e-155   
ref|NP_666262.2|  nardilysin precursor                                  504   5e-155   
gb|AAH26832.1|  Nardilysin, N-arginine dibasic convertase, NRD co...    504   5e-155   
ref|XP_004002018.1|  PREDICTED: nardilysin isoform 1                    504   5e-155   
ref|XP_006113259.1|  PREDICTED: insulin-degrading enzyme                500   5e-155   
ref|XP_005326135.1|  PREDICTED: nardilysin isoform X2                   504   5e-155   
ref|XP_005353620.1|  PREDICTED: nardilysin isoform X1                   506   5e-155   
ref|XP_005398655.1|  PREDICTED: nardilysin isoform X1                   506   5e-155   
gb|KFY12234.1|  hypothetical protein V492_04012                         501   5e-155   
ref|XP_008268423.1|  PREDICTED: LOW QUALITY PROTEIN: insulin-degr...    500   5e-155   
ref|XP_005678493.1|  PREDICTED: LOW QUALITY PROTEIN: nardilysin         505   6e-155   
ref|XP_005966240.1|  PREDICTED: nardilysin isoform X2                   504   6e-155   
gb|AAQ63406.1|  nardilysin isoform                                      502   6e-155   
ref|XP_010408762.1|  PREDICTED: insulin-degrading enzyme isoform X2     499   6e-155   
ref|XP_002715145.1|  PREDICTED: nardilysin isoform X1                   506   6e-155   
ref|XP_006200540.1|  PREDICTED: nardilysin isoform X1                   506   7e-155   
gb|ELK06148.1|  Nardilysin                                              504   8e-155   
ref|XP_010368719.1|  PREDICTED: nardilysin isoform X2                   503   8e-155   
ref|XP_006087441.1|  PREDICTED: nardilysin                              503   8e-155   
ref|XP_006919251.1|  PREDICTED: nardilysin isoform X1                   503   8e-155   
ref|XP_004025840.1|  PREDICTED: nardilysin isoform 3                    501   9e-155   
ref|NP_001229290.1|  nardilysin isoform c                               501   9e-155   
ref|XP_004400367.1|  PREDICTED: nardilysin isoform 2                    503   9e-155   
ref|XP_004273909.1|  PREDICTED: nardilysin isoform 1                    505   1e-154   
ref|XP_008278393.1|  PREDICTED: insulin-degrading enzyme isoform X1     499   1e-154   
ref|XP_010732889.1|  PREDICTED: insulin-degrading enzyme isoform X2     498   1e-154   
ref|XP_010563221.1|  PREDICTED: insulin-degrading enzyme isoform X3     496   1e-154   
ref|XP_002915766.1|  PREDICTED: nardilysin-like isoform 1               505   1e-154   
ref|XP_007077277.1|  PREDICTED: nardilysin isoform X2                   503   1e-154   
ref|XP_006934802.1|  PREDICTED: nardilysin isoform X2                   503   1e-154   
gb|KGL96243.1|  Insulin-degrading enzyme                                498   1e-154   
ref|XP_003639566.1|  PREDICTED: nardilysin isoform X3                   505   1e-154   
ref|XP_004554598.1|  PREDICTED: insulin-degrading enzyme-like iso...    498   1e-154   
ref|XP_005270960.1|  PREDICTED: nardilysin isoform X1                   496   1e-154   
gb|EEZ97922.1|  hypothetical protein TcasGA2_TC000308                   498   1e-154   
gb|KFO70974.1|  Insulin-degrading enzyme                                497   1e-154   
ref|XP_005894789.1|  PREDICTED: nardilysin isoform X1                   504   1e-154   
gb|KFR11574.1|  Insulin-degrading enzyme                                496   1e-154   
ref|XP_006043805.1|  PREDICTED: nardilysin isoform X1                   504   1e-154   
ref|NP_001193920.1|  nardilysin                                         504   1e-154   
ref|XP_004089845.1|  PREDICTED: LOW QUALITY PROTEIN: nardilysin         503   2e-154   
ref|XP_010983046.1|  PREDICTED: nardilysin                              504   2e-154   
ref|XP_005872545.1|  PREDICTED: nardilysin isoform X2                   503   2e-154   
ref|XP_004002019.1|  PREDICTED: nardilysin isoform 2                    504   2e-154   
ref|XP_006180310.1|  PREDICTED: nardilysin isoform X1                   504   2e-154   
ref|XP_007944083.1|  PREDICTED: nardilysin isoform X2                   503   2e-154   
ref|XP_008697433.1|  PREDICTED: nardilysin isoform X2                   503   2e-154   
ref|XP_005543441.1|  PREDICTED: nardilysin isoform X2                   502   2e-154   
ref|XP_005326134.1|  PREDICTED: nardilysin isoform X1                   504   2e-154   
gb|ELU09335.1|  hypothetical protein CAPTEDRAFT_155510                  497   2e-154   
ref|NP_001126966.1|  nardilysin precursor                               502   2e-154   
ref|XP_010408756.1|  PREDICTED: insulin-degrading enzyme isoform X1     498   2e-154   
ref|XP_010347424.1|  PREDICTED: nardilysin isoform X3                   501   2e-154   
ref|XP_003463112.1|  PREDICTED: nardilysin isoform 1                    503   2e-154   
ref|XP_006503053.1|  PREDICTED: nardilysin isoform X1                   504   2e-154   
gb|EMC85403.1|  Insulin-degrading enzyme                                497   2e-154   
gb|KFP60688.1|  Insulin-degrading enzyme                                497   2e-154   
ref|XP_006919252.1|  PREDICTED: nardilysin isoform X2                   504   3e-154   
ref|XP_005966239.1|  PREDICTED: nardilysin isoform X1                   504   3e-154   
ref|XP_971897.2|  PREDICTED: insulin-degrading enzyme                   498   3e-154   
gb|KFZ02923.1|  hypothetical protein V502_11392                         504   3e-154   
gb|KFW66585.1|  Insulin-degrading enzyme                                497   3e-154   
gb|KFP18691.1|  Insulin-degrading enzyme                                497   3e-154   
ref|XP_006799103.1|  PREDICTED: insulin-degrading enzyme-like           497   3e-154   
ref|XP_010732888.1|  PREDICTED: insulin-degrading enzyme isoform X1     498   4e-154   
ref|XP_004774538.1|  PREDICTED: nardilysin isoform X1                   504   4e-154   
ref|XP_004400366.1|  PREDICTED: nardilysin isoform 1                    504   4e-154   
ref|XP_010368718.1|  PREDICTED: nardilysin isoform X1                   503   4e-154   
ref|XP_008137538.1|  PREDICTED: LOW QUALITY PROTEIN: nardilysin         504   4e-154   
ref|XP_007077276.1|  PREDICTED: nardilysin isoform X1                   503   5e-154   
ref|XP_006934801.1|  PREDICTED: nardilysin isoform X1                   503   5e-154   
ref|XP_003791293.1|  PREDICTED: nardilysin-like                         502   5e-154   
ref|XP_003128026.3|  PREDICTED: nardilysin isoformX1                    501   5e-154   
ref|XP_008320371.1|  PREDICTED: insulin-degrading enzyme                498   5e-154   
ref|XP_009248379.1|  PREDICTED: nardilysin isoform X1                   503   5e-154   
ref|XP_004639182.1|  PREDICTED: nardilysin isoform X2                   501   5e-154   
gb|KFQ47144.1|  Insulin-degrading enzyme                                496   5e-154   
ref|XP_003799974.1|  PREDICTED: nardilysin                              503   6e-154   
ref|XP_005872544.1|  PREDICTED: nardilysin isoform X1                   503   6e-154   
emb|CDQ58532.1|  unnamed protein product                                496   6e-154   
gb|EHB13111.1|  Insulin-degrading enzyme                                497   6e-154   
ref|XP_004371799.1|  PREDICTED: nardilysin isoform 3                    499   6e-154   
ref|XP_004607196.1|  PREDICTED: nardilysin isoform X2                   501   7e-154   
sp|O43847.2|NRDC_HUMAN  RecName: Full=Nardilysin; AltName: Full=N...    501   7e-154   
ref|XP_004025838.1|  PREDICTED: nardilysin isoform 1                    501   7e-154   
ref|XP_004679063.1|  PREDICTED: nardilysin isoform X2                   501   7e-154   
ref|NP_001095132.1|  nardilysin isoform b precursor                     501   7e-154   
gb|KFV82796.1|  Insulin-degrading enzyme                                496   7e-154   
gb|KFZ68820.1|  Insulin-degrading enzyme                                496   7e-154   
ref|XP_008697432.1|  PREDICTED: nardilysin isoform X1                   503   8e-154   
ref|XP_005795231.1|  PREDICTED: insulin-degrading enzyme-like           497   8e-154   
ref|XP_010211466.1|  PREDICTED: insulin-degrading enzyme                496   8e-154   
ref|XP_005543440.1|  PREDICTED: nardilysin isoform X1                   503   8e-154   
gb|KFO86292.1|  Insulin-degrading enzyme                                496   8e-154   
ref|XP_001140946.1|  PREDICTED: nardilysin                              501   9e-154   
ref|XP_008554389.1|  PREDICTED: insulin-degrading enzyme isoform X2     497   9e-154   
ref|XP_007944082.1|  PREDICTED: nardilysin isoform X1                   503   9e-154   
gb|KFU91450.1|  Insulin-degrading enzyme                                496   9e-154   
ref|XP_005933661.1|  PREDICTED: insulin-degrading enzyme-like iso...    496   1e-153   
ref|XP_003463113.1|  PREDICTED: nardilysin isoform 2                    503   1e-153   
gb|EPQ18809.1|  Insulin-degrading enzyme                                497   1e-153   
gb|ELK36661.1|  Insulin-degrading enzyme                                497   1e-153   
ref|XP_008428220.1|  PREDICTED: insulin-degrading enzyme isoform X1     497   1e-153   
sp|Q5R4H6.1|NRDC_PONAB  RecName: Full=Nardilysin; AltName: Full=N...    500   1e-153   
gb|KFY83857.1|  hypothetical protein V500_09817                         503   1e-153   
ref|XP_004869312.1|  PREDICTED: nardilysin isoform X2                   500   1e-153   
ref|XP_003482130.1|  PREDICTED: nardilysin isoform X2                   502   1e-153   
gb|KFP73163.1|  Insulin-degrading enzyme                                495   1e-153   
ref|XP_004679062.1|  PREDICTED: nardilysin isoform X1                   502   1e-153   
ref|XP_004639181.1|  PREDICTED: nardilysin isoform X1                   502   2e-153   
ref|XP_008826667.1|  PREDICTED: nardilysin isoform X2                   500   2e-153   
gb|KFO54305.1|  Insulin-degrading enzyme                                494   2e-153   
gb|EFX00418.1|  a-pheromone processing metallopeptidase ste23           498   2e-153   
ref|XP_004025839.1|  PREDICTED: nardilysin isoform 2                    501   2e-153   
ref|XP_010862163.1|  PREDICTED: insulin-degrading enzyme isoform X1     496   2e-153   
ref|XP_008554388.1|  PREDICTED: insulin-degrading enzyme isoform X1     496   2e-153   
ref|NP_002516.2|  nardilysin isoform a                                  501   2e-153   
ref|XP_010862166.1|  PREDICTED: insulin-degrading enzyme isoform X4     495   2e-153   
ref|XP_006149471.1|  PREDICTED: nardilysin                              501   2e-153   
ref|XP_005933660.1|  PREDICTED: insulin-degrading enzyme-like iso...    495   2e-153   
ref|XP_010862165.1|  PREDICTED: insulin-degrading enzyme isoform X3     496   2e-153   
gb|KFQ91231.1|  Insulin-degrading enzyme                                495   2e-153   
ref|XP_010862168.1|  PREDICTED: insulin-degrading enzyme isoform X5     495   2e-153   
ref|XP_003829605.1|  PREDICTED: nardilysin isoform X1                   501   2e-153   
ref|XP_007567007.1|  PREDICTED: insulin-degrading enzyme isoform X1     496   2e-153   
ref|XP_003921610.1|  PREDICTED: nardilysin isoform X2                   499   2e-153   
gb|ELR05702.1|  insulysin                                               496   3e-153   
ref|XP_005735152.1|  PREDICTED: insulin-degrading enzyme-like iso...    494   3e-153   
ref|XP_010862164.1|  PREDICTED: insulin-degrading enzyme isoform X2     495   3e-153   
ref|XP_004554596.1|  PREDICTED: insulin-degrading enzyme-like iso...    494   3e-153   
ref|XP_007976956.1|  PREDICTED: nardilysin isoform X2                   499   3e-153   
ref|XP_004607195.1|  PREDICTED: nardilysin isoform X1                   501   3e-153   
ref|XP_004869311.1|  PREDICTED: nardilysin isoform X1                   501   4e-153   
ref|XP_006977809.1|  PREDICTED: nardilysin                              498   4e-153   
ref|XP_004554595.1|  PREDICTED: insulin-degrading enzyme-like iso...    495   4e-153   
ref|XP_005735151.1|  PREDICTED: insulin-degrading enzyme-like iso...    494   6e-153   



>ref|XP_009594332.1| PREDICTED: nardilysin isoform X1 [Nicotiana tomentosiformis]
Length=1025

 Score =  1501 bits (3886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/895 (81%), Positives = 809/895 (90%), Gaps = 1/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSK GG SNAYTETEHTCYHFEVK++ L GAL+RFSQFF
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKRGGCSNAYTETEHTCYHFEVKKDCLKGALRRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREV AVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  191   VSPLVKAEAMEREVQAVDSEFNQVLQNDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLADA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGVNLREQI +LYHDNY G  MKLVIIGGE+LD+LESWVLELFS+VKKG +V    R 
Sbjct  251   VERGVNLREQILQLYHDNYRGGSMKLVIIGGESLDLLESWVLELFSSVKKGPLVNPDGRT  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLYWLEAVKDVHIL+LSWTLPSLRK YL+KAEDYLAHLLGHEGKGSLLF LK
Sbjct  311   ELPIWRVGKLYWLEAVKDVHILDLSWTLPSLRKGYLKKAEDYLAHLLGHEGKGSLLFSLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVGDEGMHRSS AYIFGMSIHLTDSGL+KIFEIIGFVYQYLKLLR+ SPQ
Sbjct  371   ARGWVTSISAGVGDEGMHRSSFAYIFGMSIHLTDSGLEKIFEIIGFVYQYLKLLRQNSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQD   +EFR+ EE+PQD+YAAELAE LLVYPP+ V+YGDYAY++WD + IK +
Sbjct  431   EWIFKELQDTANVEFRYAEEQPQDDYAAELAEGLLVYPPKHVIYGDYAYDLWDPEFIKYV  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVD+VTKS   S DVQ EPWFGS+Y EE IPS L ELWKDP EI + LHLP
Sbjct  491   LDFFRPENMRVDIVTKSFQKSDDVQQEPWFGSRYAEEDIPSFLFELWKDPSEISICLHLP  550

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+FIPSDFSIRA+  +CD  N  P+CIL+EPLMK WYKLD TFKLPRANTYFR+TL+G
Sbjct  551   AKNEFIPSDFSIRAEKANCDSKNTKPRCILEEPLMKLWYKLDKTFKLPRANTYFRITLRG  610

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              Y NL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGFN KLPVLL
Sbjct  611   GYGNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFNDKLPVLL  670

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVLA+T SF P+DDRF+VIKEDMERTLKNTNMKPLNH+SYLRLQVLC+SFW+VEEKL L
Sbjct  671   SKVLAMTKSFLPRDDRFMVIKEDMERTLKNTNMKPLNHSSYLRLQVLCQSFWNVEEKLFL  730

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+LA+LKAF+P+LLSQLYIEGLCHGN+LEEEA+NIS+IF S FS  PLP+EMRHKEY
Sbjct  731   LNDLTLAELKAFIPELLSQLYIEGLCHGNLLEEEALNISNIFRSNFSAQPLPSEMRHKEY  790

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRD++VKNKL+TNSVVELYFQIEPE  + LIKLKA++DLFDE+VEEPLF+
Sbjct  791   VMCLPAAADLVRDIRVKNKLETNSVVELYFQIEPEEDTSLIKLKAVIDLFDELVEEPLFN  850

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVVDCS RVTYRI+GFCFRVQSS+YDP+YLQGRIDNFI+  KE+LD LDD 
Sbjct  851   QLRTKEQLGYVVDCSARVTYRIMGFCFRVQSSDYDPVYLQGRIDNFIDGVKELLDGLDDK  910

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFE+++SGLIAKLLEKDPSL+YETNRLWGQI DKRYMFD+SEKEAEEL+SI+KSDL+EWY
Sbjct  911   SFESYRSGLIAKLLEKDPSLAYETNRLWGQITDKRYMFDMSEKEAEELRSIQKSDLVEWY  970

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             HTYL++P PKCRRLSVRVWGCNT  KD+D+ +   +VIKD TAFKKS++FYPS C
Sbjct  971   HTYLRRPSPKCRRLSVRVWGCNTDWKDADSPVASVQVIKDLTAFKKSAKFYPSLC  1025



>ref|XP_006339383.1| PREDICTED: nardilysin-like [Solanum tuberosum]
Length=1023

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 723/895 (81%), Positives = 805/895 (90%), Gaps = 1/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGG SNAYTETEHTCYHFEVKR+ L GAL+RFSQFF
Sbjct  129   LEHMLFMGSTDFPDENEYDSYLSKHGGCSNAYTETEHTCYHFEVKRDCLKGALRRFSQFF  188

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  189   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSNPGHPFNRFFWGNKKSLADA  248

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ++GVNLREQI +L+HDNY G  MKL +IGGE+LD+LESWVLELFS+VKKG +V      
Sbjct  249   VQKGVNLREQILRLHHDNYRGGSMKLAVIGGESLDILESWVLELFSSVKKGPLVNPHGGS  308

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLYWL+AVKDVHIL+LSWTLPSLRK YL+KAEDYLAHLLGHEGKGSLLFFLK
Sbjct  309   ELPIWKVGKLYWLKAVKDVHILDLSWTLPSLRKGYLKKAEDYLAHLLGHEGKGSLLFFLK  368

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVGDEGMHRSS AYIFGMSIHLTD GL KIFEIIGFVYQYLKLL + SPQ
Sbjct  369   ARGWVTSISAGVGDEGMHRSSFAYIFGMSIHLTDFGLAKIFEIIGFVYQYLKLLHQNSPQ  428

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDI  +EFR+ EE+PQD+YAAELAE LLVYPPE V+YGDYAY++WD + IK +
Sbjct  429   EWIFKELQDIANVEFRYAEEQPQDDYAAELAEGLLVYPPEHVIYGDYAYDVWDAEFIKYV  488

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVDVV+KS   S DVQ EPWFGS+YVE+ IPSSL ELWKDP EI+  LHLP
Sbjct  489   LDFFRPENMRVDVVSKSFQKSDDVQQEPWFGSEYVEKDIPSSLFELWKDPTEINACLHLP  548

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+F+PSDFSIRA    CD  NA P+CILDEPLM+ WYKLDNTFKLPRANTYFR+TLKG
Sbjct  549   AKNEFVPSDFSIRAGKAKCDSENARPRCILDEPLMRIWYKLDNTFKLPRANTYFRITLKG  608

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              YSNL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGFN KLPVLL
Sbjct  609   GYSNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFNDKLPVLL  668

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVLA+T SFSP+DDRF+VIKEDM RTLKNTNMKPLNH+SYLRLQVLC+SFWDVEEKL L
Sbjct  669   SKVLAMTKSFSPRDDRFMVIKEDMVRTLKNTNMKPLNHSSYLRLQVLCQSFWDVEEKLFL  728

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+L+DL  F+P+LLSQLYIEGLCHGN+LEEEA+NIS IF S FSV PLP EMRHKEY
Sbjct  729   LNDLTLSDLNFFIPELLSQLYIEGLCHGNLLEEEALNISKIFRSNFSVQPLPFEMRHKEY  788

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRDV+VKNKL+TNSVVELYFQIEPE G+ LIKLKA++DLFDE+VEEPLF+
Sbjct  789   VMCLPTAADLVRDVRVKNKLETNSVVELYFQIEPEEGTALIKLKAVIDLFDELVEEPLFN  848

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVVDCS  VTYRI GFCFRVQSS+YDP+YLQGRI+NFIN  +E+LD LDD 
Sbjct  849   QLRTKEQLGYVVDCSAHVTYRITGFCFRVQSSDYDPVYLQGRIENFINGVEELLDGLDDK  908

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFE+++SGLIAKLLEKDPSL+YETNR WGQI DKRY+FD+SEKEAEEL+SI+KSDLIEWY
Sbjct  909   SFESYRSGLIAKLLEKDPSLAYETNRFWGQITDKRYVFDMSEKEAEELRSIQKSDLIEWY  968

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
              TYL+QP PKCRRL VRVWGCNT RKD+D+ +  A+VIKD  +FKKS++FYPS C
Sbjct  969   RTYLRQPSPKCRRLCVRVWGCNTDRKDADSPVASAEVIKDVISFKKSAKFYPSLC  1023



>ref|XP_009779932.1| PREDICTED: nardilysin isoform X1 [Nicotiana sylvestris]
Length=1025

 Score =  1494 bits (3867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/895 (81%), Positives = 807/895 (90%), Gaps = 1/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSK GG SNAYTETEHTCYHFEVKR+ L GAL+RFSQFF
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKRGGCSNAYTETEHTCYHFEVKRDCLKGALRRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREV AVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  191   VSPLVKAEAMEREVQAVDSEFNQVLQNDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLADA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGVNLREQI KLYHDNY+G  MKLVIIGGE+LD+LESWVLELFS+VKKG +V    R 
Sbjct  251   VERGVNLREQILKLYHDNYHGGSMKLVIIGGESLDILESWVLELFSSVKKGPLVNPDGRT  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLYWLEAVKDVHIL+LSWTL SLRK YL+KAEDYLAHLLGHEGKGSLLF LK
Sbjct  311   ELPIWRVGKLYWLEAVKDVHILDLSWTLRSLRKGYLKKAEDYLAHLLGHEGKGSLLFSLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +G VTSISAGVGDEGMH SS AYIFGMSIHLTDSGL+KIFEIIGFVYQYLKLLR+ SPQ
Sbjct  371   ARGLVTSISAGVGDEGMHCSSFAYIFGMSIHLTDSGLEKIFEIIGFVYQYLKLLRQNSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQD   +EFR+ EE+PQD+YAAELAE LLVYPP+ V+YGDYAY++WD + IK +
Sbjct  431   EWIFKELQDTANVEFRYAEEQPQDDYAAELAEGLLVYPPKHVIYGDYAYDLWDPEFIKYV  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVD+VTKS   S DVQ EPWFGS+YVEE IPSSL ELWKDP EI V LHLP
Sbjct  491   LDFFRPENMRVDIVTKSFQKSDDVQQEPWFGSRYVEEDIPSSLFELWKDPDEISVCLHLP  550

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+FIPSDFSIRA+  +CD  NA P+CIL+EPLMK WYKLD TFKLPRANTYFR+TL+G
Sbjct  551   AKNEFIPSDFSIRAEKANCDSKNAKPRCILEEPLMKIWYKLDKTFKLPRANTYFRITLRG  610

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              Y NL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGF+ KLPVLL
Sbjct  611   GYGNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFSDKLPVLL  670

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVLA+T SF P+DDRF+VIKEDMERTLKNTNMKPLNH+SYLRLQVLC+SFW+VEEKL L
Sbjct  671   SKVLAMTKSFLPRDDRFMVIKEDMERTLKNTNMKPLNHSSYLRLQVLCQSFWNVEEKLLL  730

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+LA+LKAF+P+LLSQLYIEGLCHGN+LEEEA+NIS+IF S FS  PLP+EMRHKEY
Sbjct  731   LNDLTLAELKAFIPELLSQLYIEGLCHGNLLEEEALNISNIFRSNFSAQPLPSEMRHKEY  790

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRD++VKNKL+TNSVVELYFQIEPE  + LIKLKA+ DLFDE VEEPLF+
Sbjct  791   VMCLPAAADLVRDIRVKNKLETNSVVELYFQIEPEEDTSLIKLKAVTDLFDEFVEEPLFN  850

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVVDCS RVTYRI+GFCFRVQSS+YDP+YLQGRIDNFI+  KE+LD+LDD 
Sbjct  851   QLRTKEQLGYVVDCSARVTYRIMGFCFRVQSSDYDPVYLQGRIDNFIDGVKELLDDLDDK  910

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFE+++SGLIAKLLEKDPSL+YETNRLWGQI DKRYMFD+SEKEAEEL+SI+KSDL+EWY
Sbjct  911   SFESYRSGLIAKLLEKDPSLAYETNRLWGQITDKRYMFDMSEKEAEELRSIQKSDLVEWY  970

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             HTYL++P PKCRRLSVRVWGCN   KD+D+ +   + IKD TAFKKS++FYPS C
Sbjct  971   HTYLRRPSPKCRRLSVRVWGCNADWKDADSPVASVQAIKDLTAFKKSAKFYPSLC  1025



>gb|EYU46017.1| hypothetical protein MIMGU_mgv1a000651mg [Erythranthe guttata]
Length=1031

 Score =  1490 bits (3857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/896 (80%), Positives = 801/896 (89%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFL GAL RF+QFF
Sbjct  136   LEHMLFMGSTDFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLKGALTRFAQFF  195

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
              SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQC TS+PGH FNRFFWGNKKSL DA
Sbjct  196   TSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCFTSSPGHAFNRFFWGNKKSLGDA  255

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR++I KLYHD+YYG  MKLV+IGGETLD LESWVL+LFS VKKG  VK    L
Sbjct  256   MEKGINLRDRILKLYHDHYYGGSMKLVLIGGETLDELESWVLDLFSNVKKGLSVKPEMSL  315

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIW+ GKLYWLEAVKDVH+L+LSWTLPSLRKDYL+KAEDYLAHLLGHEG+GSL FFLK
Sbjct  316   GIPIWRTGKLYWLEAVKDVHVLDLSWTLPSLRKDYLKKAEDYLAHLLGHEGRGSLHFFLK  375

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TSISAGVGDEGMHRSSIAYIFGMSIHLTDSGL+KIFEIIGF+YQYLKLLR+ SPQ
Sbjct  376   ARGWATSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLEKIFEIIGFIYQYLKLLRQNSPQ  435

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAE LLVYPP+ V+YGDYAYE+WDE++IK +
Sbjct  436   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAEKLLVYPPKHVIYGDYAYEVWDEEMIKHV  495

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR  NMRVD++TKS   S D+ CEPWFGSQYVEE IP +L++LWKDPPEID SLHLP
Sbjct  496   LDFFRPGNMRVDILTKSFKKSDDILCEPWFGSQYVEEDIPLNLMDLWKDPPEIDSSLHLP  555

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KNDFIP DFSI AD  +C   +A  P+CILDEP MK WYKLD TFKLPRANTYFR+TLK
Sbjct  556   SKNDFIPRDFSIHADEAACQFADASYPRCILDEPDMKLWYKLDKTFKLPRANTYFRITLK  615

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G YSN+RNA+LTELF+LLLKDELNEI+YQASVAKLETSVSLYGDKLELK+YGFN KL VL
Sbjct  616   GGYSNVRNAVLTELFILLLKDELNEIIYQASVAKLETSVSLYGDKLELKLYGFNDKLSVL  675

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA+  SFSPKDDRF VIKEDMERTL+NTNMKPL+H++YLRLQVLC+SFWDVE+KLC
Sbjct  676   LSKVLAIAKSFSPKDDRFRVIKEDMERTLRNTNMKPLSHSAYLRLQVLCQSFWDVEDKLC  735

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             LL+ LS ADLKAF+PDLLSQLYIEGLCHGNMLEEEA+ IS IF S FSV PLP E+RHKE
Sbjct  736   LLSDLSFADLKAFVPDLLSQLYIEGLCHGNMLEEEAIQISEIFKSNFSVKPLPFELRHKE  795

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+CLPS ADLV+D++VKN L+TNSVVELYFQIEPE G+ELIKLKAL DLFDEIVEEPLF
Sbjct  796   SVLCLPSSADLVKDIRVKNNLETNSVVELYFQIEPEEGTELIKLKALTDLFDEIVEEPLF  855

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVVDCSPRVTYRI+GFCFRVQSSEY+P+YLQGRI+NFIN  +E+L+ LD 
Sbjct  856   NQLRTKEQLGYVVDCSPRVTYRIIGFCFRVQSSEYNPVYLQGRIENFINGLEEMLNGLDH  915

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+K+GL+ KLLEKDPSLSYETNR WGQIVDKRYMFD+SEKEAEELK I+K D+IEW
Sbjct  916   ESFENYKNGLLGKLLEKDPSLSYETNRFWGQIVDKRYMFDMSEKEAEELKDIKKEDIIEW  975

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+QP PKCRRL++RVWGCNT  +D+DA +    VI D   FK SSEFYPS C
Sbjct  976   YRTYLRQPSPKCRRLAIRVWGCNTNWQDADAQVASTHVINDLAGFKNSSEFYPSLC  1031



>ref|XP_004231716.1| PREDICTED: nardilysin isoform X1 [Solanum lycopersicum]
Length=1015

 Score =  1487 bits (3850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 719/895 (80%), Positives = 802/895 (90%), Gaps = 1/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYD+YLS+HGG SNAYTE EHTCYHFEVKR+ L  AL+RFSQFF
Sbjct  121   LEHMLFMGSTDFPDENEYDNYLSRHGGCSNAYTEAEHTCYHFEVKRDCLKEALRRFSQFF  180

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  181   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSNPGHPFNRFFWGNKKSLADA  240

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ++GVNLREQI +LYHDNY G  MKL +IGGE++D+LESWVLELFS VKKG +V      
Sbjct  241   VQKGVNLREQILRLYHDNYRGGSMKLAVIGGESVDILESWVLELFSNVKKGPLVNPDGGS  300

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLYWL+AVKDVHIL+LSWTLPSLRK YL+KAEDYLAHLLGHEGKGSLLFFLK
Sbjct  301   ELPIWKVGKLYWLKAVKDVHILDLSWTLPSLRKGYLKKAEDYLAHLLGHEGKGSLLFFLK  360

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVGDEGMHRSS AYIFGMSIHLTD GL+KIFEIIGFVYQYLKLL + SPQ
Sbjct  361   ARGWVTSISAGVGDEGMHRSSFAYIFGMSIHLTDFGLEKIFEIIGFVYQYLKLLHQNSPQ  420

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDI  ++FR+ EE+PQD+YAAELAE LLVYPPE V+YGDYAY++WD + IK +
Sbjct  421   EWIFKELQDIANVDFRYAEEQPQDDYAAELAEGLLVYPPEHVIYGDYAYDVWDAEFIKYV  480

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVDVV+KS   S DVQ EPWFGS+YVE+ IPSSL ELWKDP EI+  LHLP
Sbjct  481   LDFFRPENMRVDVVSKSFQKSDDVQREPWFGSEYVEKDIPSSLFELWKDPTEINACLHLP  540

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+F+PSDFSIRA   +CD  NA P+CILDEPLMK WYKLDNTFKLPRANTYFR+TLKG
Sbjct  541   AKNEFVPSDFSIRAGKANCDWENARPRCILDEPLMKIWYKLDNTFKLPRANTYFRITLKG  600

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              YSNL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGFN KLPVLL
Sbjct  601   GYSNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFNDKLPVLL  660

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVL VT SFSP+DDRF+VIKEDM RTLKNTNMKPLNH+SYLRLQVLC+SFWDVEEKL L
Sbjct  661   SKVLVVTKSFSPRDDRFMVIKEDMVRTLKNTNMKPLNHSSYLRLQVLCQSFWDVEEKLFL  720

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+L+DL  F+P+LLSQLYIEGLCHGN+LEEEA+NIS IF S FSV  LP EMRHKEY
Sbjct  721   LNDLTLSDLNFFIPELLSQLYIEGLCHGNLLEEEALNISKIFRSNFSVQALPFEMRHKEY  780

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRDV+VKNKL+TNSVVELYFQIEPE G+ LIKLKA++DLFDE+VEEPLF+
Sbjct  781   VMCLPTAADLVRDVRVKNKLETNSVVELYFQIEPEEGTALIKLKAVIDLFDELVEEPLFN  840

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVVDCS RVTYRI GFCFRVQSS+YDP+YLQGRIDNFIN  +E+LD+LDD 
Sbjct  841   QLRTKEQLGYVVDCSARVTYRITGFCFRVQSSDYDPVYLQGRIDNFINGVEELLDSLDDK  900

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFE+++SGLIAKLLEKDPSL+YETNR WGQI DKRYMFD+SEKEAE L+SI+K DLIEWY
Sbjct  901   SFESYRSGLIAKLLEKDPSLAYETNRFWGQITDKRYMFDISEKEAEVLRSIQKGDLIEWY  960

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             HTYL+QP PKCRRL VRVWGCNT  KD+D+ +  A+VIKD  +FKKS++FYPS C
Sbjct  961   HTYLRQPSPKCRRLCVRVWGCNTDWKDADSPIASAQVIKDVISFKKSAKFYPSLC  1015



>ref|XP_011080663.1| PREDICTED: nardilysin isoform X1 [Sesamum indicum]
Length=1082

 Score =  1481 bits (3833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/896 (81%), Positives = 814/896 (91%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFL GAL RF+QFF
Sbjct  187   LEHMLFMGSTDFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLKGALTRFAQFF  246

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
              SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQC+TSAPGHPFNRFFWGNKKSLSDA
Sbjct  247   SSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCYTSAPGHPFNRFFWGNKKSLSDA  306

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR++I KLY+D+YYG  MKLV+IGGETL+VLESWVLELFS VKKG +VK   RL
Sbjct  307   MEKGINLRDRILKLYNDHYYGGSMKLVVIGGETLEVLESWVLELFSNVKKGLLVKPEPRL  366

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P+W+AGKLYWLEAVKDVHIL+LSWTLPSLRKDYL+KAEDYLAHLLGHEG+GSL FFLK
Sbjct  367   DIPVWEAGKLYWLEAVKDVHILDLSWTLPSLRKDYLKKAEDYLAHLLGHEGRGSLHFFLK  426

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGL+KIF+IIGFVYQYLKLLR+ SPQ
Sbjct  427   ARGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLEKIFDIIGFVYQYLKLLRQDSPQ  486

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLLVYP E V+YGDYAYE+WD ++IK +
Sbjct  487   EWIFKELQDIGHMEFRFAEEQPQDDYAAELAENLLVYPQEHVIYGDYAYEVWDAEMIKHL  546

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFFR +NMRVDV+TKS+  ++D++ EPWFGS+YVEE IPSSL++LWKDPPEID SLHLP
Sbjct  547   LGFFRPENMRVDVLTKSIKKANDIKHEPWFGSRYVEEDIPSSLMDLWKDPPEIDSSLHLP  606

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KNDFIP DFSI AD  SC   +A  P+C+LDEP MK WYKLD TFKLPRANTYFR+TLK
Sbjct  607   SKNDFIPRDFSICADKASCQFADASSPRCVLDEPYMKLWYKLDKTFKLPRANTYFRITLK  666

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G YSN+RNALLTELF+LLLKDELNEI+YQASVAKLE+SVSLYGDKLELK+YGFN KL VL
Sbjct  667   GGYSNIRNALLTELFILLLKDELNEIIYQASVAKLESSVSLYGDKLELKLYGFNDKLSVL  726

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA+  SFSPKDDRF V+KEDMERTL+NTNMKPLNH+SYLRLQVLC+SFWDVEEKLC
Sbjct  727   LSKVLAIAKSFSPKDDRFRVVKEDMERTLRNTNMKPLNHSSYLRLQVLCQSFWDVEEKLC  786

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             LL+ LSLADL+AF+PDLLSQLYIEGLCHGN+LEEEA+ IS IF S F V  LP E+RHKE
Sbjct  787   LLSDLSLADLRAFIPDLLSQLYIEGLCHGNLLEEEALQISQIFRSNFPVQSLPHELRHKE  846

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              VMCLPS ADLVRDV+VKNKL+ NSVVELYFQIEPEVG+ L KLKAL DLFDEIVEEPLF
Sbjct  847   SVMCLPSCADLVRDVRVKNKLEPNSVVELYFQIEPEVGTTLTKLKALTDLFDEIVEEPLF  906

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEY+P+YLQ RI+NFIN  +E+L+ LD+
Sbjct  907   NQLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYNPVYLQERIENFINGLEEMLNGLDN  966

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+++GL+ KLLEKDPSLSYETNR WGQIVDKRYMFDLSEKEAEELK ++K D+I W
Sbjct  967   ESFENYRNGLMGKLLEKDPSLSYETNRFWGQIVDKRYMFDLSEKEAEELKGVQKGDIINW  1026

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+QP PKCRRL+VRVWGCNT  KD+D  +   +VIKD   FK+SS+FYPSFC
Sbjct  1027  YRTYLRQPSPKCRRLAVRVWGCNTDLKDADEQVASRQVIKDLAGFKESSDFYPSFC  1082



>ref|XP_009594333.1| PREDICTED: insulin-degrading enzyme isoform X2 [Nicotiana tomentosiformis]
Length=901

 Score =  1462 bits (3784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/876 (81%), Positives = 790/876 (90%), Gaps = 1/876 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSK GG SNAYTETEHTCYHFEVK++ L GAL+RFSQFFVSPLVKAEAMEREV AVDS
Sbjct  26    SYLSKRGGCSNAYTETEHTCYHFEVKKDCLKGALRRFSQFFVSPLVKAEAMEREVQAVDS  85

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA ERGVNLREQI +LYHDNY
Sbjct  86    EFNQVLQNDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLADAVERGVNLREQILQLYHDNY  145

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
              G  MKLVIIGGE+LD+LESWVLELFS+VKKG +V    R E PIW+ GKLYWLEAVKDV
Sbjct  146   RGGSMKLVIIGGESLDLLESWVLELFSSVKKGPLVNPDGRTELPIWRVGKLYWLEAVKDV  205

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HIL+LSWTLPSLRK YL+KAEDYLAHLLGHEGKGSLLF LK +GWVTSISAGVGDEGMHR
Sbjct  206   HILDLSWTLPSLRKGYLKKAEDYLAHLLGHEGKGSLLFSLKARGWVTSISAGVGDEGMHR  265

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SS AYIFGMSIHLTDSGL+KIFEIIGFVYQYLKLLR+ SPQEWIFKELQD   +EFR+ E
Sbjct  266   SSFAYIFGMSIHLTDSGLEKIFEIIGFVYQYLKLLRQNSPQEWIFKELQDTANVEFRYAE  325

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAE LLVYPP+ V+YGDYAY++WD + IK +L FFR +NMRVD+VTKS  
Sbjct  326   EQPQDDYAAELAEGLLVYPPKHVIYGDYAYDLWDPEFIKYVLDFFRPENMRVDIVTKSFQ  385

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              S DVQ EPWFGS+Y EE IPS L ELWKDP EI + LHLPAKN+FIPSDFSIRA+  +C
Sbjct  386   KSDDVQQEPWFGSRYAEEDIPSFLFELWKDPSEISICLHLPAKNEFIPSDFSIRAEKANC  445

Query  1674  DGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLK  1850
             D  N  P+CIL+EPLMK WYKLD TFKLPRANTYFR+TL+G Y NL+NALLTELF+ LLK
Sbjct  446   DSKNTKPRCILEEPLMKLWYKLDKTFKLPRANTYFRITLRGGYGNLKNALLTELFIHLLK  505

Query  1851  DELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLV  2030
             DELNEI+YQASVAKLETSVSLYGDKLELKVYGFN KLPVLLSKVLA+T SF P+DDRF+V
Sbjct  506   DELNEIIYQASVAKLETSVSLYGDKLELKVYGFNDKLPVLLSKVLAMTKSFLPRDDRFMV  565

Query  2031  IKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQ  2210
             IKEDMERTLKNTNMKPLNH+SYLRLQVLC+SFW+VEEKL LLN L+LA+LKAF+P+LLSQ
Sbjct  566   IKEDMERTLKNTNMKPLNHSSYLRLQVLCQSFWNVEEKLFLLNDLTLAELKAFIPELLSQ  625

Query  2211  LYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNK  2390
             LYIEGLCHGN+LEEEA+NIS+IF S FS  PLP+EMRHKEYVMCLP+ ADLVRD++VKNK
Sbjct  626   LYIEGLCHGNLLEEEALNISNIFRSNFSAQPLPSEMRHKEYVMCLPAAADLVRDIRVKNK  685

Query  2391  LDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVT  2570
             L+TNSVVELYFQIEPE  + LIKLKA++DLFDE+VEEPLF++LRTKEQLGYVVDCS RVT
Sbjct  686   LETNSVVELYFQIEPEEDTSLIKLKAVIDLFDELVEEPLFNQLRTKEQLGYVVDCSARVT  745

Query  2571  YRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPS  2750
             YRI+GFCFRVQSS+YDP+YLQGRIDNFI+  KE+LD LDD SFE+++SGLIAKLLEKDPS
Sbjct  746   YRIMGFCFRVQSSDYDPVYLQGRIDNFIDGVKELLDGLDDKSFESYRSGLIAKLLEKDPS  805

Query  2751  LSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVW  2930
             L+YETNRLWGQI DKRYMFD+SEKEAEEL+SI+KSDL+EWYHTYL++P PKCRRLSVRVW
Sbjct  806   LAYETNRLWGQITDKRYMFDMSEKEAEELRSIQKSDLVEWYHTYLRRPSPKCRRLSVRVW  865

Query  2931  GCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             GCNT  KD+D+ +   +VIKD TAFKKS++FYPS C
Sbjct  866   GCNTDWKDADSPVASVQVIKDLTAFKKSAKFYPSLC  901



>ref|XP_009779934.1| PREDICTED: insulin-degrading enzyme isoform X3 [Nicotiana sylvestris]
Length=901

 Score =  1453 bits (3761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/876 (81%), Positives = 788/876 (90%), Gaps = 1/876 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSK GG SNAYTETEHTCYHFEVKR+ L GAL+RFSQFFVSPLVKAEAMEREV AVDS
Sbjct  26    SYLSKRGGCSNAYTETEHTCYHFEVKRDCLKGALRRFSQFFVSPLVKAEAMEREVQAVDS  85

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA ERGVNLREQI KLYHDNY
Sbjct  86    EFNQVLQNDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLADAVERGVNLREQILKLYHDNY  145

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             +G  MKLVIIGGE+LD+LESWVLELFS+VKKG +V    R E PIW+ GKLYWLEAVKDV
Sbjct  146   HGGSMKLVIIGGESLDILESWVLELFSSVKKGPLVNPDGRTELPIWRVGKLYWLEAVKDV  205

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HIL+LSWTL SLRK YL+KAEDYLAHLLGHEGKGSLLF LK +G VTSISAGVGDEGMH 
Sbjct  206   HILDLSWTLRSLRKGYLKKAEDYLAHLLGHEGKGSLLFSLKARGLVTSISAGVGDEGMHC  265

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SS AYIFGMSIHLTDSGL+KIFEIIGFVYQYLKLLR+ SPQEWIFKELQD   +EFR+ E
Sbjct  266   SSFAYIFGMSIHLTDSGLEKIFEIIGFVYQYLKLLRQNSPQEWIFKELQDTANVEFRYAE  325

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAE LLVYPP+ V+YGDYAY++WD + IK +L FFR +NMRVD+VTKS  
Sbjct  326   EQPQDDYAAELAEGLLVYPPKHVIYGDYAYDLWDPEFIKYVLDFFRPENMRVDIVTKSFQ  385

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              S DVQ EPWFGS+YVEE IPSSL ELWKDP EI V LHLPAKN+FIPSDFSIRA+  +C
Sbjct  386   KSDDVQQEPWFGSRYVEEDIPSSLFELWKDPDEISVCLHLPAKNEFIPSDFSIRAEKANC  445

Query  1674  DGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLK  1850
             D  NA P+CIL+EPLMK WYKLD TFKLPRANTYFR+TL+G Y NL+NALLTELF+ LLK
Sbjct  446   DSKNAKPRCILEEPLMKIWYKLDKTFKLPRANTYFRITLRGGYGNLKNALLTELFIHLLK  505

Query  1851  DELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLV  2030
             DELNEI+YQASVAKLETSVSLYGDKLELKVYGF+ KLPVLLSKVLA+T SF P+DDRF+V
Sbjct  506   DELNEIIYQASVAKLETSVSLYGDKLELKVYGFSDKLPVLLSKVLAMTKSFLPRDDRFMV  565

Query  2031  IKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQ  2210
             IKEDMERTLKNTNMKPLNH+SYLRLQVLC+SFW+VEEKL LLN L+LA+LKAF+P+LLSQ
Sbjct  566   IKEDMERTLKNTNMKPLNHSSYLRLQVLCQSFWNVEEKLLLLNDLTLAELKAFIPELLSQ  625

Query  2211  LYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNK  2390
             LYIEGLCHGN+LEEEA+NIS+IF S FS  PLP+EMRHKEYVMCLP+ ADLVRD++VKNK
Sbjct  626   LYIEGLCHGNLLEEEALNISNIFRSNFSAQPLPSEMRHKEYVMCLPAAADLVRDIRVKNK  685

Query  2391  LDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVT  2570
             L+TNSVVELYFQIEPE  + LIKLKA+ DLFDE VEEPLF++LRTKEQLGYVVDCS RVT
Sbjct  686   LETNSVVELYFQIEPEEDTSLIKLKAVTDLFDEFVEEPLFNQLRTKEQLGYVVDCSARVT  745

Query  2571  YRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPS  2750
             YRI+GFCFRVQSS+YDP+YLQGRIDNFI+  KE+LD+LDD SFE+++SGLIAKLLEKDPS
Sbjct  746   YRIMGFCFRVQSSDYDPVYLQGRIDNFIDGVKELLDDLDDKSFESYRSGLIAKLLEKDPS  805

Query  2751  LSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVW  2930
             L+YETNRLWGQI DKRYMFD+SEKEAEEL+SI+KSDL+EWYHTYL++P PKCRRLSVRVW
Sbjct  806   LAYETNRLWGQITDKRYMFDMSEKEAEELRSIQKSDLVEWYHTYLRRPSPKCRRLSVRVW  865

Query  2931  GCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             GCN   KD+D+ +   + IKD TAFKKS++FYPS C
Sbjct  866   GCNADWKDADSPVASVQAIKDLTAFKKSAKFYPSLC  901



>emb|CDP04048.1| unnamed protein product [Coffea canephora]
Length=1026

 Score =  1449 bits (3751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/896 (80%), Positives = 802/896 (90%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNAYTETEHTCYHFEV REFL GAL+RFSQFF
Sbjct  131   LEHMLFMGSTDFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVNREFLKGALRRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEFNQVLQ+DSCRLQQLQCHTS PGHPFNRFFWGNKKSL DA
Sbjct  191   ISPLVKAEAMEREVLAVDSEFNQVLQSDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLVDA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLRE+I  LY++NYY   MKLV+IGGE+LDVLESWVLELFS++KKG   K  S  
Sbjct  251   MEKGINLRERILNLYNENYYAGAMKLVVIGGESLDVLESWVLELFSSIKKGIRTKEVSVP  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAGKLYWLEAVKDVHIL+LSWTLPSLR +YL+KAEDYLAHLLGHEG+GSLLF LK
Sbjct  311   ELPIWKAGKLYWLEAVKDVHILDLSWTLPSLRHEYLKKAEDYLAHLLGHEGRGSLLFSLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TSISAGVGDEGM R+++ YIFGMSIHLTDSGL+KIFE+IGF+YQY+KLLR+VSPQ
Sbjct  371   AKGWATSISAGVGDEGMQRNTMVYIFGMSIHLTDSGLEKIFEVIGFIYQYIKLLRQVSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+F+F EE+PQDEYAAELAENLLVYPP+ V+YGDYAY++WDE++IK +
Sbjct  431   EWIFRELQDIGSMDFQFAEEQPQDEYAAELAENLLVYPPDHVIYGDYAYKLWDEEMIKHV  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVD+VTKS N S DVQ EPWFGS+Y EE IPSSL+ELW DPPE D++LHLP
Sbjct  491   LDFFRPENMRVDIVTKSFNKSHDVQNEPWFGSKYAEEDIPSSLMELWLDPPENDMALHLP  550

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSIRA++ S +  G + PKCILDEPL+KFWYKLD TFKLPRANTYFRVTL 
Sbjct  551   VKNEFIPVDFSIRAESASGELAGVSTPKCILDEPLIKFWYKLDKTFKLPRANTYFRVTLN  610

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G   NL+NALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFN KLPVL
Sbjct  611   GGCGNLKNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNDKLPVL  670

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             L KVL +T SFSPKDDRF+VIKED+ERTLKNTNMKPL+H+SYLRLQVLC+SFWDVEEKL 
Sbjct  671   LFKVLTMTKSFSPKDDRFMVIKEDIERTLKNTNMKPLSHSSYLRLQVLCQSFWDVEEKLS  730

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             LLN LSL+DL+AF+PDLLSQLYIEGLCHGN+LEEEAV IS+IF S FSVP LP EMRHKE
Sbjct  731   LLNDLSLSDLRAFIPDLLSQLYIEGLCHGNILEEEAVVISNIFKSNFSVPALPVEMRHKE  790

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              VMCLPSGADLVRD++VKNKL+ NSVVELY+QIEPE+ S L KLKALVDLFDEIVEEPLF
Sbjct  791   CVMCLPSGADLVRDIRVKNKLEKNSVVELYYQIEPELESGLTKLKALVDLFDEIVEEPLF  850

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVVDCSPRVTYRI+GFCFRVQSSEY+P++LQGRIDNFIN  +E+L+ LD+
Sbjct  851   NQLRTKEQLGYVVDCSPRVTYRIMGFCFRVQSSEYNPVHLQGRIDNFINGIEEMLEGLDN  910

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+KSGL+ KLLEKDPSL YETNR WGQIVDKRYMFDLSEKEA EL SI+K D+IEW
Sbjct  911   ESFENYKSGLMGKLLEKDPSLLYETNRFWGQIVDKRYMFDLSEKEAMELGSIQKGDVIEW  970

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+ P PKCRRL+VRVWGC T   D +  +  A++I+D   FKK S +YPS C
Sbjct  971   YRTYLRHPSPKCRRLAVRVWGCYTDWNDVNTQLSAAQLIEDLATFKKLSAYYPSMC  1026



>ref|XP_011080664.1| PREDICTED: insulin-degrading enzyme isoform X2 [Sesamum indicum]
Length=880

 Score =  1442 bits (3732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/877 (81%), Positives = 795/877 (91%), Gaps = 2/877 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTETEHTCYHFEVKREFL GAL RF+QFF SPLVKAEAMEREVLAVDS
Sbjct  4     SYLSKHGGSSNAYTETEHTCYHFEVKREFLKGALTRFAQFFSSPLVKAEAMEREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQNDSCRLQQLQC+TSAPGHPFNRFFWGNKKSLSDA E+G+NLR++I KLY+D+Y
Sbjct  64    EFNQVLQNDSCRLQQLQCYTSAPGHPFNRFFWGNKKSLSDAMEKGINLRDRILKLYNDHY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             YG  MKLV+IGGETL+VLESWVLELFS VKKG +VK   RL+ P+W+AGKLYWLEAVKDV
Sbjct  124   YGGSMKLVVIGGETLEVLESWVLELFSNVKKGLLVKPEPRLDIPVWEAGKLYWLEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HIL+LSWTLPSLRKDYL+KAEDYLAHLLGHEG+GSL FFLK +GWVTSISAGVGDEGMHR
Sbjct  184   HILDLSWTLPSLRKDYLKKAEDYLAHLLGHEGRGSLHFFLKARGWVTSISAGVGDEGMHR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SSIAYIFGMSIHLTDSGL+KIF+IIGFVYQYLKLLR+ SPQEWIFKELQDIG MEFRF E
Sbjct  244   SSIAYIFGMSIHLTDSGLEKIFDIIGFVYQYLKLLRQDSPQEWIFKELQDIGHMEFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAENLLVYP E V+YGDYAYE+WD ++IK +LGFFR +NMRVDV+TKS+ 
Sbjct  304   EQPQDDYAAELAENLLVYPQEHVIYGDYAYEVWDAEMIKHLLGFFRPENMRVDVLTKSIK  363

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              ++D++ EPWFGS+YVEE IPSSL++LWKDPPEID SLHLP+KNDFIP DFSI AD  SC
Sbjct  364   KANDIKHEPWFGSRYVEEDIPSSLMDLWKDPPEIDSSLHLPSKNDFIPRDFSICADKASC  423

Query  1674  DGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLL  1847
                +A  P+C+LDEP MK WYKLD TFKLPRANTYFR+TLKG YSN+RNALLTELF+LLL
Sbjct  424   QFADASSPRCVLDEPYMKLWYKLDKTFKLPRANTYFRITLKGGYSNIRNALLTELFILLL  483

Query  1848  KDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFL  2027
             KDELNEI+YQASVAKLE+SVSLYGDKLELK+YGFN KL VLLSKVLA+  SFSPKDDRF 
Sbjct  484   KDELNEIIYQASVAKLESSVSLYGDKLELKLYGFNDKLSVLLSKVLAIAKSFSPKDDRFR  543

Query  2028  VIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLS  2207
             V+KEDMERTL+NTNMKPLNH+SYLRLQVLC+SFWDVEEKLCLL+ LSLADL+AF+PDLLS
Sbjct  544   VVKEDMERTLRNTNMKPLNHSSYLRLQVLCQSFWDVEEKLCLLSDLSLADLRAFIPDLLS  603

Query  2208  QLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKN  2387
             QLYIEGLCHGN+LEEEA+ IS IF S F V  LP E+RHKE VMCLPS ADLVRDV+VKN
Sbjct  604   QLYIEGLCHGNLLEEEALQISQIFRSNFPVQSLPHELRHKESVMCLPSCADLVRDVRVKN  663

Query  2388  KLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRV  2567
             KL+ NSVVELYFQIEPEVG+ L KLKAL DLFDEIVEEPLF++LRTKEQLGYVVDCSPRV
Sbjct  664   KLEPNSVVELYFQIEPEVGTTLTKLKALTDLFDEIVEEPLFNQLRTKEQLGYVVDCSPRV  723

Query  2568  TYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDP  2747
             TYRILGFCFRVQSSEY+P+YLQ RI+NFIN  +E+L+ LD++SFEN+++GL+ KLLEKDP
Sbjct  724   TYRILGFCFRVQSSEYNPVYLQERIENFINGLEEMLNGLDNESFENYRNGLMGKLLEKDP  783

Query  2748  SLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             SLSYETNR WGQIVDKRYMFDLSEKEAEELK ++K D+I WY TYL+QP PKCRRL+VRV
Sbjct  784   SLSYETNRFWGQIVDKRYMFDLSEKEAEELKGVQKGDIINWYRTYLRQPSPKCRRLAVRV  843

Query  2928  WGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WGCNT  KD+D  +   +VIKD   FK+SS+FYPSFC
Sbjct  844   WGCNTDLKDADEQVASRQVIKDLAGFKESSDFYPSFC  880



>ref|XP_007208119.1| hypothetical protein PRUPE_ppa000683mg [Prunus persica]
 gb|EMJ09318.1| hypothetical protein PRUPE_ppa000683mg [Prunus persica]
Length=1037

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/896 (75%), Positives = 780/896 (87%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GAL+RFSQFF
Sbjct  142   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKREFLKGALRRFSQFF  201

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV AVDSEFNQ LQNDSCRL+QLQCHTS PGHPFNRF WGNKKSL DA
Sbjct  202   VSPLVKNEAMEREVQAVDSEFNQALQNDSCRLEQLQCHTSTPGHPFNRFSWGNKKSLVDA  261

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  V    + 
Sbjct  262   MEKGINLREQILKLYRDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVNLEFKA  321

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAGKLY LEAVKDVHIL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  322   EGPIWKAGKLYRLEAVKDVHILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  381

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KIFEIIGFVYQY+KLLR+VSPQ
Sbjct  382   SRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKIFEIIGFVYQYIKLLRKVSPQ  441

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG MEFRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD++LIK +
Sbjct  442   EWIFRELQDIGNMEFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDDELIKYV  501

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF   NMRVDVV+KS   S D QCEPWFGS Y EE I  SL++LWKDPPEIDVSLHLP
Sbjct  502   LGFFTPQNMRVDVVSKSSIKSEDFQCEPWFGSHYTEEDISPSLMDLWKDPPEIDVSLHLP  561

Query  1617  AKNDFIPSDFSIRADTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DFSIR+D +  D  N  +P+CI+DEPL+KFWYKLDNTFKLPRANTYFR+ LK
Sbjct  562   SKNEFIPCDFSIRSDNLCLDPANISSPRCIIDEPLIKFWYKLDNTFKLPRANTYFRINLK  621

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y+NL++ +LTEL++LLLKDELNEIVYQASVAKLETSVSL  DKLELKVYGFN+KLP L
Sbjct  622   SGYANLKSCVLTELYILLLKDELNEIVYQASVAKLETSVSLLSDKLELKVYGFNNKLPAL  681

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA   SF P DDRF V+KEDM+RTLKNTNMKPL+H+SYLRLQVLC+SF+DVEEKL 
Sbjct  682   LSKVLATAKSFLPTDDRFKVVKEDMKRTLKNTNMKPLSHSSYLRLQVLCQSFYDVEEKLH  741

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  LS++DLK+F+P+L SQLYIEGLCHGN+ EEEA+++S+IF   FS+ PLP E+RHKE
Sbjct  742   VLKELSISDLKSFIPELCSQLYIEGLCHGNLFEEEAISLSNIFKMNFSIQPLPIELRHKE  801

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L RD  VKNK DTNSV+ELYFQIE EVG E  +LKAL+DLFDEIVEEPLF
Sbjct  802   HVICLPPGANLTRDASVKNKSDTNSVIELYFQIEQEVGIESTRLKALIDLFDEIVEEPLF  861

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYR+ GFCF VQSSEY+PIYLQGR+DNFIN  +E+L+ LD 
Sbjct  862   NQLRTKEQLGYVVECSPRVTYRVFGFCFCVQSSEYNPIYLQGRVDNFINGLEELLEGLDG  921

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFEN++SGL+AKLLEKDPSL+YETNR W QI+DKRY+FDLS++EAEEL+S+ K D+I W
Sbjct  922   DSFENYRSGLMAKLLEKDPSLTYETNRYWNQIIDKRYIFDLSKREAEELRSVDKEDVINW  981

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y  YL+Q  PKCRRL++RVWGCNT RK+++A +E  +VI+DP  FK SS FYPS C
Sbjct  982   YKMYLQQSSPKCRRLAIRVWGCNTDRKEAEARLESVQVIEDPATFKMSSRFYPSIC  1037



>ref|XP_008241920.1| PREDICTED: nardilysin-like [Prunus mume]
Length=1037

 Score =  1412 bits (3656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/896 (75%), Positives = 777/896 (87%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GAL+RFSQFF
Sbjct  142   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKREFLKGALRRFSQFF  201

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV AVDSEFNQ LQNDSCRL+QLQCHTS PGHPFNRFFWGNKKSL DA
Sbjct  202   VSPLVKIEAMEREVQAVDSEFNQALQNDSCRLEQLQCHTSTPGHPFNRFFWGNKKSLVDA  261

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  V    + 
Sbjct  262   MEKGINLREQILKLYKDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVNLEFKT  321

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAGKLY LEAVKDVHIL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  322   EGPIWKAGKLYRLEAVKDVHILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  381

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KIFEIIGFVYQY+KLLR VSPQ
Sbjct  382   SRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKIFEIIGFVYQYIKLLRRVSPQ  441

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG MEFRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD++LIK +
Sbjct  442   EWIFRELQDIGNMEFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDDELIKYV  501

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF   NMRVDVV+KS   S D QCEPWFGS Y EE I  SL++LWKDPPEIDVSLHLP
Sbjct  502   LGFFTPQNMRVDVVSKSSIKSEDFQCEPWFGSHYTEEDISPSLMDLWKDPPEIDVSLHLP  561

Query  1617  AKNDFIPSDFSIRADTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DFSIR+D    D  N  +P+CI+DEPL+KFWYKLDNTFKLPRANTYFR+ LK
Sbjct  562   SKNEFIPCDFSIRSDNSCLDPANISSPRCIIDEPLIKFWYKLDNTFKLPRANTYFRINLK  621

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y+NL++ +LTEL++LLLKDELNEIVYQASVAKLETSVSL  DKLELKVYGFN+KLP L
Sbjct  622   SGYANLKSCVLTELYILLLKDELNEIVYQASVAKLETSVSLLSDKLELKVYGFNNKLPAL  681

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA   SF P DDRF V+KEDM+RTLKNTNMKPL+H+SYLRLQVLC+SF+DVEEKL 
Sbjct  682   LSKVLATAKSFLPTDDRFKVVKEDMKRTLKNTNMKPLSHSSYLRLQVLCQSFYDVEEKLH  741

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  LS++DLK+F+P+L SQLYIEGLCHGN+  EEA+++S+IF   FS+ PLP E+RHKE
Sbjct  742   VLKELSISDLKSFIPELCSQLYIEGLCHGNLFAEEAISLSNIFKMNFSIQPLPIELRHKE  801

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L RD  VKNK DTNSV+ELYFQIE E G E  +LKAL+DLFDEIVEEPLF
Sbjct  802   HVICLPPGANLTRDASVKNKSDTNSVIELYFQIEQEAGIESTRLKALIDLFDEIVEEPLF  861

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYR+ GFCF VQSSEY+PIYLQGR+DNFIN  +E+L+ LD 
Sbjct  862   NQLRTKEQLGYVVECSPRVTYRVFGFCFCVQSSEYNPIYLQGRVDNFINGLEELLEGLDG  921

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFEN++SGL+AKLLEKDPSL+YETNR W QI+DKRY+FDLS++EAEEL+S+ K D+I W
Sbjct  922   DSFENYRSGLMAKLLEKDPSLTYETNRYWNQIIDKRYIFDLSKREAEELRSVDKEDVINW  981

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y  YL+Q  PKCRRL++RVWGCNT RK+++A +E  +VI+DP  FK SS FYPS C
Sbjct  982   YKMYLQQSSPKCRRLAIRVWGCNTDRKEAEARLESVQVIEDPATFKMSSRFYPSIC  1037



>gb|KDP45687.1| hypothetical protein JCGZ_17294 [Jatropha curcas]
Length=1030

 Score =  1388 bits (3593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/894 (74%), Positives = 780/894 (87%), Gaps = 0/894 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVK EFL GAL+RFSQFF
Sbjct  137   LEHMLFMGSTDFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKPEFLQGALRRFSQFF  196

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREVLAVDSEFNQVLQND+CRLQQLQCHTS PG+PFNRFF GNKKSL DA
Sbjct  197   VSPLVKVEAMEREVLAVDSEFNQVLQNDACRLQQLQCHTSGPGYPFNRFFCGNKKSLIDA  256

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLRE I KLY D Y+G  MKLV+IGGE+LD+LE+WV ELFS V+KG   K   ++
Sbjct  257   MEKGINLREHILKLYRDYYHGGLMKLVVIGGESLDILENWVAELFSNVRKGPQAKPKFQV  316

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             +  +W AGKLY LEAVKDVHIL+L+WTLP LR+DYL+K+EDYLAHLLGHEG+GSL  FLK
Sbjct  317   QGSVWTAGKLYRLEAVKDVHILDLTWTLPCLRQDYLKKSEDYLAHLLGHEGRGSLHSFLK  376

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS++AGVGDEGMHRS++AYIFGMSIHLTDSGL+KIF+IIGFVYQYLKLLR+VSPQ
Sbjct  377   AKGWATSLAAGVGDEGMHRSTVAYIFGMSIHLTDSGLEKIFDIIGFVYQYLKLLRQVSPQ  436

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLLVYP E V+YGDY ++IWDE++I+ +
Sbjct  437   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLVYPAEHVIYGDYVHKIWDEEMIRHL  496

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF+ +NMR+DVV+KS  +S D Q EPWFGS+Y+EE+IP SL+ELWKDPP +DVSLHLP
Sbjct  497   LGFFKPENMRIDVVSKSFMDSQDFQFEPWFGSRYIEEHIPPSLMELWKDPPVLDVSLHLP  556

Query  1617  AKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGA  1796
             +KN+FIP +FSIRAD  +    + P+CI+D  LMKFWYK DNTFKLPR NTYFR+ LKGA
Sbjct  557   SKNEFIPCEFSIRADNSNDTNSSLPRCIIDGALMKFWYKPDNTFKLPRTNTYFRMNLKGA  616

Query  1797  YSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLS  1976
             Y+++++ +LTELF+ LLKDELNEI+YQASVAKLETSVS  GDKLELKVYGFN K+PVLLS
Sbjct  617   YNDVKSCILTELFINLLKDELNEIIYQASVAKLETSVSFVGDKLELKVYGFNDKVPVLLS  676

Query  1977  KVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcll  2156
             K+L +  SF P +DRF VIKEDMER+LKN NMKPL H+SYLRLQVLCK+F+DVEEKLC+L
Sbjct  677   KILVIANSFVPINDRFKVIKEDMERSLKNANMKPLKHSSYLRLQVLCKNFYDVEEKLCVL  736

Query  2157  nslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYV  2336
             + L LADLKAF+P L SQLYIEGLCHGN+LEEEA+NIS+IF S F V PLP  MRH+E+V
Sbjct  737   SDLCLADLKAFIPGLRSQLYIEGLCHGNLLEEEAINISNIFKSTFLVQPLPVNMRHEEHV  796

Query  2337  MCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDR  2516
             +CLP+G++L RDV+VKNK +TNSVVELYFQIEPE  S+ IKLKAL+DLFDEIVEEPLF++
Sbjct  797   LCLPAGSNLARDVKVKNKSETNSVVELYFQIEPETESKSIKLKALIDLFDEIVEEPLFNQ  856

Query  2517  LRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDS  2696
             LRTKEQLGYVV+CSPRVTYRI GFCF VQSS+Y+PIYLQGRIDNFI+D  ++L+ LDD S
Sbjct  857   LRTKEQLGYVVECSPRVTYRIYGFCFCVQSSKYNPIYLQGRIDNFISDLDKLLEGLDDTS  916

Query  2697  FENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYH  2876
             FEN+++GL+AKLLEKDPSL YETNRLW QIVDKRYMFD S+KEAEE++ + K D+I WY 
Sbjct  917   FENYRNGLMAKLLEKDPSLQYETNRLWNQIVDKRYMFDFSQKEAEEVQKLHKDDVISWYK  976

Query  2877  TYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             TYL+Q  P CRRL VRVWGCNT  K+ +A  +  + IKD +AFK SSE+YPS C
Sbjct  977   TYLQQSSPNCRRLVVRVWGCNTDLKEFEAERDSEQAIKDLSAFKMSSEYYPSLC  1030



>ref|XP_011021019.1| PREDICTED: nardilysin [Populus euphratica]
Length=1072

 Score =  1375 bits (3560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/896 (74%), Positives = 772/896 (86%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GAL+RFSQFF
Sbjct  177   LEHMLFMGSEEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKREFLKGALRRFSQFF  236

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K+EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTS PGHPFNRF WGNKKSL DA
Sbjct  237   VSPLMKSEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSGPGHPFNRFSWGNKKSLVDA  296

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLRE I KLY D Y+G  MKLV+IGGE LDVLESWV ELF+ V+KG   K   ++
Sbjct  297   MEKGINLREHILKLYRDYYHGGLMKLVVIGGEPLDVLESWVTELFAKVRKGPQTKPKFQV  356

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAG LY LEAVKDV+IL+L+WTLP L ++YL+K+EDYLAHLLGHEGKGSL  FLK
Sbjct  357   EGPIWKAGLLYRLEAVKDVNILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGKGSLHSFLK  416

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +G  TS+SAGVGDEGMHRSS+AYIFGMSIHLTD GL+KIF+IIGFVYQYLKLLREV PQ
Sbjct  417   ARGLATSLSAGVGDEGMHRSSLAYIFGMSIHLTDDGLEKIFDIIGFVYQYLKLLREVPPQ  476

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +WIFKELQDIG MEFRF EE+PQD+YAAELAENLLV+P E+V+Y DY Y+IWDE+ IK +
Sbjct  477   QWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLVFPAENVIYCDYVYKIWDEKAIKRL  536

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  +NMR+DVV+K    S D+QCEPWFGS Y+EE IP SL+E+W+DPPE+DVSLH+P
Sbjct  537   LQFFTPENMRIDVVSKPSVKSQDLQCEPWFGSSYIEEAIPPSLIEIWRDPPEVDVSLHMP  596

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+F+PSDFSIRAD +  D  NA  P+CI+DEPLMKFWYKLD+TFK+PRANTYFR+ LK
Sbjct  597   SKNEFVPSDFSIRADNLDHDPVNASFPRCIIDEPLMKFWYKLDSTFKVPRANTYFRIYLK  656

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y+++++ L+TELF+LLLKDELNEI+YQASVAKLETS+SL  DKLELKVYGFN KLP L
Sbjct  657   EGYASVKSFLMTELFILLLKDELNEIIYQASVAKLETSISLVSDKLELKVYGFNEKLPAL  716

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVL +  SF P DDRF VIKED++R LKN NMKPL+H+SYLRLQVLCKSF+DVEEK C
Sbjct  717   LSKVLVIAKSFLPSDDRFKVIKEDLKRNLKNANMKPLSHSSYLRLQVLCKSFYDVEEKQC  776

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL AF+PDL SQLYIE LCHGN+L+EEA+N+S+I  +  SV PLP  MRH+E
Sbjct  777   VLNDLSLADLNAFIPDLRSQLYIEALCHGNLLQEEAINLSNIIRNNLSVQPLPVNMRHEE  836

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLPS A+LVRDV VKNK +TNSVVELYFQIEPEVG + IKLKAL DLFDEIVEEPLF
Sbjct  837   HVICLPSSANLVRDVNVKNKSETNSVVELYFQIEPEVGLDSIKLKALADLFDEIVEEPLF  896

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYRI GFCF VQSS+Y+P+YL GRI+NFIN  +E+L+ LDD
Sbjct  897   NQLRTKEQLGYVVECSPRVTYRINGFCFIVQSSKYNPVYLLGRIENFINGLEELLEGLDD  956

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              SFEN++SGL+AKLLEKD SL YETNRLW QI DKRYMFD S KEAE LKSI KSD+I W
Sbjct  957   ASFENYRSGLMAKLLEKDHSLQYETNRLWNQITDKRYMFDSSLKEAENLKSIHKSDVINW  1016

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             + TYL+Q  PKCRRL++R+WGCNT  K+ +   +  +VI D TAFK SSE+YPS C
Sbjct  1017  FRTYLQQSSPKCRRLTIRLWGCNTDLKEVETRADSEQVITDITAFKVSSEYYPSLC  1072



>ref|XP_006491927.1| PREDICTED: insulin-degrading enzyme-like isoform X1 [Citrus sinensis]
Length=1018

 Score =  1373 bits (3554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/896 (74%), Positives = 775/896 (86%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFE+KREFL GAL RFSQFF
Sbjct  123   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEIKREFLKGALMRFSQFF  182

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQCHTS  GH FN+FFWGNKKSL DA
Sbjct  183   ISPLMKVEAMEREVLAVDSEFNQALQNDACRLQQLQCHTSQLGHAFNKFFWGNKKSLIDA  242

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY + Y G  MKLV+IGGE LD L+SWV+ELF+ V+KG  +K    +
Sbjct  243   MEKGINLREQIMKLYMNYYQGGLMKLVVIGGEPLDTLQSWVVELFANVRKGPQIKPQFTV  302

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E  IWKA KL+ LEAVKDVHIL+L+WTLP L ++YL+K+EDYLAHLLGHEG+GSL  FLK
Sbjct  303   EGTIWKACKLFRLEAVKDVHILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGRGSLHSFLK  362

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TSISAGVGDEGMHRSSIAYIF MSIHLTDSGL+KIF+IIGFVYQY+KLLR+VSPQ
Sbjct  363   GRGWATSISAGVGDEGMHRSSIAYIFVMSIHLTDSGLEKIFDIIGFVYQYIKLLRQVSPQ  422

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +WIFKELQDIG MEFRF EE+PQD+YAAELA NLL+YP E V+YGDY YE+WDE +IK +
Sbjct  423   KWIFKELQDIGNMEFRFAEEQPQDDYAAELAGNLLIYPSEHVIYGDYMYEVWDEDMIKHL  482

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DVV+KS   S D   EPWFGS+Y EE I  SL+ELW++PPEIDVSL LP
Sbjct  483   LGFFMPENMRIDVVSKSFAKSQDFHYEPWFGSRYTEEDISPSLMELWRNPPEIDVSLQLP  542

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             ++N FIP+DFSIRA+ IS D     +P CI+DEPL++FWYKLDNTFKLPRANTYFR+ LK
Sbjct  543   SQNGFIPTDFSIRANDISNDLVTVTSPTCIIDEPLIRFWYKLDNTFKLPRANTYFRINLK  602

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y N++N +LTELF+ LLKDELNEI+YQASVAKLETSVS++ DKLELKVYGFN KLPVL
Sbjct  603   GGYDNVKNCILTELFIHLLKDELNEIIYQASVAKLETSVSIFSDKLELKVYGFNDKLPVL  662

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P DDRF VIKED+ RTLKNTNMKPL+H+SYLRLQVLC+SF+DV+EKL 
Sbjct  663   LSKILAIAKSFLPSDDRFKVIKEDVVRTLKNTNMKPLSHSSYLRLQVLCQSFYDVDEKLS  722

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LSLADL AF+P+L SQLYIEGLCHGN+ +EEA++IS+IF S FSV PLP EMRH+E
Sbjct  723   ILHGLSLADLMAFIPELRSQLYIEGLCHGNLSQEEAIHISNIFKSIFSVQPLPIEMRHQE  782

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+CLPSGA+LVR+V VKNK +TNSV+ELYFQIE E G EL +LKAL+DLFDEI+EEP F
Sbjct  783   CVICLPSGANLVRNVSVKNKCETNSVIELYFQIEQEKGMELTRLKALIDLFDEILEEPFF  842

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYR+LGFCF +QSS+Y+PIYLQ RIDNFI+   E+L+ LDD
Sbjct  843   NQLRTKEQLGYVVECSPRVTYRVLGFCFCIQSSKYNPIYLQERIDNFISGLDELLEGLDD  902

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN++SGL+AKLLEKDPSL+YE+NR W QI DKRYMFD S+KEAE+LKSI+K+D+I W
Sbjct  903   ESFENYRSGLMAKLLEKDPSLTYESNRFWNQITDKRYMFDQSQKEAEDLKSIKKNDVISW  962

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+Q  PKCRRL+VRVWGCNT  K+S+   + A VIKD TAFK SSEFY S C
Sbjct  963   YKTYLQQWSPKCRRLAVRVWGCNTNIKESEKHSKSALVIKDLTAFKLSSEFYQSLC  1018



>ref|XP_008384668.1| PREDICTED: nardilysin-like [Malus domestica]
Length=1034

 Score =  1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/895 (73%), Positives = 772/895 (86%), Gaps = 2/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYD YLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFF
Sbjct  139   LEHMLFMGSTEFPDENEYDXYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFF  198

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV A+DSEFNQVLQNDSCRL+Q+QCHTSAPGHPFNRF WGNKKSL DA
Sbjct  199   VSPLVKIEAMEREVQAIDSEFNQVLQNDSCRLEQIQCHTSAPGHPFNRFCWGNKKSLVDA  258

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  VK   + 
Sbjct  259   MEKGINLREQILKLYKDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVKLEFKA  318

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAV+DV+IL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  319   EGPIWKVGKLYRLEAVRDVNILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  378

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+GW TS+SAGVGDEGM RSS+AY+F MSIHLTDSGL+KI EII +VYQ++KLL +VSPQ
Sbjct  379   TRGWATSLSAGVGDEGMXRSSVAYVFRMSIHLTDSGLEKISEIICYVYQHIKLLHQVSPQ  438

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD +LIK +
Sbjct  439   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDAELIKYV  498

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D QCEPWFGS Y EE I  SL++LWK+PPEID SL+LP
Sbjct  499   LGFFTPENMRVDVVSKSSIKSEDFQCEPWFGSHYTEEDISPSLMDLWKNPPEIDDSLYLP  558

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIPSDFSIR+D    D  N   P+CI+DEPLMKFWYKLD++FK PRANTYFR+ LK
Sbjct  559   SKNEFIPSDFSIRSDNSCLDPANISYPRCIIDEPLMKFWYKLDDSFKFPRANTYFRINLK  618

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y+NL++ +LTEL++LLLKDELNEIVYQA VAKLETSVS++ DKLELKVYGFN KLP L
Sbjct  619   GGYANLKSCVLTELYILLLKDELNEIVYQAIVAKLETSVSMFSDKLELKVYGFNDKLPAL  678

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
              SKVL    SF P DDRF  +KEDM+RTLKNTNMKPL+H+SYLRLQVLC++F+D +EKL 
Sbjct  679   FSKVLETAKSFMPTDDRFKDVKEDMKRTLKNTNMKPLSHSSYLRLQVLCQTFYDADEKLH  738

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LS++DLK+F+P+L SQLYIEGLCHGN+LEEEA+N+S+IF S F+VPPLP E+RHKE
Sbjct  739   VLNELSISDLKSFIPELCSQLYIEGLCHGNLLEEEAINLSNIFKSTFTVPPLPIELRHKE  798

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L+RD  VKNK +TNSV+ELYFQIE E G E ++LK+L+DLFDEIVEEPLF
Sbjct  799   HVICLPPGANLIRDSNVKNKSETNSVIELYFQIEQEAGIESVRLKSLIDLFDEIVEEPLF  858

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV CSPRVTYR+LGFCF VQSSEYDPIYLQGR+DNFI+  +E+LD LDD
Sbjct  859   NQLRTKEQLGYVVQCSPRVTYRVLGFCFCVQSSEYDPIYLQGRVDNFIDGLQELLDGLDD  918

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+K+GL+AKLLEKDPSL+YETNR W QI+DKRYMFDLS++EAEEL SI K D+I W
Sbjct  919   ESFENYKNGLLAKLLEKDPSLTYETNRFWNQIIDKRYMFDLSKREAEELSSIHKKDVINW  978

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             Y  YL+Q  PKCRRL++RVWGCNT  K+++A  +  + I+DP  FKKSS+FYPS 
Sbjct  979   YKMYLQQSSPKCRRLAIRVWGCNTNPKEAEAQPKSIQAIEDPATFKKSSKFYPSL  1033



>ref|XP_010108478.1| Insulin-degrading enzyme [Morus notabilis]
 gb|EXC19540.1| Insulin-degrading enzyme [Morus notabilis]
Length=1039

 Score =  1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/896 (73%), Positives = 778/896 (87%), Gaps = 3/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFL GAL+RFSQFF
Sbjct  145   LEHMLFMGSKEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLKGALRRFSQFF  204

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV AVDSEFNQVLQ+D+CRLQQLQCHT++PGHPFNRFFWGNKKSL DA
Sbjct  205   VSPLVKMEAMEREVQAVDSEFNQVLQSDACRLQQLQCHTASPGHPFNRFFWGNKKSLVDA  264

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR+QI  LY D Y+G  MKLV+IGGE+LDVLE+WV+ELF  ++KG  +    ++
Sbjct  265   MEKGINLRKQILNLYKDFYHGGLMKLVVIGGESLDVLENWVVELFGNIRKGPRINPEFKV  324

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E P WK GK+Y LEAVKDVHIL+L+WTLP LR++YL+K EDY+AHLLGHEG+GSLL FLK
Sbjct  325   EGPFWKPGKVYRLEAVKDVHILDLTWTLPCLRQEYLKKPEDYMAHLLGHEGRGSLLSFLK  384

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TS+SAGVGDEGMH SSIAYIFGMS+ LTDSGL+KIFEIIGFVYQYLKL+R+VSPQ
Sbjct  385   ARGWTTSLSAGVGDEGMHHSSIAYIFGMSMRLTDSGLEKIFEIIGFVYQYLKLMRQVSPQ  444

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAELAENLL YP E V+YGDY Y IWDE+L+K +
Sbjct  445   EWIFKELQEIGNMEFRFAEEQPQDDYAAELAENLLFYPAEHVIYGDYVYNIWDEELLKYV  504

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMR+DVV+KS N S   Q EPWFGS Y+EE I SSL+++WKDPPEIDVSLHLP
Sbjct  505   LDFFRPENMRIDVVSKSFN-SKACQVEPWFGSHYIEEDISSSLMDIWKDPPEIDVSLHLP  563

Query  1617  AKNDFIPSDFSIRADTISCDGG--NAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIPSDFSI AD    +    ++P+CILDEPL+KFWYKLD+TFKLPRANTYFR+ LK
Sbjct  564   SKNEFIPSDFSIHADNDLNNHATVSSPRCILDEPLIKFWYKLDSTFKLPRANTYFRINLK  623

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y N++N +LTELF+LLLKDELNEI+YQAS+AKLETSVS++ DKLELK+YGFN+KLPVL
Sbjct  624   GGYDNVKNCVLTELFILLLKDELNEIIYQASIAKLETSVSVFSDKLELKIYGFNNKLPVL  683

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA   SF P +DRF VI+EDM+RTLKNTNMKPL+H+SYLRLQ+LC+SF+DV+EKL 
Sbjct  684   LSKLLARAKSFLPTEDRFEVIREDMKRTLKNTNMKPLSHSSYLRLQILCQSFYDVDEKLQ  743

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L  LS+ DLKAF+P+  SQLY+EG+CHGN+LEEEA+ IS+IF + FS  PLP EMRHKE
Sbjct  744   FLERLSVNDLKAFIPECRSQLYVEGICHGNLLEEEAIAISNIFKTTFSAQPLPYEMRHKE  803

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             YV+CL +GA+LVRDV VKNK++ NSV+E YFQ+E ++G + IKLKAL+DLF+EIVEEP+F
Sbjct  804   YVICLSAGANLVRDVNVKNKMEKNSVIERYFQVEQDLGMDSIKLKALIDLFNEIVEEPMF  863

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPR+TYR+ GFCF VQSSE  PIYLQ R+DNFI   +E+L+ LDD
Sbjct  864   NQLRTKEQLGYVVECSPRITYRVFGFCFCVQSSECSPIYLQERVDNFICGLEELLEGLDD  923

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+K GL+AKLLEKDPSLSYETNRLW QIVDKRY+FDLS+KEAEEL+SI+K+D++ W
Sbjct  924   NSFENYKGGLMAKLLEKDPSLSYETNRLWNQIVDKRYIFDLSKKEAEELESIQKNDVVNW  983

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+Q  PKCRRL+VRVWGCNT  K+ +   EP +VIKD   FK SS FYPS C
Sbjct  984   YKTYLQQSSPKCRRLAVRVWGCNTDLKEVEMRPEPEQVIKDLVFFKMSSRFYPSIC  1039



>ref|XP_002319408.2| insulin-degrading enzyme-related family protein [Populus trichocarpa]
 gb|EEE95331.2| insulin-degrading enzyme-related family protein [Populus trichocarpa]
Length=1032

 Score =  1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/896 (74%), Positives = 772/896 (86%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDS+LSKHGGSSNAYTE EHTCYHFEVKREFL GAL+RFSQFF
Sbjct  137   LEHMLFMGSEEFPDENEYDSFLSKHGGSSNAYTEAEHTCYHFEVKREFLKGALRRFSQFF  196

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K+EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTS PGHPFNRF WGNKKSL DA
Sbjct  197   VSPLMKSEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSGPGHPFNRFSWGNKKSLVDA  256

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLRE I KLY D Y+G  MKLV+IGGE LDVLESWV ELF+ V+KG   K   ++
Sbjct  257   MEKGINLREHILKLYRDYYHGGLMKLVVIGGEPLDVLESWVTELFAKVRKGPQTKPKFQV  316

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAG LY LEAVKDV+IL+L+WTLP L +DYL+K+EDYLAHLLGHEGKGSL  FLK
Sbjct  317   EGPIWKAGLLYRLEAVKDVNILDLTWTLPCLHQDYLKKSEDYLAHLLGHEGKGSLHSFLK  376

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +G  TS+SAGVGDEGMHRSS+AYIFGMSIHLTD GL+KIF+IIGFVYQYLKLLREV PQ
Sbjct  377   ARGLATSLSAGVGDEGMHRSSLAYIFGMSIHLTDYGLEKIFDIIGFVYQYLKLLREVPPQ  436

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +WIFKELQDIG MEFRF EE+PQD+YAAELAENLLV+P E+V+Y DY Y+IWDE+ IK +
Sbjct  437   QWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLVFPAENVIYCDYVYKIWDEKAIKHL  496

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  +NMR+DVV+K    S D+QCEPWFGS Y+EE IP SL+E+W+DP E+DVSLH+P
Sbjct  497   LQFFTPENMRIDVVSKPSVKSQDLQCEPWFGSSYIEEAIPPSLIEIWRDPSEVDVSLHMP  556

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+F+PSDFSIRAD +  D  NA  P+CI+DEPLMKFWYKLD+TFK+PRANTYFR+ LK
Sbjct  557   SKNEFVPSDFSIRADNLDHDLVNASFPRCIIDEPLMKFWYKLDSTFKVPRANTYFRIYLK  616

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y+++++ L+TELF+LLLKDELNEI+YQASVAKLETS+SL  DKLELKVYGFN KLP L
Sbjct  617   EGYASMKSFLMTELFILLLKDELNEIIYQASVAKLETSISLVSDKLELKVYGFNEKLPAL  676

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVL +  SF P DDRF VIKED+ER LKN NMKPL+H+SYLRLQVLCKSF+DVEEK C
Sbjct  677   LSKVLVIAKSFLPSDDRFKVIKEDLERNLKNANMKPLSHSSYLRLQVLCKSFYDVEEKQC  736

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LSLADL AF+P+L SQLYIE LCHGN+L+EEA+N+S+I  +  SV PLP  MRH+E
Sbjct  737   VLSDLSLADLNAFIPELRSQLYIEALCHGNLLQEEAINLSNIIRNNLSVQPLPVNMRHEE  796

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLPS A+LVRDV VKNK +TNSVVELYFQIEPEVG + IKLKAL DLFDEIVEEPLF
Sbjct  797   HVICLPSSANLVRDVNVKNKSETNSVVELYFQIEPEVGLDSIKLKALADLFDEIVEEPLF  856

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYRI GFCF VQSS+Y+P+YL GRI+NFIN  +E+L+ LDD
Sbjct  857   NQLRTKEQLGYVVECSPRVTYRINGFCFIVQSSKYNPVYLLGRIENFINGLEELLEGLDD  916

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              SFEN+KSGL+AKLLEKDPSL YETNRLW QI DKRY+FD S KEAE+LKSI KSD+I W
Sbjct  917   ASFENYKSGLVAKLLEKDPSLQYETNRLWNQITDKRYVFDSSLKEAEKLKSIHKSDVINW  976

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             + TYL+Q  PKCRRL++R+WGCN   K+ +   +  +VI D TAFK SSE+YPS C
Sbjct  977   FRTYLQQSSPKCRRLTIRLWGCNIDLKEVETRPDSEQVITDITAFKVSSEYYPSLC  1032



>ref|XP_006432018.1| hypothetical protein CICLE_v10000133mg [Citrus clementina]
 gb|ESR45258.1| hypothetical protein CICLE_v10000133mg [Citrus clementina]
Length=1018

 Score =  1370 bits (3547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/896 (74%), Positives = 774/896 (86%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFE+KREFL GAL RFSQFF
Sbjct  123   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEIKREFLKGALMRFSQFF  182

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQCHTS  GH FN+FFWGNKKSL DA
Sbjct  183   ISPLMKVEAMEREVLAVDSEFNQALQNDACRLQQLQCHTSQLGHAFNKFFWGNKKSLIDA  242

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY + Y G  MKLV+IGGE LD L+SWV+ELF+ V+KG  +K    +
Sbjct  243   MEKGINLREQIMKLYMNYYQGGLMKLVVIGGEPLDTLQSWVVELFANVRKGPQIKPQFTV  302

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E  IWKA KL+ LEAVKDVHIL+L+WTLP L ++YL+K+EDYLAHLLGHEG+GSL  FLK
Sbjct  303   EGTIWKACKLFRLEAVKDVHILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGRGSLHSFLK  362

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TSISAGVGDEGMHRSSIAYIF MSIHLTDSGL+KIF+IIGFVYQY+KLLR+VSPQ
Sbjct  363   GRGWATSISAGVGDEGMHRSSIAYIFVMSIHLTDSGLEKIFDIIGFVYQYIKLLRQVSPQ  422

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +WIFKELQDIG MEFRF EE+PQD+YAAELA NLL+YP E V+YGDY YE+WDE +IK +
Sbjct  423   KWIFKELQDIGNMEFRFAEEQPQDDYAAELAGNLLIYPSEHVIYGDYMYEVWDEDMIKHL  482

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DVV+KS   S D   EPWFGS+Y EE I  SL+ELW++PPEIDVSL LP
Sbjct  483   LGFFMPENMRIDVVSKSFAKSQDFHYEPWFGSRYTEEDISPSLMELWRNPPEIDVSLQLP  542

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             ++N FIP+DFSIRA+ IS D     +P CI+DEPL++FWYKLDNTFKLPRANTYFR+ LK
Sbjct  543   SQNGFIPTDFSIRANDISNDLVTVTSPTCIIDEPLIRFWYKLDNTFKLPRANTYFRINLK  602

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y N++N +LTELF+ LLKDELNEI+YQASVAKLETSVS++ DKLELKVYGFN KLPVL
Sbjct  603   GGYDNVKNCILTELFIHLLKDELNEIIYQASVAKLETSVSIFSDKLELKVYGFNDKLPVL  662

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P DDRF VIKED+ RTLKNTNMKPL+H+SYLRLQVLC+SF+DV+EKL 
Sbjct  663   LSKILAIAKSFLPSDDRFKVIKEDVVRTLKNTNMKPLSHSSYLRLQVLCQSFYDVDEKLS  722

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LSLADL AF+P+L SQLYIEGL HGN+ +EEA++IS+IF S FSV PLP EMRH+E
Sbjct  723   ILHGLSLADLMAFIPELRSQLYIEGLLHGNLSQEEAIHISNIFKSIFSVQPLPIEMRHQE  782

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+CLPSGA+LVR+V VKNK +TNSV+ELYFQIE E G EL +LKAL+DLFDEI+EEP F
Sbjct  783   CVICLPSGANLVRNVSVKNKCETNSVIELYFQIEQEKGMELTRLKALIDLFDEILEEPFF  842

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPRVTYR+LGFCF +QSS+Y+PIYLQ RIDNFI+   E+L+ LDD
Sbjct  843   NQLRTKEQLGYVVECSPRVTYRVLGFCFCIQSSKYNPIYLQERIDNFISGLDELLEGLDD  902

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN++SGL+AKLLEKDPSL+YE+NR W QI DKRYMFD S+KEAE+LKSI+K+D+I W
Sbjct  903   ESFENYRSGLMAKLLEKDPSLTYESNRFWNQITDKRYMFDQSQKEAEDLKSIKKNDVISW  962

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+Q  PKCRRL+VRVWGCNT  K+S+   + A VIKD TAFK SSEFY S C
Sbjct  963   YKTYLQQWSPKCRRLAVRVWGCNTNIKESEKHSKSALVIKDLTAFKLSSEFYQSLC  1018



>ref|XP_009374381.1| PREDICTED: nardilysin-like isoform X1 [Pyrus x bretschneideri]
Length=1033

 Score =  1367 bits (3539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/895 (73%), Positives = 768/895 (86%), Gaps = 2/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFF
Sbjct  138   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFF  197

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K EAMEREV A+DSEFNQVLQNDSCRL+Q+QCHTSA GHPFNRF WGNKKSL DA
Sbjct  198   VSPLMKIEAMEREVQAIDSEFNQVLQNDSCRLEQIQCHTSATGHPFNRFSWGNKKSLVDA  257

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  VK   + 
Sbjct  258   MENGINLREQILKLYKDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVKLEFKA  317

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAV+DV+IL L WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  318   EGPIWKVGKLYRLEAVRDVNILNLMWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  377

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KIFEII +VYQY+KLLR+VSPQ
Sbjct  378   TRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKIFEIICYVYQYIKLLRQVSPQ  437

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD +LIK +
Sbjct  438   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDAELIKYV  497

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D QCEPWFGS Y EE I  SL++LWK+P EID SL+LP
Sbjct  498   LGFFTPENMRVDVVSKSSIKSEDFQCEPWFGSHYTEEDISPSLMDLWKNPQEIDDSLYLP  557

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIPSDFSIR+D +  D  N   P+CI+DEPLMKFWYKLD +FK PRANTYFR+ LK
Sbjct  558   SKNEFIPSDFSIRSDNLCLDPANISYPRCIIDEPLMKFWYKLDYSFKFPRANTYFRINLK  617

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y+NL++ +LTEL++LLLKD LNEIVYQA+VAKLETSVS++ DKLELKVYGFN KLP L
Sbjct  618   GGYANLKSCVLTELYILLLKDALNEIVYQATVAKLETSVSMFSDKLELKVYGFNDKLPAL  677

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVL    SF P DDRF  +KEDM+RTLKNTNMKPL+H+SYLRLQVLC++F+D +EKL 
Sbjct  678   LSKVLETAKSFVPTDDRFKDVKEDMKRTLKNTNMKPLSHSSYLRLQVLCQTFYDADEKLH  737

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LS++DLK+F+P+L SQLYIEGLCHGN+LEEEA+ +S+IF   F+VPPLP E+RHKE
Sbjct  738   VLNELSISDLKSFIPELCSQLYIEGLCHGNLLEEEAITLSNIFKLTFTVPPLPIELRHKE  797

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L+RD  VKNK + NSV+ELYFQIE E G E ++LK+L+DLFDEIVEEPLF
Sbjct  798   HVICLPPGANLIRDSNVKNKSEMNSVIELYFQIEQEAGIESVRLKSLIDLFDEIVEEPLF  857

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV CSPRVTYR+LGFCF VQSSEYDPIYLQGR+DNFI+  +E+LD LDD
Sbjct  858   NQLRTKEQLGYVVQCSPRVTYRVLGFCFCVQSSEYDPIYLQGRVDNFIDGLQELLDGLDD  917

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFEN+K+GL+AKLLEKDPSL+YETNR W QI+DKRYMFDLS++EAEEL SI K D+I W
Sbjct  918   ESFENYKNGLLAKLLEKDPSLTYETNRFWNQIIDKRYMFDLSKREAEELSSIHKKDVINW  977

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             Y  YL+Q  PKCRRL++ VWGCNT  K+++A  +  + I DP  FKKSS+FYPS 
Sbjct  978   YKMYLQQSSPKCRRLAIHVWGCNTNPKEAEAQPKSIQAIVDPATFKKSSKFYPSL  1032



>ref|XP_009354801.1| PREDICTED: nardilysin-like [Pyrus x bretschneideri]
Length=1029

 Score =  1367 bits (3539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/895 (73%), Positives = 769/895 (86%), Gaps = 2/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFF
Sbjct  134   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFF  193

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV A+DSEFNQVLQNDSCRL+Q+QCHTSAPGHPFNRF WGNKKSL DA
Sbjct  194   VSPLVKIEAMEREVQAIDSEFNQVLQNDSCRLEQIQCHTSAPGHPFNRFCWGNKKSLVDA  253

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+ D+LE WV+ELF  VKKG  VK   + 
Sbjct  254   MEKGINLREQILKLYKDYYHGGLMKLVVIGGESPDLLEDWVVELFGNVKKGPQVKLEFKA  313

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAV+DV+IL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  314   EGPIWKVGKLYRLEAVRDVNILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  373

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KI EII +VYQY+KLLR+VSPQ
Sbjct  374   TRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKISEIICYVYQYIKLLRQVSPQ  433

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD +LIK +
Sbjct  434   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDAELIKYV  493

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D  CEPWFGS Y EE I  SL+++WK+PPEID SLHLP
Sbjct  494   LGFFTPENMRVDVVSKSSIKSKDFHCEPWFGSHYTEEDISPSLMDMWKNPPEIDDSLHLP  553

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DFSIR+D +  D  N   P+CI+DEPL+K WYKLD++FKLPRANTYFR+ LK
Sbjct  554   SKNEFIPCDFSIRSDNLCLDPANISYPRCIIDEPLIKLWYKLDDSFKLPRANTYFRINLK  613

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y+NL++ +LTEL++LLLKDELNEIVYQA VAKLETSVS+  DKLELKVYGFN KLP L
Sbjct  614   GGYANLKSCVLTELYILLLKDELNEIVYQAIVAKLETSVSVSSDKLELKVYGFNDKLPAL  673

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA   SF P DDRF V+KEDM+R LKNTNMKPL+H+SYLRLQVLC+ F+D +EKL 
Sbjct  674   LSKVLATAKSFMPTDDRFKVVKEDMKRRLKNTNMKPLSHSSYLRLQVLCQIFYDADEKLH  733

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LS++DLK+F+P+L SQLYIEGLCHGN+LE+EA+ +S+IF S FSVPPLP ++RHKE
Sbjct  734   VLDELSISDLKSFIPELCSQLYIEGLCHGNLLEDEAITLSNIFKSNFSVPPLPIKLRHKE  793

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L+RD  VKNK +TNSV+ELYFQ+E E G E I+LKAL+DLFDEIVEEPLF
Sbjct  794   HVICLPPGANLIRDSNVKNKSETNSVIELYFQVEQEAGIESIRLKALIDLFDEIVEEPLF  853

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PRVTY + GFCF VQSSEYDPIYLQGR+DNFIN  +E+L  +DD
Sbjct  854   NQLRTKEQLGYVVECGPRVTYNVYGFCFCVQSSEYDPIYLQGRVDNFINGLEELLVGIDD  913

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFEN+KSGL+AKLLEKDPSL+YETNR W QI+DKRYMFD S++EAEEL SI K D+I+W
Sbjct  914   DSFENYKSGLLAKLLEKDPSLTYETNRFWNQIIDKRYMFDQSKREAEELGSIHKKDVIDW  973

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             Y TYL+Q  PKCRRL++RVWGCNT  K+++   +  + I+DP  FKKSS+FYPS 
Sbjct  974   YKTYLQQSSPKCRRLAIRVWGCNTDPKEAEQQPKSIQAIEDPATFKKSSKFYPSL  1028



>ref|XP_009779933.1| PREDICTED: nardilysin isoform X2 [Nicotiana sylvestris]
Length=984

 Score =  1366 bits (3535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/815 (82%), Positives = 738/815 (91%), Gaps = 1/815 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSK GG SNAYTETEHTCYHFEVKR+ L GAL+RFSQFF
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKRGGCSNAYTETEHTCYHFEVKRDCLKGALRRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREV AVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  191   VSPLVKAEAMEREVQAVDSEFNQVLQNDSCRLQQLQCHTSTPGHPFNRFFWGNKKSLADA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGVNLREQI KLYHDNY+G  MKLVIIGGE+LD+LESWVLELFS+VKKG +V    R 
Sbjct  251   VERGVNLREQILKLYHDNYHGGSMKLVIIGGESLDILESWVLELFSSVKKGPLVNPDGRT  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLYWLEAVKDVHIL+LSWTL SLRK YL+KAEDYLAHLLGHEGKGSLLF LK
Sbjct  311   ELPIWRVGKLYWLEAVKDVHILDLSWTLRSLRKGYLKKAEDYLAHLLGHEGKGSLLFSLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +G VTSISAGVGDEGMH SS AYIFGMSIHLTDSGL+KIFEIIGFVYQYLKLLR+ SPQ
Sbjct  371   ARGLVTSISAGVGDEGMHCSSFAYIFGMSIHLTDSGLEKIFEIIGFVYQYLKLLRQNSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQD   +EFR+ EE+PQD+YAAELAE LLVYPP+ V+YGDYAY++WD + IK +
Sbjct  431   EWIFKELQDTANVEFRYAEEQPQDDYAAELAEGLLVYPPKHVIYGDYAYDLWDPEFIKYV  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVD+VTKS   S DVQ EPWFGS+YVEE IPSSL ELWKDP EI V LHLP
Sbjct  491   LDFFRPENMRVDIVTKSFQKSDDVQQEPWFGSRYVEEDIPSSLFELWKDPDEISVCLHLP  550

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+FIPSDFSIRA+  +CD  NA P+CIL+EPLMK WYKLD TFKLPRANTYFR+TL+G
Sbjct  551   AKNEFIPSDFSIRAEKANCDSKNAKPRCILEEPLMKIWYKLDKTFKLPRANTYFRITLRG  610

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              Y NL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGF+ KLPVLL
Sbjct  611   GYGNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFSDKLPVLL  670

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVLA+T SF P+DDRF+VIKEDMERTLKNTNMKPLNH+SYLRLQVLC+SFW+VEEKL L
Sbjct  671   SKVLAMTKSFLPRDDRFMVIKEDMERTLKNTNMKPLNHSSYLRLQVLCQSFWNVEEKLLL  730

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+LA+LKAF+P+LLSQLYIEGLCHGN+LEEEA+NIS+IF S FS  PLP+EMRHKEY
Sbjct  731   LNDLTLAELKAFIPELLSQLYIEGLCHGNLLEEEALNISNIFRSNFSAQPLPSEMRHKEY  790

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRD++VKNKL+TNSVVELYFQIEPE  + LIKLKA+ DLFDE VEEPLF+
Sbjct  791   VMCLPAAADLVRDIRVKNKLETNSVVELYFQIEPEEDTSLIKLKAVTDLFDEFVEEPLFN  850

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVVDCS RVTYRI+GFCFRVQSS+YDP+YLQGRIDNFI+  KE+LD+LDD 
Sbjct  851   QLRTKEQLGYVVDCSARVTYRIMGFCFRVQSSDYDPVYLQGRIDNFIDGVKELLDDLDDK  910

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKR  2798
             SFE+++SGLIAKLLEKDPSL+YETNRLWGQI DKR
Sbjct  911   SFESYRSGLIAKLLEKDPSLAYETNRLWGQITDKR  945



>ref|XP_008354420.1| PREDICTED: nardilysin-like [Malus domestica]
Length=1029

 Score =  1363 bits (3527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/896 (72%), Positives = 769/896 (86%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFF
Sbjct  134   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFF  193

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV A+DSEFNQVLQNDSCRL+Q+QCHT+APGHPFNRF WGNKKSL DA
Sbjct  194   VSPLVKIEAMEREVQAIDSEFNQVLQNDSCRLEQIQCHTAAPGHPFNRFCWGNKKSLVDA  253

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  VK   + 
Sbjct  254   MEKGINLREQILKLYKDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVKLEFKA  313

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAV+DV+IL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  314   EGPIWKVGKLYRLEAVRDVNILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  373

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KI EII +VYQY+KLL +VSPQ
Sbjct  374   TRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKISEIICYVYQYIKLLHQVSPQ  433

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD +LIK +
Sbjct  434   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDAELIKYV  493

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D  CEPWFGS Y EE I  SL+++WK+PPEID SL+LP
Sbjct  494   LGFFTPENMRVDVVSKSSIKSKDFHCEPWFGSHYTEEDISPSLMDMWKNPPEIDDSLYLP  553

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIPSDFSIR+D +  D  N   P C++DEPL+KFWYKLD++FKLPRANTYFR+ LK
Sbjct  554   SKNEFIPSDFSIRSDNLCXDPANISYPXCVIDEPLIKFWYKLDDSFKLPRANTYFRINLK  613

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y+NL++ +LTEL++LLLKDELNEIVYQA VAKLETSVS++ DKLELKVYGFN KLP L
Sbjct  614   GGYANLKSCVLTELYILLLKDELNEIVYQAIVAKLETSVSVFSDKLELKVYGFNDKLPAL  673

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVLA   SF P DDRF V+KEDM+R LKNTNMKPL+H+SYLRLQVLC+ F+D +EKL 
Sbjct  674   LSKVLATAKSFMPTDDRFKVVKEDMKRRLKNTNMKPLSHSSYLRLQVLCQIFYDADEKLH  733

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LS++DLK+F+P L SQLYIEGLCHGN+LE+EA+ +S+IF   FSVPPLP E+RHKE
Sbjct  734   VLDELSVSDLKSFIPALCSQLYIEGLCHGNLLEDEAITLSNIFKLNFSVPPLPIELRHKE  793

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +V+CLP GA+L+RD  VKNK +TNSV+ELYFQ+E E G E I+LK L+DLFDEIVEEPLF
Sbjct  794   HVICLPPGANLIRDSXVKNKSETNSVIELYFQVEQEAGIESIRLKTLIDLFDEIVEEPLF  853

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PRVTYR+ GFCF VQSSEYDPIYLQGR DNFIN  +E LD +DD
Sbjct  854   NQLRTKEQLGYVVECGPRVTYRVYGFCFCVQSSEYDPIYLQGRXDNFINGLEEXLDGIDD  913

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSF N+KSGL+AKLLEKDPSL+YETNR W QI+++RYMFD S++EAEEL SI+K D+I+W
Sbjct  914   DSFXNYKSGLLAKLLEKDPSLTYETNRFWNQIIEQRYMFDQSKREAEELGSIQKKDVIDW  973

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+Q  PKCRRL++RVWGCNT  ++++   +  + I+DP  FKKSS+FYPS C
Sbjct  974   YKTYLQQSSPKCRRLAIRVWGCNTDPREAEPQPKSIQPIEDPATFKKSSKFYPSLC  1029



>emb|CBI15822.3| unnamed protein product [Vitis vinifera]
Length=1062

 Score =  1361 bits (3523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/897 (74%), Positives = 772/897 (86%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDENEYDSYLSKHGGSSNAYTE E TCYHFEV REFL GAL+RFSQFF
Sbjct  166   LEHMLFMGSADFPDENEYDSYLSKHGGSSNAYTEAERTCYHFEVNREFLKGALRRFSQFF  225

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK +AMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTSAP HPFNRF WGNKKSL DA
Sbjct  226   ISPLVKIDAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSAPDHPFNRFCWGNKKSLIDA  285

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI  LY DNY G  MKLV+IGGE+LDVLE+WVLELF+ V+KG  VK   R+
Sbjct  286   MEKGINLREQILNLYKDNYRGGLMKLVVIGGESLDVLENWVLELFNNVRKGPWVKPEPRM  345

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIWK GKLY LEAVKDVHIL+LSWTLP LR+DYL+K+EDYLAHL+GHEG+GSL FFLK
Sbjct  346   AVPIWKVGKLYRLEAVKDVHILDLSWTLPCLRQDYLKKSEDYLAHLIGHEGRGSLHFFLK  405

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVG+EGM +SSIAYIF MSIHLTDSGL+KIFEIIGFVYQY KLLR+VSPQ
Sbjct  406   ARGWVTSISAGVGNEGMQQSSIAYIFSMSIHLTDSGLEKIFEIIGFVYQYFKLLRQVSPQ  465

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAEL+ENL VYP E V+YGDYA++ WDE+ IK++
Sbjct  466   EWIFKELQNIGNMEFRFAEEQPQDDYAAELSENLFVYPKEHVIYGDYAFKEWDEEKIKNL  525

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  +NMR+DV++KS   S D Q EPWFGS+Y EE I  SL+ LW+DPPEIDVSLHLP
Sbjct  526   LCFFTPENMRIDVLSKSFPESQDFQYEPWFGSKYTEEDISPSLMALWRDPPEIDVSLHLP  585

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSI A+ +  D  N   P+CILD  LMK WYKLDNTFKLPRANTYFR+TLK
Sbjct  586   LKNEFIPCDFSIHANNMHNDLANESLPRCILDTQLMKLWYKLDNTFKLPRANTYFRITLK  645

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
              AY N++N +LTELF+ LLKDELNEI+YQASVAKLETS++L+ DKLELKVYGFN KLPVL
Sbjct  646   EAYDNVKNCVLTELFMHLLKDELNEIIYQASVAKLETSIALFSDKLELKVYGFNDKLPVL  705

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS++LA+  SF P +DRF VIKEDMERTL+NTNMKPL+H+SYLRLQ+LC+SFWDV+EKLC
Sbjct  706   LSRILAIAKSFLPTEDRFKVIKEDMERTLRNTNMKPLSHSSYLRLQILCQSFWDVDEKLC  765

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              LN LSLADLKAF+P +LSQ++IEGLCHGNML+EEA+NIS+IF + F V PLP EM HKE
Sbjct  766   SLNDLSLADLKAFIPKVLSQVHIEGLCHGNMLKEEALNISNIFENNFPVQPLPYEMMHKE  825

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEV-GSELIKLKALVDLFDEIVEEPL  2507
             +V+ LPSGA+LVRDV+VKNK +TNSVVELYFQIEPE       KLKALVDLFDEIVEEPL
Sbjct  826   HVINLPSGANLVRDVRVKNKPETNSVVELYFQIEPECWAKSTTKLKALVDLFDEIVEEPL  885

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y+P+YLQ RID FIN  +++L  LD
Sbjct  886   FNQLRTKEQLGYVVECGPRITYRVFGFCFCVQSSKYNPVYLQERIDYFINGLEDLLAGLD  945

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              +SFE F++GL+AKLLEKD SL+YETNR+WGQIVDKRYMFD+S KEAEEL+SI KSD+I+
Sbjct  946   VESFEQFRNGLLAKLLEKDTSLTYETNRIWGQIVDKRYMFDMSVKEAEELRSICKSDIID  1005

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL Q  P CRRL+VRVWGCNT  K+++A  +  +VI+D T FK SS+FYPS C
Sbjct  1006  WYRTYLLQSSPNCRRLAVRVWGCNTDLKEAEAQSQSVQVIEDLTVFKTSSKFYPSIC  1062



>ref|XP_010650820.1| PREDICTED: nardilysin isoform X1 [Vitis vinifera]
Length=1033

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/897 (74%), Positives = 772/897 (86%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDENEYDSYLSKHGGSSNAYTE E TCYHFEV REFL GAL+RFSQFF
Sbjct  137   LEHMLFMGSADFPDENEYDSYLSKHGGSSNAYTEAERTCYHFEVNREFLKGALRRFSQFF  196

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK +AMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTSAP HPFNRF WGNKKSL DA
Sbjct  197   ISPLVKIDAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSAPDHPFNRFCWGNKKSLIDA  256

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI  LY DNY G  MKLV+IGGE+LDVLE+WVLELF+ V+KG  VK   R+
Sbjct  257   MEKGINLREQILNLYKDNYRGGLMKLVVIGGESLDVLENWVLELFNNVRKGPWVKPEPRM  316

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIWK GKLY LEAVKDVHIL+LSWTLP LR+DYL+K+EDYLAHL+GHEG+GSL FFLK
Sbjct  317   AVPIWKVGKLYRLEAVKDVHILDLSWTLPCLRQDYLKKSEDYLAHLIGHEGRGSLHFFLK  376

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVG+EGM +SSIAYIF MSIHLTDSGL+KIFEIIGFVYQY KLLR+VSPQ
Sbjct  377   ARGWVTSISAGVGNEGMQQSSIAYIFSMSIHLTDSGLEKIFEIIGFVYQYFKLLRQVSPQ  436

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAEL+ENL VYP E V+YGDYA++ WDE+ IK++
Sbjct  437   EWIFKELQNIGNMEFRFAEEQPQDDYAAELSENLFVYPKEHVIYGDYAFKEWDEEKIKNL  496

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  +NMR+DV++KS   S D Q EPWFGS+Y EE I  SL+ LW+DPPEIDVSLHLP
Sbjct  497   LCFFTPENMRIDVLSKSFPESQDFQYEPWFGSKYTEEDISPSLMALWRDPPEIDVSLHLP  556

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSI A+ +  D  N   P+CILD  LMK WYKLDNTFKLPRANTYFR+TLK
Sbjct  557   LKNEFIPCDFSIHANNMHNDLANESLPRCILDTQLMKLWYKLDNTFKLPRANTYFRITLK  616

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
              AY N++N +LTELF+ LLKDELNEI+YQASVAKLETS++L+ DKLELKVYGFN KLPVL
Sbjct  617   EAYDNVKNCVLTELFMHLLKDELNEIIYQASVAKLETSIALFSDKLELKVYGFNDKLPVL  676

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS++LA+  SF P +DRF VIKEDMERTL+NTNMKPL+H+SYLRLQ+LC+SFWDV+EKLC
Sbjct  677   LSRILAIAKSFLPTEDRFKVIKEDMERTLRNTNMKPLSHSSYLRLQILCQSFWDVDEKLC  736

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              LN LSLADLKAF+P +LSQ++IEGLCHGNML+EEA+NIS+IF + F V PLP EM HKE
Sbjct  737   SLNDLSLADLKAFIPKVLSQVHIEGLCHGNMLKEEALNISNIFENNFPVQPLPYEMMHKE  796

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEV-GSELIKLKALVDLFDEIVEEPL  2507
             +V+ LPSGA+LVRDV+VKNK +TNSVVELYFQIEPE       KLKALVDLFDEIVEEPL
Sbjct  797   HVINLPSGANLVRDVRVKNKPETNSVVELYFQIEPECWAKSTTKLKALVDLFDEIVEEPL  856

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y+P+YLQ RID FIN  +++L  LD
Sbjct  857   FNQLRTKEQLGYVVECGPRITYRVFGFCFCVQSSKYNPVYLQERIDYFINGLEDLLAGLD  916

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              +SFE F++GL+AKLLEKD SL+YETNR+WGQIVDKRYMFD+S KEAEEL+SI KSD+I+
Sbjct  917   VESFEQFRNGLLAKLLEKDTSLTYETNRIWGQIVDKRYMFDMSVKEAEELRSICKSDIID  976

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL Q  P CRRL+VRVWGCNT  K+++A  +  +VI+D T FK SS+FYPS C
Sbjct  977   WYRTYLLQSSPNCRRLAVRVWGCNTDLKEAEAQSQSVQVIEDLTVFKTSSKFYPSIC  1033



>ref|XP_002276484.1| PREDICTED: nardilysin isoform X2 [Vitis vinifera]
Length=1045

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/897 (74%), Positives = 772/897 (86%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDENEYDSYLSKHGGSSNAYTE E TCYHFEV REFL GAL+RFSQFF
Sbjct  149   LEHMLFMGSADFPDENEYDSYLSKHGGSSNAYTEAERTCYHFEVNREFLKGALRRFSQFF  208

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK +AMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTSAP HPFNRF WGNKKSL DA
Sbjct  209   ISPLVKIDAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSAPDHPFNRFCWGNKKSLIDA  268

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI  LY DNY G  MKLV+IGGE+LDVLE+WVLELF+ V+KG  VK   R+
Sbjct  269   MEKGINLREQILNLYKDNYRGGLMKLVVIGGESLDVLENWVLELFNNVRKGPWVKPEPRM  328

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIWK GKLY LEAVKDVHIL+LSWTLP LR+DYL+K+EDYLAHL+GHEG+GSL FFLK
Sbjct  329   AVPIWKVGKLYRLEAVKDVHILDLSWTLPCLRQDYLKKSEDYLAHLIGHEGRGSLHFFLK  388

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVG+EGM +SSIAYIF MSIHLTDSGL+KIFEIIGFVYQY KLLR+VSPQ
Sbjct  389   ARGWVTSISAGVGNEGMQQSSIAYIFSMSIHLTDSGLEKIFEIIGFVYQYFKLLRQVSPQ  448

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAEL+ENL VYP E V+YGDYA++ WDE+ IK++
Sbjct  449   EWIFKELQNIGNMEFRFAEEQPQDDYAAELSENLFVYPKEHVIYGDYAFKEWDEEKIKNL  508

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  +NMR+DV++KS   S D Q EPWFGS+Y EE I  SL+ LW+DPPEIDVSLHLP
Sbjct  509   LCFFTPENMRIDVLSKSFPESQDFQYEPWFGSKYTEEDISPSLMALWRDPPEIDVSLHLP  568

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSI A+ +  D  N   P+CILD  LMK WYKLDNTFKLPRANTYFR+TLK
Sbjct  569   LKNEFIPCDFSIHANNMHNDLANESLPRCILDTQLMKLWYKLDNTFKLPRANTYFRITLK  628

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
              AY N++N +LTELF+ LLKDELNEI+YQASVAKLETS++L+ DKLELKVYGFN KLPVL
Sbjct  629   EAYDNVKNCVLTELFMHLLKDELNEIIYQASVAKLETSIALFSDKLELKVYGFNDKLPVL  688

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS++LA+  SF P +DRF VIKEDMERTL+NTNMKPL+H+SYLRLQ+LC+SFWDV+EKLC
Sbjct  689   LSRILAIAKSFLPTEDRFKVIKEDMERTLRNTNMKPLSHSSYLRLQILCQSFWDVDEKLC  748

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              LN LSLADLKAF+P +LSQ++IEGLCHGNML+EEA+NIS+IF + F V PLP EM HKE
Sbjct  749   SLNDLSLADLKAFIPKVLSQVHIEGLCHGNMLKEEALNISNIFENNFPVQPLPYEMMHKE  808

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEV-GSELIKLKALVDLFDEIVEEPL  2507
             +V+ LPSGA+LVRDV+VKNK +TNSVVELYFQIEPE       KLKALVDLFDEIVEEPL
Sbjct  809   HVINLPSGANLVRDVRVKNKPETNSVVELYFQIEPECWAKSTTKLKALVDLFDEIVEEPL  868

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y+P+YLQ RID FIN  +++L  LD
Sbjct  869   FNQLRTKEQLGYVVECGPRITYRVFGFCFCVQSSKYNPVYLQERIDYFINGLEDLLAGLD  928

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              +SFE F++GL+AKLLEKD SL+YETNR+WGQIVDKRYMFD+S KEAEEL+SI KSD+I+
Sbjct  929   VESFEQFRNGLLAKLLEKDTSLTYETNRIWGQIVDKRYMFDMSVKEAEELRSICKSDIID  988

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL Q  P CRRL+VRVWGCNT  K+++A  +  +VI+D T FK SS+FYPS C
Sbjct  989   WYRTYLLQSSPNCRRLAVRVWGCNTDLKEAEAQSQSVQVIEDLTVFKTSSKFYPSIC  1045



>gb|KEH34462.1| insulin-degrading enzyme [Medicago truncatula]
Length=1041

 Score =  1360 bits (3519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/898 (73%), Positives = 771/898 (86%), Gaps = 5/898 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHF+VKRE+L GAL+RFSQFF
Sbjct  145   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFDVKREYLKGALRRFSQFF  204

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREV AVDSEFNQVLQ+D+CRLQQLQCHTS P HP N+FFWGNKKSL+DA
Sbjct  205   ISPLVKAEAMEREVQAVDSEFNQVLQSDACRLQQLQCHTSTPNHPLNKFFWGNKKSLADA  264

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LREQI KLY D Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG  V     +
Sbjct  265   MEKGIDLREQILKLYKDYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGPQVNPKFTV  324

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GK+Y LEAVKDVH L+LSWTLPSL ++YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  325   EGPIWKPGKIYRLEAVKDVHTLDLSWTLPSLHQEYLKKPEDYLAHLLGHEGRGSLLSFLK  384

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVGD+G++RSSIAY+F MS+HLTDSG++KIF+IIGFVYQYL LLR+ SPQ
Sbjct  385   AKGWASSLSAGVGDDGVYRSSIAYVFVMSLHLTDSGVEKIFDIIGFVYQYLNLLRQNSPQ  444

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKE+Q+IG MEFRF EE+PQD+YAAELAENL  YP EDV+YGDY Y+ WDEQLIK +
Sbjct  445   EWIFKEIQNIGNMEFRFAEEQPQDDYAAELAENLKFYPSEDVIYGDYVYKTWDEQLIKQV  504

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+K ++ S D Q EPWFGS+YVEE IP  L+ELW++P EID SLHLP
Sbjct  505   LGFFVPENMRVDVVSKLVHKSEDFQHEPWFGSRYVEEDIPQDLIELWRNPQEIDASLHLP  564

Query  1617  AKNDFIPSDFSIRADTISCDG----GNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVT  1784
             +KN+FIPSDFSIRA   +CDG      +P+CI+DE L+KFWYKLD+TF++PRANTYFR+ 
Sbjct  565   SKNEFIPSDFSIRAGG-ACDGDFENSTSPRCIVDEALIKFWYKLDSTFRVPRANTYFRIN  623

Query  1785  LKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLP  1964
             LKG Y N ++ +L+ELF+ LLKDELNEI+YQAS+AKLETSV+  GD LELKVYGFN KL 
Sbjct  624   LKGGYDNAKSCVLSELFIHLLKDELNEIIYQASIAKLETSVAYVGDMLELKVYGFNEKLS  683

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEk  2144
             VLLSKVL+   SF P DDR+ VIKEDM+R LKN+NMKPL+H+SYLRLQVLC+SF+DV+EK
Sbjct  684   VLLSKVLSTARSFMPTDDRYQVIKEDMKRALKNSNMKPLSHSSYLRLQVLCESFYDVDEK  743

Query  2145  lcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRH  2324
             L  LN L L DLKAF+P+L SQLYIEGLCHGN+ EEEAVNIS+IF + F V PLP + RH
Sbjct  744   LQYLNDLLLDDLKAFIPELRSQLYIEGLCHGNLSEEEAVNISNIFKTNFPVKPLPIKSRH  803

Query  2325  KEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEP  2504
              E V+C PS A+LVRD+ VKNKL+ NSV+ELYFQIE ++G    KLKAL+DLFDEIVEEP
Sbjct  804   AERVICFPSNANLVRDINVKNKLEKNSVIELYFQIEEDLGLGSTKLKALIDLFDEIVEEP  863

Query  2505  LFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNL  2684
             LF++LRTKEQLGYVV+CSPRVTYR+ GFCF +QS+EY+P+YLQGR+++FIN  +E+LD L
Sbjct  864   LFNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQSAEYNPVYLQGRVESFINGLEELLDGL  923

Query  2685  DDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLI  2864
             DDDSFEN+KSGL+ KLLEKDPSL+YE+NRLW QIVDKRY+FD+S+KEAEELK+I K+D+I
Sbjct  924   DDDSFENYKSGLMGKLLEKDPSLTYESNRLWNQIVDKRYIFDISKKEAEELKNISKNDVI  983

Query  2865  EWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             EWY TYLKQ  PKCRRL VRVWGCNT  KD++A  +   VI DP AFKK S+FYPSFC
Sbjct  984   EWYKTYLKQSSPKCRRLLVRVWGCNTDMKDAEAPSKSVHVITDPVAFKKQSKFYPSFC  1041



>ref|XP_004500358.1| PREDICTED: nardilysin-like isoform X1 [Cicer arietinum]
Length=1036

 Score =  1353 bits (3502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/893 (74%), Positives = 764/893 (86%), Gaps = 3/893 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  141   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  200

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREV AVDSEFNQVLQ+D+CRLQQLQCHTS P HP N+FFWGNKKSL DA
Sbjct  201   ISPLVKMEAMEREVQAVDSEFNQVLQSDACRLQQLQCHTSTPNHPLNKFFWGNKKSLVDA  260

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LR+QI KLY+D Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG  V     +
Sbjct  261   MEKGIDLRDQILKLYNDYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGPQVNPKFPV  320

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+LSWTLPSL ++YL+K EDYLAHLLGHEG+GSLLFFLK
Sbjct  321   EGPIWKPGKLYRLEAVKDVHILDLSWTLPSLHQEYLKKPEDYLAHLLGHEGRGSLLFFLK  380

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEG++RSSIAY+F MSIHLTDSG +KIF+IIGFVYQYL LLR+ SPQ
Sbjct  381   AKGWATSLSAGVGDEGIYRSSIAYVFVMSIHLTDSGAEKIFDIIGFVYQYLNLLRQNSPQ  440

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAELAENL  YP E V+YGDY Y+ WDEQLIK +
Sbjct  441   EWIFKELQNIGNMEFRFAEEQPQDDYAAELAENLKHYPAEHVIYGDYVYKTWDEQLIKQV  500

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+K  + S D+Q EPWFGS+YVEE I   L+ELW++P EID SLHLP
Sbjct  501   LGFFVPENMRVDVVSKLFHKSEDIQYEPWFGSRYVEEDIAQDLIELWRNPSEIDASLHLP  560

Query  1617  AKNDFIPSDFSIRA-DTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             +KN+FIPSDFSIRA DT   D  N  +P+CI+DE L+KFWYKLD+TFK+PRANTYFR+ L
Sbjct  561   SKNEFIPSDFSIRASDTGDDDSANSTSPRCIIDEALIKFWYKLDSTFKVPRANTYFRINL  620

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y N ++ +L+ELF+ LLKDELNEIVYQASVAKLETSV+  GD LELKVYGFN KLPV
Sbjct  621   KGGYDNAKSCVLSELFIHLLKDELNEIVYQASVAKLETSVAYVGDMLELKVYGFNEKLPV  680

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L+   SF+P DDR+ VIKEDM+R LKN+NMKPL+H+SYLRLQVLC+SF+DVEEKL
Sbjct  681   LLSKILSTAKSFTPTDDRYQVIKEDMKRALKNSNMKPLSHSSYLRLQVLCESFYDVEEKL  740

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               LN L L DLKAF+P+L SQLYIEGLCHGN+ EEEA++I  IF   F V PLP + RH 
Sbjct  741   HYLNELLLDDLKAFVPELRSQLYIEGLCHGNLSEEEAISIYHIFKRNFPVNPLPIKSRHA  800

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRD+ VKN L+ NSV+ELYFQIE ++G    KLKAL+DLFDEIVEEPL
Sbjct  801   ERVICLPSNANLVRDINVKNNLEKNSVIELYFQIEQDLGLGSTKLKALIDLFDEIVEEPL  860

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+CSPRVTYR+ GFCF +QSS+Y+PIYLQGRI++FIN  +E+LD LD
Sbjct  861   FNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQSSDYNPIYLQGRIESFINGLEELLDGLD  920

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             DDSFEN+KSGL+AKLLEKDPSL+YE+NRLW QIVDKRY+FD+S+KEAEEL++I K D+IE
Sbjct  921   DDSFENYKSGLMAKLLEKDPSLTYESNRLWNQIVDKRYIFDISKKEAEELRNITKHDVIE  980

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFY  3026
             WY TYLKQ  PKCRRL VRVWGCNT  KD++A  E   VI DP AFKK S+F+
Sbjct  981   WYKTYLKQSSPKCRRLLVRVWGCNTDMKDAEAQPESVHVITDPVAFKKQSKFF  1033



>ref|XP_006491928.1| PREDICTED: insulin-degrading enzyme-like isoform X2 [Citrus sinensis]
 ref|XP_006491929.1| PREDICTED: insulin-degrading enzyme-like isoform X3 [Citrus sinensis]
Length=880

 Score =  1334 bits (3452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/877 (74%), Positives = 756/877 (86%), Gaps = 2/877 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTETEHTCYHFE+KREFL GAL RFSQFF+SPL+K EAMEREVLAVDS
Sbjct  4     SYLSKHGGSSNAYTETEHTCYHFEIKREFLKGALMRFSQFFISPLMKVEAMEREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQ LQND+CRLQQLQCHTS  GH FN+FFWGNKKSL DA E+G+NLREQI KLY + Y
Sbjct  64    EFNQALQNDACRLQQLQCHTSQLGHAFNKFFWGNKKSLIDAMEKGINLREQIMKLYMNYY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
              G  MKLV+IGGE LD L+SWV+ELF+ V+KG  +K    +E  IWKA KL+ LEAVKDV
Sbjct  124   QGGLMKLVVIGGEPLDTLQSWVVELFANVRKGPQIKPQFTVEGTIWKACKLFRLEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HIL+L+WTLP L ++YL+K+EDYLAHLLGHEG+GSL  FLK +GW TSISAGVGDEGMHR
Sbjct  184   HILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGRGSLHSFLKGRGWATSISAGVGDEGMHR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SSIAYIF MSIHLTDSGL+KIF+IIGFVYQY+KLLR+VSPQ+WIFKELQDIG MEFRF E
Sbjct  244   SSIAYIFVMSIHLTDSGLEKIFDIIGFVYQYIKLLRQVSPQKWIFKELQDIGNMEFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELA NLL+YP E V+YGDY YE+WDE +IK +LGFF  +NMR+DVV+KS  
Sbjct  304   EQPQDDYAAELAGNLLIYPSEHVIYGDYMYEVWDEDMIKHLLGFFMPENMRIDVVSKSFA  363

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              S D   EPWFGS+Y EE I  SL+ELW++PPEIDVSL LP++N FIP+DFSIRA+ IS 
Sbjct  364   KSQDFHYEPWFGSRYTEEDISPSLMELWRNPPEIDVSLQLPSQNGFIPTDFSIRANDISN  423

Query  1674  D--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLL  1847
             D     +P CI+DEPL++FWYKLDNTFKLPRANTYFR+ LKG Y N++N +LTELF+ LL
Sbjct  424   DLVTVTSPTCIIDEPLIRFWYKLDNTFKLPRANTYFRINLKGGYDNVKNCILTELFIHLL  483

Query  1848  KDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFL  2027
             KDELNEI+YQASVAKLETSVS++ DKLELKVYGFN KLPVLLSK+LA+  SF P DDRF 
Sbjct  484   KDELNEIIYQASVAKLETSVSIFSDKLELKVYGFNDKLPVLLSKILAIAKSFLPSDDRFK  543

Query  2028  VIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLS  2207
             VIKED+ RTLKNTNMKPL+H+SYLRLQVLC+SF+DV+EKL +L+ LSLADL AF+P+L S
Sbjct  544   VIKEDVVRTLKNTNMKPLSHSSYLRLQVLCQSFYDVDEKLSILHGLSLADLMAFIPELRS  603

Query  2208  QLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKN  2387
             QLYIEGLCHGN+ +EEA++IS+IF S FSV PLP EMRH+E V+CLPSGA+LVR+V VKN
Sbjct  604   QLYIEGLCHGNLSQEEAIHISNIFKSIFSVQPLPIEMRHQECVICLPSGANLVRNVSVKN  663

Query  2388  KLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRV  2567
             K +TNSV+ELYFQIE E G EL +LKAL+DLFDEI+EEP F++LRTKEQLGYVV+CSPRV
Sbjct  664   KCETNSVIELYFQIEQEKGMELTRLKALIDLFDEILEEPFFNQLRTKEQLGYVVECSPRV  723

Query  2568  TYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDP  2747
             TYR+LGFCF +QSS+Y+PIYLQ RIDNFI+   E+L+ LDD+SFEN++SGL+AKLLEKDP
Sbjct  724   TYRVLGFCFCIQSSKYNPIYLQERIDNFISGLDELLEGLDDESFENYRSGLMAKLLEKDP  783

Query  2748  SLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             SL+YE+NR W QI DKRYMFD S+KEAE+LKSI+K+D+I WY TYL+Q  PKCRRL+VRV
Sbjct  784   SLTYESNRFWNQITDKRYMFDQSQKEAEDLKSIKKNDVISWYKTYLQQWSPKCRRLAVRV  843

Query  2928  WGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WGCNT  K+S+   + A VIKD TAFK SSEFY S C
Sbjct  844   WGCNTNIKESEKHSKSALVIKDLTAFKLSSEFYQSLC  880



>ref|XP_010685975.1| PREDICTED: nardilysin isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1037

 Score =  1333 bits (3450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/896 (73%), Positives = 763/896 (85%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTE EHTCYHF+VKREFL  AL+RFSQFF
Sbjct  142   LEHMLFMGSAEFPDENEYDSYLSKHGGSSNAYTEVEHTCYHFDVKREFLREALRRFSQFF  201

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK+EAMEREVLAVDSEFNQVLQ+DSCRLQQLQCHTS PGHP+NRFFWGNKKSL DA
Sbjct  202   ISPLVKSEAMEREVLAVDSEFNQVLQSDSCRLQQLQCHTSVPGHPYNRFFWGNKKSLMDA  261

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+GV+LR++I K+Y DNYYG  +KLV+IGGE+LD+LESWVLELFS VKKG   +   + 
Sbjct  262   VEKGVDLRQRIMKMYEDNYYGEFIKLVLIGGESLDILESWVLELFSDVKKGLSSRLEIKH  321

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW AGKLY +EAVKDVH+LE+SW LP LR DY++K EDY AHL+GHEG+GSL FFLK
Sbjct  322   EGPIWNAGKLYRVEAVKDVHVLEVSWKLPCLRTDYMKKLEDYFAHLIGHEGRGSLHFFLK  381

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             +KGW+TSISAGVG++GM+RSS+AYIFGM+IHLTDSGL KI+EIIGFVYQYLKLLR   PQ
Sbjct  382   SKGWITSISAGVGEDGMNRSSLAYIFGMNIHLTDSGLDKIYEIIGFVYQYLKLLRGAPPQ  441

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELA NLL+YPPE V+YG+YA+E WD + +K I
Sbjct  442   EWIFKELQDIGKMEFRFAEEQPQDDYAAELAANLLIYPPEHVIYGEYAFEDWDAEKLKFI  501

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FF  DNMRVD+++KS   S D  CEPWFG++Y EE I  SL++LW+DPP ID SLHLP
Sbjct  502   LDFFVPDNMRVDILSKSFATSGDALCEPWFGARYTEEDIALSLMDLWRDPPAIDGSLHLP  561

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DF + AD +S D   G+ P+CILDEPLMK W+KLD TFKLPRANTYFR+ L 
Sbjct  562   SKNEFIPVDFPVHADNVSNDIVDGSYPRCILDEPLMKLWFKLDRTFKLPRANTYFRINLN  621

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY+++R+ LLTELFVLLLKDELNEIVYQAS+AKLETS+S+ GDKLELKVYGF+ KLP+L
Sbjct  622   GAYASVRSFLLTELFVLLLKDELNEIVYQASLAKLETSISVSGDKLELKVYGFSEKLPLL  681

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L +  SFSPKDDRF V+KE MER L+NTNMKPLNHASYLRLQ+LCKSFWDV+EKL 
Sbjct  682   LSKILDIAKSFSPKDDRFEVVKEGMERNLRNTNMKPLNHASYLRLQILCKSFWDVDEKLQ  741

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L  LSLA+L AF+P LLSQLY EGLCHGN+LEEEA+NIS+IF S+F VP LP E RHKE
Sbjct  742   CLADLSLAELLAFIPQLLSQLYFEGLCHGNLLEEEAINISNIFRSHFPVPALPIEARHKE  801

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+CLPSGA+ VRD+ VKNKLD NSVVELY+QIE E   + +K K+  DLFDEIVEEP +
Sbjct  802   RVLCLPSGANHVRDLCVKNKLDPNSVVELYYQIEQENAVDSLKQKSFSDLFDEIVEEPFY  861

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+CSPR+TYR+ GFCF +QSS+Y+PIYLQ RID+FI+  K+ L+ LDD
Sbjct  862   NQLRTKEQLGYVVECSPRMTYRVFGFCFCIQSSKYNPIYLQERIDDFIDGLKDFLEKLDD  921

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              SFE+FKSGLIAKLLEKDPSLSYETNR W QIVDKRYMFD SEK A+ ++ I+KSDLI+W
Sbjct  922   GSFESFKSGLIAKLLEKDPSLSYETNRFWNQIVDKRYMFDYSEKVAQIVRDIQKSDLIDW  981

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL++  PKCRRL++RVWGCNT  K+++A      VI D  AFK SSEFY S C
Sbjct  982   YSTYLRRDSPKCRRLAIRVWGCNTDIKEAEAQERSEVVINDFAAFKSSSEFYASLC  1037



>ref|XP_009374382.1| PREDICTED: insulin-degrading enzyme-like isoform X2 [Pyrus x 
bretschneideri]
Length=880

 Score =  1329 bits (3439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/876 (72%), Positives = 749/876 (86%), Gaps = 2/876 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFFVSPL+K EAMEREV A+DS
Sbjct  4     SYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFFVSPLMKIEAMEREVQAIDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQNDSCRL+Q+QCHTSA GHPFNRF WGNKKSL DA E G+NLREQI KLY D Y
Sbjct  64    EFNQVLQNDSCRLEQIQCHTSATGHPFNRFSWGNKKSLVDAMENGINLREQILKLYKDYY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             +G  MKLV+IGGE+LDVLE WV+EL+  VKKG  VK   + E PIWK GKLY LEAV+DV
Sbjct  124   HGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVKLEFKAEGPIWKVGKLYRLEAVRDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             +IL L WT P L +DYL+K EDYLAHLLGHEG+GSL F+LKT+GW TS+SAGVGDEGMHR
Sbjct  184   NILNLMWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLKTRGWATSLSAGVGDEGMHR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SS+AY+F MSIHLTDSGL+KIFEII +VYQY+KLLR+VSPQEWIF+ELQDIG M+FRF E
Sbjct  244   SSVAYVFRMSIHLTDSGLEKIFEIICYVYQYIKLLRQVSPQEWIFRELQDIGNMDFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAENLL+YP E+V+YGDY Y+IWD +LIK +LGFF  +NMRVDVV+KS  
Sbjct  304   EQPQDDYAAELAENLLLYPAENVIYGDYVYKIWDAELIKYVLGFFTPENMRVDVVSKSSI  363

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              S D QCEPWFGS Y EE I  SL++LWK+P EID SL+LP+KN+FIPSDFSIR+D +  
Sbjct  364   KSEDFQCEPWFGSHYTEEDISPSLMDLWKNPQEIDDSLYLPSKNEFIPSDFSIRSDNLCL  423

Query  1674  DGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLL  1847
             D  N   P+CI+DEPLMKFWYKLD +FK PRANTYFR+ LKG Y+NL++ +LTEL++LLL
Sbjct  424   DPANISYPRCIIDEPLMKFWYKLDYSFKFPRANTYFRINLKGGYANLKSCVLTELYILLL  483

Query  1848  KDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFL  2027
             KD LNEIVYQA+VAKLETSVS++ DKLELKVYGFN KLP LLSKVL    SF P DDRF 
Sbjct  484   KDALNEIVYQATVAKLETSVSMFSDKLELKVYGFNDKLPALLSKVLETAKSFVPTDDRFK  543

Query  2028  VIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLS  2207
              +KEDM+RTLKNTNMKPL+H+SYLRLQVLC++F+D +EKL +LN LS++DLK+F+P+L S
Sbjct  544   DVKEDMKRTLKNTNMKPLSHSSYLRLQVLCQTFYDADEKLHVLNELSISDLKSFIPELCS  603

Query  2208  QLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKN  2387
             QLYIEGLCHGN+LEEEA+ +S+IF   F+VPPLP E+RHKE+V+CLP GA+L+RD  VKN
Sbjct  604   QLYIEGLCHGNLLEEEAITLSNIFKLTFTVPPLPIELRHKEHVICLPPGANLIRDSNVKN  663

Query  2388  KLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRV  2567
             K + NSV+ELYFQIE E G E ++LK+L+DLFDEIVEEPLF++LRTKEQLGYVV CSPRV
Sbjct  664   KSEMNSVIELYFQIEQEAGIESVRLKSLIDLFDEIVEEPLFNQLRTKEQLGYVVQCSPRV  723

Query  2568  TYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDP  2747
             TYR+LGFCF VQSSEYDPIYLQGR+DNFI+  +E+LD LDD+SFEN+K+GL+AKLLEKDP
Sbjct  724   TYRVLGFCFCVQSSEYDPIYLQGRVDNFIDGLQELLDGLDDESFENYKNGLLAKLLEKDP  783

Query  2748  SLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             SL+YETNR W QI+DKRYMFDLS++EAEEL SI K D+I WY  YL+Q  PKCRRL++ V
Sbjct  784   SLTYETNRFWNQIIDKRYMFDLSKREAEELSSIHKKDVINWYKMYLQQSSPKCRRLAIHV  843

Query  2928  WGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             WGCNT  K+++A  +  + I DP  FKKSS+FYPS 
Sbjct  844   WGCNTNPKEAEAQPKSIQAIVDPATFKKSSKFYPSL  879



>gb|KHN48410.1| Insulin-degrading enzyme [Glycine soja]
Length=935

 Score =  1327 bits (3434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/897 (72%), Positives = 765/897 (85%), Gaps = 4/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  40    LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  99

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHT+A  HP NRFFWGNKKSL DA
Sbjct  100   ISPLVKMEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTAAHNHPLNRFFWGNKKSLVDA  159

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY + Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG        +
Sbjct  160   MEKGINLREQILKLYKEYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGQ-ANPVFTV  218

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK+GK+Y LEAVKDVHIL+LSWTLP L ++YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  219   EGPIWKSGKVYRLEAVKDVHILDLSWTLPCLHQEYLKKPEDYLAHLLGHEGRGSLLSFLK  278

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVG+EG++RSSIAY+F MSIHLTDSG++KIF+IIGFVYQYLKLL + SPQ
Sbjct  279   SRGWATSLSAGVGEEGIYRSSIAYVFVMSIHLTDSGVEKIFDIIGFVYQYLKLLSQDSPQ  338

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG M+FRF EE+P D+YAAELAEN+  YPPE V+YGDY ++ WD+QL+K +
Sbjct  339   EWIFKELQNIGNMDFRFAEEQPPDDYAAELAENMHFYPPEHVIYGDYVFKTWDKQLLKQV  398

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D Q EPWFGS+YVEE I  S +ELW++PPEIDVSLHLP
Sbjct  399   LGFFIPENMRVDVVSKSFLKSEDFQYEPWFGSRYVEEDIGQSFMELWRNPPEIDVSLHLP  458

Query  1617  AKNDFIPSDFSIRA-DTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             +KN+FIPSDFSIRA DT   D  N+  P+CI+DE L+K WYK D+TFK+PRANTYFR+T+
Sbjct  459   SKNEFIPSDFSIRASDTCVDDFANSTSPRCIIDEALIKLWYKPDSTFKVPRANTYFRITM  518

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y+++++ +L+ELF+ LLKDELNEI YQAS+AKLETSV+  GD LELKVYGFN KLPV
Sbjct  519   KGGYADVKSCVLSELFIHLLKDELNEITYQASIAKLETSVTYVGDMLELKVYGFNEKLPV  578

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK  +V+ SF P DDRF VIKEDM+R LKNTNMKPL+H++YLRLQVLC+SF+D +EKL
Sbjct  579   LLSKFFSVSKSFVPTDDRFKVIKEDMKRALKNTNMKPLSHSTYLRLQVLCESFYDADEKL  638

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
             C LN L L DLKAF+P LLSQ+Y+EGLCHGN+ +EEA+NIS IF   F V PLP E+RH 
Sbjct  639   CYLNDLFLDDLKAFIPGLLSQIYVEGLCHGNLSKEEAINISKIFKMSFPVNPLPIELRHA  698

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRDV VKNK + NSVVELYFQI+ + G   IKLKAL+DLFDEIVEEP 
Sbjct  699   ERVICLPSSANLVRDVNVKNKSEKNSVVELYFQIDQDFGLGSIKLKALIDLFDEIVEEPF  758

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+CSPRVTYR+ GFCF VQSSEY+P+YLQGRI+NF+N  +E+LD LD
Sbjct  759   FNQLRTKEQLGYVVECSPRVTYRVFGFCFCVQSSEYNPVYLQGRIENFLNGLEELLDGLD  818

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              DSFEN+KSGL+AKLLEKDPSL+YE+NRLW QIV+KRY+FDLS+KEAEELK+I K D++E
Sbjct  819   GDSFENYKSGLVAKLLEKDPSLTYESNRLWNQIVEKRYIFDLSKKEAEELKNISKHDIVE  878

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYLK   PKCR+L +R+WGCNT  K+++A  +    I DP AFK  S+FYPSFC
Sbjct  879   WYKTYLKPSSPKCRQLLIRLWGCNTDLKEAEALPKSVLAITDPAAFKMQSKFYPSFC  935



>ref|XP_003552920.2| PREDICTED: nardilysin-like [Glycine max]
Length=1110

 Score =  1326 bits (3433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/897 (72%), Positives = 765/897 (85%), Gaps = 4/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  215   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  274

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHT+A  HP NRFFWGNKKSL DA
Sbjct  275   ISPLVKMEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTAAHNHPLNRFFWGNKKSLVDA  334

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY + Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG        +
Sbjct  335   MEKGINLREQILKLYKEYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGQ-ANPVFTV  393

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK+GK+Y LEAVKDVHIL+LSWTLP L ++YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  394   EGPIWKSGKVYRLEAVKDVHILDLSWTLPCLHQEYLKKPEDYLAHLLGHEGRGSLLSFLK  453

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVG+EG++RSSIAY+F MSIHLTDSG++KIF+IIGFVYQYLKLL + SPQ
Sbjct  454   SRGWATSLSAGVGEEGIYRSSIAYVFVMSIHLTDSGVEKIFDIIGFVYQYLKLLSQDSPQ  513

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG M+FRF EE+P D+YAAELAEN+  YPPE V+YGDY ++ WD+QL+K +
Sbjct  514   EWIFKELQNIGNMDFRFAEEQPPDDYAAELAENMHFYPPEHVIYGDYVFKTWDKQLLKQV  573

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D Q EPWFGS+YVEE I  S +ELW++PPEIDVSLHLP
Sbjct  574   LGFFIPENMRVDVVSKSFLKSEDFQYEPWFGSRYVEEDIGQSFMELWRNPPEIDVSLHLP  633

Query  1617  AKNDFIPSDFSIRA-DTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             +KN+FIPSDFSIRA DT   D  N+  P+CI+DE L+K WYK D+TFK+PRANTYFR+T+
Sbjct  634   SKNEFIPSDFSIRASDTCVDDFANSTSPRCIIDEALIKLWYKPDSTFKVPRANTYFRITM  693

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y+++++ +L+ELF+ LLKDELNEI YQAS+AKLETSV+  GD LELKVYGFN KLPV
Sbjct  694   KGGYADVKSCVLSELFIHLLKDELNEITYQASIAKLETSVTYVGDMLELKVYGFNEKLPV  753

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK  +V+ SF P DDRF VIKEDM+R LKNTNMKPL+H++YLRLQVLC+SF+D +EKL
Sbjct  754   LLSKFFSVSKSFVPTDDRFKVIKEDMKRALKNTNMKPLSHSTYLRLQVLCESFYDADEKL  813

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
             C LN L L DLKAF+P LLSQ+Y+EGLCHGN+ +EEA+NIS IF   F V PLP E+RH 
Sbjct  814   CYLNDLFLDDLKAFIPGLLSQIYVEGLCHGNLSKEEAINISKIFKMSFPVNPLPIELRHA  873

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRDV VKNK + NSVVELYFQI+ + G   IKLKAL+DLFDEIVEEP 
Sbjct  874   ERVICLPSSANLVRDVNVKNKSEKNSVVELYFQIDQDFGLGSIKLKALIDLFDEIVEEPF  933

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+CSPRVTYR+ GFCF VQSSEY+P+YLQGRI+NF+N  +E+LD LD
Sbjct  934   FNQLRTKEQLGYVVECSPRVTYRVFGFCFCVQSSEYNPVYLQGRIENFLNGLEELLDGLD  993

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              DSFEN+KSGL+AKLLEKDPSL+YE+NRLW QIV+KRY+FDLS+KEAEELK+I K D++E
Sbjct  994   GDSFENYKSGLVAKLLEKDPSLTYESNRLWNQIVEKRYIFDLSKKEAEELKNISKHDIVE  1053

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYLK   PKCR+L +R+WGCNT  K+++A  +    I DP AFK  S+FYPSFC
Sbjct  1054  WYKTYLKPSSPKCRQLLIRLWGCNTDLKEAEALPKSVLAITDPAAFKMQSKFYPSFC  1110



>ref|XP_010045418.1| PREDICTED: nardilysin isoform X1 [Eucalyptus grandis]
 gb|KCW87579.1| hypothetical protein EUGRSUZ_B04025 [Eucalyptus grandis]
Length=1027

 Score =  1325 bits (3429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/896 (71%), Positives = 756/896 (84%), Gaps = 2/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  132   LEHMLFMGSADYPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKREFLEGALKRFSQFF  191

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK +AM+REVLAVDSEFNQV+Q+D+CRLQQLQCHTS PGH  NRFFWGNKKSL DA
Sbjct  192   ISPLVKMDAMDREVLAVDSEFNQVMQSDACRLQQLQCHTSTPGHALNRFFWGNKKSLVDA  251

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GVNLRE I KL+ + Y+G  MKLV+IGGE LDVLESWV ELF  +KKG  V+     
Sbjct  252   IENGVNLRECILKLFSNYYHGAVMKLVVIGGEPLDVLESWVTELFGKIKKGPPVQFEYEK  311

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E  IWKAG++YWLEAVKDVH+L+L+WTLP LR+ YL+K+EDYLAHLLGHEG+GSL  F K
Sbjct  312   ERAIWKAGQIYWLEAVKDVHVLDLTWTLPCLRQHYLKKSEDYLAHLLGHEGRGSLHSFFK  371

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TS+SAGVGDEG+HRSSIAY+FGMSI LTDSGL+KIFE+IG+VYQYLKLLR+ SP 
Sbjct  372   ARGWATSLSAGVGDEGIHRSSIAYVFGMSIRLTDSGLEKIFEMIGYVYQYLKLLRQASPS  431

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLLVYP E V+YGDYAY+ WDE++I+ +
Sbjct  432   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLVYPAEHVIYGDYAYKEWDEEMIRYL  491

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  DNMR+DV++KS++ S D+Q EPWF S Y+ E +  +LL LWKDPPEID SLH P
Sbjct  492   LGFFSPDNMRIDVLSKSIDKSKDIQIEPWFESCYIMEDVSPALLGLWKDPPEIDSSLHPP  551

Query  1617  AKNDFIPSDFSIRADTI--SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             ++N+FIP DFSIR D +       ++P+CILDEPLMK WYKLD+TFKLPRAN YFRV LK
Sbjct  552   SRNEFIPRDFSIRVDEVHNHVSSVSSPRCILDEPLMKLWYKLDDTFKLPRANAYFRVNLK  611

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y + R+ L+TELF+LLLKDELNEI+YQAS+AKLETSVS + DKLELK+YGFN KLP+L
Sbjct  612   GGYDDARSCLMTELFILLLKDELNEIIYQASIAKLETSVSFFSDKLELKLYGFNEKLPIL  671

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L +T SF P DDRF VIKE++ERTL+NTN+KPLNH+SYLRLQ+LCK+F+DV+EKL 
Sbjct  672   LSKILVITKSFLPTDDRFKVIKEELERTLRNTNIKPLNHSSYLRLQLLCKTFYDVDEKLH  731

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L +L++ DLKAF+P L SQLYIEGLCHGN+LE+EA+ +   F     V  LPAEMRH+E
Sbjct  732   CLGNLTIDDLKAFIPVLRSQLYIEGLCHGNLLEDEAIVLLEAFRVNLHVQALPAEMRHRE  791

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             +++ LPSGA+LVRD++ KNK +TNSVVELYFQIEPE G E IKLKAL+DLFDEIVEEPLF
Sbjct  792   HIVSLPSGANLVRDIRAKNKSETNSVVELYFQIEPEGGKESIKLKALMDLFDEIVEEPLF  851

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRT+EQLGYVV+ SPRVTYRI GFCF VQSS+YDP+YL GRID FI+  +E+L  LD+
Sbjct  852   NQLRTQEQLGYVVEGSPRVTYRIYGFCFCVQSSKYDPVYLLGRIDKFIDSLEELLGGLDE  911

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              +F+N+K+GLI+KLLEKDPSL+YETNR W QI+DKRYMFD SE+EAE L++ +K ++I W
Sbjct  912   CTFDNYKNGLISKLLEKDPSLTYETNRFWSQIIDKRYMFDFSEREAEALRNTKKDEVINW  971

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+QP P+CRRL+VRVWGCN   KD+ A   P +VI D  AFK SS++YP  C
Sbjct  972   YKTYLRQPSPRCRRLAVRVWGCNADLKDAHAQRGPMQVIDDLAAFKLSSKYYPGLC  1027



>gb|EPS63741.1| hypothetical protein M569_11043, partial [Genlisea aurea]
Length=997

 Score =  1321 bits (3420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/895 (73%), Positives = 755/895 (84%), Gaps = 12/895 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETEHTCYHF+VKREFL GAL+RF+QFF
Sbjct  110   LEHMLFMGSKEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFDVKREFLKGALERFAQFF  169

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
              SPL+KAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGN+KSLSDA
Sbjct  170   SSPLIKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNRKSLSDA  229

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR++I KLY + Y+G  MKLV+IGGETLD+LESW+LELFS+V+KG + K     
Sbjct  230   MEKGINLRDRIMKLYQNYYHGGSMKLVVIGGETLDILESWILELFSSVQKGVLPKPDIGS  289

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIW AGKLYWLE+VKDVH+L+LSW LPS+RKDYL+KAEDYLAHLLGHEG+G LLF+LK
Sbjct  290   VLPIWTAGKLYWLESVKDVHVLDLSWPLPSMRKDYLKKAEDYLAHLLGHEGRGGLLFYLK  349

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTS+SAGVGD+G+ RSS+AY+FGMSIHLTDSG++KIFEIIG +YQY+KLLR+   Q
Sbjct  350   ARGWVTSLSAGVGDDGLLRSSLAYVFGMSIHLTDSGIEKIFEIIGLIYQYIKLLRQDDHQ  409

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAA LAENL VYPP   +YG+YAYE+WD+QLI+ +
Sbjct  410   EWIFKELQDIGNMEFRFAEEQPQDDYAASLAENLHVYPPAHAIYGEYAYEVWDQQLIEYL  469

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF+  NMRVD++TKS   S D+  EPWFGSQYVEE IP S++E W++P EID  LHLP
Sbjct  470   LGFFKPGNMRVDILTKSFEKSDDIHREPWFGSQYVEEDIPLSVMEQWENPSEIDSLLHLP  529

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              +N+F+P DFSIRAD +S    +A  PKCILDE  MK WYKLDNTFKLPRAN YFR+TLK
Sbjct  530   CRNEFLPVDFSIRADMVSNQFSDAPSPKCILDEAYMKLWYKLDNTFKLPRANAYFRITLK  589

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G YS+LRN+LLT LFVLLLKD LNEIVYQASVAKLETSVSLYGD LELK+YGF+ KL VL
Sbjct  590   GGYSSLRNSLLTGLFVLLLKDNLNEIVYQASVAKLETSVSLYGDILELKLYGFSDKLSVL  649

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSKVL    ++ P DDRF VIKEDMERTL+N NMKPLNHASYL LQVLC+SF+DVEEKL 
Sbjct  650   LSKVLVAAKTYVPTDDRFSVIKEDMERTLRNANMKPLNHASYLALQVLCQSFFDVEEKLH  709

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             LLN LSL DLKA +PDL SQLYIEG+CHGNMLEEEA+ IS IF S F VPPLP E+RHKE
Sbjct  710   LLNDLSLGDLKALIPDLFSQLYIEGICHGNMLEEEALRISEIFRSNFCVPPLPLELRHKE  769

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              VMCLP  AD  RDV VKNKL+ NSVVELYFQIEPE  S+L  LKAL+DLF+EIVEEPLF
Sbjct  770   LVMCLPPNADFSRDVLVKNKLEPNSVVELYFQIEPEEASKLANLKALMDLFEEIVEEPLF  829

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LR    LGYVVDC  +  YRI+G CFRVQS+EYDP+YLQ RIDNFIN    +LD +D 
Sbjct  830   NQLR---HLGYVVDCCTKTAYRIMGLCFRVQSAEYDPVYLQSRIDNFINGFGVMLDEVDG  886

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             D FEN+K+GL+ KLLEKDPSLSYET+R WGQIV+KRYMFDLS KEAE L+ ++K D+IEW
Sbjct  887   DCFENYKNGLMGKLLEKDPSLSYETDRYWGQIVNKRYMFDLSAKEAEALQDVKKEDVIEW  946

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASME---PAKVIKDPTAFKKSSEFY  3026
             Y++YL+QP PKCRRL++RVWGCNT     D  M+    A  I D  AFK S+EFY
Sbjct  947   YNSYLRQPSPKCRRLAIRVWGCNT----GDVFMKKRVTASSIGDVEAFKDSAEFY  997



>gb|KHN04241.1| Insulin-degrading enzyme [Glycine soja]
Length=936

 Score =  1320 bits (3415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/897 (72%), Positives = 761/897 (85%), Gaps = 4/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  41    LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  100

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTSA  HP NRFFWGNKKSL+DA
Sbjct  101   ISPLVKMEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSAHNHPLNRFFWGNKKSLADA  160

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NL EQI KLY D Y+G  MKLVIIGGE+LDVLESWV+ELF  +KKG        +
Sbjct  161   MEKGINLLEQILKLYKDYYHGGLMKLVIIGGESLDVLESWVVELFGAIKKG-QANPVFTV  219

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW++GK+Y LEAVKDVHIL+LSWTLP L ++YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  220   EGPIWESGKVYRLEAVKDVHILDLSWTLPCLHQEYLKKPEDYLAHLLGHEGRGSLLSFLK  279

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVG+EG++RSSIAY+F MSIHLTDSG++KIF+IIGFVYQYLKLLRE +P 
Sbjct  280   SRGWATSLSAGVGEEGIYRSSIAYVFVMSIHLTDSGIEKIFDIIGFVYQYLKLLREDTPP  339

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG M+FRF EE+P D+YAAELAENL  YPPE V+YGDY ++ WDEQL+K +
Sbjct  340   EWIFKELQNIGNMDFRFAEEQPPDDYAAELAENLHFYPPEHVIYGDYVFKTWDEQLLKQV  399

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D Q EPWFGS+YVEE I  S  ELW++PPEID SLHLP
Sbjct  400   LGFFVPENMRVDVVSKSFLKSEDFQYEPWFGSRYVEEDIAQSFRELWRNPPEIDASLHLP  459

Query  1617  AKNDFIPSDFSIRA-DTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             ++N+FIPSDFSIRA DT   D  N+  P+C++DE L+KFWYK D+TFK+PRANTYFR+T+
Sbjct  460   SQNEFIPSDFSIRASDTCVDDFANSTSPRCLIDEALIKFWYKPDSTFKVPRANTYFRITM  519

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y+++++ +L+ELF+ LLKDELNEI YQAS+AKLETSV+  GD LELKVYGFN KLPV
Sbjct  520   KGGYADVKSCVLSELFIHLLKDELNEITYQASIAKLETSVTYVGDMLELKVYGFNEKLPV  579

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK  +V+ SF P DDRF VIKEDM+R LKN NMKPL+H++YLRLQVLC+SF+D +EKL
Sbjct  580   LLSKFFSVSKSFMPTDDRFKVIKEDMKRALKNANMKPLSHSTYLRLQVLCESFYDADEKL  639

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               LN L L DLKAF+P LLSQ+Y+EGLCHGN+ +EEA+ I+ IF   F V PLP E+RH 
Sbjct  640   HHLNDLFLDDLKAFIPGLLSQIYMEGLCHGNLSKEEAIGIAKIFKMNFPVNPLPIELRHA  699

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRDV VKNK + NSVVELYFQIE + G   IKLKAL+DLFDEIVEEP 
Sbjct  700   ERVICLPSSANLVRDVNVKNKSEKNSVVELYFQIEQDFGLGSIKLKALIDLFDEIVEEPF  759

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+CSPRVTYRI GFCF VQSSEY P+YLQ RI+NF+N  +E+LD LD
Sbjct  760   FNQLRTKEQLGYVVECSPRVTYRISGFCFCVQSSEYHPVYLQSRIENFLNGLEELLDGLD  819

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
              DSFEN+KSGL+AKLLEKDPSL+YE+NRLW QIV+KRY+FDLS+KEAEELK+I K D++E
Sbjct  820   GDSFENYKSGLMAKLLEKDPSLTYESNRLWNQIVEKRYIFDLSKKEAEELKNISKHDVVE  879

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYLK   PKCR+L +R+WGCNT  K+++A  +  +VI DP AFK  S+FYPSFC
Sbjct  880   WYKTYLKPSSPKCRQLLIRLWGCNTDLKEAEALPKSVQVITDPAAFKMQSKFYPSFC  936



>ref|XP_010253096.1| PREDICTED: nardilysin isoform X1 [Nelumbo nucifera]
Length=1037

 Score =  1317 bits (3408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/897 (71%), Positives = 760/897 (85%), Gaps = 4/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSK GGSSNAYTETEHTCYHFEVKREFL GAL+RFSQFF
Sbjct  142   LEHMLFMGSTKFPDENEYDSYLSKRGGSSNAYTETEHTCYHFEVKREFLKGALERFSQFF  201

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMERE+LAVDSEFNQVLQND+CRLQQLQC+TS+ GHPFNRFFWGNKKSL DA
Sbjct  202   ISPLVKVEAMEREILAVDSEFNQVLQNDACRLQQLQCYTSSQGHPFNRFFWGNKKSLVDA  261

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGVNLREQI  LY +NY+G  MKLV+IGGE+LDVL++WV+ELFS V+ G  +K   + 
Sbjct  262   MERGVNLREQILHLYRENYHGGLMKLVVIGGESLDVLQNWVVELFSDVRDGPRLKPDYQK  321

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAG++Y LEAVKDVHIL L+WTLP L  +Y+ K EDYLAHL+GHEG+GSLLFFLK
Sbjct  322   EGPIWKAGRIYRLEAVKDVHILNLTWTLPCLHNEYMAKPEDYLAHLMGHEGRGSLLFFLK  381

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVGDEGM+RSS+AYIFG+SIHLTDSGL+K++E+IG VYQYLKLLRE +PQ
Sbjct  382   AKGWASSLSAGVGDEGMNRSSVAYIFGISIHLTDSGLEKVYEVIGVVYQYLKLLREAAPQ  441

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLLVYP + V+YGD+AYE+WDE+LI  I
Sbjct  442   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLVYPEKHVIYGDFAYELWDEKLIMHI  501

Query  1437  LGFFRADNMRVDVVTKSL-NNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMRVD ++KS    S D + EPWFGSQY EE I  + LELW+DPPEID +LH+
Sbjct  502   LSFFTPENMRVDTLSKSFYKQSLDFKYEPWFGSQYTEEEILPTHLELWRDPPEIDPALHM  561

Query  1614  PAKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KNDFIP DFSIR++  S +  N   P+CILD+PL+KFWYKLD TFKLPRANTYF +T+
Sbjct  562   PVKNDFIPRDFSIRSNGSSNNLANTHFPRCILDQPLIKFWYKLDETFKLPRANTYFLITV  621

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y++++  +LTELFV LLKD+LNE++YQA VAKLETS+S+  DK+ELKVYGFN KLP+
Sbjct  622   KGGYADVKRCVLTELFVNLLKDDLNEVLYQAGVAKLETSLSIISDKIELKVYGFNDKLPI  681

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             L+SK+L V   F P  DRF VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL
Sbjct  682   LVSKILTVARKFCPTADRFKVIKEDMERAFRNANMKPLSHSSYLRLQVLREIFWDVDDKL  741

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L  LSLADL+AF+P+LLSQL+IEGLCHGN+ EEEA+NI  IF   F+V PLP EM H+
Sbjct  742   ACLVYLSLADLEAFIPELLSQLHIEGLCHGNLTEEEAINIMDIFRKNFTV-PLPVEMWHE  800

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+C PSGA+ VRDV VKNKL+TNSVVELYFQIE +VG E  +L+AL DLFD+I+EEPL
Sbjct  801   ERVICFPSGANFVRDVPVKNKLETNSVVELYFQIEQDVGVEATRLRALADLFDDIIEEPL  860

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV+CSPR+TY +LGFCF VQSS+Y P+YLQ RID+FI+  +E+LD +D
Sbjct  861   FDQLRTKEQLGYVVECSPRITYCVLGFCFCVQSSKYSPLYLQERIDSFIDGLQELLDKID  920

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D++FEN++SGLIAK LEKDPSL+YETN LWGQIVDKRY+FD+S KEAEEL+SI+KSD+I+
Sbjct  921   DEAFENYRSGLIAKKLEKDPSLAYETNHLWGQIVDKRYLFDMSAKEAEELRSIKKSDVID  980

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY+ YL+   PKCRRL +R+WGCNT  +++    +  KVI++  AFK S+ FYPS C
Sbjct  981   WYNRYLRLSSPKCRRLVIRLWGCNTNMQENATQGKSVKVIEELAAFKTSAAFYPSLC  1037



>ref|XP_010522008.1| PREDICTED: insulin-degrading enzyme [Tarenaya hassleriana]
Length=1104

 Score =  1316 bits (3406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/896 (71%), Positives = 752/896 (84%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  211   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLKGALKRFSQFF  270

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K EAMEREVLAVDSEFNQ LQ+D+CRLQQLQCHTS   HPFN+F WGNKKSLSDA
Sbjct  271   VSPLMKVEAMEREVLAVDSEFNQALQSDACRLQQLQCHTSGTNHPFNKFAWGNKKSLSDA  330

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGVNLR+ I KLY ++Y+G  MKLV+IGGE+LDVLESWV+ELF+ VKKG  ++   + 
Sbjct  331   MERGVNLRDCIMKLYKEHYHGGLMKLVVIGGESLDVLESWVVELFADVKKGPQIRPPLKA  390

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAG LY LEAVKDVHIL+L WTLPSLR  YL+K EDYLAHLLGHEG+GSL  FLK
Sbjct  391   EGPIWKAGNLYRLEAVKDVHILDLIWTLPSLRHAYLKKPEDYLAHLLGHEGRGSLHSFLK  450

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEG++RSS+AY F MSIHLTDSGL+KI++IIG+VYQYLKLLR+VSPQ
Sbjct  451   GKGWATSLSAGVGDEGLNRSSLAYNFSMSIHLTDSGLEKIYDIIGYVYQYLKLLRDVSPQ  510

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG M+FR+ EE+PQD+YAAELAEN+L YP E V+YGDY Y  WD ++IK +
Sbjct  511   EWIFKELQNIGNMDFRYAEEQPQDDYAAELAENMLAYPVEHVIYGDYVYTTWDPEMIKYL  570

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DVV+KS+  S D Q EPWFGS+YVEE +PSSL+E WK+P EID SLHLP
Sbjct  571   LGFFTPENMRIDVVSKSI-KSQDFQHEPWFGSRYVEEDVPSSLMEAWKNPSEIDTSLHLP  629

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             AKN+FIP DFSIRA     D  N   P+CI+D+ LMK WYKLD TFK+PRANTYFR+ LK
Sbjct  630   AKNEFIPCDFSIRAMNSDGDSKNQSPPRCIIDKALMKLWYKLDETFKVPRANTYFRINLK  689

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y +++N LLTELF+ LLKDELNE +YQASVAKLETS+S+YGDKLELKVYGFN KLP L
Sbjct  690   GGYDSVKNCLLTELFINLLKDELNETIYQASVAKLETSLSMYGDKLELKVYGFNDKLPAL  749

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS+VL V  SF P  +RF VIKE+MER LKNTNMKPLNH+SYLRLQ+LCK F+D +EKL 
Sbjct  750   LSEVLTVAKSFIPTLERFKVIKENMERGLKNTNMKPLNHSSYLRLQLLCKRFYDADEKLS  809

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL  F+P+L SQ++IE LCHGN+ EEEA NIS+IF S     PLP++ RH+E
Sbjct  810   VLNDLSLADLTTFIPELRSQIFIEALCHGNLSEEEANNISNIFKSSLMAEPLPSKFRHEE  869

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             ++ C P G++LVRDV VKNK +TNSVVELY+QI+ E  ++  ++KA++DLFDEI+EEPLF
Sbjct  870   HITCFPLGSNLVRDVSVKNKSETNSVVELYYQIDSE-EAQSTRMKAILDLFDEIIEEPLF  928

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYRI GFCF VQSS+Y PIYL  RID FI    E+L+ LDD
Sbjct  929   NQLRTKEQLGYVVECGPRLTYRIHGFCFCVQSSKYSPIYLLERIDGFITSIDELLEQLDD  988

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              SFE+++SG+IAKLLEKDPSLSYETNRLWGQIVDKRYMFD S KEAEEL+SI+K D+++W
Sbjct  989   KSFEDYRSGMIAKLLEKDPSLSYETNRLWGQIVDKRYMFDFSVKEAEELRSIQKKDVVDW  1048

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL +P PKCR+L+VRVWGCNT   +  +  + A++I D  AFK SS+FYPS C
Sbjct  1049  YRTYLTEPSPKCRKLAVRVWGCNTDMNEGKSVPKSAEIITDVAAFKSSSQFYPSLC  1104



>ref|XP_004294732.1| PREDICTED: insulin-degrading enzyme-like [Fragaria vesca subsp. 
vesca]
Length=1030

 Score =  1313 bits (3398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/895 (70%), Positives = 749/895 (84%), Gaps = 1/895 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GAL RFSQFF
Sbjct  136   LEHMLFMGSKEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKREFLKGALTRFSQFF  195

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK+EAMEREV AVDSEFNQVLQND+CRL+QLQCHT++PGHPFNRF WGNKKSLSDA
Sbjct  196   VSPLVKSEAMEREVQAVDSEFNQVLQNDACRLEQLQCHTASPGHPFNRFAWGNKKSLSDA  255

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE+WVLELF  VKKG  VK   + 
Sbjct  256   MEKGINLREQILKLYRDFYHGGLMKLVVIGGESLDVLENWVLELFGNVKKGPQVKLEFKA  315

Query  897   -ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFL  1073
              E PIWK GK+Y LEAVKD+HIL L+WT P LR+DYL+K+EDY++HLLGHEG+GSL  + 
Sbjct  316   AEGPIWKGGKVYRLEAVKDIHILHLTWTFPCLRQDYLKKSEDYISHLLGHEGRGSLHSYF  375

Query  1074  KTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSP  1253
             K +GW TS++AGVGD+GMHRSS+AY+F M I+LTDSGL KIF+IIG VYQY+KLL +VSP
Sbjct  376   KARGWATSLAAGVGDDGMHRSSVAYVFRMDIYLTDSGLDKIFDIIGLVYQYIKLLHKVSP  435

Query  1254  QEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKD  1433
             QEWIFKELQD G MEFRF EE+PQD+YA+ELA NLL+Y  E V+YG YAY+IW E+ IK 
Sbjct  436   QEWIFKELQDTGNMEFRFAEEQPQDDYASELAGNLLIYAAEHVIYGAYAYKIWAEESIKY  495

Query  1434  ILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             +L F R +NMR+DVV+K      D QCEPWFGS Y EE I  SL++LWKDPPEIDVSLHL
Sbjct  496   VLNFLRPENMRIDVVSKPSMKLEDFQCEPWFGSHYTEEDISPSLIDLWKDPPEIDVSLHL  555

Query  1614  PAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             P KN+FIP+DFSIR+D +     + P+CILDEPL+KFWYKLD+TFKLPRANTYFR+ LKG
Sbjct  556   PEKNEFIPTDFSIRSDGLDTTDVSLPRCILDEPLVKFWYKLDSTFKLPRANTYFRINLKG  615

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              Y N+++ +LTEL++ LLKDELNEIVYQAS+AKLETSVS+  D LELKVYGFN KLP LL
Sbjct  616   GYDNVKSCVLTELYISLLKDELNEIVYQASMAKLETSVSVSSDNLELKVYGFNDKLPALL  675

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SK+L  T SF P  DRFLVIKE+MER LKNTNMKPL+H+SYLRLQVL + F+DV+EKL +
Sbjct  676   SKILKTTKSFMPTSDRFLVIKENMERKLKNTNMKPLSHSSYLRLQVLFQKFYDVDEKLHV  735

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN LS++D+K F+P L SQLYIEGLCHGN+ E+EA+++S IF + FSV PLP E+RH+E+
Sbjct  736   LNGLSVSDMKLFIPQLCSQLYIEGLCHGNLSEKEAISLSDIFKTNFSVQPLPVELRHREH  795

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
               CLP  A+L+RD  VKNK +TNSV+ELYFQIE EV SE  +++AL+DLFDEIVEEPLF+
Sbjct  796   FTCLPPSANLIRDASVKNKSETNSVIELYFQIEREVFSESPRMRALIDLFDEIVEEPLFN  855

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGY V C+PRVT  + GFCF VQS+EY+PIYLQGR++ FI   +E+L  LDDD
Sbjct  856   QLRTKEQLGYTVQCAPRVTTNVFGFCFYVQSAEYNPIYLQGRLEIFIKSLEELLQGLDDD  915

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFEN+++GL+AKLLEKDPSL YETNR W +I DKRYMFD +++EA +LK+I+K D+I WY
Sbjct  916   SFENYRAGLMAKLLEKDPSLQYETNRFWSEITDKRYMFDYTKQEAVQLKNIQKEDVINWY  975

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
              TYL+Q  PKCR+L+VRVWGCNT  K+++A  E  KVI+D  AF  SSEFYPS C
Sbjct  976   KTYLQQLSPKCRKLAVRVWGCNTDMKEAEARPESVKVIEDLGAFTMSSEFYPSNC  1030



>ref|XP_007017077.1| Insulinase (Peptidase family M16) family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34696.1| Insulinase (Peptidase family M16) family protein isoform 1 [Theobroma 
cacao]
Length=1063

 Score =  1306 bits (3379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/891 (70%), Positives = 752/891 (84%), Gaps = 3/891 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EH+CYHFEV+REFL GAL+RFSQFF
Sbjct  132   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHSCYHFEVEREFLKGALRRFSQFF  191

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQ LQNDS RLQQLQCHTS  GHPFN F WGNKKSL DA
Sbjct  192   ISPLVKLEAMEREVLAVDSEFNQALQNDSFRLQQLQCHTSEHGHPFNTFSWGNKKSLVDA  251

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LR+QI +LY D Y+G  MKLV+IGGE LD+L+ WV+ELF  V++G + +    +
Sbjct  252   VEKGIDLRKQILELYKDYYHGGLMKLVVIGGEPLDLLQQWVVELFLDVRQGSLGRPEFTV  311

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E P+W+AGKLY L+AVKDVHILEL WTLP L ++YL+K E YLAHLLGHEGKGSL +F K
Sbjct  312   EGPVWRAGKLYRLQAVKDVHILELRWTLPCLLQEYLKKPEAYLAHLLGHEGKGSLHYFFK  371

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGV D+GM RSS+AYIF MSIHLTDSGL+KI ++IG+VYQYLKLL  +SPQ
Sbjct  372   AKGWATSLSAGVSDDGMQRSSVAYIFSMSIHLTDSGLEKILDVIGYVYQYLKLLHLLSPQ  431

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ++G ++FRF EEEPQD+YA+ELAENLLVYP E V+YGDY +E WDE++I+ I
Sbjct  432   EWIFKELQEMGNLDFRFAEEEPQDDYASELAENLLVYPAEHVIYGDYVFEFWDEEMIRKI  491

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DVV+KS   S DV+ EPWFGS YVEE I  SL+ELW+DPP+IDVSLHLP
Sbjct  492   LGFFTPENMRIDVVSKSFK-SQDVKYEPWFGSHYVEEEISPSLMELWRDPPDIDVSLHLP  550

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSIRAD +  D  N   P CILDEPLMKFWYKLD+TFKLPRANTYF++ LK
Sbjct  551   LKNEFIPCDFSIRADNMQIDPANESLPVCILDEPLMKFWYKLDSTFKLPRANTYFQINLK  610

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY NL++ LLTEL++ LLKDELNEI+YQASVAKLETSV++Y DKL LK+YGFN KLPVL
Sbjct  611   GAYLNLKSCLLTELYIHLLKDELNEIIYQASVAKLETSVAMYSDKLGLKLYGFNDKLPVL  670

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             L  VLA+  SF P +DRF VIKE++ERTLKN NMKPL H+SYLRLQ+LCKSF+DV+EKL 
Sbjct  671   LCTVLAIANSFLPTNDRFKVIKENVERTLKNANMKPLRHSSYLRLQILCKSFYDVDEKLA  730

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L  LSL+DLKAF+P+L SQ++IEGLCHGN+LE+E ++IS+IF S FSV P+P  MRH+E
Sbjct  731   FLKDLSLSDLKAFIPELRSQIHIEGLCHGNLLEKEVLDISNIFKSNFSVQPMPVTMRHRE  790

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C PSGA+ VRDV VKNK +TNSV+ELYFQIEPEVG E +KLKAL+DLFDEIVEEP +
Sbjct  791   QVICFPSGANFVRDVSVKNKSETNSVLELYFQIEPEVGVEAVKLKALIDLFDEIVEEPHY  850

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV CSPRVTYR+ GFCF +QSS+Y P+YLQ R DNFIN  +E+L+ LDD
Sbjct  851   NQLRTKEQLGYVVQCSPRVTYRVYGFCFCIQSSKYSPVYLQERADNFINGLEELLEGLDD  910

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SGL AKLLEKD SLSYET+R W QIVD RYMFDL ++EAEEL+SI+K D++ W
Sbjct  911   ESFESYRSGLTAKLLEKDSSLSYETSRFWNQIVDNRYMFDLPKREAEELRSIQKVDIVNW  970

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEF  3023
             Y  YL+Q  PKCRRL+VRVWGCN   K++++  +  +VI+D  AF+ SS +
Sbjct  971   YKMYLQQSSPKCRRLAVRVWGCNADLKEAESKQDCVQVIEDVEAFRVSSNW  1021



>ref|XP_008465304.1| PREDICTED: nardilysin [Cucumis melo]
Length=1021

 Score =  1300 bits (3363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/897 (71%), Positives = 754/897 (84%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST++PDENEYDSYLSKHGGSSNAYTE EHTCYHF+VK EFL GALKRFSQFF
Sbjct  125   LEHMLFMGSTDYPDENEYDSYLSKHGGSSNAYTEAEHTCYHFDVKPEFLKGALKRFSQFF  184

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQND CRLQQLQC+TS PGHPFNRFFWGNKKSL DA
Sbjct  185   ISPLVKIEAMEREVLAVDSEFNQVLQNDVCRLQQLQCYTSVPGHPFNRFFWGNKKSLVDA  244

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KL+ D Y+G  MKL +IGGE LD+LESWVLELF  +KKG   K    +
Sbjct  245   MEKGINLREQILKLFRDYYHGGLMKLTVIGGEPLDMLESWVLELFVDLKKGVQAKPKFTV  304

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW++GKLY LEAV+DVHIL+L+WTLP L+ +YL+K EDY+AHLLGHEGKGSL FFLK
Sbjct  305   KDPIWQSGKLYKLEAVEDVHILDLAWTLPCLQHNYLKKPEDYIAHLLGHEGKGSLHFFLK  364

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+GM RSS+AY+FGMSI+LTDSG +KIFEIIG+VYQYLKLLR++SPQ
Sbjct  365   AKGWATSLSAGVGDDGMCRSSMAYVFGMSIYLTDSGKEKIFEIIGYVYQYLKLLRQISPQ  424

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG MEFRF EE+PQD+YAAELAENL  YP E V+YG+Y ++IWDE L+K I
Sbjct  425   EWIFRELQDIGNMEFRFAEEQPQDDYAAELAENLSFYPAEHVIYGEYVHKIWDEDLVKHI  484

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF  +NMRVD+V+KS +   D + EPWFGS Y  + I  SL++LW+DPPEID SL+LP
Sbjct  485   IGFFTPENMRVDIVSKSFSKLEDFKIEPWFGSHYSVDDIAPSLMDLWRDPPEIDASLYLP  544

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             AKN+FIP DFSIRA  +  D    ++P+CILDEPLMKFWYKLDN+FKLPRANTYFR+ L 
Sbjct  545   AKNEFIPRDFSIRASKVCNDLLLESSPRCILDEPLMKFWYKLDNSFKLPRANTYFRINLS  604

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G YS+++N LLTELFV LLKD+LN+I+YQAS+AKLETSV++ GDKLELKV+GFN KLP L
Sbjct  605   GGYSSVKNCLLTELFVHLLKDKLNDIIYQASIAKLETSVAISGDKLELKVFGFNDKLPNL  664

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA   +F P +DRF VIKE MER L+NTNMKP +H+SYLRLQVLC+ F+D +EK  
Sbjct  665   LSKLLATAKTFMPSEDRFKVIKEKMERNLRNTNMKPRSHSSYLRLQVLCERFYDADEKSD  724

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LS  DLKA +P++LSQLYIEGLCHGN LEEEA+++S+IF   FSV PLP  MRH E
Sbjct  725   VLNDLSFVDLKAHIPEVLSQLYIEGLCHGNFLEEEAISLSNIFKDNFSVQPLPLGMRHYE  784

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVG-SELIKLKALVDLFDEIVEEPL  2507
              VMCLP GA+LVRDV VKNKL+ NSV+ELYFQIEPEVG  E I+ KAL+DLFDEI++EPL
Sbjct  785   RVMCLPPGANLVRDVSVKNKLERNSVLELYFQIEPEVGMEESIRQKALIDLFDEIIDEPL  844

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+CSPRVTYRI GFCF VQSSEY PI+LQ R +NFI   +E+L +LD
Sbjct  845   FNQLRTKEQLGYVVECSPRVTYRIYGFCFSVQSSEYSPIFLQERFENFITGLQELLLDLD  904

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             + SFEN+K+GLI KLLEKDPSL +ETNRLW QIVDKRY FD S+KE E+LK+I K+D+I+
Sbjct  905   EASFENYKNGLIGKLLEKDPSLYHETNRLWDQIVDKRYAFDFSQKEVEKLKNIEKNDIID  964

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL++  PKCRRL++RVWGC T   D++  ++    IKD  AFK SS FYPS C
Sbjct  965   WYKTYLQESSPKCRRLAIRVWGCETNMIDAETPVKSVVAIKDVEAFKTSSMFYPSLC  1021



>ref|XP_010315799.1| PREDICTED: nardilysin isoform X2 [Solanum lycopersicum]
Length=897

 Score =  1293 bits (3347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/774 (81%), Positives = 696/774 (90%), Gaps = 1/774 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYD+YLS+HGG SNAYTE EHTCYHFEVKR+ L  AL+RFSQFF
Sbjct  121   LEHMLFMGSTDFPDENEYDNYLSRHGGCSNAYTEAEHTCYHFEVKRDCLKEALRRFSQFF  180

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTS PGHPFNRFFWGNKKSL+DA
Sbjct  181   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSNPGHPFNRFFWGNKKSLADA  240

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ++GVNLREQI +LYHDNY G  MKL +IGGE++D+LESWVLELFS VKKG +V      
Sbjct  241   VQKGVNLREQILRLYHDNYRGGSMKLAVIGGESVDILESWVLELFSNVKKGPLVNPDGGS  300

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLYWL+AVKDVHIL+LSWTLPSLRK YL+KAEDYLAHLLGHEGKGSLLFFLK
Sbjct  301   ELPIWKVGKLYWLKAVKDVHILDLSWTLPSLRKGYLKKAEDYLAHLLGHEGKGSLLFFLK  360

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTSISAGVGDEGMHRSS AYIFGMSIHLTD GL+KIFEIIGFVYQYLKLL + SPQ
Sbjct  361   ARGWVTSISAGVGDEGMHRSSFAYIFGMSIHLTDFGLEKIFEIIGFVYQYLKLLHQNSPQ  420

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDI  ++FR+ EE+PQD+YAAELAE LLVYPPE V+YGDYAY++WD + IK +
Sbjct  421   EWIFKELQDIANVDFRYAEEQPQDDYAAELAEGLLVYPPEHVIYGDYAYDVWDAEFIKYV  480

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             L FFR +NMRVDVV+KS   S DVQ EPWFGS+YVE+ IPSSL ELWKDP EI+  LHLP
Sbjct  481   LDFFRPENMRVDVVSKSFQKSDDVQREPWFGSEYVEKDIPSSLFELWKDPTEINACLHLP  540

Query  1617  AKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
             AKN+F+PSDFSIRA   +CD  NA P+CILDEPLMK WYKLDNTFKLPRANTYFR+TLKG
Sbjct  541   AKNEFVPSDFSIRAGKANCDWENARPRCILDEPLMKIWYKLDNTFKLPRANTYFRITLKG  600

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
              YSNL+NALLTELF+ LLKDELNEI+YQASVAKLETSVSLYGDKLELKVYGFN KLPVLL
Sbjct  601   GYSNLKNALLTELFIHLLKDELNEIIYQASVAKLETSVSLYGDKLELKVYGFNDKLPVLL  660

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SKVL VT SFSP+DDRF+VIKEDM RTLKNTNMKPLNH+SYLRLQVLC+SFWDVEEKL L
Sbjct  661   SKVLVVTKSFSPRDDRFMVIKEDMVRTLKNTNMKPLNHSSYLRLQVLCQSFWDVEEKLFL  720

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN L+L+DL  F+P+LLSQLYIEGLCHGN+LEEEA+NIS IF S FSV  LP EMRHKEY
Sbjct  721   LNDLTLSDLNFFIPELLSQLYIEGLCHGNLLEEEALNISKIFRSNFSVQALPFEMRHKEY  780

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
             VMCLP+ ADLVRDV+VKNKL+TNSVVELYFQIEPE G+ LIKLKA++DLFDE+VEEPLF+
Sbjct  781   VMCLPTAADLVRDVRVKNKLETNSVVELYFQIEPEEGTALIKLKAVIDLFDELVEEPLFN  840

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEIL  2675
             +LRTKEQLGYVVDCS RVTYRI GFCFRVQSS+YDP+YLQGRIDNFIN  +E+L
Sbjct  841   QLRTKEQLGYVVDCSARVTYRITGFCFRVQSSDYDPVYLQGRIDNFINGVEELL  894



>ref|XP_010685976.1| PREDICTED: insulin-degrading enzyme isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=880

 Score =  1292 bits (3344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/877 (72%), Positives = 745/877 (85%), Gaps = 2/877 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTE EHTCYHF+VKREFL  AL+RFSQFF+SPLVK+EAMEREVLAVDS
Sbjct  4     SYLSKHGGSSNAYTEVEHTCYHFDVKREFLREALRRFSQFFISPLVKSEAMEREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQ+DSCRLQQLQCHTS PGHP+NRFFWGNKKSL DA E+GV+LR++I K+Y DNY
Sbjct  64    EFNQVLQSDSCRLQQLQCHTSVPGHPYNRFFWGNKKSLMDAVEKGVDLRQRIMKMYEDNY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             YG  +KLV+IGGE+LD+LESWVLELFS VKKG   +   + E PIW AGKLY +EAVKDV
Sbjct  124   YGEFIKLVLIGGESLDILESWVLELFSDVKKGLSSRLEIKHEGPIWNAGKLYRVEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             H+LE+SW LP LR DY++K EDY AHL+GHEG+GSL FFLK+KGW+TSISAGVG++GM+R
Sbjct  184   HVLEVSWKLPCLRTDYMKKLEDYFAHLIGHEGRGSLHFFLKSKGWITSISAGVGEDGMNR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SS+AYIFGM+IHLTDSGL KI+EIIGFVYQYLKLLR   PQEWIFKELQDIG MEFRF E
Sbjct  244   SSLAYIFGMNIHLTDSGLDKIYEIIGFVYQYLKLLRGAPPQEWIFKELQDIGKMEFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELA NLL+YPPE V+YG+YA+E WD + +K IL FF  DNMRVD+++KS  
Sbjct  304   EQPQDDYAAELAANLLIYPPEHVIYGEYAFEDWDAEKLKFILDFFVPDNMRVDILSKSFA  363

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISC  1673
              S D  CEPWFG++Y EE I  SL++LW+DPP ID SLHLP+KN+FIP DF + AD +S 
Sbjct  364   TSGDALCEPWFGARYTEEDIALSLMDLWRDPPAIDGSLHLPSKNEFIPVDFPVHADNVSN  423

Query  1674  D--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLL  1847
             D   G+ P+CILDEPLMK W+KLD TFKLPRANTYFR+ L GAY+++R+ LLTELFVLLL
Sbjct  424   DIVDGSYPRCILDEPLMKLWFKLDRTFKLPRANTYFRINLNGAYASVRSFLLTELFVLLL  483

Query  1848  KDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFL  2027
             KDELNEIVYQAS+AKLETS+S+ GDKLELKVYGF+ KLP+LLSK+L +  SFSPKDDRF 
Sbjct  484   KDELNEIVYQASLAKLETSISVSGDKLELKVYGFSEKLPLLLSKILDIAKSFSPKDDRFE  543

Query  2028  VIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLS  2207
             V+KE MER L+NTNMKPLNHASYLRLQ+LCKSFWDV+EKL  L  LSLA+L AF+P LLS
Sbjct  544   VVKEGMERNLRNTNMKPLNHASYLRLQILCKSFWDVDEKLQCLADLSLAELLAFIPQLLS  603

Query  2208  QLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKN  2387
             QLY EGLCHGN+LEEEA+NIS+IF S+F VP LP E RHKE V+CLPSGA+ VRD+ VKN
Sbjct  604   QLYFEGLCHGNLLEEEAINISNIFRSHFPVPALPIEARHKERVLCLPSGANHVRDLCVKN  663

Query  2388  KLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRV  2567
             KLD NSVVELY+QIE E   + +K K+  DLFDEIVEEP +++LRTKEQLGYVV+CSPR+
Sbjct  664   KLDPNSVVELYYQIEQENAVDSLKQKSFSDLFDEIVEEPFYNQLRTKEQLGYVVECSPRM  723

Query  2568  TYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDP  2747
             TYR+ GFCF +QSS+Y+PIYLQ RID+FI+  K+ L+ LDD SFE+FKSGLIAKLLEKDP
Sbjct  724   TYRVFGFCFCIQSSKYNPIYLQERIDDFIDGLKDFLEKLDDGSFESFKSGLIAKLLEKDP  783

Query  2748  SLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             SLSYETNR W QIVDKRYMFD SEK A+ ++ I+KSDLI+WY TYL++  PKCRRL++RV
Sbjct  784   SLSYETNRFWNQIVDKRYMFDYSEKVAQIVRDIQKSDLIDWYSTYLRRDSPKCRRLAIRV  843

Query  2928  WGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WGCNT  K+++A      VI D  AFK SSEFY S C
Sbjct  844   WGCNTDIKEAEAQERSEVVINDFAAFKSSSEFYASLC  880



>dbj|BAF01167.1| hypothetical protein [Arabidopsis thaliana]
Length=1061

 Score =  1291 bits (3340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/896 (69%), Positives = 746/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  168   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  227

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  228   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  287

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  288   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGDVKNGSKIRPTLEA  347

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  348   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRSAYVKKPEDYLAHLLGHEGRGSLHSFLK  407

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+VSPQ
Sbjct  408   AKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQ  467

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FRF EE+P D+YAAEL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  468   EWIFKELQDIGNMDFRFAEEQPADDYAAELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  527

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS Y+EE +P SL+E W +P E+D SLHLP
Sbjct  528   MGFFTPQNMRIDVVSKSI-KSEEFQQEPWFGSSYIEEDVPLSLMESWSNPSEVDNSLHLP  586

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ LK
Sbjct  587   SKNQFIPCDFSIRAINSDVDPKSQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLK  646

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTEL++ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  647   GAYASVKNCLLTELYINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  706

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  +RF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  707   LSKILAIAKSFMPNLERFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKGIYDSDEKLS  766

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L SQ++IE LCHGN+ E+EAVNIS+IF    +V PLP++ RH E
Sbjct  767   VLNDLSLDDLNSFIPELRSQIFIEALCHGNLSEDEAVNISNIFKDSLTVEPLPSKCRHGE  826

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P GA LVRDV VKNK +TNSVVELY+QIEPE  ++  + KA++DLF EI+EEPLF
Sbjct  827   QITCFPMGAKLVRDVNVKNKSETNSVVELYYQIEPE-EAQSTRTKAVLDLFHEIIEEPLF  885

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR+DNFI D + +L+ LDD
Sbjct  886   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRVDNFIKDIEGLLEQLDD  945

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +S+E+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI+K D+I W
Sbjct  946   ESYEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIQKKDVISW  1005

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGC+T  K++    +  +VI D  AFK +S+FYPS C
Sbjct  1006  YKTYFRESSPKCRRLAVRVWGCDTNMKETQTDQKAVQVIADAVAFKSTSKFYPSLC  1061



>ref|NP_172173.2| Insulinase (peptidase family M16) family protein [Arabidopsis 
thaliana]
 gb|AEE28051.1| Insulinase (peptidase family M16) family protein [Arabidopsis 
thaliana]
Length=1024

 Score =  1290 bits (3338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/896 (69%), Positives = 746/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  191   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  251   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGDVKNGSKIRPTLEA  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  311   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRSAYVKKPEDYLAHLLGHEGRGSLHSFLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+VSPQ
Sbjct  371   AKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FRF EE+P D+YAAEL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  431   EWIFKELQDIGNMDFRFAEEQPADDYAAELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS Y+EE +P SL+E W +P E+D SLHLP
Sbjct  491   MGFFTPQNMRIDVVSKSI-KSEEFQQEPWFGSSYIEEDVPLSLMESWSNPSEVDNSLHLP  549

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ LK
Sbjct  550   SKNQFIPCDFSIRAINSDVDPKSQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLK  609

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTEL++ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  610   GAYASVKNCLLTELYINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  669

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  +RF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  670   LSKILAIAKSFMPNLERFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  729

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L SQ++IE LCHGN+ E+EAVNIS+IF    +V PLP++ RH E
Sbjct  730   VLNDLSLDDLNSFIPELRSQIFIEALCHGNLSEDEAVNISNIFKDSLTVEPLPSKCRHGE  789

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P GA LVRDV VKNK +TNSVVELY+QIEPE  ++  + KA++DLF EI+EEPLF
Sbjct  790   QITCFPMGAKLVRDVNVKNKSETNSVVELYYQIEPE-EAQSTRTKAVLDLFHEIIEEPLF  848

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR+DNFI D + +L+ LDD
Sbjct  849   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRVDNFIKDIEGLLEQLDD  908

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +S+E+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI+K D+I W
Sbjct  909   ESYEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIQKKDVISW  968

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGC+T  K++    +  +VI D  AFK +S+FYPS C
Sbjct  969   YKTYFRESSPKCRRLAVRVWGCDTNMKETQTDQKAVQVIADAVAFKSTSKFYPSLC  1024



>ref|XP_010045419.1| PREDICTED: insulin-degrading enzyme isoform X2 [Eucalyptus grandis]
Length=880

 Score =  1289 bits (3336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/877 (70%), Positives = 738/877 (84%), Gaps = 2/877 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF+SPLVK +AM+REVLAVDS
Sbjct  4     SYLSKHGGSSNAYTEAEHTCYHFEVKREFLEGALKRFSQFFISPLVKMDAMDREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQV+Q+D+CRLQQLQCHTS PGH  NRFFWGNKKSL DA E GVNLRE I KL+ + Y
Sbjct  64    EFNQVMQSDACRLQQLQCHTSTPGHALNRFFWGNKKSLVDAIENGVNLRECILKLFSNYY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             +G  MKLV+IGGE LDVLESWV ELF  +KKG  V+     E  IWKAG++YWLEAVKDV
Sbjct  124   HGAVMKLVVIGGEPLDVLESWVTELFGKIKKGPPVQFEYEKERAIWKAGQIYWLEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             H+L+L+WTLP LR+ YL+K+EDYLAHLLGHEG+GSL  F K +GW TS+SAGVGDEG+HR
Sbjct  184   HVLDLTWTLPCLRQHYLKKSEDYLAHLLGHEGRGSLHSFFKARGWATSLSAGVGDEGIHR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SSIAY+FGMSI LTDSGL+KIFE+IG+VYQYLKLLR+ SP EWIFKELQDIG MEFRF E
Sbjct  244   SSIAYVFGMSIRLTDSGLEKIFEMIGYVYQYLKLLRQASPSEWIFKELQDIGNMEFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAENLLVYP E V+YGDYAY+ WDE++I+ +LGFF  DNMR+DV++KS++
Sbjct  304   EQPQDDYAAELAENLLVYPAEHVIYGDYAYKEWDEEMIRYLLGFFSPDNMRIDVLSKSID  363

Query  1494  NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTI--  1667
              S D+Q EPWF S Y+ E +  +LL LWKDPPEID SLH P++N+FIP DFSIR D +  
Sbjct  364   KSKDIQIEPWFESCYIMEDVSPALLGLWKDPPEIDSSLHPPSRNEFIPRDFSIRVDEVHN  423

Query  1668  SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLL  1847
                  ++P+CILDEPLMK WYKLD+TFKLPRAN YFRV LKG Y + R+ L+TELF+LLL
Sbjct  424   HVSSVSSPRCILDEPLMKLWYKLDDTFKLPRANAYFRVNLKGGYDDARSCLMTELFILLL  483

Query  1848  KDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFL  2027
             KDELNEI+YQAS+AKLETSVS + DKLELK+YGFN KLP+LLSK+L +T SF P DDRF 
Sbjct  484   KDELNEIIYQASIAKLETSVSFFSDKLELKLYGFNEKLPILLSKILVITKSFLPTDDRFK  543

Query  2028  VIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLS  2207
             VIKE++ERTL+NTN+KPLNH+SYLRLQ+LCK+F+DV+EKL  L +L++ DLKAF+P L S
Sbjct  544   VIKEELERTLRNTNIKPLNHSSYLRLQLLCKTFYDVDEKLHCLGNLTIDDLKAFIPVLRS  603

Query  2208  QLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKN  2387
             QLYIEGLCHGN+LE+EA+ +   F     V  LPAEMRH+E+++ LPSGA+LVRD++ KN
Sbjct  604   QLYIEGLCHGNLLEDEAIVLLEAFRVNLHVQALPAEMRHREHIVSLPSGANLVRDIRAKN  663

Query  2388  KLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRV  2567
             K +TNSVVELYFQIEPE G E IKLKAL+DLFDEIVEEPLF++LRT+EQLGYVV+ SPRV
Sbjct  664   KSETNSVVELYFQIEPEGGKESIKLKALMDLFDEIVEEPLFNQLRTQEQLGYVVEGSPRV  723

Query  2568  TYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDP  2747
             TYRI GFCF VQSS+YDP+YL GRID FI+  +E+L  LD+ +F+N+K+GLI+KLLEKDP
Sbjct  724   TYRIYGFCFCVQSSKYDPVYLLGRIDKFIDSLEELLGGLDECTFDNYKNGLISKLLEKDP  783

Query  2748  SLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             SL+YETNR W QI+DKRYMFD SE+EAE L++ +K ++I WY TYL+QP P+CRRL+VRV
Sbjct  784   SLTYETNRFWSQIIDKRYMFDFSEREAEALRNTKKDEVINWYKTYLRQPSPRCRRLAVRV  843

Query  2928  WGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WGCN   KD+ A   P +VI D  AFK SS++YP  C
Sbjct  844   WGCNADLKDAHAQRGPMQVIDDLAAFKLSSKYYPGLC  880



>ref|XP_002892364.1| metalloendopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68623.1| metalloendopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=1024

 Score =  1288 bits (3334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/896 (69%), Positives = 747/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  190

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  191   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  250

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  251   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGDVKNGSKIRPTLEA  310

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  311   EGPIWKGGKLYRLEAVKDVHILGLTWTLPPLRYAYVKKPEDYLAHLLGHEGRGSLHSFLK  370

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+VSPQ
Sbjct  371   AKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQ  430

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FRF EE+P D+YAAEL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  431   EWIFKELQDIGNMDFRFAEEQPADDYAAELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  490

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + + EPWFGS Y+EE +P SL+E W +P E+D SLHLP
Sbjct  491   MGFFTPQNMRIDVVSKSI-KSEEFEQEPWFGSSYIEEDVPLSLMESWSNPSEVDNSLHLP  549

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ LK
Sbjct  550   SKNQFIPCDFSIRAINSDVDPKSQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLK  609

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  610   GAYASVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  669

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  +RF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  670   LSKILAIAKSFMPNLERFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  729

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L SQ++IE LCHGN+ E+EAVNIS+IF +  +V PLP++ RH E
Sbjct  730   VLNDLSLDDLNSFIPELRSQIFIEALCHGNLSEDEAVNISNIFKNSLTVEPLPSKCRHGE  789

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P GA LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+EEPLF
Sbjct  790   QITCFPLGAKLVRDVDVKNKSETNSVVELYYQIEPE-EAQSTRMKAVLDLFHEIIEEPLF  848

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR+DNFI D + +L+ LDD
Sbjct  849   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRVDNFIKDIEGLLEQLDD  908

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +S+E+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI+K D+I W
Sbjct  909   ESYEDYRSGMIARLLEKDPSLLSETNELWSQIVDKRYMFDFSHKEAEELRSIQKKDVIRW  968

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGC+T  K++    +  +VI D  AFK +S+FYPS C
Sbjct  969   YKTYFRESSPKCRRLAVRVWGCDTNMKETQTDQKAVQVIADAVAFKSTSKFYPSLC  1024



>ref|XP_009110970.1| PREDICTED: nardilysin-like [Brassica rapa]
Length=1018

 Score =  1283 bits (3321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/896 (68%), Positives = 739/896 (82%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  125   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  184

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQCHTSA GHPFNRF WGNKKSLS A
Sbjct  185   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCHTSAKGHPFNRFSWGNKKSLSGA  244

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD LESWV+ELF  VK G  +  +   
Sbjct  245   MENGVDLRECIMKLYKEYYHGGLMKLVVIGGESLDTLESWVVELFGDVKNGSKIMPTLEA  304

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW+ GKLY LEAVKDVH L+L+WTLP LR  Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  305   KGPIWEGGKLYRLEAVKDVHTLDLTWTLPPLRHAYVKKPEDYLAHLLGHEGKGSLLSFLK  364

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG+ YQYLKLLR+ SPQ
Sbjct  365   GKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYTYQYLKLLRDASPQ  424

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+EN+L YP E ++YGDY Y+ WD ++I D+
Sbjct  425   EWIFKELQDIGNMDFRYAEEQAADDYAAELSENMLAYPVEHIIYGDYVYQTWDSKMIADL  484

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             + FF   NMR+DVV+KS+  S + Q EPWFGSQY+ E +P +L+E W +P E+D SLHLP
Sbjct  485   MSFFTPKNMRIDVVSKSI-KSEEFQTEPWFGSQYIVEDVPLALMETWSNPSEVDKSLHLP  543

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             ++N FIPSDFSIRA +   D    + PKCI+DEPLMKFWYKLD TFK+PRANTYFR+ LK
Sbjct  544   SENQFIPSDFSIRATSSDGDLKSQSPPKCIIDEPLMKFWYKLDETFKVPRANTYFRINLK  603

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKV+GFN K+P L
Sbjct  604   GAYGSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVFGFNEKIPAL  663

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER L+NTNMKPLNH++YLRLQ+LCK  +D EEKL 
Sbjct  664   LSKILAIAKSFIPSLDRFKVIKENMERGLRNTNMKPLNHSTYLRLQLLCKRIYDSEEKLS  723

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P++ SQ++IE LCHGN+ E+EAVNIS+IF +  +V PLP + RH E
Sbjct  724   VLNDLSLTDLNSFIPEVRSQIFIEALCHGNLSEDEAVNISNIFKNSLTVEPLPVKSRHGE  783

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P  A LVRDV VKNK +TNSVVELY+QIEPE      ++KA++DLF EI+EEPLF
Sbjct  784   QITCFPLSAKLVRDVNVKNKSETNSVVELYYQIEPEEAKS-TRMKAVLDLFSEIIEEPLF  842

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GRIDNFI D + +L+ LD+
Sbjct  843   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRIDNFIKDIEGMLEQLDE  902

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SGLI KLLEKDPSL  ETN LW QIVDKRYMFD S+KEAEEL+SI K D+++W
Sbjct  903   ESFEDYRSGLIGKLLEKDPSLLSETNELWSQIVDKRYMFDYSQKEAEELRSIEKKDVMKW  962

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY K+  PK RRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  963   YKTYFKESSPKSRRLAVRVWGCNTNMKETQTDPKSVQVIADAVAFKSTSKFYPSLC  1018



>ref|XP_006417870.1| hypothetical protein EUTSA_v10006660mg [Eutrema salsugineum]
 gb|ESQ36223.1| hypothetical protein EUTSA_v10006660mg [Eutrema salsugineum]
Length=1027

 Score =  1283 bits (3321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/898 (68%), Positives = 748/898 (83%), Gaps = 8/898 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  134   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  193

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ LQND+CRLQQ QC+TSA GHPFNRF WGNKKSLS A
Sbjct  194   VAPLMKTEAMERELLAVDSEFNQALQNDACRLQQFQCYTSAKGHPFNRFSWGNKKSLSGA  253

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  254   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGDVKNGSKIRPTLEA  313

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GKLY LEAV+DVHIL+L+WTLP LR  Y++K+EDYLAHLLGHEG+GSL  FLK
Sbjct  314   KCPIWKGGKLYRLEAVRDVHILDLTWTLPPLRHAYVKKSEDYLAHLLGHEGRGSLHSFLK  373

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG+VYQYLKLLR+V+PQ
Sbjct  374   GKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYVYQYLKLLRDVTPQ  433

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+P D+YAAEL+EN+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  434   EWIFKELQDIGNMDFRYAEEQPADDYAAELSENMLAYPVEHVIYGDYVYQTWDPKMIEDL  493

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+Y EE +P SL+E W +P E+D SLHLP
Sbjct  494   MGFFTPKNMRIDVVSKSI-TSEEFQTEPWFGSRYREEDVPLSLIETWSNPSEVDKSLHLP  552

Query  1617  AKNDFIPSDFSIRADTISCDG----GNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVT  1784
             +KN+FIP DFSIRA  I+ DG     + PKCI+DEP MKFWYKLD TFK+PRANTYFR+ 
Sbjct  553   SKNEFIPCDFSIRA--INSDGETKSPSPPKCIIDEPFMKFWYKLDETFKVPRANTYFRIN  610

Query  1785  LKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLP  1964
             LKGAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P
Sbjct  611   LKGAYDSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIP  670

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEk  2144
              LLSK+LA+  SF P  DRF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EK
Sbjct  671   ALLSKILAIAKSFMPSLDRFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEK  730

Query  2145  lcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRH  2324
             L +LN LSL DL +F+P++ SQ++IE LCHGN+ E+EAVNIS+IF +  +V PLP + RH
Sbjct  731   LSVLNDLSLTDLNSFIPEVRSQIFIEALCHGNLSEDEAVNISNIFKNSLTVEPLPVKRRH  790

Query  2325  KEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEP  2504
              E + C P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+EEP
Sbjct  791   GEQITCFPLSAKLVRDVNVKNKSETNSVVELYYQIEPE-EAQSTRMKAILDLFHEIIEEP  849

Query  2505  LFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNL  2684
             LF++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR+DNFI D + +L+ L
Sbjct  850   LFNQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRVDNFIKDIEGLLEQL  909

Query  2685  DDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLI  2864
             D++S+E+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+I
Sbjct  910   DEESYEDYRSGMIARLLEKDPSLLSETNELWSQIVDKRYMFDFSHKEAEELRSIEKKDVI  969

Query  2865  EWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
              W+ TY ++  PKCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  970   SWFKTYFRESSPKCRRLAVRVWGCNTNMKETQTDHKSVQVIADAVAFKSTSQFYPSLC  1027



>ref|XP_004150605.1| PREDICTED: insulin-degrading enzyme-like [Cucumis sativus]
Length=1022

 Score =  1281 bits (3316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/898 (71%), Positives = 749/898 (83%), Gaps = 5/898 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST++PDENEYDSYLSKHGG SNAYTETEHTCYHFEVK EFL GALKRFSQFF
Sbjct  126   LEHMLFMGSTDYPDENEYDSYLSKHGGFSNAYTETEHTCYHFEVKPEFLKGALKRFSQFF  185

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+DSCRLQQLQC+TS PGHPFNRFFWGNKKSL DA
Sbjct  186   ISPLVKTEAMEREVLAVDSEFNQVLQDDSCRLQQLQCYTSVPGHPFNRFFWGNKKSLVDA  245

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR+QI KL+ D Y+G  MKL +IGGE LDVLESWVLELF  VKKG   K    +
Sbjct  246   MEKGINLRDQILKLFSDYYHGGLMKLTVIGGEPLDVLESWVLELFGDVKKGVQAKPKFTV  305

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW++GKLY LEAV+DVHIL+L+WTLP L+ +YL+K EDY+AHLLGHEG GSL F LK
Sbjct  306   KDPIWQSGKLYKLEAVEDVHILDLAWTLPCLQHNYLKKPEDYVAHLLGHEGNGSLHFSLK  365

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGM RSS+AY+FGMSI+LTDSG +KIFEIIG+VYQYLKLLR++SPQ
Sbjct  366   AKGWATSLSAGVGDEGMCRSSMAYVFGMSIYLTDSGKEKIFEIIGYVYQYLKLLRQISPQ  425

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENL  YP E V+YG+Y Y+IWDE L+K I
Sbjct  426   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLSFYPAEHVIYGEYVYKIWDEDLVKHI  485

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF  +NMRVD+V+KS +   D + EPWFGS Y  + I  SL++LW+DPPEID SLHLP
Sbjct  486   IGFFTPENMRVDIVSKSFSKLEDFKIEPWFGSHYSVDDIAPSLMDLWRDPPEIDASLHLP  545

Query  1617  AKNDFIPSDFSIRADTISCDG---GNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             AKN FIP DFSIRA  + C+      +P CILDEPLMKFWYKLDN+FKLPRANTYF + L
Sbjct  546   AKNQFIPCDFSIRASKV-CNNLPLEYSPICILDEPLMKFWYKLDNSFKLPRANTYFHINL  604

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
              G YS+++N LLTELFVLLLKD+LNEI+YQA++AKLETSV++ GDKLELKV+GFN KLP 
Sbjct  605   SGGYSSVKNYLLTELFVLLLKDKLNEIIYQATIAKLETSVAISGDKLELKVFGFNDKLPN  664

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+LA   +F P +DRF VIKE MER LKNTNMKP +H+SYLRLQVLC+ F+D +EK 
Sbjct  665   LLSKLLATARTFMPSEDRFKVIKEKMERNLKNTNMKPRSHSSYLRLQVLCERFYDADEKS  724

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
              +LN LS  DLKA +P LLSQLYIEGLCHGN  EEEA+++S+IF   FSV PLP  MRH 
Sbjct  725   DVLNDLSFVDLKAHIPKLLSQLYIEGLCHGNFSEEEAISLSNIFKDNFSVQPLPLGMRHY  784

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVG-SELIKLKALVDLFDEIVEEP  2504
             E VMCLP GA+LVRDV VKN+L+ NSV+ELYFQIEPEVG  E I+ KAL+DLFDEI++EP
Sbjct  785   ERVMCLPPGANLVRDVSVKNRLERNSVLELYFQIEPEVGMEESIRQKALIDLFDEIIDEP  844

Query  2505  LFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNL  2684
             L+++LRTKEQLGYVV CSPR TYRI GFCF VQSSEY+PI+LQ R +NFI   +E+L  L
Sbjct  845   LYNQLRTKEQLGYVVQCSPRSTYRIYGFCFSVQSSEYNPIFLQERFENFITGLQELLLGL  904

Query  2685  DDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLI  2864
             D+ SFEN+K+GLI KLLEKDPSL +ETNRLW QIV+KRY FD  +KEAEELK+I+K+++I
Sbjct  905   DEASFENYKNGLIGKLLEKDPSLYHETNRLWSQIVEKRYAFDFLQKEAEELKNIQKNNII  964

Query  2865  EWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             +WY+TYL++  PKCRRL++RVWGC T   D++  ++    IKD  AFK SS FYPS C
Sbjct  965   DWYNTYLQESSPKCRRLAIRVWGCETNMIDAETPVKSVVAIKDVEAFKTSSMFYPSLC  1022



>ref|XP_004165736.1| PREDICTED: LOW QUALITY PROTEIN: insulin-degrading enzyme-like 
[Cucumis sativus]
Length=1022

 Score =  1279 bits (3309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/898 (70%), Positives = 748/898 (83%), Gaps = 5/898 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST++PDENEYDSYLSKHGG SNAYTETEHTCYHFEVK EFL GALKRFSQFF
Sbjct  126   LEHMLFMGSTDYPDENEYDSYLSKHGGFSNAYTETEHTCYHFEVKPEFLKGALKRFSQFF  185

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+DSCRLQQLQC+TS PGHPFNRFFWGNKKSL DA
Sbjct  186   ISPLVKTEAMEREVLAVDSEFNQVLQDDSCRLQQLQCYTSVPGHPFNRFFWGNKKSLVDA  245

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR+QI KL+ D Y+G  MKL +IGGE LDVLESWVLELF  VK G   K    +
Sbjct  246   MEKGINLRDQILKLFSDYYHGGLMKLTVIGGEPLDVLESWVLELFGDVKXGVQAKPKFTV  305

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW++GKLY LEAV+DVHIL+L+WTLP L+ +YL+K EDY+AHLLGHEG GSL F LK
Sbjct  306   KDPIWQSGKLYKLEAVEDVHILDLAWTLPCLQHNYLKKPEDYVAHLLGHEGNGSLHFSLK  365

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGM RSS+AY+FGMSI+LTDSG +KIFEIIG+VYQYLKLLR++SPQ
Sbjct  366   AKGWATSLSAGVGDEGMCRSSMAYVFGMSIYLTDSGKEKIFEIIGYVYQYLKLLRQISPQ  425

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M+FRF EE+PQD+YAAELAENL  YP E V+YG+Y Y+IWDE L+K I
Sbjct  426   EWIFRELQDIGNMDFRFAEEQPQDDYAAELAENLSFYPAEHVIYGEYVYKIWDEDLVKHI  485

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF  +NMRVD+V+KS +   D + EPWFGS Y  + I  SL++LW+DPPEID SLHLP
Sbjct  486   IGFFTPENMRVDIVSKSFSKLEDFKIEPWFGSHYSVDDIAPSLMDLWRDPPEIDASLHLP  545

Query  1617  AKNDFIPSDFSIRADTISCDG---GNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             AKN FIP DFSIRA  + C+      +P CILDEPLMKFWYKLDN+FKLPRANTYF + L
Sbjct  546   AKNQFIPCDFSIRASKV-CNNLPLEYSPICILDEPLMKFWYKLDNSFKLPRANTYFHINL  604

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
              G YS+++N LLTELFVLLLKD+LNEI+YQA++AKLETSV++ GDKLELKV+GFN KLP 
Sbjct  605   SGGYSSVKNYLLTELFVLLLKDKLNEIIYQATIAKLETSVAISGDKLELKVFGFNDKLPN  664

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+LA   +F P +DRF VIKE MER LKNTNMKP +H+SYLRLQVLC+ F+D +EK 
Sbjct  665   LLSKLLATARTFMPSEDRFKVIKEKMERNLKNTNMKPRSHSSYLRLQVLCERFYDADEKS  724

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
              +LN LS  DLKA +P LLSQLYIEGLCHGN  EEEA+++S+IF   FSV PLP  MRH 
Sbjct  725   DVLNDLSFVDLKAHIPKLLSQLYIEGLCHGNFSEEEAISLSNIFKDNFSVQPLPLGMRHY  784

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVG-SELIKLKALVDLFDEIVEEP  2504
             E VMCLP GA+LVRDV VKN+L+ NSV+ELYFQIEPEVG  E I+ KAL+DLFDEI++EP
Sbjct  785   ERVMCLPPGANLVRDVSVKNRLERNSVLELYFQIEPEVGMEESIRQKALIDLFDEIIDEP  844

Query  2505  LFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNL  2684
             L+++LRTKEQLGYVV CSPR TYRI GFCF VQSSEY+PI+LQ R +NFI   +E+L  L
Sbjct  845   LYNQLRTKEQLGYVVQCSPRSTYRIYGFCFSVQSSEYNPIFLQERFENFITGLQELLLGL  904

Query  2685  DDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLI  2864
             D+ SFEN+K+GLI KLLEKDPSL +ETNRLW QIV+KRY FD  +KEAEELK+I+K+++I
Sbjct  905   DEASFENYKNGLIGKLLEKDPSLYHETNRLWSQIVEKRYAFDFLQKEAEELKNIQKNNII  964

Query  2865  EWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             +WY+TYL++  PKCRRL++RVWGC T   D++  ++    IKD  AFK SS FYPS C
Sbjct  965   DWYNTYLQESSPKCRRLAIRVWGCETNMIDAETPVKSVVAIKDVEAFKTSSMFYPSLC  1022



>ref|XP_010253097.1| PREDICTED: insulin-degrading enzyme isoform X2 [Nelumbo nucifera]
Length=940

 Score =  1275 bits (3300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/879 (70%), Positives = 742/879 (84%), Gaps = 4/879 (0%)
 Frame = +3

Query  411   DSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVD  590
             +SYLSK GGSSNAYTETEHTCYHFEVKREFL GAL+RFSQFF+SPLVK EAMERE+LAVD
Sbjct  63    NSYLSKRGGSSNAYTETEHTCYHFEVKREFLKGALERFSQFFISPLVKVEAMEREILAVD  122

Query  591   SEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDN  770
             SEFNQVLQND+CRLQQLQC+TS+ GHPFNRFFWGNKKSL DA ERGVNLREQI  LY +N
Sbjct  123   SEFNQVLQNDACRLQQLQCYTSSQGHPFNRFFWGNKKSLVDAMERGVNLREQILHLYREN  182

Query  771   YYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKD  950
             Y+G  MKLV+IGGE+LDVL++WV+ELFS V+ G  +K   + E PIWKAG++Y LEAVKD
Sbjct  183   YHGGLMKLVVIGGESLDVLQNWVVELFSDVRDGPRLKPDYQKEGPIWKAGRIYRLEAVKD  242

Query  951   VHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMH  1130
             VHIL L+WTLP L  +Y+ K EDYLAHL+GHEG+GSLLFFLK KGW +S+SAGVGDEGM+
Sbjct  243   VHILNLTWTLPCLHNEYMAKPEDYLAHLMGHEGRGSLLFFLKAKGWASSLSAGVGDEGMN  302

Query  1131  RSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFI  1310
             RSS+AYIFG+SIHLTDSGL+K++E+IG VYQYLKLLRE +PQEWIFKELQDIG MEFRF 
Sbjct  303   RSSVAYIFGISIHLTDSGLEKVYEVIGVVYQYLKLLREAAPQEWIFKELQDIGNMEFRFA  362

Query  1311  EEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSL  1490
             EE+PQD+YAAELAENLLVYP + V+YGD+AYE+WDE+LI  IL FF  +NMRVD ++KS 
Sbjct  363   EEQPQDDYAAELAENLLVYPEKHVIYGDFAYELWDEKLIMHILSFFTPENMRVDTLSKSF  422

Query  1491  NNSS-DVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTI  1667
                S D + EPWFGSQY EE I  + LELW+DPPEID +LH+P KNDFIP DFSIR++  
Sbjct  423   YKQSLDFKYEPWFGSQYTEEEILPTHLELWRDPPEIDPALHMPVKNDFIPRDFSIRSNGS  482

Query  1668  SCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVL  1841
             S +  N   P+CILD+PL+KFWYKLD TFKLPRANTYF +T+KG Y++++  +LTELFV 
Sbjct  483   SNNLANTHFPRCILDQPLIKFWYKLDETFKLPRANTYFLITVKGGYADVKRCVLTELFVN  542

Query  1842  LLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDR  2021
             LLKD+LNE++YQA VAKLETS+S+  DK+ELKVYGFN KLP+L+SK+L V   F P  DR
Sbjct  543   LLKDDLNEVLYQAGVAKLETSLSIISDKIELKVYGFNDKLPILVSKILTVARKFCPTADR  602

Query  2022  FLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDL  2201
             F VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL  L  LSLADL+AF+P+L
Sbjct  603   FKVIKEDMERAFRNANMKPLSHSSYLRLQVLREIFWDVDDKLACLVYLSLADLEAFIPEL  662

Query  2202  LSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQV  2381
             LSQL+IEGLCHGN+ EEEA+NI  IF   F+V PLP EM H+E V+C PSGA+ VRDV V
Sbjct  663   LSQLHIEGLCHGNLTEEEAINIMDIFRKNFTV-PLPVEMWHEERVICFPSGANFVRDVPV  721

Query  2382  KNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSP  2561
             KNKL+TNSVVELYFQIE +VG E  +L+AL DLFD+I+EEPLFD+LRTKEQLGYVV+CSP
Sbjct  722   KNKLETNSVVELYFQIEQDVGVEATRLRALADLFDDIIEEPLFDQLRTKEQLGYVVECSP  781

Query  2562  RVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEK  2741
             R+TY +LGFCF VQSS+Y P+YLQ RID+FI+  +E+LD +DD++FEN++SGLIAK LEK
Sbjct  782   RITYCVLGFCFCVQSSKYSPLYLQERIDSFIDGLQELLDKIDDEAFENYRSGLIAKKLEK  841

Query  2742  DPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSV  2921
             DPSL+YETN LWGQIVDKRY+FD+S KEAEEL+SI+KSD+I+WY+ YL+   PKCRRL +
Sbjct  842   DPSLAYETNHLWGQIVDKRYLFDMSAKEAEELRSIKKSDVIDWYNRYLRLSSPKCRRLVI  901

Query  2922  RVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             R+WGCNT  +++    +  KVI++  AFK S+ FYPS C
Sbjct  902   RLWGCNTNMQENATQGKSVKVIEELAAFKTSAAFYPSLC  940



>ref|XP_006303778.1| hypothetical protein CARUB_v10012025mg [Capsella rubella]
 gb|EOA36676.1| hypothetical protein CARUB_v10012025mg [Capsella rubella]
Length=1025

 Score =  1274 bits (3297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/896 (68%), Positives = 744/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGG+SNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  132   LEHMLFMGSTEFPDENEYDSYLSKHGGASNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  191

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREV+AVDSEFNQ LQND+CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  192   VAPLMKTEAMEREVIAVDSEFNQALQNDACRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  251

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  252   IENGVDLRECIMKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGGVKNGSKIRPTLEA  311

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  312   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  371

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG+VYQYLKLLR+VSPQ
Sbjct  372   SRGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYVYQYLKLLRDVSPQ  431

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +WIFKELQDIG M+FRF EE+P D+YAAEL+ENLL YP E V+YGDY Y+ WD +LI+D+
Sbjct  432   KWIFKELQDIGNMDFRFAEEQPADDYAAELSENLLAYPVEHVIYGDYVYQTWDPKLIEDL  491

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS   S + Q EPWFGS+Y+EE +P S++E W +P E+D SLHLP
Sbjct  492   MGFFTPKNMRIDVVSKSF-KSEEFQQEPWFGSRYIEEDVPLSMMETWTNPSEVDKSLHLP  550

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ LK
Sbjct  551   SKNQFIPCDFSIRAINSDVDPKTQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLK  610

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  611   GAYASVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  670

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L +  SF P  +RF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  671   LSKILTIAKSFMPSLERFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  730

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L  Q++IE LCHGN+ E+EAVNIS+IF +  +V PLP++ RH E
Sbjct  731   VLNDLSLDDLNSFIPELRCQIFIEALCHGNLSEDEAVNISNIFKNSLTVEPLPSKCRHGE  790

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P  A LVRDV VKNK +TNSVVELY+QI PE  ++  ++KA++DLF EI+EEPLF
Sbjct  791   QITCFPVSAKLVRDVNVKNKSETNSVVELYYQIGPE-EAQSTRMKAVLDLFHEIIEEPLF  849

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR+DNFI + + +L+ LD+
Sbjct  850   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRVDNFIKEIEGLLEQLDE  909

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI+K D+I+W
Sbjct  910   ESFEDYRSGMIARLLEKDPSLLSETNELWSQIVDKRYMFDFSHKEAEELRSIQKKDVIKW  969

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++    CRRL+VRVWGC+T  K+S    +  +VI D  AFK +S+FYPS C
Sbjct  970   YKTYFRESSRNCRRLAVRVWGCDTNMKESQTDEKSVQVIADAVAFKSTSQFYPSLC  1025



>gb|KFK43001.1| hypothetical protein AALP_AA1G066600 [Arabis alpina]
Length=1083

 Score =  1272 bits (3292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/896 (68%), Positives = 740/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  190   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  249

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K+EAMEREVLAVDSEFNQ LQND+CRLQQ QC+TSA GHP NRF WGNKKSLS A
Sbjct  250   VAPLMKSEAMEREVLAVDSEFNQALQNDACRLQQFQCYTSAKGHPLNRFAWGNKKSLSGA  309

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE+I  LY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G   + +   
Sbjct  310   IENGVDLRERIMNLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGNVKNGSKTRPTLEA  369

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDV+IL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSLL FLK
Sbjct  370   EGPIWKGGKLYRLEAVKDVNILDLAWTLPPLRHAYVKKTEDYLAHLLGHEGRGSLLSFLK  429

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVG++G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+VSPQ
Sbjct  430   AKGWATSLSAGVGEDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQ  489

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+P D+YA+EL+EN+LVYP E V+YGDY Y+ WD ++I+D+
Sbjct  490   EWIFKELQDIGNMDFRYAEEQPADDYASELSENMLVYPVEHVIYGDYVYQTWDPKMIEDL  549

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             + FF   NMR+DVV+KS+  S + Q EPWFGS+++EE +P SL+E W +P E+D SLHLP
Sbjct  550   MDFFTPKNMRIDVVSKSI-KSEEFQHEPWFGSRFIEEDVPLSLMETWSNPSEVDTSLHLP  608

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANT FR+ LK
Sbjct  609   SKNEFIPCDFSIRAINADVDPKSPSPPRCIIDEPFMKFWYKLDETFKVPRANTCFRINLK  668

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNE +YQAS+AKLETS+S+Y DKLELKVYGFN K+P L
Sbjct  669   GAYDSVKNCLLTELFINLLKDELNETIYQASMAKLETSLSMYNDKLELKVYGFNEKIPAL  728

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             L+K+LA   SF P  DRF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  729   LTKILAKAKSFMPSLDRFKVIKENMERGFRNTNMKPLNHSAYLRLQLLCKQIYDSDEKLS  788

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P++ SQ++IE LCHGN+ E+EAVNIS+IF +  +V PLP + RH E
Sbjct  789   VLNDLSLTDLNSFIPEVRSQIFIEALCHGNLSEDEAVNISNIFKTSLTVEPLPRKCRHGE  848

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P    LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KAL+DLF EI+EEPLF
Sbjct  849   QITCFPLSGKLVRDVNVKNKSETNSVVELYYQIEPE-ETQSTRMKALLDLFHEIIEEPLF  907

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV C PR+TYRI GFCF VQSS+Y P++L GR+DNFI D +++L  LD+
Sbjct  908   NQLRTKEQLGYVVQCGPRLTYRIHGFCFCVQSSKYGPVHLLGRVDNFIKDIEKLLKQLDN  967

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SG+IAKLLEKDPSL  ETN LW +IVDKRYMFD S KEAEELK+I+K D+I W
Sbjct  968   ESFEDYRSGMIAKLLEKDPSLLSETNELWSEIVDKRYMFDYSHKEAEELKTIQKKDVINW  1027

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY K+  PKCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  1028  YKTYFKESSPKCRRLAVRVWGCNTNMKETQTDQKSVQVIADAVAFKSTSQFYPSLC  1083



>ref|XP_009119013.1| PREDICTED: insulin-degrading enzyme-like isoform X3 [Brassica 
rapa]
Length=1061

 Score =  1264 bits (3271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/896 (68%), Positives = 734/896 (82%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  168   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  227

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ LQND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  228   VAPLMKTEAMERELLAVDSEFNQALQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  287

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE LD+LESWV ELF  VK G  ++ +   
Sbjct  288   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGEPLDLLESWVAELFGDVKNGSKIRPTLVA  347

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLY LEAV+DVH L L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  348   EGPIWEGGKLYRLEAVRDVHTLNLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  407

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KG +TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+ SPQ
Sbjct  408   VKGLITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDASPQ  467

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  468   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  527

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D SLHLP
Sbjct  528   MGFFTPKNMRIDVVSKSV-KSEEFQTEPWFGSRYVEEDVPLTLMETWSNPSEVDTSLHLP  586

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK+PRANTYFR+ LK
Sbjct  587   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFKVPRANTYFRINLK  646

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  647   GAYDSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  706

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +N+NMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  707   LSKILAIAKSFMPSLDRFKVIKENMERGFRNSNMKPLNHSTYLRLQLLCKRIYDSDEKLS  766

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL +F+  + SQ+YIE LCHGN+ E+E VNIS+IF +  +V PLP + RH E
Sbjct  767   VLNDLSLADLNSFISVVRSQIYIEALCHGNLSEDETVNISNIFKNSLTVEPLPVKCRHGE  826

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +MC P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  827   QIMCFPLNAKLVRDVTVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  885

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  886   NQLRTKEQLGYVVECGPRLTYRVQGFCFCVQSSKYGPIHLLERVDNFIKDIEALLEQLDE  945

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  946   DSFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  1005

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++   KCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  1006  YKTYFRESSRKCRRLAVRVWGCNTDMKETQTDPKSMQVIADAVAFKSTSKFYPSLC  1061



>ref|XP_008782651.1| PREDICTED: nardilysin [Phoenix dactylifera]
Length=1037

 Score =  1264 bits (3270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/898 (69%), Positives = 751/898 (84%), Gaps = 4/898 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEV RE+L GALKRFSQFF
Sbjct  140   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVNREYLKGALKRFSQFF  199

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEFNQVLQ+DSCRL QL CHTS PGHPFNRFFWGNKKSL DA
Sbjct  200   ISPLVKAEAMEREVLAVDSEFNQVLQSDSCRLLQLHCHTSVPGHPFNRFFWGNKKSLIDA  259

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+ LRE+I ++Y +NY+G  MKLV+IGGE LDVLE WV+ELFS VK G  +K S+++
Sbjct  260   MEHGIKLREEILQMYRENYHGGMMKLVVIGGEPLDVLEGWVVELFSNVKTGHPLKMSTKI  319

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GK+Y LEAVKDVH+LEL+W LP L K+YL+K EDYLAHL+GHEG+GSLL+FLK
Sbjct  320   DIPIWKEGKIYKLEAVKDVHMLELTWKLPCLHKEYLKKPEDYLAHLMGHEGRGSLLYFLK  379

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+S+GVGDEGM RSSIAYIF MSIHLTDSGL+ ++E+IGFVYQY+KLLR+ +PQ
Sbjct  380   AKGWATSLSSGVGDEGMRRSSIAYIFIMSIHLTDSGLEMLYEVIGFVYQYIKLLRQSTPQ  439

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EW+FKELQDIG MEFRF EE+PQD+YAAELAENLL+Y  E ++YG+YA+E+WD +L++ +
Sbjct  440   EWMFKELQDIGNMEFRFAEEQPQDDYAAELAENLLLYSEEHIIYGEYAFELWDPELVEHV  499

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMR+D+++KS +  S+ +Q EPWFGS+Y+EE I  SLL+LW +PPEI+  LHL
Sbjct  500   LSFFTPENMRIDILSKSFDKHSEAIQYEPWFGSRYIEEDISPSLLKLWSNPPEINQHLHL  559

Query  1614  PAKNDFIPSDFSIRADTIS--CDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+FIP  FS+ +  IS      N PKC+++ PLMK WYK+D TF +PRANTYF +T+
Sbjct  560   PLKNEFIPHVFSLCSANISKCLLDTNHPKCVVNHPLMKLWYKIDLTFNVPRANTYFLITV  619

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K  Y++++N +LTELFV LLKDELNEI+YQA VAKLETS+S+ GDKLELK+YGFN KL +
Sbjct  620   KDGYNSVKNCVLTELFVNLLKDELNEILYQAGVAKLETSLSIVGDKLELKLYGFNDKLSL  679

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L ++ SFSP  +RF VIKEDMER  +NTNMKPL+H+SYLRLQVL +SFWDV++KL
Sbjct  680   LLSKILTLSRSFSPNVERFKVIKEDMERAFRNTNMKPLSHSSYLRLQVLRESFWDVDDKL  739

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L +LSL+DL+AFLP+LLSQL+IEGLCHGN+LEEEA+NIS+IFT+ FSV PLPAE RH+
Sbjct  740   SCLVNLSLSDLEAFLPNLLSQLHIEGLCHGNLLEEEAINISNIFTNIFSVEPLPAEFRHQ  799

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPSGA L+R V+VKN L+ NSVVELYFQIE +VG E  KL+A+ DLF  IVEEP 
Sbjct  800   ERVLCLPSGASLIRSVRVKNDLEVNSVVELYFQIEQDVGMEATKLRAITDLFSHIVEEPC  859

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV C PR+TYR+LGFCFRVQSSEY PIYL  RID FI+  +E LD LD
Sbjct  860   FDQLRTKEQLGYVVHCGPRMTYRVLGFCFRVQSSEYSPIYLHDRIDTFISGLQEFLDKLD  919

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D+SFEN ++GLIA+ LEKDPSL+YET   W QIV+KRY+FD+ + EAEELK+I+KSD+I 
Sbjct  920   DESFENHRNGLIAEKLEKDPSLTYETGHYWSQIVEKRYLFDMLKVEAEELKTIQKSDVIN  979

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL+ P  KCR+L+V VWGCNT   +     E   KVI+D  + K SSEFYPS C
Sbjct  980   WYKTYLRLPSSKCRQLAVHVWGCNTNFNEELKMQEKFGKVIEDIDSLKMSSEFYPSLC  1037



>ref|XP_010457845.1| PREDICTED: insulin-degrading enzyme-like isoform X1 [Camelina 
sativa]
Length=1090

 Score =  1263 bits (3269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/896 (67%), Positives = 742/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGG+SNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  197   LEHMLFMGSSEFPDENEYDSYLSKHGGASNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  256

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QND CRLQQLQC+TSA GHPFNRF WGNKKSLS +
Sbjct  257   VAPLMKTEAMERELLAVDSEFNQTIQNDLCRLQQLQCYTSAKGHPFNRFAWGNKKSLSGS  316

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  317   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGAVKNGSKIRPTLEA  376

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  377   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  436

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+K+++IIG+VYQYLKLLR+VSPQ
Sbjct  437   GRGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKVYDIIGYVYQYLKLLRDVSPQ  496

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+F+F EE+  D+YA EL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  497   EWIFKELQDIGNMDFKFAEEQAADDYAVELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  556

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+Y+EE +P SL+E W +P E+D SLHLP
Sbjct  557   MGFFTPKNMRIDVVSKSI-KSEEFQQEPWFGSRYIEEDVPLSLMETWTNPSEVDASLHLP  615

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ L 
Sbjct  616   SKNQFIPCDFSIRAINSDVDPKTQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLN  675

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+ GDKLELKVYGFN K+P L
Sbjct  676   GAYASVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMSGDKLELKVYGFNEKIPAL  735

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L +  SF P  +RF VIKE+MER L+NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  736   LSKILTIAKSFMPSLERFKVIKENMERGLRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  795

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L SQ+++E LCHGN+ E+EAVNIS+IF    +V PLP++ RH E
Sbjct  796   VLNDLSLDDLNSFIPELRSQIFMEALCHGNLSEDEAVNISNIFKKSLTVEPLPSKCRHGE  855

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +   P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF+EI+EEPLF
Sbjct  856   QITRFPVSAKLVRDVSVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFNEIIEEPLF  914

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV C+PR+TYR+ GFCF VQSS+Y P++L GR+DNFI + + +L+ LD+
Sbjct  915   NQLRTKEQLGYVVQCAPRLTYRVHGFCFSVQSSKYGPVHLLGRVDNFIKEIEGLLEQLDE  974

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S K AEEL++I+K D+I+W
Sbjct  975   ESFEDYRSGVIARLLEKDPSLLSETNELWSQIVDKRYMFDFSHKVAEELRNIQKKDVIKW  1034

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGC+T  K+S    +  +VI D  AFK +++FYPS C
Sbjct  1035  YKTYFRESSPKCRRLAVRVWGCDTNMKESQTDEKSVQVIADAVAFKSTTQFYPSLC  1090



>ref|XP_010457846.1| PREDICTED: insulin-degrading enzyme-like isoform X2 [Camelina 
sativa]
Length=1089

 Score =  1263 bits (3268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/896 (67%), Positives = 742/896 (83%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGG+SNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  196   LEHMLFMGSSEFPDENEYDSYLSKHGGASNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  255

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QND CRLQQLQC+TSA GHPFNRF WGNKKSLS +
Sbjct  256   VAPLMKTEAMERELLAVDSEFNQTIQNDLCRLQQLQCYTSAKGHPFNRFAWGNKKSLSGS  315

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  316   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGAVKNGSKIRPTLEA  375

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  376   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  435

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+K+++IIG+VYQYLKLLR+VSPQ
Sbjct  436   GRGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKVYDIIGYVYQYLKLLRDVSPQ  495

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+F+F EE+  D+YA EL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  496   EWIFKELQDIGNMDFKFAEEQAADDYAVELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  555

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+Y+EE +P SL+E W +P E+D SLHLP
Sbjct  556   MGFFTPKNMRIDVVSKSI-KSEEFQQEPWFGSRYIEEDVPLSLMETWTNPSEVDASLHLP  614

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ L 
Sbjct  615   SKNQFIPCDFSIRAINSDVDPKTQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLN  674

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY++++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+ GDKLELKVYGFN K+P L
Sbjct  675   GAYASVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMSGDKLELKVYGFNEKIPAL  734

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L +  SF P  +RF VIKE+MER L+NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  735   LSKILTIAKSFMPSLERFKVIKENMERGLRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  794

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P+L SQ+++E LCHGN+ E+EAVNIS+IF    +V PLP++ RH E
Sbjct  795   VLNDLSLDDLNSFIPELRSQIFMEALCHGNLSEDEAVNISNIFKKSLTVEPLPSKCRHGE  854

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +   P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF+EI+EEPLF
Sbjct  855   QITRFPVSAKLVRDVSVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFNEIIEEPLF  913

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV C+PR+TYR+ GFCF VQSS+Y P++L GR+DNFI + + +L+ LD+
Sbjct  914   NQLRTKEQLGYVVQCAPRLTYRVHGFCFSVQSSKYGPVHLLGRVDNFIKEIEGLLEQLDE  973

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S K AEEL++I+K D+I+W
Sbjct  974   ESFEDYRSGVIARLLEKDPSLLSETNELWSQIVDKRYMFDFSHKVAEELRNIQKKDVIKW  1033

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGC+T  K+S    +  +VI D  AFK +++FYPS C
Sbjct  1034  YKTYFRESSPKCRRLAVRVWGCDTNMKESQTDEKSVQVIADAVAFKSTTQFYPSLC  1089



>ref|XP_009119014.1| PREDICTED: nardilysin-like isoform X4 [Brassica rapa]
 ref|XP_009119015.1| PREDICTED: nardilysin-like isoform X4 [Brassica rapa]
Length=1022

 Score =  1263 bits (3268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/896 (68%), Positives = 734/896 (82%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  129   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  188

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ LQND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  189   VAPLMKTEAMERELLAVDSEFNQALQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  248

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE LD+LESWV ELF  VK G  ++ +   
Sbjct  249   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGEPLDLLESWVAELFGDVKNGSKIRPTLVA  308

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLY LEAV+DVH L L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  309   EGPIWEGGKLYRLEAVRDVHTLNLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  368

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KG +TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+ SPQ
Sbjct  369   VKGLITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDASPQ  428

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  429   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  488

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D SLHLP
Sbjct  489   MGFFTPKNMRIDVVSKSV-KSEEFQTEPWFGSRYVEEDVPLTLMETWSNPSEVDTSLHLP  547

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK+PRANTYFR+ LK
Sbjct  548   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFKVPRANTYFRINLK  607

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  608   GAYDSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  667

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +N+NMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  668   LSKILAIAKSFMPSLDRFKVIKENMERGFRNSNMKPLNHSTYLRLQLLCKRIYDSDEKLS  727

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL +F+  + SQ+YIE LCHGN+ E+E VNIS+IF +  +V PLP + RH E
Sbjct  728   VLNDLSLADLNSFISVVRSQIYIEALCHGNLSEDETVNISNIFKNSLTVEPLPVKCRHGE  787

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +MC P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  788   QIMCFPLNAKLVRDVTVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  846

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  847   NQLRTKEQLGYVVECGPRLTYRVQGFCFCVQSSKYGPIHLLERVDNFIKDIEALLEQLDE  906

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  907   DSFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  966

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++   KCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  967   YKTYFRESSRKCRRLAVRVWGCNTDMKETQTDPKSMQVIADAVAFKSTSKFYPSLC  1022



>ref|XP_009119011.1| PREDICTED: insulin-degrading enzyme-like isoform X1 [Brassica 
rapa]
Length=1085

 Score =  1263 bits (3268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/896 (68%), Positives = 734/896 (82%), Gaps = 4/896 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  192   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  251

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ LQND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  252   VAPLMKTEAMERELLAVDSEFNQALQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  311

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE LD+LESWV ELF  VK G  ++ +   
Sbjct  312   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGEPLDLLESWVAELFGDVKNGSKIRPTLVA  371

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLY LEAV+DVH L L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  372   EGPIWEGGKLYRLEAVRDVHTLNLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  431

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KG +TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+ SPQ
Sbjct  432   VKGLITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDASPQ  491

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  492   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  551

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D SLHLP
Sbjct  552   MGFFTPKNMRIDVVSKSV-KSEEFQTEPWFGSRYVEEDVPLTLMETWSNPSEVDTSLHLP  610

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK+PRANTYFR+ LK
Sbjct  611   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFKVPRANTYFRINLK  670

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  671   GAYDSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  730

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +N+NMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  731   LSKILAIAKSFMPSLDRFKVIKENMERGFRNSNMKPLNHSTYLRLQLLCKRIYDSDEKLS  790

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL +F+  + SQ+YIE LCHGN+ E+E VNIS+IF +  +V PLP + RH E
Sbjct  791   VLNDLSLADLNSFISVVRSQIYIEALCHGNLSEDETVNISNIFKNSLTVEPLPVKCRHGE  850

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +MC P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  851   QIMCFPLNAKLVRDVTVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  909

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  910   NQLRTKEQLGYVVECGPRLTYRVQGFCFCVQSSKYGPIHLLERVDNFIKDIEALLEQLDE  969

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  970   DSFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  1029

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++   KCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  1030  YKTYFRESSRKCRRLAVRVWGCNTDMKETQTDPKSMQVIADAVAFKSTSKFYPSLC  1085



>ref|XP_010921136.1| PREDICTED: nardilysin isoform X1 [Elaeis guineensis]
Length=1035

 Score =  1246 bits (3224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/898 (68%), Positives = 743/898 (83%), Gaps = 4/898 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+ FPDENEYDSYLSKHGGSSNAYTETE+TCYHFEV RE L GALKRFSQFF
Sbjct  138   LEHMLFMGSSRFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVNREHLMGALKRFSQFF  197

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEFNQVLQ+DSCRL QL CHTS PGHPFNRF WGNKKSL DA
Sbjct  198   ISPLVKAEAMEREVLAVDSEFNQVLQSDSCRLFQLHCHTSIPGHPFNRFTWGNKKSLIDA  257

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLRE+I ++Y DNY+G  MKLV+IGGE LD+LE WV+ELFS VK G  +K S+R+
Sbjct  258   MENGINLREEILQMYRDNYHGGMMKLVVIGGEPLDILEGWVVELFSDVKTGPPLKMSTRI  317

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GK+Y LEAVKDVHILEL+W LP L K+YL+K EDYLAHLLGHEG+GSLL+F K
Sbjct  318   DIPIWKVGKIYRLEAVKDVHILELTWKLPCLHKEYLKKPEDYLAHLLGHEGRGSLLYFFK  377

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGM RSSIAYIF MSIHLTDSGL+ ++E+IGFVYQY+KLLR+ +PQ
Sbjct  378   AKGWATSLSAGVGDEGMRRSSIAYIFVMSIHLTDSGLEMLYEVIGFVYQYIKLLRQSTPQ  437

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLL+Y  E +++G+Y +E+WD +L++ +
Sbjct  438   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLLYSEEHIIFGEYVFELWDPELVEHV  497

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMR+D+++KS +  S+ +Q EPWFGS+Y+EE I  SLL+LW DPPEI   LHL
Sbjct  498   LSFFTPENMRIDILSKSFDKHSEAIQYEPWFGSRYIEEDISPSLLKLWSDPPEIHQHLHL  557

Query  1614  PAKNDFIPSDFSIRADTIS--CDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+FIP  FS+    IS      N PKCI+++PLMK WYK+D TF +PRANTYF +T+
Sbjct  558   PLKNEFIPRVFSLCNSNISKCLLDTNHPKCIMNQPLMKVWYKIDLTFNVPRANTYFLITV  617

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K  Y++++N +LTELFV LLKDELNEI+YQA VAKLETS+S+ G+KLELK+YGFN KL +
Sbjct  618   KDGYNSVKNCVLTELFVNLLKDELNEILYQAGVAKLETSLSIVGNKLELKLYGFNDKLSL  677

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L ++ SF P  +RF VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL
Sbjct  678   LLSKILTLSRSFFPNVERFKVIKEDMERAFRNCNMKPLSHSSYLRLQVLREKFWDVDDKL  737

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
                 +LSL+DL+AF+P+LLSQL+IEGLCHGN+LEEEA+NIS+IFT+ FSV PL AE RH+
Sbjct  738   SCFVNLSLSDLEAFIPNLLSQLHIEGLCHGNLLEEEAINISNIFTNIFSVEPLAAEFRHQ  797

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPSGA L+R V+VKN L+ NSVVELYFQIE +VG E  KL+A+ DLF +IVEEP 
Sbjct  798   ERVLCLPSGASLIRSVRVKNDLEVNSVVELYFQIEQDVGMEANKLRAITDLFSDIVEEPC  857

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV C PR+TYR+LGFCF VQSSEY PIYL  RIDNFI+  +E+LD LD
Sbjct  858   FDQLRTKEQLGYVVQCGPRMTYRVLGFCFLVQSSEYSPIYLHDRIDNFISGLQELLDKLD  917

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D+SFEN ++GLIA+ LEK PSL+YET   W QIV KRY+FD+ + EAEELK+I+KSD+I 
Sbjct  918   DESFENHRNGLIAEKLEKFPSLAYETGDHWSQIVAKRYLFDMLKVEAEELKTIQKSDVIN  977

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL+ P PKCR+L+V VWGCNT   +     E   +VI+D  +FK SSEFYPS C
Sbjct  978   WYKTYLRPPSPKCRQLAVHVWGCNTNFNEELKLQEKFGQVIEDVDSFKMSSEFYPSLC  1035



>ref|XP_010921138.1| PREDICTED: insulin-degrading enzyme isoform X3 [Elaeis guineensis]
Length=901

 Score =  1244 bits (3218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/898 (68%), Positives = 742/898 (83%), Gaps = 4/898 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
              +HMLFMGS+ FPDENEYDSYLSKHGGSSNAYTETE+TCYHFEV RE L GALKRFSQFF
Sbjct  4     TKHMLFMGSSRFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVNREHLMGALKRFSQFF  63

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEFNQVLQ+DSCRL QL CHTS PGHPFNRF WGNKKSL DA
Sbjct  64    ISPLVKAEAMEREVLAVDSEFNQVLQSDSCRLFQLHCHTSIPGHPFNRFTWGNKKSLIDA  123

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLRE+I ++Y DNY+G  MKLV+IGGE LD+LE WV+ELFS VK G  +K S+R+
Sbjct  124   MENGINLREEILQMYRDNYHGGMMKLVVIGGEPLDILEGWVVELFSDVKTGPPLKMSTRI  183

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GK+Y LEAVKDVHILEL+W LP L K+YL+K EDYLAHLLGHEG+GSLL+F K
Sbjct  184   DIPIWKVGKIYRLEAVKDVHILELTWKLPCLHKEYLKKPEDYLAHLLGHEGRGSLLYFFK  243

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGM RSSIAYIF MSIHLTDSGL+ ++E+IGFVYQY+KLLR+ +PQ
Sbjct  244   AKGWATSLSAGVGDEGMRRSSIAYIFVMSIHLTDSGLEMLYEVIGFVYQYIKLLRQSTPQ  303

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLL+Y  E +++G+Y +E+WD +L++ +
Sbjct  304   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLLYSEEHIIFGEYVFELWDPELVEHV  363

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMR+D+++KS +  S+ +Q EPWFGS+Y+EE I  SLL+LW DPPEI   LHL
Sbjct  364   LSFFTPENMRIDILSKSFDKHSEAIQYEPWFGSRYIEEDISPSLLKLWSDPPEIHQHLHL  423

Query  1614  PAKNDFIPSDFSIRADTIS--CDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+FIP  FS+    IS      N PKCI+++PLMK WYK+D TF +PRANTYF +T+
Sbjct  424   PLKNEFIPRVFSLCNSNISKCLLDTNHPKCIMNQPLMKVWYKIDLTFNVPRANTYFLITV  483

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K  Y++++N +LTELFV LLKDELNEI+YQA VAKLETS+S+ G+KLELK+YGFN KL +
Sbjct  484   KDGYNSVKNCVLTELFVNLLKDELNEILYQAGVAKLETSLSIVGNKLELKLYGFNDKLSL  543

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L ++ SF P  +RF VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL
Sbjct  544   LLSKILTLSRSFFPNVERFKVIKEDMERAFRNCNMKPLSHSSYLRLQVLREKFWDVDDKL  603

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
                 +LSL+DL+AF+P+LLSQL+IEGLCHGN+LEEEA+NIS+IFT+ FSV PL AE RH+
Sbjct  604   SCFVNLSLSDLEAFIPNLLSQLHIEGLCHGNLLEEEAINISNIFTNIFSVEPLAAEFRHQ  663

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPSGA L+R V+VKN L+ NSVVELYFQIE +VG E  KL+A+ DLF +IVEEP 
Sbjct  664   ERVLCLPSGASLIRSVRVKNDLEVNSVVELYFQIEQDVGMEANKLRAITDLFSDIVEEPC  723

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV C PR+TYR+LGFCF VQSSEY PIYL  RIDNFI+  +E+LD LD
Sbjct  724   FDQLRTKEQLGYVVQCGPRMTYRVLGFCFLVQSSEYSPIYLHDRIDNFISGLQELLDKLD  783

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D+SFEN ++GLIA+ LEK PSL+YET   W QIV KRY+FD+ + EAEELK+I+KSD+I 
Sbjct  784   DESFENHRNGLIAEKLEKFPSLAYETGDHWSQIVAKRYLFDMLKVEAEELKTIQKSDVIN  843

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL+ P PKCR+L+V VWGCNT   +     E   +VI+D  +FK SSEFYPS C
Sbjct  844   WYKTYLRPPSPKCRQLAVHVWGCNTNFNEELKLQEKFGQVIEDVDSFKMSSEFYPSLC  901



>ref|XP_009119012.1| PREDICTED: insulin-degrading enzyme-like isoform X2 [Brassica 
rapa]
Length=1074

 Score =  1239 bits (3206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/896 (67%), Positives = 725/896 (81%), Gaps = 15/896 (2%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  192   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  251

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ LQND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  252   VAPLMKTEAMERELLAVDSEFNQALQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  311

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE           LF  VK G  ++ +   
Sbjct  312   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGE-----------LFGDVKNGSKIRPTLVA  360

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW+ GKLY LEAV+DVH L L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  361   EGPIWEGGKLYRLEAVRDVHTLNLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  420

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KG +TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+ SPQ
Sbjct  421   VKGLITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDASPQ  480

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  481   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  540

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D SLHLP
Sbjct  541   MGFFTPKNMRIDVVSKSVK-SEEFQTEPWFGSRYVEEDVPLTLMETWSNPSEVDTSLHLP  599

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK+PRANTYFR+ LK
Sbjct  600   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFKVPRANTYFRINLK  659

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY +++N LLTELF+ LLKDELNEI+YQAS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  660   GAYDSVKNCLLTELFINLLKDELNEIIYQASIAKLETSLSMYGDKLELKVYGFNEKIPAL  719

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +N+NMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  720   LSKILAIAKSFMPSLDRFKVIKENMERGFRNSNMKPLNHSTYLRLQLLCKRIYDSDEKLS  779

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL +F+  + SQ+YIE LCHGN+ E+E VNIS+IF +  +V PLP + RH E
Sbjct  780   VLNDLSLADLNSFISVVRSQIYIEALCHGNLSEDETVNISNIFKNSLTVEPLPVKCRHGE  839

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +MC P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  840   QIMCFPLNAKLVRDVTVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  898

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  899   NQLRTKEQLGYVVECGPRLTYRVQGFCFCVQSSKYGPIHLLERVDNFIKDIEALLEQLDE  958

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  959   DSFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  1018

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++   KCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  1019  YKTYFRESSRKCRRLAVRVWGCNTDMKETQTDPKSMQVIADAVAFKSTSKFYPSLC  1074



>gb|AAF63132.1|AC011001_2 Putative N-arginine dibasic convertase [Arabidopsis thaliana]
Length=1039

 Score =  1228 bits (3177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/913 (65%), Positives = 731/913 (80%), Gaps = 23/913 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFS---  527
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKR+    
Sbjct  131   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRYKNCL  190

Query  528   ---------QFFVSPLVKAEAM--EREVLAVDS---EFNQVLQNDSCRLQQLQCHTSAPG  665
                      + F     KA  +   + VL   S   EFNQ LQND+CRLQQLQC+TSA G
Sbjct  191   SCYFTYLDKRHFAVKFTKAVDIYVVKSVLLTKSKFVEFNQALQNDACRLQQLQCYTSAKG  250

Query  666   HPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLE  845
             HPFNRF WGNKKSLS A E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+E
Sbjct  251   HPFNRFAWGNKKSLSGAMENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVE  310

Query  846   LFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYL  1025
             LF  VK G  ++ +   E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYL
Sbjct  311   LFGDVKNGSKIRPTLEAEGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRSAYVKKPEDYL  370

Query  1026  AHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEI  1205
             AHLLGHEG+GSL  FLK KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++I
Sbjct  371   AHLLGHEGRGSLHSFLKAKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDI  430

Query  1206  IGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVV  1385
             IG++YQYLKLLR+VSPQEWIFKELQDIG M+FRF EE+P D+YAAEL+EN+L YP E V+
Sbjct  431   IGYIYQYLKLLRDVSPQEWIFKELQDIGNMDFRFAEEQPADDYAAELSENMLAYPVEHVI  490

Query  1386  YGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSL  1565
             YGDY Y+ WD +LI+D++GFF   NMR+DVV+KS+  S + Q EPWFGS Y+EE +P SL
Sbjct  491   YGDYVYQTWDPKLIEDLMGFFTPQNMRIDVVSKSI-KSEEFQQEPWFGSSYIEEDVPLSL  549

Query  1566  LELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLD  1739
             +E W +P E+D SLHLP+KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD
Sbjct  550   MESWSNPSEVDNSLHLPSKNQFIPCDFSIRAINSDVDPKSQSPPRCIIDEPFMKFWYKLD  609

Query  1740  NTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYG  1919
              TFK+PRANTYFR+ LKGAY++++N LLTEL++ LLKDELNEI+YQA+  KLETS+S+YG
Sbjct  610   ETFKVPRANTYFRINLKGAYASVKNCLLTELYINLLKDELNEIIYQAT--KLETSLSMYG  667

Query  1920  DKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYL  2099
             DKLELKVYGFN K+P LLSK+LA+  SF P  +RF VIKE+MER  +NTNMKPLNH++YL
Sbjct  668   DKLELKVYGFNEKIPALLSKILAIAKSFMPNLERFKVIKENMERGFRNTNMKPLNHSTYL  727

Query  2100  RLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIF  2279
             RLQ+LCK  +D +EKL +LN LSL DL +F+P+L SQ++IE LCHGN+ E+EAVNIS+IF
Sbjct  728   RLQLLCKRIYDSDEKLSVLNDLSLDDLNSFIPELRSQIFIEALCHGNLSEDEAVNISNIF  787

Query  2280  TSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIK  2459
                 +V PLP++ RH E + C P GA LVRDV VKNK +TNSVVELY+QIEPE  ++  +
Sbjct  788   KDSLTVEPLPSKCRHGEQITCFPMGAKLVRDVNVKNKSETNSVVELYYQIEPE-EAQSTR  846

Query  2460  LKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGR  2639
              KA++DLF EI+EEPLF++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GR
Sbjct  847   TKAVLDLFHEIIEEPLFNQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGR  906

Query  2640  IDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSE  2819
             +DNFI D + +L+ LDD+S+E+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S 
Sbjct  907   VDNFIKDIEGLLEQLDDESYEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSH  966

Query  2820  KEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPT  2999
             KEAEEL+SI+K D+I WY TY ++  PKCRRL+VRVWGC+T  K++    +  +VI D  
Sbjct  967   KEAEELRSIQKKDVISWYKTYFRESSPKCRRLAVRVWGCDTNMKETQTDQKAVQVIADAV  1026

Query  3000  AFKKSSEFYPSFC  3038
             AFK +S+FYPS C
Sbjct  1027  AFKSTSKFYPSLC  1039



>ref|XP_007208116.1| hypothetical protein PRUPE_ppa000686mg [Prunus persica]
 gb|EMJ09315.1| hypothetical protein PRUPE_ppa000686mg [Prunus persica]
Length=1036

 Score =  1226 bits (3171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/896 (66%), Positives = 724/896 (81%), Gaps = 5/896 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVK+EFL GAL+RFSQFF
Sbjct  144   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKQEFLKGALRRFSQFF  203

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K EAMEREV AVDSEFNQVLQN+SCRL+Q  CHT+APGHPFN+FFWGNKKSL DA
Sbjct  204   VSPLMKIEAMEREVQAVDSEFNQVLQNESCRLEQFHCHTAAPGHPFNKFFWGNKKSLVDA  263

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLRE+I KLY D Y+G  MKLV+IGGE+LD+LE WV+ELF+ VKKG   K   + 
Sbjct  264   MENGINLRERILKLYRDYYHGGLMKLVVIGGESLDILEDWVVELFTNVKKGPQEKLQFKA  323

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAGKLY LE V+D H+L L+WTLP L ++YL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  324   EGPIWKAGKLYRLEPVRDFHMLYLTWTLPCLHQEYLKKPEDYLAHLLGHEGRGSLHFYLK  383

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW T ++AG G   ++++S+AY+F M+IHLTDSGL+K+F++IG VYQY+KLL +VSPQ
Sbjct  384   ARGWATYLAAGAGGGCIYQTSVAYVFNMTIHLTDSGLEKMFDVIGIVYQYIKLLHQVSPQ  443

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG MEF+F EE  QD YA+ LA +LL YP + ++YG YAYE WDE+LIK +
Sbjct  444   EWIFRELQDIGNMEFKFSEEPAQDSYASGLAGSLLFYPAKYIIYGGYAYESWDEELIKHV  503

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  DNMRVD+V+KS   S D QCEPWFGS+Y EE I  SL++LWKDP EIDVSLHLP
Sbjct  504   LGFFTPDNMRVDLVSKSSIKSEDFQCEPWFGSKYTEEDISPSLMDLWKDPLEIDVSLHLP  563

Query  1617  AKNDFIPSDFSIRADTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN+FIP DFSIR+D    D  N  +P+CI+DEPLMK WYKLD TFKLPR NTYFR++LK
Sbjct  564   SKNEFIPFDFSIRSDNSCHDPANISSPRCIIDEPLMKLWYKLDTTFKLPRVNTYFRISLK  623

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G  +NLRN++L EL+  LL+DELNEI+YQA +A LE  V   G+KLE+KV GFN KLP L
Sbjct  624   GGCANLRNSILMELYGRLLRDELNEIIYQALLANLEAYVGPVGEKLEIKVSGFNDKLPAL  683

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA   +F P DDR  VIKE+M+R +KNTNM PL H SYLRLQVL ++F+D ++KL 
Sbjct  684   LSKILATVKNFLPTDDRLKVIKENMKRRIKNTNMNPLVHTSYLRLQVLWQTFYDPDDKLH  743

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L+ LS++DL +F+P+L SQ++IEGLCHGNMLEEEA+++S+IF   FS  PLP E+ H+E
Sbjct  744   VLDELSISDLNSFIPELWSQVFIEGLCHGNMLEEEAISLSNIFKMNFSGQPLPTELWHRE  803

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+CLP GA+LVRD  VKNK +TNSV EL+FQI+ +V   L  +  ++DL   I+ EPLF
Sbjct  804   RVLCLPPGANLVRDASVKNKSETNSVTELHFQIKQDV---LTTMNGVIDLLIAIIWEPLF  860

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGY+V+C PR+TYR+ GF F VQSSEY P+YLQ RIDNFI+  +E+L+ +DD
Sbjct  861   NQLRTKEQLGYIVECGPRITYRVFGFIFYVQSSEYSPVYLQERIDNFIDGLEELLEGIDD  920

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             D FEN++SGL+A LLEKD SL+ ET+R W +IV KRYMFD + +EAEELK+I K D+I W
Sbjct  921   DLFENYRSGLMAGLLEKDLSLTCETDRYWCEIVGKRYMFDFAAEEAEELKTIHKEDVINW  980

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TYL+Q  PKCRRL+ RVWGCNT  K+++A  E  KVI+DP  FK SS FYPS C
Sbjct  981   YRTYLQQSSPKCRRLATRVWGCNTDPKEAEARSESMKVIEDPATFKMSSTFYPSLC  1036



>ref|XP_009416319.1| PREDICTED: nardilysin [Musa acuminata subsp. malaccensis]
Length=1040

 Score =  1220 bits (3156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/898 (66%), Positives = 734/898 (82%), Gaps = 4/898 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYD YLSKHGGS+NA+TETE+TCY+FEV RE+L GALKRFSQFF
Sbjct  143   LEHMLFMGSSEFPDENEYDHYLSKHGGSTNAFTETEYTCYYFEVNREYLKGALKRFSQFF  202

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREV+AVDSEFNQVLQ+DSCRL QL CHTS+ GHPFNRF+WGNKKSL DA
Sbjct  203   ISPLVKAEAMEREVMAVDSEFNQVLQSDSCRLLQLHCHTSSVGHPFNRFYWGNKKSLVDA  262

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLRE+I K+Y +NY+G  MKLV+IGGE LDVL+ WV+ELFS +K G  +  S + 
Sbjct  263   MENGINLREEILKMYAENYHGGIMKLVVIGGEPLDVLQEWVVELFSNIKAGPPLTMSYKS  322

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIWK GKLY LEAVKDVHILEL+WTLP L K+YL+K EDYLAHLLGHEG+GSLL+FLK
Sbjct  323   NLPIWKVGKLYRLEAVKDVHILELTWTLPCLHKEYLKKPEDYLAHLLGHEGRGSLLYFLK  382

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             +KG  +S+SAGVGDEGM RSSIAYIF +SI+LTDSGL+K +E+IGFVYQYLKLL + +PQ
Sbjct  383   SKGLASSLSAGVGDEGMRRSSIAYIFVISIYLTDSGLEKFYEVIGFVYQYLKLLCQSTPQ  442

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EW+FKELQDIG MEFRF EE+PQD+YA +LAEN+  Y  + ++YG+YA+E WD  LI+ I
Sbjct  443   EWVFKELQDIGNMEFRFAEEQPQDDYAVDLAENMFFYSEKHIIYGEYAFEHWDPDLIQHI  502

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMR+D+++KS +  S+ +Q EPWFGS+++EE I  SLL+LW +PPEI  SLHL
Sbjct  503   LSFFSPENMRIDILSKSFDKQSEAIQYEPWFGSRFIEEDISPSLLKLWGNPPEISPSLHL  562

Query  1614  PAKNDFIPSDFSIRADTIS--CDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P +NDFIPSDFS+R+  +S      + P+CI+D+PLMK WYK+D TF +PRANTYF +T+
Sbjct  563   PLRNDFIPSDFSLRSANLSKILSNTSNPQCIIDQPLMKLWYKVDLTFNVPRANTYFLITV  622

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K    ++RN +LTELFVLLLKDELNEI+YQA VAKLETS+S  GDKLELK+YGFN KLP+
Sbjct  623   KDGSLSVRNCVLTELFVLLLKDELNEIIYQAGVAKLETSLSFVGDKLELKLYGFNDKLPI  682

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L ++ +F P  DRF VIKEDMER  +NTNMKPL+H+SYLRLQVL +SFWDV++KL
Sbjct  683   LLSKILKLSKTFMPNIDRFKVIKEDMERAYRNTNMKPLSHSSYLRLQVLRESFWDVDDKL  742

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L +LSL+DL  F+P LLSQLYIEGLCHGN+ EEEA+NIS+IFT+ F V P+PA +RHK
Sbjct  743   SCLLNLSLSDLVEFIPSLLSQLYIEGLCHGNLSEEEAINISNIFTNTFPVEPIPAGLRHK  802

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CL SG  L R V VKN+L+ NSVVELYFQIE +VG E  +L+A  DLF  I+EEP 
Sbjct  803   ERVICLSSGCSLNRSVSVKNELEVNSVVELYFQIEQDVGMEATRLRATTDLFSNIIEEPC  862

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV+  PR+TYR+LG+CFR+QSS+Y P+YL  RI+NFIN  +++LD LD
Sbjct  863   FDQLRTKEQLGYVVESGPRMTYRVLGYCFRIQSSKYSPLYLHDRINNFINGLQDLLDCLD  922

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D+SF++ +SGLIA+ LEKDPSL+YET   W QIV+KRY+FD+ + EAEELK+I KSD+I+
Sbjct  923   DESFQSHRSGLIAEKLEKDPSLTYETGHYWSQIVEKRYLFDMLKVEAEELKTIEKSDVID  982

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             WY  YL+ P PKCR+L++ +WGCNT  K+    +      I+D    K SSEFY S C
Sbjct  983   WYKKYLRPPSPKCRQLAIHIWGCNTDIKEETKMLNKFGNAIEDINFLKSSSEFYSSLC  1040



>ref|XP_010921139.1| PREDICTED: insulin-degrading enzyme isoform X4 [Elaeis guineensis]
Length=882

 Score =  1211 bits (3133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/879 (68%), Positives = 725/879 (82%), Gaps = 4/879 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTETE+TCYHFEV RE L GALKRFSQFF+SPLVKAEAMEREVLAVDS
Sbjct  4     SYLSKHGGSSNAYTETEYTCYHFEVNREHLMGALKRFSQFFISPLVKAEAMEREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQVLQ+DSCRL QL CHTS PGHPFNRF WGNKKSL DA E G+NLRE+I ++Y DNY
Sbjct  64    EFNQVLQSDSCRLFQLHCHTSIPGHPFNRFTWGNKKSLIDAMENGINLREEILQMYRDNY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
             +G  MKLV+IGGE LD+LE WV+ELFS VK G  +K S+R++ PIWK GK+Y LEAVKDV
Sbjct  124   HGGMMKLVVIGGEPLDILEGWVVELFSDVKTGPPLKMSTRIDIPIWKVGKIYRLEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HILEL+W LP L K+YL+K EDYLAHLLGHEG+GSLL+F K KGW TS+SAGVGDEGM R
Sbjct  184   HILELTWKLPCLHKEYLKKPEDYLAHLLGHEGRGSLLYFFKAKGWATSLSAGVGDEGMRR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SSIAYIF MSIHLTDSGL+ ++E+IGFVYQY+KLLR+ +PQEWIFKELQDIG MEFRF E
Sbjct  244   SSIAYIFVMSIHLTDSGLEMLYEVIGFVYQYIKLLRQSTPQEWIFKELQDIGNMEFRFAE  303

Query  1314  EEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLN  1493
             E+PQD+YAAELAENLL+Y  E +++G+Y +E+WD +L++ +L FF  +NMR+D+++KS +
Sbjct  304   EQPQDDYAAELAENLLLYSEEHIIFGEYVFELWDPELVEHVLSFFTPENMRIDILSKSFD  363

Query  1494  NSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTIS  1670
               S+ +Q EPWFGS+Y+EE I  SLL+LW DPPEI   LHLP KN+FIP  FS+    IS
Sbjct  364   KHSEAIQYEPWFGSRYIEEDISPSLLKLWSDPPEIHQHLHLPLKNEFIPRVFSLCNSNIS  423

Query  1671  --CDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLL  1844
                   N PKCI+++PLMK WYK+D TF +PRANTYF +T+K  Y++++N +LTELFV L
Sbjct  424   KCLLDTNHPKCIMNQPLMKVWYKIDLTFNVPRANTYFLITVKDGYNSVKNCVLTELFVNL  483

Query  1845  LKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRF  2024
             LKDELNEI+YQA VAKLETS+S+ G+KLELK+YGFN KL +LLSK+L ++ SF P  +RF
Sbjct  484   LKDELNEILYQAGVAKLETSLSIVGNKLELKLYGFNDKLSLLLSKILTLSRSFFPNVERF  543

Query  2025  LVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLL  2204
              VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL    +LSL+DL+AF+P+LL
Sbjct  544   KVIKEDMERAFRNCNMKPLSHSSYLRLQVLREKFWDVDDKLSCFVNLSLSDLEAFIPNLL  603

Query  2205  SQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVK  2384
             SQL+IEGLCHGN+LEEEA+NIS+IFT+ FSV PL AE RH+E V+CLPSGA L+R V+VK
Sbjct  604   SQLHIEGLCHGNLLEEEAINISNIFTNIFSVEPLAAEFRHQERVLCLPSGASLIRSVRVK  663

Query  2385  NKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPR  2564
             N L+ NSVVELYFQIE +VG E  KL+A+ DLF +IVEEP FD+LRTKEQLGYVV C PR
Sbjct  664   NDLEVNSVVELYFQIEQDVGMEANKLRAITDLFSDIVEEPCFDQLRTKEQLGYVVQCGPR  723

Query  2565  VTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKD  2744
             +TYR+LGFCF VQSSEY PIYL  RIDNFI+  +E+LD LDD+SFEN ++GLIA+ LEK 
Sbjct  724   MTYRVLGFCFLVQSSEYSPIYLHDRIDNFISGLQELLDKLDDESFENHRNGLIAEKLEKF  783

Query  2745  PSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVR  2924
             PSL+YET   W QIV KRY+FD+ + EAEELK+I+KSD+I WY TYL+ P PKCR+L+V 
Sbjct  784   PSLAYETGDHWSQIVAKRYLFDMLKVEAEELKTIQKSDVINWYKTYLRPPSPKCRQLAVH  843

Query  2925  VWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             VWGCNT   +     E   +VI+D  +FK SSEFYPS C
Sbjct  844   VWGCNTNFNEELKLQEKFGQVIEDVDSFKMSSEFYPSLC  882



>ref|XP_006842457.1| hypothetical protein AMTR_s00077p00061270 [Amborella trichopoda]
 gb|ERN04132.1| hypothetical protein AMTR_s00077p00061270 [Amborella trichopoda]
Length=1048

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/897 (65%), Positives = 723/897 (81%), Gaps = 16/897 (2%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS  FPDENEYDSYL+KHGGSSNAYTETEHTCYHFEV REFL  ALKRFSQFF
Sbjct  165   LEHMLFMGSAAFPDENEYDSYLAKHGGSSNAYTETEHTCYHFEVNREFLRDALKRFSQFF  224

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEF   LQ+D  RLQQLQCHTS PG+PFN+FF GNKKSL DA
Sbjct  225   ISPLVKAEAMEREVLAVDSEFKLNLQSDGSRLQQLQCHTSTPGNPFNKFFCGNKKSLMDA  284

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ++G+++REQI KLY + Y G +MKLV+IGGE+L+ LESWV+ELFS V++G+ ++ + + 
Sbjct  285   MDKGIDMREQILKLYEETYLGGQMKLVVIGGESLETLESWVVELFSDVREGNRLRDNFK-  343

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               PIW AGKLYWLEAVKD+HIL L+W LP L K+YL+K +DYLAHL+GHE  GSL  FLK
Sbjct  344   NGPIWDAGKLYWLEAVKDIHILNLTWQLPCLDKEYLKKPQDYLAHLIGHESSGSLHSFLK  403

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGWVTS+SAGVG+EG++RSSI YIF +SI+LTD GL K FE++G VYQYL+LL +  PQ
Sbjct  404   RKGWVTSLSAGVGEEGVYRSSIGYIFVVSIYLTDLGLDKAFEVVGTVYQYLRLLCQAGPQ  463

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
              W+FKELQDIG MEFRF EE+PQDEYAAELAENLL+YP E ++YGDYA+E+WDE+L++ +
Sbjct  464   SWVFKELQDIGNMEFRFAEEQPQDEYAAELAENLLLYPEEHIIYGDYAFEVWDERLVEHV  523

Query  1437  LGFFRADNMRVDVVTKSLNNSSDV-QCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L F   DNMR+D+++KS +   +V + EPWFGS+Y EE I  SLLELW++P EID SLHL
Sbjct  524   LSFLSPDNMRIDILSKSFDKKPEVVKYEPWFGSRYTEESIQPSLLELWRNPLEIDPSLHL  583

Query  1614  PAKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+F+P DFSIR+   S D G +  PKCI+DEP MK WYKLD TFK+PRANTYF +T+
Sbjct  584   PQKNEFVPCDFSIRSSQESEDRGVSEIPKCIIDEPNMKLWYKLDTTFKVPRANTYFLITV  643

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K AY+ ++  +LTELFV LL+DELNEI+YQA VAKLETS+S+ GD++E+K+YGFN KLP 
Sbjct  644   KEAYTCIKQCVLTELFVSLLRDELNEILYQADVAKLETSLSISGDRIEVKLYGFNDKLPT  703

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L+++ SF P +D F VIKE+MERT +N+NMKPLNH+SYLRLQVL   FWDV++KL
Sbjct  704   LLSKILSISRSFLPSEDHFKVIKENMERTFRNSNMKPLNHSSYLRLQVLRNKFWDVDDKL  763

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L   SL+DLK  +P LLSQLYIEG+CHGN+LEEEA+NI++IF   F VPPLP E+RH+
Sbjct  764   SCLADTSLSDLKNVIPRLLSQLYIEGICHGNILEEEALNIANIFRDIFPVPPLPKELRHE  823

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+ LPSG  L+R+  VKN  + NSVVELYFQIEP+ G E  + + + DLF+EI+ EP 
Sbjct  824   ERVLHLPSGTCLIRNANVKNNSEVNSVVELYFQIEPDKGVESTRSRVMADLFEEIIGEPC  883

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGYVV+C PR+T+R++GFCFRVQSS Y P+YLQ R+DNFI+  +E+LD LD
Sbjct  884   FNQLRTKEQLGYVVECDPRMTFRVIGFCFRVQSSRYGPLYLQERVDNFIDKLQEVLDGLD  943

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
               SFEN++SGLIAK LEKDPSLSYET+  WGQI D+RY+F++S+ EAEELK I K D+IE
Sbjct  944   QRSFENYRSGLIAKKLEKDPSLSYETDHYWGQIFDRRYLFNMSKMEAEELKRIEKEDVIE  1003

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             WY+ Y K    KC RL++ VWGC T       +ME     +D  AFK SS+FYPS C
Sbjct  1004  WYNAYFKGESEKCCRLAIHVWGCTT-------NME-----EDLEAFKLSSKFYPSLC  1048



>ref|XP_010921137.1| PREDICTED: nardilysin isoform X2 [Elaeis guineensis]
Length=985

 Score =  1183 bits (3061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/898 (65%), Positives = 704/898 (78%), Gaps = 54/898 (6%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+ FPDENEYDSYLSKHGGSSNAYTETE+TCYHFEV RE L GALKRFSQFF
Sbjct  138   LEHMLFMGSSRFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVNREHLMGALKRFSQFF  197

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVKAEAMEREVLAVDSEFNQVLQ+DSCRL QL CHTS PGHPFNRF WGNKKSL DA
Sbjct  198   ISPLVKAEAMEREVLAVDSEFNQVLQSDSCRLFQLHCHTSIPGHPFNRFTWGNKKSLIDA  257

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+NLRE+I ++Y DNY+G  MKLV+IGGE LD+LE WV+ELFS VK G  +K S+R+
Sbjct  258   MENGINLREEILQMYRDNYHGGMMKLVVIGGEPLDILEGWVVELFSDVKTGPPLKMSTRI  317

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GK+Y LEAVKDVHILEL+W LP L K+YL+K EDYLAHLLGHEG+GSLL+F K
Sbjct  318   DIPIWKVGKIYRLEAVKDVHILELTWKLPCLHKEYLKKPEDYLAHLLGHEGRGSLLYFFK  377

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGM RSSIAYIF MSIHLTDSGL+ ++E+IGFVYQY+KLLR+ +PQ
Sbjct  378   AKGWATSLSAGVGDEGMRRSSIAYIFVMSIHLTDSGLEMLYEVIGFVYQYIKLLRQSTPQ  437

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+PQD+YAAELAENLL+Y  E +++G+Y +E+WD +L++ +
Sbjct  438   EWIFKELQDIGNMEFRFAEEQPQDDYAAELAENLLLYSEEHIIFGEYVFELWDPELVEHV  497

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  +NMR+D+++KS +  S+ +Q EPWFGS+Y+EE I  SLL+LW DPPEI   LHL
Sbjct  498   LSFFTPENMRIDILSKSFDKHSEAIQYEPWFGSRYIEEDISPSLLKLWSDPPEIHQHLHL  557

Query  1614  PAKNDFIPSDFSIRADTIS-C-DGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+FIP  FS+    IS C    N PKCI+++PLMK WYK+D TF +PRANTYF +T+
Sbjct  558   PLKNEFIPRVFSLCNSNISKCLLDTNHPKCIMNQPLMKVWYKIDLTFNVPRANTYFLITV  617

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K  Y++++N +LTELFV LLKDELNEI+YQ                              
Sbjct  618   KDGYNSVKNCVLTELFVNLLKDELNEILYQ------------------------------  647

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
                                 VIKEDMER  +N NMKPL+H+SYLRLQVL + FWDV++KL
Sbjct  648   --------------------VIKEDMERAFRNCNMKPLSHSSYLRLQVLREKFWDVDDKL  687

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
                 +LSL+DL+AF+P+LLSQL+IEGLCHGN+LEEEA+NIS+IFT+ FSV PL AE RH+
Sbjct  688   SCFVNLSLSDLEAFIPNLLSQLHIEGLCHGNLLEEEAINISNIFTNIFSVEPLAAEFRHQ  747

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPSGA L+R V+VKN L+ NSVVELYFQIE +VG E  KL+A+ DLF +IVEEP 
Sbjct  748   ERVLCLPSGASLIRSVRVKNDLEVNSVVELYFQIEQDVGMEANKLRAITDLFSDIVEEPC  807

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGYVV C PR+TYR+LGFCF VQSSEY PIYL  RIDNFI+  +E+LD LD
Sbjct  808   FDQLRTKEQLGYVVQCGPRMTYRVLGFCFLVQSSEYSPIYLHDRIDNFISGLQELLDKLD  867

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             D+SFEN ++GLIA+ LEK PSL+YET   W QIV KRY+FD+ + EAEELK+I+KSD+I 
Sbjct  868   DESFENHRNGLIAEKLEKFPSLAYETGDHWSQIVAKRYLFDMLKVEAEELKTIQKSDVIN  927

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEP-AKVIKDPTAFKKSSEFYPSFC  3038
             WY TYL+ P PKCR+L+V VWGCNT   +     E   +VI+D  +FK SSEFYPS C
Sbjct  928   WYKTYLRPPSPKCRQLAVHVWGCNTNFNEELKLQEKFGQVIEDVDSFKMSSEFYPSLC  985



>emb|CDY10234.1| BnaC05g04770D [Brassica napus]
Length=974

 Score =  1182 bits (3059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/896 (64%), Positives = 699/896 (78%), Gaps = 46/896 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  123   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  182

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  183   VAPLMKTEAMERELLAVDSEFNQAIQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  242

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE LD+LESWV+ELF  VK G  ++ +   
Sbjct  243   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGEPLDLLESWVVELFGDVKNGSKIRPTLEA  302

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GKLY LEAV+DVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  303   KGPIWKGGKLYRLEAVRDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  362

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW+TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQY+KLLR+ SPQ
Sbjct  363   GKGWITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYIKLLRDASPQ  422

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  423   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  482

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D +LHLP
Sbjct  483   MGFFTPKNMRIDVVSKSV-KSEEFQTEPWFGSRYVEEEVPLTLMETWSNPSEVDTALHLP  541

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK             
Sbjct  542   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFK-------------  588

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                                          AS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  589   -----------------------------ASIAKLETSLSMYGDKLELKVYGFNEKIPAL  619

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  620   LSKILAIAKSFMPSLDRFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  679

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSL DL +F+P++ SQ+YIE LCHGN+ E+E VNIS+IF +  +V PLP + RH  
Sbjct  680   VLNDLSLTDLNSFIPEVRSQIYIEALCHGNLSEDETVNISNIFKNSLTVEPLPVKCRHGG  739

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              + C P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  740   QITCFPLNAKLVRDVTVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  798

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  799   NQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPIHLLERVDNFIKDIEALLEQLDE  858

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
              SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  859   KSFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  918

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  919   YKTYFRESSPKCRRLAVRVWGCNTDMKETQTDPKSVQVIADAVAFKSTSKFYPSLC  974



>ref|XP_004984458.1| PREDICTED: nardilysin-like [Setaria italica]
Length=1036

 Score =  1182 bits (3059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/897 (63%), Positives = 709/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGG+SNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  140   LEHMLFMGSSEFPDENEYDSYLSKHGGASNAFTETEYTCYHFEVKREYLKGALDRFSQFF  199

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  200   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLSQLQSHTCSQGHPLNRFTWGNKKSLVDA  259

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD+LE W +ELFS VK G ++  + + 
Sbjct  260   MGSGINLREEILQMYMRNYHGGAMKLVIIGGEPLDILEGWTMELFSKVKAGPLLDMTPKT  319

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK+GKLY LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  320   DMPFWKSGKLYKLEAVRDVHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  379

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG  G  RSS AYIF MSIHLTDSGLK +FE+IG VYQY+KLL++  PQ
Sbjct  380   AKGWASSLSAGVGSGGSERSSYAYIFEMSIHLTDSGLKNVFEVIGSVYQYIKLLKQSEPQ  439

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+P D+YA +LAEN+L Y  + +V G+Y +E WD +L+K  
Sbjct  440   EWIFKELQDIGNMEFRFAEEQPPDDYAVDLAENMLFYSEKHIVCGEYIHEDWDPELVKHA  499

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV+++S +  S  +QCEPWFGSQY+EE IPSSL+E W++P +ID +LHL
Sbjct  500   LCFFNPDNMRVDVLSRSFDKQSQAIQCEPWFGSQYIEEDIPSSLIESWRNPVQIDPNLHL  559

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A+       + P+CI+DEP +K WYK+D TF +PRANTYF +++ 
Sbjct  560   PRKNEFIPGDFTLRNANYPRSSSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLISVN  619

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                S+L N++LTELF  LLKDELNE++YQA VAKLETS+S+ G  LE+K+YG+N KLP L
Sbjct  620   DGCSSLENSVLTELFANLLKDELNEVLYQAYVAKLETSMSVVGSNLEIKLYGYNDKLPTL  679

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +L+   SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL 
Sbjct  680   LSNILSAFRSFSPKTDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKLE  739

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L +L+  DL  F+P +LSQL+IEGLCHGN+ EEEA+NIS IF +  S   LP E RH  
Sbjct  740   VLMNLTFTDLVTFVPKILSQLHIEGLCHGNLSEEEAINISKIFRNTLSAQTLPEEARHGV  799

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P+GA+ VR V+VKN L+ NSVVE+YF IE ++G E  +L+A+ DLF  I+EEP F
Sbjct  800   RVICIPNGANFVRSVRVKNDLEENSVVEVYFPIEQDIGKEATRLRAITDLFSSIIEEPCF  859

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y PIYLQ RIDNFIN    +LD LDD
Sbjct  860   DQLRTKEQLGYTVDSSPRMTYRMLAYCFRVMSSKYSPIYLQSRIDNFINGLSTLLDGLDD  919

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEK+PSLSY+T   W QIVDKRY+FD+ + EAEEL++I+K+D+I W
Sbjct  920   ETFEHHRSGLIADKLEKEPSLSYQTGDYWSQIVDKRYLFDMPKLEAEELRTIQKADVIAW  979

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             Y+TY++   PK RRL++ V+GCN+   ++    E +  VI D  + K SS+FY S C
Sbjct  980   YNTYIRSSAPKRRRLAIHVYGCNSDIAEAAKLQEQSWTVIDDVKSLKVSSQFYSSLC  1036



>gb|EAZ26839.1| hypothetical protein OsJ_10755 [Oryza sativa Japonica Group]
Length=1040

 Score =  1181 bits (3054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/897 (63%), Positives = 713/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  144   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVKREYLKGALDRFSQFF  203

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  204   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQGHPLNRFTWGNKKSLVDA  263

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD+LESW +ELFS VK G ++  S + 
Sbjct  264   MGSGINLREEILQMYKTNYHGGMMKLVIIGGEPLDILESWTMELFSKVKGGPLLDMSPKT  323

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P W++GKL+ LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  324   DMPFWRSGKLHRLEAVRDVHSLCLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLCFLK  383

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG +G  RSS AYIF MSI LTDSGLK ++E+I  VYQY+KLL++  PQ
Sbjct  384   AKGWASSLSAGVGTDGTQRSSYAYIFEMSIRLTDSGLKNLYEVISAVYQYIKLLKQSEPQ  443

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+YA +LAEN+L Y  + +V G+Y YE WD +L+K +
Sbjct  444   EWIFKELQDIGYMEFRFAEEQPPDDYAVDLAENMLYYSEKHIVSGEYIYEGWDPELVKHV  503

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFG+QY+EE IPSS +E W++P +ID + HL
Sbjct  504   LSFFHPDNMRVDVLSKSFDKQSQAIQCEPWFGAQYIEEDIPSSFMESWRNPAQIDDAFHL  563

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A+       + P+CI+DEP +K WYK+D TF +PRANTYF +++K
Sbjct  564   PRKNEFIPGDFNLRNANMPKPLSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLISVK  623

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               YSNL N++LT+LFV LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL  L
Sbjct  624   DGYSNLENSVLTDLFVNLLKDELNEVLYQAYVAKLETSMSVVGSNLELKLYGYNDKLSTL  683

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL 
Sbjct  684   LSSILAASQSFSPKSDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKLE  743

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+ +DL A++P LLSQL+IEGLCHGN+ E+EA+NIS IF +  S   LP E RH+E
Sbjct  744   VLMKLTFSDLVAYVPKLLSQLHIEGLCHGNLSEDEAMNISKIFQNTLSAQTLPDEARHEE  803

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P   + VR V+VKN+L+ NSVVE+YF +E ++G +  KL+A+ DLF  I+EEP F
Sbjct  804   RVLCIPDDTNFVRSVRVKNELEENSVVEVYFPVEQDIGKDATKLRAITDLFSNIIEEPCF  863

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RID+FI+    +LD LD+
Sbjct  864   DQLRTKEQLGYTVDSSPRMTYRVLAYCFRVMSSKYSPVYLQSRIDSFIDGVSALLDGLDE  923

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEKDPSLSY+T   W QIVDKRYMFD+S+ EAEEL+++RK D+I W
Sbjct  924   ETFEHHRSGLIADKLEKDPSLSYQTGDYWSQIVDKRYMFDMSKLEAEELRTVRKEDVISW  983

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKV-IKDPTAFKKSSEFYPSFC  3038
             Y+TY+K   PK RRL++ V+GCN+   ++    E + + I D  + KKSS+FY S C
Sbjct  984   YNTYIKPSSPKRRRLAIHVYGCNSDIAEAAKLKEQSWITIDDVKSLKKSSQFYSSLC  1040



>gb|EAY89915.1| hypothetical protein OsI_11464 [Oryza sativa Indica Group]
Length=1037

 Score =  1181 bits (3054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/897 (63%), Positives = 713/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  141   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVKREYLKGALDRFSQFF  200

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  201   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQGHPLNRFTWGNKKSLVDA  260

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD+LESW +ELFS VK G ++  S + 
Sbjct  261   MGSGINLREEILQMYKTNYHGGMMKLVIIGGEPLDILESWTMELFSKVKGGPLLDMSPKT  320

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P W++GKL+ LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  321   DMPFWRSGKLHRLEAVRDVHSLCLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLCFLK  380

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG +G  RSS AYIF MSI LTDSGLK ++E+I  VYQY+KLL++  PQ
Sbjct  381   AKGWASSLSAGVGTDGTQRSSYAYIFEMSIRLTDSGLKNLYEVISAVYQYIKLLKQSEPQ  440

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+YA +LAEN+L Y  + +V G+Y YE WD +L+K +
Sbjct  441   EWIFKELQDIGYMEFRFAEEQPPDDYAVDLAENMLYYSEKHIVSGEYIYEGWDPELVKHV  500

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFG+QY+EE IPSS +E W++P +ID + HL
Sbjct  501   LSFFHPDNMRVDVLSKSFDKQSQAIQCEPWFGAQYIEEDIPSSFMESWRNPAQIDDAFHL  560

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A+       + P+CI+DEP +K WYK+D TF +PRANTYF +++K
Sbjct  561   PRKNEFIPGDFNLRNANMPKPLSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLISVK  620

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               YSNL N++LT+LFV LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL  L
Sbjct  621   DGYSNLENSVLTDLFVNLLKDELNEVLYQAYVAKLETSMSVVGSNLELKLYGYNDKLSTL  680

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL 
Sbjct  681   LSSILAASQSFSPKSDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKLE  740

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+ +DL A++P LLSQL+IEGLCHGN+ E+EA+NIS IF +  S   LP E RH+E
Sbjct  741   VLMKLTFSDLVAYVPKLLSQLHIEGLCHGNLSEDEAMNISKIFQNTLSAQTLPDEARHEE  800

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P   + VR V+VKN+L+ NSVVE+YF +E ++G +  KL+A+ DLF  I+EEP F
Sbjct  801   RVLCIPDDTNFVRSVRVKNELEENSVVEVYFPVEQDIGKDATKLRAITDLFSNIIEEPCF  860

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RID+FI+    +LD LD+
Sbjct  861   DQLRTKEQLGYTVDSSPRMTYRVLAYCFRVMSSKYSPVYLQSRIDSFIDGVSALLDGLDE  920

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEKDPSLSY+T   W QIVDKRYMFD+S+ EAEEL+++RK D+I W
Sbjct  921   ETFEHHRSGLIADKLEKDPSLSYQTGDYWSQIVDKRYMFDMSKLEAEELRTVRKEDVISW  980

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKV-IKDPTAFKKSSEFYPSFC  3038
             Y+TY+K   PK RRL++ V+GCN+   ++    E + + I D  + KKSS+FY S C
Sbjct  981   YNTYIKPSSPKRRRLAIHVYGCNSDIAEAAKLKEQSWITIDDVKSLKKSSQFYSSLC  1037



>ref|NP_001050040.1| Os03g0336300 [Oryza sativa Japonica Group]
 gb|ABF95819.1| Insulinase containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11954.1| Os03g0336300 [Oryza sativa Japonica Group]
 dbj|BAG90931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1040

 Score =  1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/897 (63%), Positives = 713/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  144   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVKREYLKGALDRFSQFF  203

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  204   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQGHPLNRFTWGNKKSLVDA  263

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD+LESW +ELFS VK G ++  S + 
Sbjct  264   MGSGINLREEILQMYKTNYHGGMMKLVIIGGEPLDILESWTMELFSKVKGGPLLDMSPKT  323

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P W++GKL+ LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  324   DMPFWRSGKLHRLEAVRDVHSLCLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLCFLK  383

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG +G  RSS AYIF MSI LTDSGLK ++E+I  VYQY+KLL++  PQ
Sbjct  384   AKGWASSLSAGVGTDGTQRSSYAYIFEMSIRLTDSGLKNLYEVISAVYQYIKLLKQSEPQ  443

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+YA +LAEN+L Y  + +V G+Y YE WD +L+K +
Sbjct  444   EWIFKELQDIGYMEFRFAEEQPPDDYAVDLAENMLYYSEKHIVSGEYIYEGWDPELVKHV  503

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFG+QY+EE IPSS +E W++P +ID + HL
Sbjct  504   LSFFHPDNMRVDVLSKSFDKQSQAIQCEPWFGAQYIEEDIPSSFMESWRNPAQIDDAFHL  563

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A+       + P+CI+DEP +K WYK+D TF +PRANTYF +++K
Sbjct  564   PRKNEFIPGDFNLRNANMPKPLSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLISVK  623

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               YSNL N++LT+LFV LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL  L
Sbjct  624   DGYSNLENSVLTDLFVNLLKDELNEVLYQAYVAKLETSMSVVGSNLELKLYGYNDKLSTL  683

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL 
Sbjct  684   LSSILAASQSFSPKSDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKLE  743

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+ +DL A++P LLSQL+IEGLCHGN+ E+EA+NIS IF +  S   LP E RH+E
Sbjct  744   VLMKLTFSDLVAYVPKLLSQLHIEGLCHGNLSEDEAMNISKIFQNTLSAQTLPDEARHEE  803

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P   + VR V+VKN+L+ NSVVE+YF +E ++G +  KL+A+ DLF  I+EEP F
Sbjct  804   RVLCIPDDTNFVRSVRVKNELEENSVVEVYFPVEQDIGKDATKLRAITDLFSNIIEEPCF  863

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RID+FI+    +LD LD+
Sbjct  864   DQLRTKEQLGYTVDSSPRMTYRVLAYCFRVMSSKYSPVYLQSRIDSFIDGVSALLDGLDE  923

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEKDPSLSY+T   W QIVDKRYMFD+S+ EAEEL+++RK D+I W
Sbjct  924   ETFEHHRSGLIADKLEKDPSLSYQTGDYWSQIVDKRYMFDMSKLEAEELRTVRKEDVISW  983

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKV-IKDPTAFKKSSEFYPSFC  3038
             Y+TY+K   PK RRL++ V+GCN+   ++    E + + I D  + KKSS+FY S C
Sbjct  984   YNTYIKPSSPKRRRLAIHVYGCNSDIAEAAKLKEQSWITIDDVKSLKKSSQFYSSLC  1040



>ref|XP_002467901.1| hypothetical protein SORBIDRAFT_01g036110 [Sorghum bicolor]
 gb|EER94899.1| hypothetical protein SORBIDRAFT_01g036110 [Sorghum bicolor]
Length=1034

 Score =  1177 bits (3044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/897 (63%), Positives = 704/897 (78%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGG+SNA+TETE+TCYHFEVKRE L GAL RFSQFF
Sbjct  138   LEHMLFMGSSEFPDENEYDSYLSKHGGASNAFTETEYTCYHFEVKREHLKGALDRFSQFF  197

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT +  HP NRF WGNKKSL DA
Sbjct  198   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQRHPLNRFTWGNKKSLVDA  257

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I  +Y  NY+G  M+LVIIGGE LD+LE W +ELFS VK G  +    + 
Sbjct  258   MGSGINLREEILHMYMRNYHGGAMRLVIIGGEPLDILEGWTMELFSKVKAGPRLDIGPKT  317

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK+GKLY LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  318   DIPFWKSGKLYKLEAVRDVHSLCLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  377

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG  G  RSS AYIF MSI LTDSGLK +FE+IG VYQY+KLL++  PQ
Sbjct  378   AKGWASSLSAGVGSGGSQRSSYAYIFEMSIRLTDSGLKNVFEVIGAVYQYIKLLKQSEPQ  437

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG MEFRF EE+P D+YA +L EN+L Y  + +V G+Y YE WD +L+K  
Sbjct  438   EWIFKELQDIGHMEFRFAEEQPPDDYAVDLTENMLFYSEKHIVCGEYIYEDWDPELVKHA  497

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFGSQY+EE IPSSL+E WK+P ++D +LHL
Sbjct  498   LSFFNPDNMRVDVLSKSFDKQSQAIQCEPWFGSQYIEEDIPSSLIESWKNPVQVDANLHL  557

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A++        P CI+DEP +K WYK+D TF +PRANTYF +++K
Sbjct  558   PRKNEFIPGDFTLRNANSPGSSSDANPCCIVDEPFIKLWYKMDMTFNVPRANTYFFISVK  617

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                S+L N++LTELF  LLKDELNE++YQA VAKLETS+     KLE+K+YG+N KLP+L
Sbjct  618   DGCSSLENSVLTELFAHLLKDELNEVLYQAYVAKLETSICAVASKLEIKLYGYNDKLPIL  677

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L+   SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+ KL 
Sbjct  678   LSKILSTLRSFSPKTDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDTKLE  737

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+  DL AF+P +LSQL++EGLCHGN+ E+EAVNIS IF +  S P LP E RH E
Sbjct  738   VLMKLTFTDLVAFVPKILSQLHVEGLCHGNLSEDEAVNISKIFLNTLSAPTLPEEARHSE  797

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              VMC+P+GA+ VR V+VKN L+ NSVVE+YF IE +VG E  +L+A+ DLF  I+EEP F
Sbjct  798   RVMCIPNGANFVRSVRVKNDLEENSVVEVYFPIEQDVGKEATRLRAITDLFSNIIEEPCF  857

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CF+V SS+Y PIYLQ RIDNFI+   ++LD L++
Sbjct  858   DQLRTKEQLGYTVDSSPRMTYRMLAYCFQVMSSKYSPIYLQSRIDNFIDGLSDLLDGLNE  917

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEK+PSLSY+TN  W QI DKRYMFD+++ EAEELK++ K+D+I W
Sbjct  918   ETFEHHRSGLIADKLEKEPSLSYQTNDYWSQIADKRYMFDMAKLEAEELKTVHKADVIAW  977

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             Y+TY++   PK RRL++ V+GCN+   ++    E +  +I D  + K SS+FY S C
Sbjct  978   YNTYIRSSAPKRRRLAIHVYGCNSDITEAAKLQEQSWIIIDDIESLKASSQFYSSLC  1034



>emb|CDY54887.1| BnaA10g27980D [Brassica napus]
Length=1017

 Score =  1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/896 (64%), Positives = 699/896 (78%), Gaps = 46/896 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL  ALKRFSQFF
Sbjct  166   LEHMLFMGSTDFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLRDALKRFSQFF  225

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QND+CRLQQLQCHTS  GHP NRF WGNKKSLS A
Sbjct  226   VAPLMKTEAMERELLAVDSEFNQAIQNDACRLQQLQCHTSTKGHPLNRFAWGNKKSLSGA  285

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE LD+LESWV+ELF  VK G  ++ +   
Sbjct  286   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGEPLDLLESWVVELFGDVKNGSKIRPTLEA  345

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW+ GKLY LEAV+DVH L+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  346   KGPIWEGGKLYRLEAVRDVHTLDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  405

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW+TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+ SPQ
Sbjct  406   GKGWITSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDASPQ  465

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YAAEL+ N+L YP E V+YGDY Y+ WD ++I+D+
Sbjct  466   EWIFKELQDIGNMDFRYAEEQAADDYAAELSGNMLAYPVEHVIYGDYVYQTWDPKMIEDL  525

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+YVEE +P +L+E W +P E+D SLHLP
Sbjct  526   MGFFTPKNMRIDVVSKSV-KSEEFQTEPWFGSRYVEEDVPLTLMETWSNPSEVDTSLHLP  584

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + PKC++DEPLMKFWYKLD TFK             
Sbjct  585   SKNQFIPCDFSIRAINSDADPKSQSPPKCLIDEPLMKFWYKLDETFK-------------  631

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                                          AS+AKLETS+S+YGDKLELKVYGFN K+P L
Sbjct  632   -----------------------------ASIAKLETSLSMYGDKLELKVYGFNEKIPAL  662

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+LA+  SF P  DRF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EKL 
Sbjct  663   LSKILAIAKSFMPSLDRFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEKLS  722

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LN LSLADL +F+  + SQ+YIE LCHGN+ E+E +NIS+IF +  +V PLP + RH E
Sbjct  723   VLNDLSLADLNSFISVVRSQIYIEALCHGNLSEDETINISNIFKNSLTVEPLPVKCRHGE  782

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              +MC P  A LVRDV VKN+ +TNSVVELY+QIEPE  ++  ++KA++DLF EI+ EPLF
Sbjct  783   QIMCFPLNAKLVRDVTVKNRSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIGEPLF  841

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y PI+L  R+DNFI D + +L+ LD+
Sbjct  842   NQLRTKEQLGYVVECGPRLTYRVQGFCFCVQSSKYGPIHLLERVDNFIKDIETLLEQLDE  901

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             +SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S KEAEEL+SI K D+IEW
Sbjct  902   ESFEDYRSGMIARLLEKDPSLLSETNDLWSQIVDKRYMFDFSHKEAEELRSIEKKDVIEW  961

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             Y TY ++  PKCRRL+VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  962   YKTYFRESSPKCRRLAVRVWGCNTDMKETQTEPKSMQVIADAVAFKSTSKFYPSLC  1017



>ref|XP_008660178.1| PREDICTED: nardilysin [Zea mays]
 gb|AFW88452.1| hypothetical protein ZEAMMB73_847713 [Zea mays]
Length=1036

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/897 (63%), Positives = 709/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGG+SNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  140   LEHMLFMGSTEFPDENEYDSYLSKHGGASNAFTETEYTCYHFEVKREYLKGALDRFSQFF  199

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+D+CRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  200   VSPLVKAEAMDREILAVDSEFNQVLQSDTCRLYQLQSHTCSQGHPLNRFTWGNKKSLVDA  259

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  M+LVIIGGE LD+LE W +ELFS VK G ++    + 
Sbjct  260   MGSGINLREEILEMYMRNYHGGAMRLVIIGGEPLDILEGWTMELFSKVKTGPLLDIGPKT  319

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK GKLY LEAV+D+H L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  320   DIPFWKPGKLYKLEAVRDLHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  379

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG  G  RSS AYIF MSI LTDSGLK +FE+IG VYQY+KLL++  PQ
Sbjct  380   AKGWASSLSAGVGSGGSQRSSYAYIFEMSICLTDSGLKNVFEVIGAVYQYIKLLKQSEPQ  439

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+Y  +LAEN+L Y  + +V G+Y +E WD +L+K  
Sbjct  440   EWIFKELQDIGYMEFRFAEEQPPDDYVVDLAENMLFYSEKHIVCGEYIFEDWDSELVKHA  499

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFGS Y+EE IPSSL+E WK+P ++D +LHL
Sbjct  500   LSFFNPDNMRVDVLSKSFDKQSQAIQCEPWFGSHYIEEDIPSSLIESWKNPVQVDDNLHL  559

Query  1614  PAKNDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R A++      + P+CI+DEP +K WYK+D TF +PRANTYF + +K
Sbjct  560   PRKNEFIPGDFTLRNANSPGSSSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLIYVK  619

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               YS+L N++L +LF  LLKDELNE++YQA VAKLETS S+   KLE+K+YG+N KLP+L
Sbjct  620   DGYSSLENSVLIDLFANLLKDELNEVLYQAYVAKLETSTSVVASKLEIKLYGYNDKLPIL  679

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +L+   SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV++KL 
Sbjct  680   LSNILSTVRSFSPKTDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDKKLE  739

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             LL  L+  DL AF+P +LSQL+IEGLCHGN+ E+E +NIS IF +  S   LP E RH+E
Sbjct  740   LLMKLTFTDLVAFVPKILSQLHIEGLCHGNLSEDETINISKIFLNTLSAQTLPEEARHEE  799

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P+GA+LVR V+VKN L+ NSVVE+YF IE +VG E  +L+A+ DLF  I+EEP F
Sbjct  800   RVICIPNGANLVRSVRVKNDLEENSVVEVYFPIEQDVGKEATRLRAITDLFSNIIEEPCF  859

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y PIYLQ RIDNFI+    +LD L++
Sbjct  860   DQLRTKEQLGYTVDSSPRMTYRMLAYCFRVMSSKYSPIYLQSRIDNFIDGLSALLDELNE  919

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEK+PSLSY+T+  W QI DKRYMFD+S+ EAEELK+++K+D+I W
Sbjct  920   ETFEHHRSGLIADKLEKEPSLSYQTSDYWSQIADKRYMFDMSKLEAEELKTVQKADVIAW  979

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             Y+TY++   PK RRL++ V+GCN+   ++    E +  +I D  + K SS+FY S C
Sbjct  980   YNTYIRSSSPKRRRLAIHVYGCNSDIAEAAKLQEQSWTIIDDVESLKASSQFYSSLC  1036



>ref|XP_004500359.1| PREDICTED: nardilysin-like isoform X2 [Cicer arietinum]
Length=925

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/776 (74%), Positives = 665/776 (86%), Gaps = 3/776 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  141   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  200

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREV AVDSEFNQVLQ+D+CRLQQLQCHTS P HP N+FFWGNKKSL DA
Sbjct  201   ISPLVKMEAMEREVQAVDSEFNQVLQSDACRLQQLQCHTSTPNHPLNKFFWGNKKSLVDA  260

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LR+QI KLY+D Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG  V     +
Sbjct  261   MEKGIDLRDQILKLYNDYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGPQVNPKFPV  320

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAVKDVHIL+LSWTLPSL ++YL+K EDYLAHLLGHEG+GSLLFFLK
Sbjct  321   EGPIWKPGKLYRLEAVKDVHILDLSWTLPSLHQEYLKKPEDYLAHLLGHEGRGSLLFFLK  380

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEG++RSSIAY+F MSIHLTDSG +KIF+IIGFVYQYL LLR+ SPQ
Sbjct  381   AKGWATSLSAGVGDEGIYRSSIAYVFVMSIHLTDSGAEKIFDIIGFVYQYLNLLRQNSPQ  440

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG MEFRF EE+PQD+YAAELAENL  YP E V+YGDY Y+ WDEQLIK +
Sbjct  441   EWIFKELQNIGNMEFRFAEEQPQDDYAAELAENLKHYPAEHVIYGDYVYKTWDEQLIKQV  500

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+K  + S D+Q EPWFGS+YVEE I   L+ELW++P EID SLHLP
Sbjct  501   LGFFVPENMRVDVVSKLFHKSEDIQYEPWFGSRYVEEDIAQDLIELWRNPSEIDASLHLP  560

Query  1617  AKNDFIPSDFSIRA-DTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             +KN+FIPSDFSIRA DT   D  N  +P+CI+DE L+KFWYKLD+TFK+PRANTYFR+ L
Sbjct  561   SKNEFIPSDFSIRASDTGDDDSANSTSPRCIIDEALIKFWYKLDSTFKVPRANTYFRINL  620

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y N ++ +L+ELF+ LLKDELNEIVYQASVAKLETSV+  GD LELKVYGFN KLPV
Sbjct  621   KGGYDNAKSCVLSELFIHLLKDELNEIVYQASVAKLETSVAYVGDMLELKVYGFNEKLPV  680

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L+   SF+P DDR+ VIKEDM+R LKN+NMKPL+H+SYLRLQVLC+SF+DVEEKL
Sbjct  681   LLSKILSTAKSFTPTDDRYQVIKEDMKRALKNSNMKPLSHSSYLRLQVLCESFYDVEEKL  740

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               LN L L DLKAF+P+L SQLYIEGLCHGN+ EEEA++I  IF   F V PLP + RH 
Sbjct  741   HYLNELLLDDLKAFVPELRSQLYIEGLCHGNLSEEEAISIYHIFKRNFPVNPLPIKSRHA  800

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRD+ VKN L+ NSV+ELYFQIE ++G    KLKAL+DLFDEIVEEPL
Sbjct  801   ERVICLPSNANLVRDINVKNNLEKNSVIELYFQIEQDLGLGSTKLKALIDLFDEIVEEPL  860

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEIL  2675
             F++LRTKEQLGYVV+CSPRVTYR+ GFCF +QSS+Y+PIYLQGRI++FIN  +E+L
Sbjct  861   FNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQSSDYNPIYLQGRIESFINGLEELL  916



>ref|XP_003557963.1| PREDICTED: nardilysin [Brachypodium distachyon]
Length=1035

 Score =  1169 bits (3024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/898 (63%), Positives = 708/898 (79%), Gaps = 5/898 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNA+TETE+TCYHF+VKRE+L GAL RFSQFF
Sbjct  139   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAFTETEYTCYHFDVKREYLKGALDRFSQFF  198

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL +A
Sbjct  199   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSHGHPLNRFTWGNKKSLVEA  258

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD LE+W +ELFS VK G ++  S + 
Sbjct  259   MGSGINLREEILQMYTSNYHGGMMKLVIIGGEPLDTLEAWTMELFSKVKAGPLLDISPKT  318

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               P WK+GKL+ LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  319   NMPFWKSGKLHKLEAVRDVHSLYLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  378

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG  G  RSS AYIF MSI LTDSGLK ++E+I  VYQYL LL++  PQ
Sbjct  379   AKGWASSLSAGVGSGGAQRSSYAYIFEMSIRLTDSGLKNLYEVITAVYQYLNLLKQSDPQ  438

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+Y  +LAEN+L Y  + +V G+Y YE W+ +L+K +
Sbjct  439   EWIFKELQDIGYMEFRFAEEQPPDDYVVDLAENMLFYSEKHIVAGEYLYEGWEPELVKHV  498

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVD+++K  +  S  ++CEPWFGSQY+EE IPSSL+E W++P +ID + HL
Sbjct  499   LSFFHPDNMRVDILSKLFDKQSQAIKCEPWFGSQYIEEDIPSSLIESWRNPGQIDANFHL  558

Query  1614  PAKNDFIPSDFSIRADTI--SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             P KN+FIP DF++R  +I  S +  N P+CI+DEP +K WYK+D+TF +PRANTYF +++
Sbjct  559   PRKNEFIPGDFTLRNASIDKSLNDDN-PRCIVDEPFIKLWYKMDSTFNVPRANTYFLISV  617

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K   S+LRN++LT+LF  LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL +
Sbjct  618   KDGCSSLRNSVLTDLFANLLKDELNEVLYQAYVAKLETSLSVVGSNLELKLYGYNDKLAI  677

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLS +LA + SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL
Sbjct  678   LLSNILAASQSFSPKIDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKL  737

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
              +L +L+ +DL AF+P+LLSQL+IEGLCHGN+  EE ++IS IF +  S   LP E RH 
Sbjct  738   EVLATLTFSDLAAFVPELLSQLHIEGLCHGNLSGEEVIHISKIFRNTLSAQTLPEEARHG  797

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V C+P+GA+ +R V+VKN  + NSVVE+YF +E +VG E  +L+A+ DLF  I+EEP 
Sbjct  798   ERVFCIPNGANFLRSVRVKNDPEENSVVEVYFPVEQDVGKEATRLRAITDLFSNIIEEPC  857

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             FD+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RIDNFIN    +LD LD
Sbjct  858   FDQLRTKEQLGYTVDSSPRMTYRVLAYCFRVMSSKYSPVYLQSRIDNFINGLSSLLDALD  917

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             +++FE+ KSGLIA  LEKDPSLSY+T   W QIVDKRYMFD+S+ EAEEL+++RK D+I 
Sbjct  918   EETFEHHKSGLIADKLEKDPSLSYQTGDYWSQIVDKRYMFDMSKLEAEELRTVRKEDVIS  977

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             WY TY++   PK RRL++ V+GCN+   ++    E +   I D  + K SS+FY S C
Sbjct  978   WYDTYIRSSSPKRRRLAIHVYGCNSDIAEAAKLQEQSWTAIDDVKSLKVSSQFYSSLC  1035



>ref|XP_006651351.1| PREDICTED: nardilysin-like [Oryza brachyantha]
Length=1041

 Score =  1165 bits (3015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/897 (62%), Positives = 707/897 (79%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNA+TETE+TCYHFEVKRE+L GAL RFSQFF
Sbjct  145   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVKREYLKGALDRFSQFF  204

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSL DA
Sbjct  205   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQGHPLNRFTWGNKKSLVDA  264

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD+LE W +ELFS VK G ++  S + 
Sbjct  265   MGSGINLREEILQMYTTNYHGGMMKLVIIGGEPLDILEGWTMELFSKVKAGPLLDMSPKT  324

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P W++GKL+ LEAV+D+H L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  325   DMPFWRSGKLHKLEAVRDIHSLCLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLCFLK  384

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +S+SAGVG  G  RSS AYIF MSI LTDSGLK ++E+I  VYQY+KLL++  PQ
Sbjct  385   AKGWASSLSAGVGTGGAQRSSYAYIFEMSIRLTDSGLKNLYEVISAVYQYIKLLKQSEPQ  444

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+YA +LAEN+L Y  + +V G+Y YE WD +L+K +
Sbjct  445   EWIFKELQDIGYMEFRFAEEQPPDDYAVDLAENMLHYSEKHIVSGEYIYEGWDPELVKHV  504

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVDV++KS +  S  +QCEPWFG+QY+EE IP+S +E W++P +ID + HL
Sbjct  505   LSFFHPDNMRVDVLSKSFDKQSQAIQCEPWFGAQYIEEDIPASFMESWRNPAQIDDAFHL  564

Query  1614  PAKNDFIPSDFSIRADTISCD-GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN+FIP DF++R   I      + P+CI+DEP +K WYK+D TF +PRANTYF +++K
Sbjct  565   PRKNEFIPGDFNLRNANIPKPLSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLISVK  624

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               YS L N++LT+LF  LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KLP+L
Sbjct  625   DGYSTLENSVLTDLFANLLKDELNEVLYQAYVAKLETSLSVVGSNLELKLYGYNDKLPIL  684

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV+EKL 
Sbjct  685   LSSILAASQSFSPKSDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDEKLE  744

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+ +DL A++P LLSQL+IEGLCHGN+ E+EA+NIS IF +      LP E RH E
Sbjct  745   VLMKLTFSDLVAYVPKLLSQLHIEGLCHGNLSEDEAINISKIFRNTLLGQTLPDEARHGE  804

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V C+P+G + VR V VKN+L+ NSVVE+YF +E ++G++  +L+A+ DLF  I+EEP F
Sbjct  805   RVFCIPNGTNFVRSVHVKNELEENSVVEVYFPVEQDIGNDATRLRAITDLFSNIIEEPCF  864

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY V  SPR+TYR+L +CF+V SS+Y PIYLQ RIDNFI+    +LD LD+
Sbjct  865   DQLRTKEQLGYTVHSSPRMTYRVLAYCFQVMSSKYSPIYLQSRIDNFIDGLSALLDGLDE  924

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ +SGLIA  LEKDPSLSY+T   W QIVDKRYMFD+S+ EAEEL+++RK D+I W
Sbjct  925   ETFEHHRSGLIADKLEKDPSLSYQTGDYWSQIVDKRYMFDMSKLEAEELRTVRKEDVISW  984

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKV-IKDPTAFKKSSEFYPSFC  3038
             ++TY+K   PK RRL++ ++GC +   ++    E + + I D  + K+SS+FY S C
Sbjct  985   FNTYIKPSSPKRRRLAIHLYGCKSDIAEATKLQEQSWIAIDDIKSLKRSSQFYSSLC  1041



>dbj|BAJ95837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1036

 Score =  1154 bits (2984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/897 (61%), Positives = 704/897 (78%), Gaps = 3/897 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+ FPDENEYDSYLSKHGGSSNA+TETE+TCYHFEV RE+L GAL RFSQFF
Sbjct  140   LEHMLFMGSSVFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVNREYLKGALDRFSQFF  199

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDSEFNQVLQ+DSCRL QLQ HT + GHP NRF WGNKKSLS+A
Sbjct  200   VSPLVKAEAMDREILAVDSEFNQVLQSDSCRLYQLQSHTCSQGHPLNRFTWGNKKSLSNA  259

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD LE+W +ELFS VK G +++ S + 
Sbjct  260   MGSGINLREEILQMYMSNYHGGMMKLVIIGGEPLDTLEAWTMELFSEVKAGPLLEISPKT  319

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK+GKLY LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  320   DMPFWKSGKLYKLEAVRDVHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  379

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +++SAGVG  G  RSS AYIF MSI L+DSGLK +FE+I  VYQY+ LL++  PQ
Sbjct  380   AKGWASTLSAGVGTGGTQRSSYAYIFEMSIRLSDSGLKNLFEVITAVYQYINLLKQSEPQ  439

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+Y  +LAEN+L Y  + ++ G+Y YE W+ +L+K +
Sbjct  440   EWIFKELQDIGYMEFRFAEEQPPDDYVVDLAENMLFYSEKHIISGEYIYEGWEPELVKHV  499

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVD++++S +  S  ++CEPWFGSQY+EE IPSSL+E W++P EID + HL
Sbjct  500   LSFFHPDNMRVDILSRSFDKQSQAIRCEPWFGSQYIEEDIPSSLIESWRNPVEIDGNFHL  559

Query  1614  PAKNDFIPSDFSIRADTI-SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN++IP DFS+R  +I      + P+CI+DEP +K W+K+D TF +PRAN YF +++K
Sbjct  560   PRKNEYIPGDFSLRNASIPKSSNDDNPRCIVDEPFIKLWHKMDITFNVPRANAYFLISVK  619

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                S+LRN++LT+LF  LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL +L
Sbjct  620   DGCSSLRNSVLTDLFANLLKDELNEVLYQAYVAKLETSLSVVGSNLELKLYGYNDKLAIL  679

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  +NTNMKP++H++YLRLQ L + FWDV EKL 
Sbjct  680   LSHILAASQSFSPKIDRFEVIKEDLERAYRNTNMKPMSHSTYLRLQFLRQIFWDVNEKLK  739

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L  L+ +DL AF+P+LLSQL+IEGLCHGN+  EEA+NIS+IF +  S   L  E RH E
Sbjct  740   VLAMLTFSDLAAFVPELLSQLHIEGLCHGNLSGEEAINISNIFRNTLSGQTLSVEARHGE  799

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V C+P GA+ +R V+VKN L+ NSVVE+Y+ +E ++G E  +L+A+ DLF  I+EEP F
Sbjct  800   RVFCIPHGANFIRSVRVKNDLEENSVVEVYYPVEQDIGKESTRLRAITDLFSNIIEEPCF  859

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS++ P+YLQ RIDNFI+    +LD L++
Sbjct  860   DQLRTKEQLGYTVDSSPRMTYRLLAYCFRVMSSKHSPVYLQSRIDNFIDGLSALLDGLEE  919

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++FE+ KSGLIA+ LEKDPSLSY+T   W QI DKRYMFD+++ EAEEL+++ K D+I W
Sbjct  920   ETFEHHKSGLIAQKLEKDPSLSYQTGDYWSQITDKRYMFDMAKLEAEELRTVGKEDVISW  979

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             Y+TY++   P  RRL++ V+GCN+   ++    E +   I D  + K SS+FYP+ C
Sbjct  980   YNTYIRSSSPTRRRLAIHVYGCNSDIAEAAKLQEQSWTAIDDVESLKVSSQFYPNLC  1036



>ref|XP_007017078.1| Insulinase (Peptidase family M16) family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34697.1| Insulinase (Peptidase family M16) family protein isoform 2 [Theobroma 
cacao]
Length=820

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/769 (72%), Positives = 652/769 (85%), Gaps = 3/769 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EH+CYHFEV+REFL GAL+RFSQFF
Sbjct  21    LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHSCYHFEVEREFLKGALRRFSQFF  80

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQ LQNDS RLQQLQCHTS  GHPFN F WGNKKSL DA
Sbjct  81    ISPLVKLEAMEREVLAVDSEFNQALQNDSFRLQQLQCHTSEHGHPFNTFSWGNKKSLVDA  140

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LR+QI +LY D Y+G  MKLV+IGGE LD+L+ WV+ELF  V++G + +    +
Sbjct  141   VEKGIDLRKQILELYKDYYHGGLMKLVVIGGEPLDLLQQWVVELFLDVRQGSLGRPEFTV  200

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E P+W+AGKLY L+AVKDVHILEL WTLP L ++YL+K E YLAHLLGHEGKGSL +F K
Sbjct  201   EGPVWRAGKLYRLQAVKDVHILELRWTLPCLLQEYLKKPEAYLAHLLGHEGKGSLHYFFK  260

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGV D+GM RSS+AYIF MSIHLTDSGL+KI ++IG+VYQYLKLL  +SPQ
Sbjct  261   AKGWATSLSAGVSDDGMQRSSVAYIFSMSIHLTDSGLEKILDVIGYVYQYLKLLHLLSPQ  320

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ++G ++FRF EEEPQD+YA+ELAENLLVYP E V+YGDY +E WDE++I+ I
Sbjct  321   EWIFKELQEMGNLDFRFAEEEPQDDYASELAENLLVYPAEHVIYGDYVFEFWDEEMIRKI  380

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DVV+KS   S DV+ EPWFGS YVEE I  SL+ELW+DPP+IDVSLHLP
Sbjct  381   LGFFTPENMRIDVVSKSF-KSQDVKYEPWFGSHYVEEEISPSLMELWRDPPDIDVSLHLP  439

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSIRAD +  D  N   P CILDEPLMKFWYKLD+TFKLPRANTYF++ LK
Sbjct  440   LKNEFIPCDFSIRADNMQIDPANESLPVCILDEPLMKFWYKLDSTFKLPRANTYFQINLK  499

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY NL++ LLTEL++ LLKDELNEI+YQASVAKLETSV++Y DKL LK+YGFN KLPVL
Sbjct  500   GAYLNLKSCLLTELYIHLLKDELNEIIYQASVAKLETSVAMYSDKLGLKLYGFNDKLPVL  559

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             L  VLA+  SF P +DRF VIKE++ERTLKN NMKPL H+SYLRLQ+LCKSF+DV+EKL 
Sbjct  560   LCTVLAIANSFLPTNDRFKVIKENVERTLKNANMKPLRHSSYLRLQILCKSFYDVDEKLA  619

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L  LSL+DLKAF+P+L SQ++IEGLCHGN+LE+E ++IS+IF S FSV P+P  MRH+E
Sbjct  620   FLKDLSLSDLKAFIPELRSQIHIEGLCHGNLLEKEVLDISNIFKSNFSVQPMPVTMRHRE  679

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C PSGA+ VRDV VKNK +TNSV+ELYFQIEPEVG E +KLKAL+DLFDEIVEEP +
Sbjct  680   QVICFPSGANFVRDVSVKNKSETNSVLELYFQIEPEVGVEAVKLKALIDLFDEIVEEPHY  739

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIN  2657
             ++LRTKEQLGYVV CSPRVTYR+ GFCF +QSS+Y P++  G+  +  N
Sbjct  740   NQLRTKEQLGYVVQCSPRVTYRVYGFCFCIQSSKYSPVWEVGKQQHSFN  788



>ref|XP_004296020.1| PREDICTED: insulin-degrading enzyme-like [Fragaria vesca subsp. 
vesca]
Length=999

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/894 (62%), Positives = 699/894 (78%), Gaps = 10/894 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FP ENEYDSYLSKHGGSSNAYT  EHTCY FEV  EFL GAL RFSQFF
Sbjct  103   LEHMLFMGSTKFPIENEYDSYLSKHGGSSNAYTCAEHTCYFFEVSPEFLKGALTRFSQFF  162

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K E MERE+ A+DSEFN+VLQND CRL+QLQC+TS+PGHPFNRF  GNKKSL DA
Sbjct  163   VSPLIKIEPMEREIQAIDSEFNRVLQNDFCRLRQLQCYTSSPGHPFNRFSQGNKKSLDDA  222

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ++G+NL+EQI KLY + Y+G  MKLV+IGGE+LD+LE W+LELF  VK G  V    + 
Sbjct  223   MKKGINLQEQILKLYRNYYHGGLMKLVVIGGESLDLLEKWILELFGDVKTGTQVNLEFKA  282

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK+GK+Y LEAV+DVHIL+LSWTLP LR+ YL+  E YL HLL HEGKGSL F+LK
Sbjct  283   EGPIWKSGKVYRLEAVQDVHILQLSWTLPCLRQHYLKGPEFYLHHLLEHEGKGSLHFYLK  342

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVT + A V      R  +A +F M I+LTDSGL+KIFEIIG VYQY+KLLR+ +P 
Sbjct  343   ARGWVTYLGASVS-----RYPVADVFCMIIYLTDSGLEKIFEIIGLVYQYIKLLRQETP-  396

Query  1257  EWIFKELQDIGFMEFRFIEEEP-QDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKD  1433
             EWIF+ELQDIG M F+F EEEP QD+YA+ LAENL  Y  E V+YGDY ++IWDE LI+ 
Sbjct  397   EWIFRELQDIGNMCFKFAEEEPFQDDYASNLAENLQRYAAEHVIYGDYMFDIWDEVLIQK  456

Query  1434  ILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             +LGF   +NMR+DVV+KS + + + QCEPW+GS Y EE +  SL+ELWKDPPEIDVSLHL
Sbjct  457   VLGFLSPENMRIDVVSKSSSKTEEFQCEPWYGSHYTEEDLSPSLMELWKDPPEIDVSLHL  516

Query  1614  PAKNDFIPSDFSIRADTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              AKN+FIPSDFSIR+D I  D  N  +P CILDEPLMK WYKLD+TFKLPRAN YF + +
Sbjct  517   RAKNEFIPSDFSIRSDGICLDISNISSPTCILDEPLMKIWYKLDSTFKLPRANAYFFIRM  576

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K  Y N+++++LT++++ LL+DEL+EI+YQA VA L TS+S++ DKL+L+VYGFN KLP 
Sbjct  577   KCGYDNVKSSVLTDIYIDLLEDELSEIIYQAHVACLGTSISVFTDKLQLQVYGFNDKLPA  636

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK+L    SF P DDRF VIKEDM R  +N NM P   ++YLR QVL +SF++V+E  
Sbjct  637   LLSKILETVKSFLPTDDRFKVIKEDMVRVYRNANMNPWCQSTYLREQVLLQSFYNVDELF  696

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
              +LN LS++DLK+F+P+L SQ+YIEGL HGN+ +EEA+++S++F + FSV  LP E+  +
Sbjct  697   HVLNGLSVSDLKSFIPELFSQIYIEGLFHGNLSQEEAISLSNLFKTNFSVQSLPVELMFR  756

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
              + +CLP  A+L+RD  VKNK +TNSV ELYFQIE  VGSE +K K L+DL D I++EPL
Sbjct  757   NHCICLPPNANLIRDATVKNKSETNSVAELYFQIEWAVGSESMKWKVLIDLLDAIIKEPL  816

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGY V+C   + + + G  F VQSSEY+PI+LQGR+DNFIN  + +L+ LD
Sbjct  817   FNQLRTKEQLGYGVECGRDLKWGVFGILFSVQSSEYNPIHLQGRLDNFINGLEVLLEGLD  876

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             DDSFEN+K+GL+  LL+KD SL+ ETNR W +I  KRYMF+ S+K AEEL+SI+K D+I 
Sbjct  877   DDSFENYKAGLMKNLLKKDTSLTRETNRFWNEIYIKRYMFNYSKKAAEELRSIKKEDVII  936

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASM-EPAKVIKDPTAFKKSSEFY  3026
             +Y TYL+Q  PKCRRL+ RVWGCNT  K +DA+  E  +VI+D  A K SS+FY
Sbjct  937   FYKTYLQQSSPKCRRLATRVWGCNTNFKKADAARPESVQVIEDVAALKMSSKFY  990



>ref|XP_004300711.1| PREDICTED: insulin-degrading enzyme-like [Fragaria vesca subsp. 
vesca]
Length=967

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/892 (62%), Positives = 699/892 (78%), Gaps = 11/892 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYDSYLSKHGGSSNA T  E+T YHFEVK EFL GAL RFSQFF
Sbjct  83    LEHMLFMGSTKFPDENEYDSYLSKHGGSSNACTREENTSYHFEVKPEFLKGALTRFSQFF  142

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K+EAMERE+ ++DSEFN+VLQND CRL+QLQ HT+ PGHPFN F  GNK+SL DA
Sbjct  143   VSPLMKSEAMERELQSIDSEFNRVLQNDFCRLEQLQGHTATPGHPFNNFSRGNKRSLDDA  202

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLR+QI ++Y D Y+G  MKLV+IGGE+LD+LE WVLELF  VKKG  V    + 
Sbjct  203   REKGINLRQQIMQMYTDYYHGGLMKLVVIGGESLDILEQWVLELFGDVKKGPQVNLEFKA  262

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW  GKLY LEAV DVHIL L+W LPSL + YL+  + +L+HLL HEG+GSL F+LK
Sbjct  263   EGPIWNVGKLYRLEAVNDVHILHLAWALPSLHQHYLKCPDYFLSHLLEHEGRGSLYFYLK  322

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW T ++A V     +R S+A +F M I+LTDSGL++IFEI+G VYQY+KLLR+VSPQ
Sbjct  323   AKGWATYLNASV-----NRYSVADVFCMIIYLTDSGLEQIFEIVGSVYQYIKLLRQVSPQ  377

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+ELQDIG M FRF++++PQD+YA +L  NLL Y  E V+YGDY YE WD++LI+ +
Sbjct  378   EWIFRELQDIGNMSFRFMQDQPQDDYAVKLGGNLLRYSAEHVIYGDYVYETWDKELIEYV  437

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFFR +NMR+DV++KS     + QCEPWFGS Y EE I  SL+ LWKDPPE+D SLHLP
Sbjct  438   LGFFRPENMRIDVISKSSFKLENFQCEPWFGSHYTEEDISPSLMNLWKDPPEVDNSLHLP  497

Query  1617  AKNDFIPSDFSIRADTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN FIP DFSIR+D    D  N  +P+CILDEPL+K WYKLD+TFK PR N YFR+ LK
Sbjct  498   LKNMFIPGDFSIRSDVCCPDSANISSPRCILDEPLVKIWYKLDSTFKQPRVNAYFRINLK  557

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             G Y N+++ +LTEL++ LL+DELNEIVYQA+VA L T V+   D +ELKVYGFN KLP L
Sbjct  558   GGYDNVKSYVLTELYIELLEDELNEIVYQANVAGLGTHVNGSNDFMELKVYGFNDKLPAL  617

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LSK+L VT +F P  DRF VI+E MER LKNTNM P +H+SYLR QVL   ++DV+E+L 
Sbjct  618   LSKILTVTRNFLPTYDRFEVIRERMERMLKNTNMDPQSHSSYLRRQVLYHKYYDVDEELQ  677

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +LNSLS++D+K F+P+L SQLYIEG CHGN++EEEA+++S+IF + F+V PLP E+RHK+
Sbjct  678   VLNSLSVSDMKLFIPELCSQLYIEGFCHGNLVEEEALHLSNIFKTNFTVEPLPIELRHKD  737

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
             + MCLP  A+LVR+  VKN  +TNSV+ELYFQIE E      +L+AL  LF +IV+EPL+
Sbjct  738   HCMCLPPSANLVREACVKNNSETNSVIELYFQIEIES----TRLRALAKLFMKIVDEPLY  793

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGYVV C  R   R+ GF F V+SSE++PIYLQGR+DNFIN    +L  LDD
Sbjct  794   DQLRTKEQLGYVVWCGLREICRVYGFVFCVESSEHNPIYLQGRVDNFINGVDLLLHGLDD  853

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             DSFEN+K GLIA LLE+D +L +ET+RLW +I +KRY +D  ++ AEE++S++K D+I +
Sbjct  854   DSFENYKDGLIANLLERDETLGHETSRLWEEITNKRYTYDWPKRVAEEVRSLQKEDIINF  913

Query  2871  YHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFY  3026
             Y TYL+   PKCRRL++RVWGCN+  K+++A  E  ++I+D  AFK SSEFY
Sbjct  914   YKTYLQPSSPKCRRLAIRVWGCNSDLKEAEAPPESIQLIQDLAAFKMSSEFY  965



>ref|XP_004296019.1| PREDICTED: insulin-degrading enzyme-like [Fragaria vesca subsp. 
vesca]
Length=953

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/892 (63%), Positives = 690/892 (77%), Gaps = 4/892 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEY SYLSKHGGSSNAYT  EHT Y F+VKREFL GAL+RFSQFF
Sbjct  51    LEHMLFMGSTKFPDENEYASYLSKHGGSSNAYTAAEHTSYFFDVKREFLKGALERFSQFF  110

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPL+K+EAMEREV A+DSEFN  LQ+D  RL QLQ HTS+PGHPFNRF  GNKKSL DA
Sbjct  111   VSPLMKSEAMEREVQAIDSEFNTHLQDDFSRLGQLQGHTSSPGHPFNRFPCGNKKSLDDA  170

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+NL+E+I KLY D Y+G  MKLV+IGGE+L+VLE WVLELF  VKKG  VK   + 
Sbjct  171   KDNGINLQERILKLYRDYYHGGLMKLVVIGGESLNVLEHWVLELFGDVKKGPQVKLEFKT  230

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWKAGKLY LEAV DVHIL L+W LP L++ YL+K E YL HLLGHEG+GSL  +LK
Sbjct  231   EGPIWKAGKLYRLEAVDDVHILHLAWILPCLQEHYLKKPEGYLCHLLGHEGRGSLYSYLK  290

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GWVTS+ AGV       SS+AYIF M I+LTDSGL+KIFEIIGFVYQY++LLR++SPQ
Sbjct  291   ARGWVTSLDAGVSKSDC--SSVAYIFCMVIYLTDSGLEKIFEIIGFVYQYIELLRQMSPQ  348

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+EL DIG MEF F EE+  D+YA+ LAENLL Y  E V+YGDY  E WD++LI+ +
Sbjct  349   EWIFRELHDIGNMEFIFAEEQDHDDYASGLAENLLCYATEHVIYGDYVNESWDKELIEYV  408

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMR+DV++KSL  S D QCEPWFGS Y EE I   L +LWK+P E +VSLHLP
Sbjct  409   LGFFWPENMRIDVISKSLFKSEDFQCEPWFGSHYTEEDISPYLRDLWKNPQETNVSLHLP  468

Query  1617  AKNDFIPSDFSIRADTISCDGG-NAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKG  1793
              KNDFIP DFSIR+D +  D     P+CILD+PLMKFWYKLD+TFKLP  NTYFR+ LKG
Sbjct  469   EKNDFIPRDFSIRSDGLCIDTAMTYPRCILDQPLMKFWYKLDSTFKLPHVNTYFRINLKG  528

Query  1794  AYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLL  1973
             AY N+++ +LT L++ LL DELNEI+Y+ASVA L+TS SL  DKL+L VYGF+ KLP LL
Sbjct  529   AYDNVKSCVLTSLYLDLLTDELNEILYEASVASLQTSFSLSQDKLQLLVYGFHDKLPALL  588

Query  1974  SKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcl  2153
             SK+L    SF P DDRF V KEDM R   NTNM   ++++YLR QVL +SF+ V+E+L +
Sbjct  589   SKILETVKSFLPTDDRFEVFKEDMGRAYANTNMDAWSYSTYLRDQVLLQSFYTVDEQLHV  648

Query  2154  lnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEY  2333
             LN LS++DL +F+P++ SQLYIEGL HGN+ EEEA+ ++  F   F+VPPLP E+ ++ +
Sbjct  649   LNGLSVSDLISFIPEIFSQLYIEGLLHGNLSEEEAITLAKSFQQNFAVPPLPTELVYRNH  708

Query  2334  VMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFD  2513
              +CLP  A+L+ D  VKNK +TNSV++LYFQIE  + SE I+LK LVDLF EIV+EP FD
Sbjct  709   CICLPPNANLIIDTTVKNKSETNSVLQLYFQIEQAMRSESIRLKLLVDLFHEIVQEPFFD  768

Query  2514  RLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDD  2693
             +LRTKEQLGYVV C    T ++ GF F VQSS+Y+P++LQ R++NFI   +E+L  LDDD
Sbjct  769   QLRTKEQLGYVVLCGWTHTCKVFGFYFSVQSSKYNPVHLQSRLENFIVGLEELLKGLDDD  828

Query  2694  SFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWY  2873
             SFEN+K GL+AKL EKD SL+ ET RLW QI+ K Y F+ S+  AE+L SI+K D+  +Y
Sbjct  829   SFENYKGGLMAKLFEKDASLTCETYRLWTQILGKWYTFEYSKMAAEQLISIQKEDVTNFY  888

Query  2874  HTYLKQPFPKCRRLSVRVWGCNTQRKDS-DASMEPAKVIKDPTAFKKSSEFY  3026
              TYL Q  PKCRRL+ RVWGCNT  K++ +A  E  +VI+D +AFK SS+FY
Sbjct  889   KTYLHQSSPKCRRLTTRVWGCNTDLKEAEEARPESEQVIEDLSAFKMSSKFY  940



>emb|CDY09948.1| BnaC08g45030D [Brassica napus]
Length=947

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/824 (66%), Positives = 664/824 (81%), Gaps = 23/824 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGG+SNAYTE EHT               K  + FF
Sbjct  128   LEHMLFMGSTEFPDENEYDSYLSKHGGASNAYTEMEHTYLE------------KVLTLFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQ QC+TSA GHPFNRF WGNKKSLS A
Sbjct  176   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQFQCYTSAKGHPFNRFSWGNKKSLSGA  235

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  V+ +   
Sbjct  236   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGDVKSGSKVRPTLEA  295

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW+ GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  296   KGPIWEGGKLYRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  355

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++IIG++YQYLKLLR+VSPQ
Sbjct  356   GKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQ  415

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+FR+ EE+  D+YA EL+EN+L YP E ++YGDY Y+ WD ++I+D+
Sbjct  416   EWIFKELQDIGNMDFRYAEEQAADDYATELSENMLAYPVEHIIYGDYVYQTWDPKMIEDL  475

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+++EE +PSSL+E+W +P E+D SLHLP
Sbjct  476   MGFFTPKNMRIDVVSKSI-KSEEFQTEPWFGSRFIEEDVPSSLMEIWSNPSEVDNSLHLP  534

Query  1617  AKNDFIPSDFSIRADTISCDGG----NAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVT  1784
             +KN FIP DFS+RA  IS D      + PKCI+DEPLMKFWYKLD TFK+PRANTYFR+ 
Sbjct  535   SKNQFIPYDFSLRA--ISSDADPKIQSPPKCIIDEPLMKFWYKLDETFKVPRANTYFRIN  592

Query  1785  LKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLP  1964
             LKGAY +++N LLTELF+ LLKDELNEI   AS+AKLETS+S+YGDKLELKVYGFN K+P
Sbjct  593   LKGAYDSMKNCLLTELFINLLKDELNEI---ASIAKLETSLSMYGDKLELKVYGFNEKIP  649

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEk  2144
              LLSK+LA+  SF P  DRF VIKE+MER  +NTNMKPLNH++YLRLQ+LCK  +D +EK
Sbjct  650   ALLSKILAIAKSFMPSLDRFKVIKENMERGFRNTNMKPLNHSTYLRLQLLCKRIYDSDEK  709

Query  2145  lcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRH  2324
             L +LN LSL DL +F+P + SQ++IE LCHGN+ E+EAVNIS IF +  +  PLP + RH
Sbjct  710   LSVLNDLSLNDLNSFIPVVRSQIFIEALCHGNLSEDEAVNISRIFKNSLTTEPLPVKCRH  769

Query  2325  KEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEP  2504
              E + C P  A LVRDV VKNK +TNSVVELY+QIEPE  ++  ++KA++DLF EI+EEP
Sbjct  770   GEQITCFPLSAKLVRDVNVKNKSETNSVVELYYQIEPE-EAQSTRMKAMLDLFHEIIEEP  828

Query  2505  LFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNL  2684
             LF++LRTKEQL Y VDC PR+TYR+ GFCF VQSS+Y P++L GRIDNFI D + +L+ L
Sbjct  829   LFNQLRTKEQLCYDVDCGPRLTYRVHGFCFCVQSSKYGPVHLLGRIDNFIKDIEALLEQL  888

Query  2685  DDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
             D++SF +++SG+IA+LLEKDPSL  ETN LW QIVDK     LS
Sbjct  889   DEESFGDYRSGVIARLLEKDPSLLSETNELWSQIVDKSKTLSLS  932



>ref|XP_002518286.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44046.1| conserved hypothetical protein [Ricinus communis]
Length=929

 Score =  1093 bits (2826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/894 (63%), Positives = 672/894 (75%), Gaps = 102/894 (11%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVK EFL GAL+R     
Sbjct  138   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKPEFLKGALRR-----  192

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
                                                          F++FF      + +A
Sbjct  193   ---------------------------------------------FSQFFISPLVKI-EA  206

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ER V LR        D Y+G  MKLV+IGGE+LDVLE WV EL + V+KG + K +  +
Sbjct  207   MEREV-LR--------DYYHGGLMKLVVIGGESLDVLEGWVTELLANVRKGSLAKPTFEM  257

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIWK GKLY LEAVKDVHIL+L+WTLP LR+DYL+K+EDYLAHLLGHEG+GSL  FLK
Sbjct  258   QGPIWKTGKLYRLEAVKDVHILDLTWTLPCLRQDYLKKSEDYLAHLLGHEGRGSLHSFLK  317

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGDEGMHRSSIAYIFGMSIHLTDSGL+KIF++IGFVYQYLKLLR+VSPQ
Sbjct  318   AKGWATSLSAGVGDEGMHRSSIAYIFGMSIHLTDSGLEKIFDMIGFVYQYLKLLRQVSPQ  377

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDI  MEFRF EE+PQD+YAAELAE+LLVYP E V+YG+Y Y++WDE++IK +
Sbjct  378   EWIFKELQDIANMEFRFAEEQPQDDYAAELAEHLLVYPAEHVIYGEYLYKVWDEEMIKHL  437

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LG    +NMR+DVV+KS                  E+ +   L+ +       +VSL   
Sbjct  438   LGVLTPENMRIDVVSKSFTK---------------EQVLHMYLIYICCMEIRYEVSLX--  480

Query  1617  AKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGA  1796
                                      +CI+DEPLMKFWYKLDNTFKLPRANTYFR+ LKGA
Sbjct  481   -------------------------RCIIDEPLMKFWYKLDNTFKLPRANTYFRINLKGA  515

Query  1797  YSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLS  1976
             YSN+ + LLTELF+ LLKDELNEI+YQAS+AKLETSVS  GD LELKVYGFN K+PVLLS
Sbjct  516   YSNVTSCLLTELFIQLLKDELNEIIYQASIAKLETSVSFIGDMLELKVYGFNDKVPVLLS  575

Query  1977  KVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcll  2156
             KVL +  SF P +DRF VIKE++ER+LKN NMKPL+H+SYLRLQVLCKSF+DVEEKLC+L
Sbjct  576   KVLVIAKSFLPTNDRFKVIKENIERSLKNANMKPLSHSSYLRLQVLCKSFYDVEEKLCVL  635

Query  2157  nslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYV  2336
              +LSLADLKAF+ +L SQL+IEGLCHGN+LE EA+N+S+IF S  S+ PLP  MRH+E V
Sbjct  636   RNLSLADLKAFILELRSQLFIEGLCHGNLLEGEAINLSNIFKSNLSLQPLPVHMRHRESV  695

Query  2337  MCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDR  2516
             + LP G++L RDV VKNK +TNSVVELYFQIEPE+G   IKLKALVDLFDEIV+EPLF++
Sbjct  696   LSLPLGSNLARDVNVKNKSETNSVVELYFQIEPEIGLNSIKLKALVDLFDEIVDEPLFNQ  755

Query  2517  LRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDS  2696
             LRTKEQLGYVV+CSPRVTYR+ GFCF VQSS+Y P+YLQ RI+NFI+  +E+L  LD+ S
Sbjct  756   LRTKEQLGYVVECSPRVTYRVYGFCFCVQSSKYSPVYLQDRIENFISGLEELLAVLDEAS  815

Query  2697  FENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYH  2876
             FEN+K+GL+AKLLEKDPSL YETNRLW QIVDKRY FD SE+EAEELK+I K+D++ WY 
Sbjct  816   FENYKNGLMAKLLEKDPSLQYETNRLWNQIVDKRYTFDFSEQEAEELKTINKNDVVNWYK  875

Query  2877  TYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             TYL+Q   KCRRL+VRVWGCNT  K+ + + +  +VIKD + FK SSE+YPSFC
Sbjct  876   TYLQQSSSKCRRLAVRVWGCNTSLKEFETTRDSEQVIKDLSTFKMSSEYYPSFC  929



>ref|XP_006579996.1| PREDICTED: nardilysin-like [Glycine max]
Length=944

 Score =  1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/725 (72%), Positives = 615/725 (85%), Gaps = 4/725 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  221   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  280

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQ+D+CRLQQLQCHTSA  HP NRFFWGNKKSL DA
Sbjct  281   ISPLVKMEAMEREVLAVDSEFNQVLQSDACRLQQLQCHTSAHNHPLNRFFWGNKKSLVDA  340

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLVIIGGE+LDVLESWV+ELF  +KKG        +
Sbjct  341   MEKGINLREQILKLYKDYYHGGLMKLVIIGGESLDVLESWVVELFGAIKKGQ-ANPVFTV  399

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIW++GK+Y LEAVKDVHIL+LSWTLP L ++YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  400   EGPIWESGKVYRLEAVKDVHILDLSWTLPCLHQEYLKKPEDYLAHLLGHEGRGSLLSFLK  459

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             ++GW TS+SAGVG+EG++RSSIAY+F MSIHLTDSG++KIF+IIGFVYQYLKLLRE +P 
Sbjct  460   SRGWATSLSAGVGEEGIYRSSIAYVFVMSIHLTDSGIEKIFDIIGFVYQYLKLLREDTPP  519

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ+IG M+FRF EE+P D+YAAELAENL  YPPE V+YGDY ++ WDEQL+K +
Sbjct  520   EWIFKELQNIGNMDFRFAEEQPPDDYAAELAENLHFYPPEHVIYGDYVFKTWDEQLLKQV  579

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             LGFF  +NMRVDVV+KS   S D Q EPWFGS+YVEE I  S  ELW++PPEID SLHLP
Sbjct  580   LGFFVPENMRVDVVSKSFLKSEDFQYEPWFGSRYVEEDIAQSFRELWRNPPEIDASLHLP  639

Query  1617  AKNDFIPSDFSIRA-DTISCDGGN--APKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
             ++N+FIPSDFSIRA DT   D  N  +P+C++DE L+KFWYK D+TFK+PRANTYFR+T+
Sbjct  640   SQNEFIPSDFSIRASDTCVDDFANSTSPRCLIDEALIKFWYKPDSTFKVPRANTYFRITM  699

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             KG Y+++++ +L+ELF+ LLKDELNEI YQAS+AKLETSV+  GD LELKVYGFN KLPV
Sbjct  700   KGGYADVKSCVLSELFIHLLKDELNEITYQASIAKLETSVTYVGDMLELKVYGFNEKLPV  759

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             LLSK  +V+ SF P DDRF VIKEDM+R LKN NMKPL+H++YLRLQVLC+SF+D +EKL
Sbjct  760   LLSKFFSVSKSFMPTDDRFKVIKEDMKRALKNANMKPLSHSTYLRLQVLCESFYDADEKL  819

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               LN L L DLKAF+P LLSQ+Y+EGLCHGN+ +EEA+ I+ IF   F V PLP E+RH 
Sbjct  820   HYLNDLFLDDLKAFIPGLLSQIYMEGLCHGNLSKEEAIGIAKIFKMNFPVNPLPIELRHA  879

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E V+CLPS A+LVRDV VKNK + NSVVELYFQIE + G   IKLKAL+DLFDEIVEEP 
Sbjct  880   ERVICLPSSANLVRDVNVKNKSEKNSVVELYFQIEQDFGLGSIKLKALIDLFDEIVEEPF  939

Query  2508  FDRLR  2522
             F++LR
Sbjct  940   FNQLR  944



>ref|XP_007017079.1| Insulinase (Peptidase family M16) family protein isoform 3 [Theobroma 
cacao]
 gb|EOY34698.1| Insulinase (Peptidase family M16) family protein isoform 3 [Theobroma 
cacao]
Length=770

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/769 (67%), Positives = 612/769 (80%), Gaps = 53/769 (7%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EH+CYHFEV+REFL GAL+RFSQFF
Sbjct  21    LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHSCYHFEVEREFLKGALRRFSQFF  80

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQ LQNDS RLQQLQCHTS  GHPFN F WGNKKSL DA
Sbjct  81    ISPLVKLEAMEREVLAVDSEFNQALQNDSFRLQQLQCHTSEHGHPFNTFSWGNKKSLVDA  140

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G++LR+QI +LY D Y+G  MKLV+IGGE LD+L+ WV+ELF  V++G + +    +
Sbjct  141   VEKGIDLRKQILELYKDYYHGGLMKLVVIGGEPLDLLQQWVVELFLDVRQGSLGRPEFTV  200

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E P+W+AGKLY L+AVKDVHILEL WTLP L ++YL+K E YLAHLLGHEGKGSL +F K
Sbjct  201   EGPVWRAGKLYRLQAVKDVHILELRWTLPCLLQEYLKKPEAYLAHLLGHEGKGSLHYFFK  260

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGV D+GM RSS+AYIF MSIHLTDSGL+KI ++IG+VYQYLKLL  +SPQ
Sbjct  261   AKGWATSLSAGVSDDGMQRSSVAYIFSMSIHLTDSGLEKILDVIGYVYQYLKLLHLLSPQ  320

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQ++G ++FRF EEEPQD+YA+ELA                             
Sbjct  321   EWIFKELQEMGNLDFRFAEEEPQDDYASELA-----------------------------  351

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
                                   DV+ EPWFGS YVEE I  SL+ELW+DPP+IDVSLHLP
Sbjct  352   ----------------------DVKYEPWFGSHYVEEEISPSLMELWRDPPDIDVSLHLP  389

Query  1617  AKNDFIPSDFSIRADTISCDGGNA--PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
              KN+FIP DFSIRAD +  D  N   P CILDEPLMKFWYKLD+TFKLPRANTYF++ LK
Sbjct  390   LKNEFIPCDFSIRADNMQIDPANESLPVCILDEPLMKFWYKLDSTFKLPRANTYFQINLK  449

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
             GAY NL++ LLTEL++ LLKDELNEI+YQASVAKLETSV++Y DKL LK+YGFN KLPVL
Sbjct  450   GAYLNLKSCLLTELYIHLLKDELNEIIYQASVAKLETSVAMYSDKLGLKLYGFNDKLPVL  509

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             L  VLA+  SF P +DRF VIKE++ERTLKN NMKPL H+SYLRLQ+LCKSF+DV+EKL 
Sbjct  510   LCTVLAIANSFLPTNDRFKVIKENVERTLKNANMKPLRHSSYLRLQILCKSFYDVDEKLA  569

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L  LSL+DLKAF+P+L SQ++IEGLCHGN+LE+E ++IS+IF S FSV P+P  MRH+E
Sbjct  570   FLKDLSLSDLKAFIPELRSQIHIEGLCHGNLLEKEVLDISNIFKSNFSVQPMPVTMRHRE  629

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C PSGA+ VRDV VKNK +TNSV+ELYFQIEPEVG E +KLKAL+DLFDEIVEEP +
Sbjct  630   QVICFPSGANFVRDVSVKNKSETNSVLELYFQIEPEVGVEAVKLKALIDLFDEIVEEPHY  689

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIN  2657
             ++LRTKEQLGYVV CSPRVTYR+ GFCF +QSS+Y P++  G+  +  N
Sbjct  690   NQLRTKEQLGYVVQCSPRVTYRVYGFCFCIQSSKYSPVWEVGKQQHSFN  738



>gb|KGN47209.1| hypothetical protein Csa_6G205830 [Cucumis sativus]
Length=759

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/747 (68%), Positives = 611/747 (82%), Gaps = 5/747 (1%)
 Frame = +3

Query  810   ETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSL  989
             E LDVLESWVLELF  VKKG   K    ++ PIW++GKLY LEAV+DVHIL+L+WTLP L
Sbjct  14    EPLDVLESWVLELFGDVKKGVQAKPKFTVKDPIWQSGKLYKLEAVEDVHILDLAWTLPCL  73

Query  990   RKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIH  1169
             + +YL+K EDY+AHLLGHEG GSL F LK KGW TS+SAGVGDEGM RSS+AY+FGMSI+
Sbjct  74    QHNYLKKPEDYVAHLLGHEGNGSLHFSLKAKGWATSLSAGVGDEGMCRSSMAYVFGMSIY  133

Query  1170  LTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELA  1349
             LTDSG +KIFEIIG+VYQYLKLLR++SPQEWIF+ELQDIG M+FRF EE+PQD+YAAELA
Sbjct  134   LTDSGKEKIFEIIGYVYQYLKLLRQISPQEWIFRELQDIGNMDFRFAEEQPQDDYAAELA  193

Query  1350  ENLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFG  1529
             ENL  YP E V+YG+Y Y+IWDE L+K I+GFF  +NMRVD+V+KS +   D + EPWFG
Sbjct  194   ENLSFYPAEHVIYGEYVYKIWDEDLVKHIIGFFTPENMRVDIVSKSFSKLEDFKIEPWFG  253

Query  1530  SQYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDG---GNAPKCI  1700
             S Y  + I  SL++LW+DPPEID SLHLPAKN FIP DFSIRA  + C+      +P CI
Sbjct  254   SHYSVDDIAPSLMDLWRDPPEIDASLHLPAKNQFIPCDFSIRASKV-CNNLPLEYSPICI  312

Query  1701  LDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQA  1880
             LDEPLMKFWYKLDN+FKLPRANTYF + L G YS+++N LLTELFVLLLKD+LNEI+YQA
Sbjct  313   LDEPLMKFWYKLDNSFKLPRANTYFHINLSGGYSSVKNYLLTELFVLLLKDKLNEIIYQA  372

Query  1881  SVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLK  2060
             ++AKLETSV++ GDKLELKV+GFN KLP LLSK+LA   +F P +DRF VIKE MER LK
Sbjct  373   TIAKLETSVAISGDKLELKVFGFNDKLPNLLSKLLATARTFMPSEDRFKVIKEKMERNLK  432

Query  2061  NTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGN  2240
             NTNMKP +H+SYLRLQVLC+ F+D +EK  +LN LS  DLKA +P LLSQLYIEGLCHGN
Sbjct  433   NTNMKPRSHSSYLRLQVLCERFYDADEKSDVLNDLSFVDLKAHIPKLLSQLYIEGLCHGN  492

Query  2241  MLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELY  2420
               EEEA+++S+IF   FSV PLP  MRH E VMCLP GA+LVRDV VKN+L+ NSV+ELY
Sbjct  493   FSEEEAISLSNIFKDNFSVQPLPLGMRHYERVMCLPPGANLVRDVSVKNRLERNSVLELY  552

Query  2421  FQIEPEVG-SELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFR  2597
             FQIEPEVG  E I+ KAL+DLFDEI++EPL+++LRTKEQLGYVV CSPR TYRI GFCF 
Sbjct  553   FQIEPEVGMEESIRQKALIDLFDEIIDEPLYNQLRTKEQLGYVVQCSPRSTYRIYGFCFS  612

Query  2598  VQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLW  2777
             VQSSEY+PI+LQ R +NFI   +E+L  LD+ SFEN+K+GLI KLLEKDPSL +ETNRLW
Sbjct  613   VQSSEYNPIFLQERFENFITGLQELLLGLDEASFENYKNGLIGKLLEKDPSLYHETNRLW  672

Query  2778  GQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDS  2957
              QIV+KRY FD  +KEAEELK+I+K+++I+WY+TYL++  PKCRRL++RVWGC T   D+
Sbjct  673   SQIVEKRYAFDFLQKEAEELKNIQKNNIIDWYNTYLQESSPKCRRLAIRVWGCETNMIDA  732

Query  2958  DASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             +  ++    IKD  AFK SS FYPS C
Sbjct  733   ETPVKSVVAIKDVEAFKTSSMFYPSLC  759



>gb|EMS55750.1| Insulin-degrading enzyme [Triticum urartu]
Length=1079

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/825 (59%), Positives = 619/825 (75%), Gaps = 43/825 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+ FPDENEYDSYLSKHGGSSNA+TETE+TCYHFEV RE+L GAL RFSQFF
Sbjct  139   LEHMLFMGSSVFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVNREYLKGALDRFSQFF  198

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDS                                GNKKSLS+A
Sbjct  199   VSPLVKAEAMDREILAVDS--------------------------------GNKKSLSNA  226

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD LE+W +ELFS VK G +++ S + 
Sbjct  227   MGSGINLREEILQMYMSNYHGGMMKLVIIGGEPLDTLEAWTIELFSEVKAGPLLEISPKS  286

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK+GKLY LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  287   DMPFWKSGKLYKLEAVRDVHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  346

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +++SAGVG  G  RSS AYIF MSI L+DSGLK +FE+I  VYQY+ LL++  PQ
Sbjct  347   AKGWASTLSAGVGTGGTQRSSYAYIFEMSIRLSDSGLKNLFEVITAVYQYINLLKQSEPQ  406

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAA---ELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
             EWIFKELQDIG+MEFRF EE+P D+Y       AEN+L Y  + ++ G+Y YE W+ +L+
Sbjct  407   EWIFKELQDIGYMEFRFAEEQPPDDYGLLKFYFAENMLFYSEKHIISGEYIYEGWEPELV  466

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVS  1604
             K +L FF  DNMRVD++++S +  S  ++CEPWFGSQY+EE IP SL+E W++P EID +
Sbjct  467   KHVLSFFHPDNMRVDILSRSFDKQSQAIRCEPWFGSQYIEEDIPPSLIESWRNPVEIDGN  526

Query  1605  LHLPAKNDFIPSDFSIRADTI-SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRV  1781
              HLP KN++IP DFS+R  +I      + P+CI+DEP +K W+K+D TF +PRAN YF +
Sbjct  527   FHLPRKNEYIPGDFSLRNASIPKSSNDDNPRCIVDEPFIKLWHKMDITFNVPRANAYFLI  586

Query  1782  TLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKL  1961
             ++K   S+LRN++LT+LF  LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL
Sbjct  587   SVKDGCSSLRNSVLTDLFANLLKDELNEVLYQAYVAKLETSLSVVGSNLELKLYGYNDKL  646

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEE  2141
              +LLS +LA + SFSPK DRF VIKED+ER  +NTNMKP++H++YLRLQ L + FWDV E
Sbjct  647   AILLSHILAASQSFSPKMDRFEVIKEDLERAYRNTNMKPMSHSTYLRLQFLRQIFWDVNE  706

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMR  2321
             KL +L +L+ +DL AF+P+LLSQL+IEGLCHGN+  EEA+NIS IF +  S   L  E R
Sbjct  707   KLKVLATLTFSDLAAFVPELLSQLHIEGLCHGNLSGEEAINISKIFQNTLSGQTLSVEAR  766

Query  2322  HKEYVMCLPSGADLVRDVQVKNKLDTNSVVE------LYFQIEPEVGSELIKLKALVDLF  2483
             H E V+C+P GA+ +R V+VKN L+ NSVVE      +    E ++G E  +L+A+ DLF
Sbjct  767   HGERVLCIPHGANFIRSVRVKNDLEENSVVEVLNIFTVIVSFEQDIGKESTRLRAITDLF  826

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
               I+EEP FD+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RIDNFI+  
Sbjct  827   SNIIEEPCFDQLRTKEQLGYTVDSSPRMTYRLLAYCFRVMSSKYSPVYLQSRIDNFIDGL  886

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKR  2798
               +LD L++++FE+ KSGLIA+ LEKDPSLSY+T   W QI DKR
Sbjct  887   SALLDGLEEETFEHHKSGLIAQKLEKDPSLSYQTGDYWSQITDKR  931


 Score = 79.3 bits (194),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query  2799  YMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA  2978
             YMFD+S+ EAEEL+++ K D+I WY+TY++   P  RRL++ V+GCN    ++    E +
Sbjct  999   YMFDMSKLEAEELRTVGKEDVISWYNTYIRSSSPTRRRLAIHVYGCNPDIAEAATLQEQS  1058

Query  2979  -KVIKDPTAFKKSSEFYPSFC  3038
                I D  + K SS+FYPS C
Sbjct  1059  WTAIDDVESLKGSSQFYPSLC  1079



>dbj|BAJ99118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=808

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/804 (58%), Positives = 616/804 (77%), Gaps = 3/804 (0%)
 Frame = +3

Query  636   QLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNYYGRKMKLVIIGGET  815
             QLQ HT + GHP NRF WGNKKSLS+A   G+NLRE+I ++Y  NY+G  MKLVIIGGE 
Sbjct  5     QLQSHTCSQGHPLNRFTWGNKKSLSNAMGSGINLREEILQMYMSNYHGGMMKLVIIGGEP  64

Query  816   LDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRK  995
             LD LE+W +ELFS VK G +++ S + + P WK+GKLY LEAV+DVH L LSWTLP L K
Sbjct  65    LDTLEAWTMELFSEVKAGPLLEISPKTDMPFWKSGKLYKLEAVRDVHSLFLSWTLPCLHK  124

Query  996   DYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLT  1175
             +Y++K EDYLAHLLGHEGKGSLL+FLK KGW +++SAGVG  G  RSS AYIF MSI L+
Sbjct  125   EYMKKPEDYLAHLLGHEGKGSLLYFLKAKGWASTLSAGVGTGGTQRSSYAYIFEMSIRLS  184

Query  1176  DSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAEN  1355
             DSGLK +FE+I  VYQY+ LL++  PQEWIFKELQDIG+MEFRF EE+P D+Y  +LAEN
Sbjct  185   DSGLKNLFEVITAVYQYINLLKQSEPQEWIFKELQDIGYMEFRFAEEQPPDDYVVDLAEN  244

Query  1356  LLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGS  1532
             +L Y  + ++ G+Y YE W+ +L+K +L FF  DNMRVD++++S +  S  ++CEPWFGS
Sbjct  245   MLFYSEKHIISGEYIYEGWEPELVKHVLSFFHPDNMRVDILSRSFDKQSQAIRCEPWFGS  304

Query  1533  QYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTI-SCDGGNAPKCILDE  1709
             QY+EE IPSSL+E W++P EID + HLP KN++IP DFS+R  +I      + P+CI+DE
Sbjct  305   QYIEEDIPSSLIESWRNPVEIDGNFHLPRKNEYIPGDFSLRNASIPKSSNDDNPRCIVDE  364

Query  1710  PLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVA  1889
             P +K W+K+D TF +PRAN YF +++K   S+LRN++LT+LF  LLKDELNE++YQA VA
Sbjct  365   PFIKLWHKMDITFNVPRANAYFLISVKDGCSSLRNSVLTDLFANLLKDELNEVLYQAYVA  424

Query  1890  KLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTN  2069
             KLETS+S+ G  LELK+YG+N KL +LLS +LA + SFSPK DRF VIKED+ER  +NTN
Sbjct  425   KLETSLSVVGSNLELKLYGYNDKLAILLSHILAASQSFSPKIDRFEVIKEDLERAYRNTN  484

Query  2070  MKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLE  2249
             MKP++H++YLRLQ L + FWDV EKL +L  L+ +DL AF+P+LLSQL+IEGLCHGN+  
Sbjct  485   MKPMSHSTYLRLQFLRQIFWDVNEKLKVLAMLTFSDLAAFVPELLSQLHIEGLCHGNLSG  544

Query  2250  EEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQI  2429
             EEA+NIS+IF +  S   L  E RH E V C+P GA+ +R V+VKN L+ NSVVE+Y+ +
Sbjct  545   EEAINISNIFRNTLSGQTLSVEARHGERVFCIPHGANFIRSVRVKNDLEENSVVEVYYPV  604

Query  2430  EPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSS  2609
             E ++G E  +L+A+ DLF  I+EEP FD+LRTKEQLGY VD SPR+TYR+L +CFRV SS
Sbjct  605   EQDIGKESTRLRAITDLFSNIIEEPCFDQLRTKEQLGYTVDSSPRMTYRLLAYCFRVMSS  664

Query  2610  EYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIV  2789
             ++ P+YLQ RIDNFI+    +LD L++++FE+ KSGLIA+ LEKDPSLSY+T   W QI 
Sbjct  665   KHSPVYLQSRIDNFIDGLSALLDGLEEETFEHHKSGLIAQKLEKDPSLSYQTGDYWSQIT  724

Query  2790  DKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASM  2969
             DKRYMFD+++ EAEEL+++ K D+I WY+TY++   P  RRL++ V+GCN+   ++    
Sbjct  725   DKRYMFDMAKLEAEELRTVGKEDVISWYNTYIRSSSPTRRRLAIHVYGCNSDIAEAAKLQ  784

Query  2970  EPA-KVIKDPTAFKKSSEFYPSFC  3038
             E +   I D  + K SS+FYP+ C
Sbjct  785   EQSWTAIDDVESLKVSSQFYPNLC  808



>gb|EMT16196.1| Insulin-degrading enzyme [Aegilops tauschii]
Length=1402

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/815 (60%), Positives = 615/815 (75%), Gaps = 48/815 (6%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+ FPDENEYDSYLSKHGGSSNA+TETE+TCYHFEV RE+L GAL RFSQFF
Sbjct  402   LEHMLFMGSSVFPDENEYDSYLSKHGGSSNAFTETEYTCYHFEVNREYLKGALDRFSQFF  461

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVKAEAM+RE+LAVDS                                GNKKSLS+A
Sbjct  462   VSPLVKAEAMDREILAVDS--------------------------------GNKKSLSNA  489

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
                G+NLRE+I ++Y  NY+G  MKLVIIGGE LD LE+W +ELFS VK G +++ S + 
Sbjct  490   MGSGINLREEILQMYMSNYHGGMMKLVIIGGEPLDTLEAWTMELFSEVKAGPLLEISPKT  549

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P WK+GKLY LEAV+DVH L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK
Sbjct  550   DMPFWKSGKLYKLEAVRDVHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLK  609

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW +++SAGVG  G  RSS AYIF MSI L+DSGLK +FE+I  VYQY+ LL++  PQ
Sbjct  610   AKGWASTLSAGVGTGGTQRSSYAYIFEMSIRLSDSGLKNLFEVITAVYQYINLLKQSEPQ  669

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG+MEFRF EE+P D+Y  +LAE              Y YE W+ +L+K +
Sbjct  670   EWIFKELQDIGYMEFRFAEEQPPDDYVVDLAE--------------YIYEGWEPELVKHV  715

Query  1437  LGFFRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L FF  DNMRVD++++S +  S  ++CEPWFGSQY+EE IPSSL+E W++P EID + HL
Sbjct  716   LSFFHPDNMRVDILSRSFDKQSQAIRCEPWFGSQYIEEDIPSSLIESWRNPVEIDGNFHL  775

Query  1614  PAKNDFIPSDFSIRADTI-SCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             P KN++IP DFS+R  +I      + P+CI+DEP +K W+K+D TF +PRAN YF +++K
Sbjct  776   PRKNEYIPGDFSLRNASIPKSSNDDNPRCIVDEPFIKLWHKMDITFNVPRANAYFLISVK  835

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                S+LRN++LT+LF  LLKDELNE++YQA VAKLETS+S+ G  LELK+YG+N KL +L
Sbjct  836   DGCSSLRNSVLTDLFANLLKDELNEVLYQAYVAKLETSLSVVGSNLELKLYGYNDKLAIL  895

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
             LS +LA + SFSPK DRF VIKED+ER  +NTNMKP++H++YLRLQ L + FWDV EKL 
Sbjct  896   LSHILAASQSFSPKIDRFEVIKEDLERAYRNTNMKPMSHSTYLRLQFLRQIFWDVNEKLK  955

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
             +L +L+ +DL AF+P+LLSQL+IEGLCHGN+  +EA+NIS IF +  S   L  E RH E
Sbjct  956   VLATLTFSDLAAFVPELLSQLHIEGLCHGNLSGDEAINISKIFQNTLSGQTLSVEARHGE  1015

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              V+C+P GA+ +R V+VKN L+ NSVVE+YF +E ++G +  +L+A+ DLF  I+EEP F
Sbjct  1016  RVLCIPHGANFIRSVRVKNDLEENSVVEVYFPVEQDIGKDSTRLRAITDLFSNIIEEPCF  1075

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             D+LRTKEQLGY VD SPR+TYR+L +CFRV SS+Y P+YLQ RIDNFI+    +LD L++
Sbjct  1076  DQLRTKEQLGYTVDSSPRMTYRLLAYCFRVMSSKYSPVYLQSRIDNFIDGLSALLDGLEE  1135

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDK  2795
             ++FE+ KSGLIA+ LEKDPSLSY+T   W QI DK
Sbjct  1136  ETFEHHKSGLIAQKLEKDPSLSYQTGDYWSQITDK  1170


 Score = 76.6 bits (187),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query  2799  YMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA  2978
             YMFD+S+ EAEEL+++ K D+I WY+ Y++   P  RRL++ V+GCN+   ++    E +
Sbjct  1322  YMFDMSKLEAEELRTVGKEDVISWYNAYIRSSSPTRRRLAIHVYGCNSDIAEAAKLQEQS  1381

Query  2979  -KVIKDPTAFKKSSEFYPSFC  3038
                I D  + K SS+FYPS C
Sbjct  1382  WTAIDDVESLKGSSQFYPSLC  1402



>gb|AFW88451.1| hypothetical protein ZEAMMB73_847713 [Zea mays]
Length=777

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/774 (60%), Positives = 598/774 (77%), Gaps = 3/774 (0%)
 Frame = +3

Query  726   GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETP  905
             G+NLRE+I ++Y  NY+G  M+LVIIGGE LD+LE W +ELFS VK G ++    + + P
Sbjct  4     GINLREEILEMYMRNYHGGAMRLVIIGGEPLDILEGWTMELFSKVKTGPLLDIGPKTDIP  63

Query  906   IWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKG  1085
              WK GKLY LEAV+D+H L LSWTLP L K+Y++K EDYLAHLLGHEGKGSLL+FLK KG
Sbjct  64    FWKPGKLYKLEAVRDLHSLFLSWTLPCLHKEYMKKPEDYLAHLLGHEGKGSLLYFLKAKG  123

Query  1086  WVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWI  1265
             W +S+SAGVG  G  RSS AYIF MSI LTDSGLK +FE+IG VYQY+KLL++  PQEWI
Sbjct  124   WASSLSAGVGSGGSQRSSYAYIFEMSICLTDSGLKNVFEVIGAVYQYIKLLKQSEPQEWI  183

Query  1266  FKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDILGF  1445
             FKELQDIG+MEFRF EE+P D+Y  +LAEN+L Y  + +V G+Y +E WD +L+K  L F
Sbjct  184   FKELQDIGYMEFRFAEEQPPDDYVVDLAENMLFYSEKHIVCGEYIFEDWDSELVKHALSF  243

Query  1446  FRADNMRVDVVTKSLNNSSD-VQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLPAK  1622
             F  DNMRVDV++KS +  S  +QCEPWFGS Y+EE IPSSL+E WK+P ++D +LHLP K
Sbjct  244   FNPDNMRVDVLSKSFDKQSQAIQCEPWFGSHYIEEDIPSSLIESWKNPVQVDDNLHLPRK  303

Query  1623  NDFIPSDFSIR-ADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLKGAY  1799
             N+FIP DF++R A++      + P+CI+DEP +K WYK+D TF +PRANTYF + +K  Y
Sbjct  304   NEFIPGDFTLRNANSPGSSSDDNPRCIVDEPFIKLWYKMDMTFNVPRANTYFLIYVKDGY  363

Query  1800  SNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSK  1979
             S+L N++L +LF  LLKDELNE++YQA VAKLETS S+   KLE+K+YG+N KLP+LLS 
Sbjct  364   SSLENSVLIDLFANLLKDELNEVLYQAYVAKLETSTSVVASKLEIKLYGYNDKLPILLSN  423

Query  1980  VLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklclln  2159
             +L+   SFSPK DRF VIKED+ER  KNTNMKP++H++YLRLQVL + FWDV++KL LL 
Sbjct  424   ILSTVRSFSPKTDRFEVIKEDLERAYKNTNMKPMSHSTYLRLQVLREIFWDVDKKLELLM  483

Query  2160  slsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVM  2339
              L+  DL AF+P +LSQL+IEGLCHGN+ E+E +NIS IF +  S   LP E RH+E V+
Sbjct  484   KLTFTDLVAFVPKILSQLHIEGLCHGNLSEDETINISKIFLNTLSAQTLPEEARHEERVI  543

Query  2340  CLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRL  2519
             C+P+GA+LVR V+VKN L+ NSVVE+YF IE +VG E  +L+A+ DLF  I+EEP FD+L
Sbjct  544   CIPNGANLVRSVRVKNDLEENSVVEVYFPIEQDVGKEATRLRAITDLFSNIIEEPCFDQL  603

Query  2520  RTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSF  2699
             RTKEQLGY VD SPR+TYR+L +CFRV SS+Y PIYLQ RIDNFI+    +LD L++++F
Sbjct  604   RTKEQLGYTVDSSPRMTYRMLAYCFRVMSSKYSPIYLQSRIDNFIDGLSALLDELNEETF  663

Query  2700  ENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHT  2879
             E+ +SGLIA  LEK+PSLSY+T+  W QI DKRYMFD+S+ EAEELK+++K+D+I WY+T
Sbjct  664   EHHRSGLIADKLEKEPSLSYQTSDYWSQIADKRYMFDMSKLEAEELKTVQKADVIAWYNT  723

Query  2880  YLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPA-KVIKDPTAFKKSSEFYPSFC  3038
             Y++   PK RRL++ V+GCN+   ++    E +  +I D  + K SS+FY S C
Sbjct  724   YIRSSSPKRRRLAIHVYGCNSDIAEAAKLQEQSWTIIDDVESLKASSQFYSSLC  777



>ref|XP_001760214.1| predicted protein [Physcomitrella patens]
 gb|EDQ74970.1| predicted protein [Physcomitrella patens]
Length=967

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/897 (51%), Positives = 625/897 (70%), Gaps = 6/897 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDENEYD++LSKHGG SNA+T+TE TCYHFEV    L  AL RFSQFF
Sbjct  71    LEHMLFMGSEKFPDENEYDNFLSKHGGGSNAFTDTEFTCYHFEVSPNHLQPALDRFSQFF  130

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             ++PL K E M+REV A+DSEF QVLQ+D+CRL QLQCHT+ PGHPF  F WGNKKSLS+ 
Sbjct  131   IAPLAKPETMDREVQAIDSEFEQVLQSDACRLLQLQCHTAKPGHPFRSFSWGNKKSLSEP  190

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              ERGV++R ++ +LY D+Y   +MKL ++GGE L+ L+ WV+E F  VK G         
Sbjct  191   MERGVDMRSKLIQLYKDHYLASRMKLTVLGGEPLETLKEWVMEHFGKVKDGGQTPLRFPW  250

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + P+W+ G LY +E+VKD H++ L+W  P L   YL+K +DY++HL+GHEG GSLL  LK
Sbjct  251   DGPVWEPGSLYRVESVKDQHLIALTWPFPCLEAAYLKKPQDYISHLIGHEGAGSLLSLLK  310

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW T +SAGVG+ G   SS  Y+F ++I LTDSGL+   +++G +YQY+K+LR   PQ
Sbjct  311   AKGWATGLSAGVGEGGYDHSSAGYMFSVNIWLTDSGLEHALDVVGVLYQYVKMLRTTGPQ  370

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             +W+F ELQ +G MEFRF EEE  D+Y   LA N+ +Y  E  +YGDYA+E WD +L+ D+
Sbjct  371   KWVFDELQAMGMMEFRFAEEESADQYVVRLASNMHIYREEHTIYGDYAFEEWDPELVADL  430

Query  1437  LGFFRADNMRVDVVTKSLNNSSDV---QCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             +      NMR+D+VTK+ + +S V   Q EPWF   Y  E +   +L+ W +P ++D +L
Sbjct  431   IDRVNPYNMRLDLVTKNFDKNSPVAGIQYEPWFEVPYTVEKLSDDILQRWANPEQVDPAL  490

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              +P  N FIP DF+I+         + PK +LDE  +K WYKLD TF  PRANTYF VT 
Sbjct  491   SMPVVNAFIPHDFTIKTGKTDAPSPDIPKLLLDELGLKVWYKLDRTFNTPRANTYFSVTC  550

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPV  1967
             K A  N+R+ +LTE++V LL+ ELNE +Y A+VAKLE+S++  GDKL+LK++GFN KLPV
Sbjct  551   KAASQNIRSIVLTEIYVKLLEHELNETIYLANVAKLESSMTFSGDKLDLKLFGFNEKLPV  610

Query  1968  LLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
             L SK+  +  S  P+ DRF VIKED+ER  +NTNMKPL H++YLRLQ L + FW V+EKL
Sbjct  611   LASKIAELLTSLVPRLDRFQVIKEDLERGYRNTNMKPLKHSAYLRLQALKERFWPVDEKL  670

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L SLS+AD+ A +P L S+ YIE LCHGN+ EEEA+ I++IF        LPAE R  
Sbjct  671   ACLLSLSVADVSAHIPHLFSETYIEALCHGNLYEEEALGITNIFKQSLVKTALPAESRPV  730

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
             E ++ L +G+ ++    VKN+ + NSVVE+YFQ+E ++G E ++L+ ++DLF+++V EP 
Sbjct  731   ERIVKLDAGSAILHTATVKNEAEENSVVEMYFQLEKDLGKESLRLRGIIDLFEQMVHEPC  790

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQLGY VDC  RVTY++LGFCFRVQS++Y+P++++ RI+ FI    +IL ++ 
Sbjct  791   FNQLRTKEQLGYRVDCGVRVTYKVLGFCFRVQSAKYNPVFVEQRINAFITSLSQILSDVH  850

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIE  2867
             DD F N+K  LI + LE+D SL  ET+R W QI D+RY+F+  + EA E+ +I K ++++
Sbjct  851   DDEFSNYKEALIEEKLERDHSLVDETDRHWEQIWDQRYLFEARKLEAAEIMTIEKKEILD  910

Query  2868  WYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDA---SMEPAKVIKDPTAFKKSSEFYP  3029
             ++  Y        R+LS+ +WG N + +  D    S +   V+ D ++FK   E YP
Sbjct  911   FFTKYFSPSSLGRRKLSIHIWGGNAKSEKGDKLANSFKDVTVVDDLSSFKAKIELYP  967



>ref|XP_002981869.1| hypothetical protein SELMODRAFT_154839 [Selaginella moellendorffii]
 gb|EFJ16962.1| hypothetical protein SELMODRAFT_154839 [Selaginella moellendorffii]
Length=940

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/900 (46%), Positives = 602/900 (67%), Gaps = 13/900 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS++FPDENEY  +L++HGGSSNA+TE E+TCYHF+V   +L  AL+RFSQFF
Sbjct  46    LEHMLFMGSSKFPDENEYAGFLAEHGGSSNAFTEMEYTCYHFDVNHMYLKPALERFSQFF  105

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK +++EREV AVDSEF Q LQND CRL QL+CHT+   HP+NRF WGN KSL +A
Sbjct  106   ISPLVKGDSIEREVQAVDSEFVQALQNDGCRLNQLKCHTADLRHPYNRFSWGNAKSLGEA  165

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
               +  ++R+++ + Y  +Y   +MKLV++GGE L  L+ WV ELF  + +G         
Sbjct  166   ITKCTDIRQKLIEFYKQHYLANRMKLVVLGGEPLATLKEWVTELFEDIPEGSSKPQRFSW  225

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               P+W AGK+Y +E+VKD H L LSW +P L  +YL+K  DYL+HL+GHEGKGSLL FLK
Sbjct  226   NGPVWPAGKIYHVESVKDQHRLILSWVMPCLHTEYLKKPHDYLSHLIGHEGKGSLLQFLK  285

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
               GW T ++AGV ++   +S+  Y+F + I+LT SGL KI EI+G  ++++KLLR+  PQ
Sbjct  286   ANGWATDLAAGVSEDDFEKSTAGYLFSVCINLTVSGLGKIHEIVGKFFEFVKLLRDSKPQ  345

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+EL  +  M+FRF+EEEP D+Y + LA+N+ ++P   V+YGDYA++ WD +L +++
Sbjct  346   EWIFEELHAVSAMDFRFVEEEPADDYVSTLAKNMHLFPEHHVIYGDYAHDQWDPKLAEEL  405

Query  1437  LGFFRADNMRVDVVTKSLN-NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L +     MRVD+VTKS N ++ DV  EPWFG+ YV    P  LL  W +P  ++ +LHL
Sbjct  406   LNYLSPMTMRVDIVTKSFNKDAPDVVFEPWFGTPYVVNEAPKDLLNGWLNPLAVNDALHL  465

Query  1614  PAKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             PA N+FI  DFSI+    S D  N  P  I ++  +K W+KLD TF+ PRAN + +++ +
Sbjct  466   PAVNEFISRDFSIK----SADDSNVLPVVIAEDSSVKVWHKLDRTFQTPRANVFMKLSCR  521

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                  LR+ +LT L+ LLLKD LNE +Y A+VA L +SV      +E KV+G+N KL VL
Sbjct  522   --MDGLRSEVLTSLYTLLLKDALNETIYMATVAGLSSSVVANIHNIEFKVHGYNEKLGVL  579

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
               ++  +  +  P +DRF V KE  ER  +N  +KP+ H++ LR+Q+L    W  EE+L 
Sbjct  580   AQQICQLLKALVPANDRFEVAKEQYERLCRNARVKPMTHSAALRVQILRMGSWSEEERLA  639

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L++LS  D++ F+P L  + ++E LCHGN+ +EEA++I ++  S     P+  E   K 
Sbjct  640   YLSTLSAEDVRNFIPQLFREAHVEALCHGNLTKEEALDIVNVVKSTVVTVPMLEETMPKI  699

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              ++ +PS  D   +V V N L+ NSV ELYFQ+  ++G+E ++   L DLF+ +V EP F
Sbjct  700   RIVKIPSQTDFAYNVPVVNPLEENSVAELYFQMGLDLGAESVREHVLGDLFEHMVYEPFF  759

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRT EQLGY VDC  R TY +LGFCFR+ SS+Y P ++  RI++FI+  ++ LD++ +
Sbjct  760   NQLRTIEQLGYRVDCGTRYTYGVLGFCFRIMSSKYSPTHIHKRIEDFIDKLQKTLDDMSE  819

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             + F+N+K+ LIA+ +EKD  LS ET+R WG ++D+RY+FD  EKEA  LK I+K D++EW
Sbjct  820   EVFDNYKNCLIAEKMEKDKCLSDETDRHWGHVLDQRYLFDAHEKEAVALKDIKKEDVVEW  879

Query  2871  YHTYLKQPFPKCRRLSVRVWGCN-----TQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             Y  +++      R L + VWGC       + K+      P ++I+D   FK  +E YP F
Sbjct  880   YKQHIRAGGSMRRSLCIHVWGCQFKDEMQKNKNKRNKRTPYRLIEDIDEFKNKAELYPPF  939



>ref|XP_002985987.1| hypothetical protein SELMODRAFT_157708 [Selaginella moellendorffii]
 gb|EFJ12806.1| hypothetical protein SELMODRAFT_157708 [Selaginella moellendorffii]
Length=940

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/900 (46%), Positives = 604/900 (67%), Gaps = 13/900 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS++FPDENEY  +L++HGGSSNA+TE E+TCYHF+V   +L  AL+RFSQFF
Sbjct  46    LEHMLFMGSSKFPDENEYAGFLAEHGGSSNAFTEMEYTCYHFDVNHMYLKPALERFSQFF  105

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+K +++EREV AVDSEF Q LQND CRL QL+CHT+   HP+NRF WGN KSL +A
Sbjct  106   ISPLIKGDSVEREVQAVDSEFVQALQNDGCRLNQLKCHTADLLHPYNRFSWGNAKSLGEA  165

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
               +  ++R+++ + Y  +Y   +MKLV++GGE L  L+ WV ELF  + +G         
Sbjct  166   ITKCTDIRQKLIEFYKQHYLANRMKLVVLGGEPLATLKEWVTELFEDIPEGSSKPQRFSW  225

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
               P+W AGK+Y +E+VKD H L LSW +P L  +YL+K  DYL+H++GHEGKGSLL FLK
Sbjct  226   NGPVWPAGKIYHVESVKDQHRLILSWVMPCLHTEYLKKPHDYLSHIIGHEGKGSLLQFLK  285

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
               GW T ++AGV ++   +S+  Y+F + I+LT SGL KI EI+G  ++++KLLR+  PQ
Sbjct  286   ANGWATDLAAGVSEDDFEKSTAGYLFSVCINLTVSGLGKIHEIVGNFFEFVKLLRDSKPQ  345

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIF+EL  +  M+FRF+EEEP D+Y + LA+N+ ++P   V+YGDYA++ WD +L +++
Sbjct  346   EWIFEELHAVSAMDFRFVEEEPADDYVSTLAKNMHLFPEHHVIYGDYAHDQWDPKLAEEL  405

Query  1437  LGFFRADNMRVDVVTKSLN-NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHL  1613
             L +     MRVD+VTKS N ++ DV  EPWFG+ YV    P  LL  W +P  ++ +LHL
Sbjct  406   LNYLSPMTMRVDIVTKSFNKDAPDVVFEPWFGTPYVVNEAPKDLLNGWLNPLAVNDALHL  465

Query  1614  PAKNDFIPSDFSIRADTISCDGGNA-PKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             PA N+FI  DFSI+    S D  N  P  I ++  +K W+KLD TF+ PRAN + +++ +
Sbjct  466   PAVNEFISRDFSIK----SADDSNVLPVVIAEDSSVKVWHKLDRTFQTPRANVFMKLSCR  521

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                  LR+ +LT L+ LLLKD LNE +Y A+VA L +SV      +E KV+G+N KL VL
Sbjct  522   --MDGLRSEVLTSLYTLLLKDALNETIYMATVAGLSSSVVANIHNIEFKVHGYNEKLGVL  579

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklc  2150
               ++  +  +  P +DRF V KE  ER  +N  +KP+ H++ LR+Q+L    W  EE+L 
Sbjct  580   AQQICQLLKALVPANDRFEVAKEQYERLCRNARVKPMTHSAALRVQILRMGSWSEEERLA  639

Query  2151  llnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKE  2330
              L++LS  D++ F+P L  + ++E LCHGN+ +EEA++I ++  S     P+  E   K 
Sbjct  640   CLSTLSAEDVRNFIPQLFREAHVEALCHGNLTKEEALDIVNVVKSTVVTVPMLEETMPKI  699

Query  2331  YVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLF  2510
              ++ +PS  D   +V V N L+ NSV ELYFQ+  ++G+E ++   L DLF+++V EP F
Sbjct  700   RIVKIPSQTDFAYNVPVVNPLEENSVAELYFQMGLDLGAESVREHILGDLFEQMVYEPFF  759

Query  2511  DRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDD  2690
             ++LRT EQLGY VDC  R TY +LGFCFR+ SS+Y P ++  RI++FI+  ++ LD++ +
Sbjct  760   NQLRTIEQLGYRVDCGTRYTYGVLGFCFRIMSSKYSPTHIHKRIEDFIDKLQKTLDDMSE  819

Query  2691  DSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEW  2870
             ++F+N+K+ LIA+ +EKD  LS ET+R WG ++D+RY+FD  EKEA  LK I+K D++EW
Sbjct  820   EAFDNYKNCLIAEKMEKDKCLSEETDRHWGHVLDQRYLFDAHEKEAVALKDIKKEDVVEW  879

Query  2871  YHTYLKQPFPKCRRLSVRVWGCN-----TQRKDSDASMEPAKVIKDPTAFKKSSEFYPSF  3035
             Y  +++      R L + VWGC       + K+      P ++I+D   FK  +E YP F
Sbjct  880   YKQHIRAGGSMRRSLCIHVWGCQFKDEMQKNKNKRNKRTPYRLIEDIDEFKNKAELYPPF  939



>gb|KDO49710.1| hypothetical protein CISIN_1g0017301mg, partial [Citrus sinensis]
 gb|KDO49711.1| hypothetical protein CISIN_1g0017301mg, partial [Citrus sinensis]
 gb|KDO49712.1| hypothetical protein CISIN_1g0017301mg, partial [Citrus sinensis]
 gb|KDO49713.1| hypothetical protein CISIN_1g0017301mg, partial [Citrus sinensis]
Length=564

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/564 (71%), Positives = 482/564 (85%), Gaps = 2/564 (0%)
 Frame = +3

Query  1353  NLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGS  1532
             NLL+YP E V+YG+Y YE+WDE++IK +LGFF  +NMR+DVV+KS   S D   EPWFGS
Sbjct  1     NLLIYPAEHVIYGEYMYEVWDEEMIKHLLGFFMPENMRIDVVSKSFAKSQDFHYEPWFGS  60

Query  1533  QYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCD--GGNAPKCILD  1706
             +Y EE I  SL+ELW++PPEIDVSL LP++N+FIP+DFSIRA+ IS D     +P CI+D
Sbjct  61    RYTEEDISPSLMELWRNPPEIDVSLQLPSQNEFIPTDFSIRANDISNDLVTVTSPTCIID  120

Query  1707  EPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASV  1886
             EPL++FWYKLDNTFKLPRANTYFR+ LKG Y N++N +LTELF+ LLKDELNEI+YQASV
Sbjct  121   EPLIRFWYKLDNTFKLPRANTYFRINLKGGYDNVKNCILTELFIHLLKDELNEIIYQASV  180

Query  1887  AKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNT  2066
             AKLETSVS++ DKLELKVYGFN KLPVLLSK+LA+  SF P DDRF VIKED+ RTLKNT
Sbjct  181   AKLETSVSIFSDKLELKVYGFNDKLPVLLSKILAIAKSFLPSDDRFKVIKEDVVRTLKNT  240

Query  2067  NMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNML  2246
             NMKPL+H+SYLRLQVLC+SF+DV+EKL +L+ LSLADL AF+P+L SQLYIEGLCHGN+ 
Sbjct  241   NMKPLSHSSYLRLQVLCQSFYDVDEKLSILHGLSLADLMAFIPELRSQLYIEGLCHGNLS  300

Query  2247  EEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQ  2426
             +EEA++IS+IF S FSV PLP EMRH+E V+CLPSGA+LVR+V VKNK +TNSV+ELYFQ
Sbjct  301   QEEAIHISNIFKSIFSVQPLPIEMRHQECVICLPSGANLVRNVSVKNKCETNSVIELYFQ  360

Query  2427  IEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQS  2606
             IE E G EL +LKAL+DLFDEI+EEP F++LRTKEQLGYVV+CSPRVTYR+ GFCF +QS
Sbjct  361   IEQEKGMELTRLKALIDLFDEILEEPFFNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQS  420

Query  2607  SEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQI  2786
             S+Y+PIYLQ RIDNFI+   E+L+ LDD+SFEN++SGL+AKLLEKDPSL+YE+NR W QI
Sbjct  421   SKYNPIYLQERIDNFISGLDELLEGLDDESFENYRSGLMAKLLEKDPSLTYESNRFWNQI  480

Query  2787  VDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDAS  2966
              DKRYMFD S+KEAE+LKSI+K+D+I WY TYL+Q  PKCRRL+VRVWGCNT  K+S+  
Sbjct  481   TDKRYMFDQSQKEAEDLKSIKKNDVISWYKTYLQQWSPKCRRLAVRVWGCNTNIKESEKH  540

Query  2967  MEPAKVIKDPTAFKKSSEFYPSFC  3038
              + A VIKD TAFK SSEFY S C
Sbjct  541   SKSALVIKDLTAFKLSSEFYQSLC  564



>gb|KDO49709.1| hypothetical protein CISIN_1g0017301mg, partial [Citrus sinensis]
Length=565

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/565 (71%), Positives = 482/565 (85%), Gaps = 3/565 (1%)
 Frame = +3

Query  1353  NLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGS  1532
             NLL+YP E V+YG+Y YE+WDE++IK +LGFF  +NMR+DVV+KS   S D   EPWFGS
Sbjct  1     NLLIYPAEHVIYGEYMYEVWDEEMIKHLLGFFMPENMRIDVVSKSFAKSQDFHYEPWFGS  60

Query  1533  QYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCD--GGNAPKCILD  1706
             +Y EE I  SL+ELW++PPEIDVSL LP++N+FIP+DFSIRA+ IS D     +P CI+D
Sbjct  61    RYTEEDISPSLMELWRNPPEIDVSLQLPSQNEFIPTDFSIRANDISNDLVTVTSPTCIID  120

Query  1707  EPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASV  1886
             EPL++FWYKLDNTFKLPRANTYFR+ LKG Y N++N +LTELF+ LLKDELNEI+YQASV
Sbjct  121   EPLIRFWYKLDNTFKLPRANTYFRINLKGGYDNVKNCILTELFIHLLKDELNEIIYQASV  180

Query  1887  AKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNT  2066
             AKLETSVS++ DKLELKVYGFN KLPVLLSK+LA+  SF P DDRF VIKED+ RTLKNT
Sbjct  181   AKLETSVSIFSDKLELKVYGFNDKLPVLLSKILAIAKSFLPSDDRFKVIKEDVVRTLKNT  240

Query  2067  NMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNML  2246
             NMKPL+H+SYLRLQVLC+SF+DV+EKL +L+ LSLADL AF+P+L SQLYIEGLCHGN+ 
Sbjct  241   NMKPLSHSSYLRLQVLCQSFYDVDEKLSILHGLSLADLMAFIPELRSQLYIEGLCHGNLS  300

Query  2247  EEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVE-LYF  2423
             +EEA++IS+IF S FSV PLP EMRH+E V+CLPSGA+LVR+V VKNK +TNSV+E LYF
Sbjct  301   QEEAIHISNIFKSIFSVQPLPIEMRHQECVICLPSGANLVRNVSVKNKCETNSVIEVLYF  360

Query  2424  QIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQ  2603
             QIE E G EL +LKAL+DLFDEI+EEP F++LRTKEQLGYVV+CSPRVTYR+ GFCF +Q
Sbjct  361   QIEQEKGMELTRLKALIDLFDEILEEPFFNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQ  420

Query  2604  SSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQ  2783
             SS+Y+PIYLQ RIDNFI+   E+L+ LDD+SFEN++SGL+AKLLEKDPSL+YE+NR W Q
Sbjct  421   SSKYNPIYLQERIDNFISGLDELLEGLDDESFENYRSGLMAKLLEKDPSLTYESNRFWNQ  480

Query  2784  IVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDA  2963
             I DKRYMFD S+KEAE+LKSI+K+D+I WY TYL+Q  PKCRRL+VRVWGCNT  K+S+ 
Sbjct  481   ITDKRYMFDQSQKEAEDLKSIKKNDVISWYKTYLQQWSPKCRRLAVRVWGCNTNIKESEK  540

Query  2964  SMEPAKVIKDPTAFKKSSEFYPSFC  3038
               + A VIKD TAFK SSEFY S C
Sbjct  541   HSKSALVIKDLTAFKLSSEFYQSLC  565



>ref|XP_010480372.1| PREDICTED: insulin-degrading enzyme-like [Camelina sativa]
Length=1031

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/614 (63%), Positives = 498/614 (81%), Gaps = 4/614 (1%)
 Frame = +3

Query  1203  IIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDV  1382
             ++G VYQYLKLLR+VSPQEWIFKELQDIG M+F+F EE+P D+YA+EL+EN+L YP E V
Sbjct  420   LLGHVYQYLKLLRDVSPQEWIFKELQDIGNMDFKFAEEQPADDYASELSENMLAYPVEHV  479

Query  1383  VYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSS  1562
             +YGDY Y+ WD +LI+D++GFF   NMR+DVV+KS+  S + Q EPWFGS+Y+EE +P S
Sbjct  480   IYGDYVYQTWDPKLIEDLMGFFTPKNMRIDVVSKSIK-SEEFQQEPWFGSRYIEEDVPLS  538

Query  1563  LLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKL  1736
             L+E W +P E+D SLHLP+KN FIP DFSIRA     D    + P+CI+DEP MKFWYKL
Sbjct  539   LMETWTNPSEVDASLHLPSKNQFIPCDFSIRAINSDVDPKTQSPPRCIIDEPFMKFWYKL  598

Query  1737  DNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLY  1916
             D TFK+PRANTYFR+ LKGAY++++N LLTELF+ LLKDELNEI+YQAS+AKLET++S+Y
Sbjct  599   DETFKVPRANTYFRINLKGAYASVKNCLLTELFINLLKDELNEIIYQASIAKLETALSMY  658

Query  1917  GDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASY  2096
             GDKLELKVYGFN K+P LLSK+L +  SF P  +RF VIKE+MER  +NTNMKPLNH++Y
Sbjct  659   GDKLELKVYGFNEKIPALLSKILTIAKSFMPSLERFKVIKENMERGFRNTNMKPLNHSTY  718

Query  2097  LRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSI  2276
             LRLQ+LCK  +D +EKL +LN LSL DL +F+P++ SQ++IE LCHGN+ E+EAVNIS+I
Sbjct  719   LRLQLLCKRIYDSDEKLSVLNDLSLDDLNSFIPEVRSQIFIEALCHGNLSEDEAVNISNI  778

Query  2277  FTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
             F +  +V PLP++ RH E +   P  A LVRDV VKNK +TNSV+ELY+QIEPE  ++  
Sbjct  779   FKNSLTVEPLPSKCRHGEQITRFPVSAKLVRDVSVKNKSETNSVIELYYQIEPE-EAQST  837

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             ++KA++DLF EI+EEPLF++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L G
Sbjct  838   RMKAMLDLFHEIIEEPLFNQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLG  897

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
             R+DNFI + + +L+ LD++SFE+++SG+IA+LLEKDPSL  ETN LW QIVDKRYMFD S
Sbjct  898   RVDNFIKEIEVLLEQLDEESFEDYRSGMIARLLEKDPSLLSETNELWSQIVDKRYMFDFS  957

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDP  2996
              KEAEEL++I+K D+I+WY TY  +  PKCRRL+VRVWGC+T  K+S    +  +VI D 
Sbjct  958   HKEAEELRNIQKKDVIKWYKTYFIESSPKCRRLAVRVWGCDTNMKESQTDEKSVQVIADA  1017

Query  2997  TAFKKSSEFYPSFC  3038
              AFK +S+FYPS C
Sbjct  1018  VAFKSTSQFYPSLC  1031


 Score =   379 bits (974),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGG+SNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  195   LEHMLFMGSTEFPDENEYDSYLSKHGGASNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  254

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QNDSCRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  255   VAPLMKTEAMERELLAVDSEFNQAIQNDSCRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  314

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  315   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGAVKNGSKIRPTLEA  374

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGH  1043
             E PIWK GKLY LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGH
Sbjct  375   EGPIWKGGKLYRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGH  423



>ref|XP_007146872.1| hypothetical protein PHAVU_006G0775001g, partial [Phaseolus vulgaris]
 gb|ESW18866.1| hypothetical protein PHAVU_006G0775001g, partial [Phaseolus vulgaris]
Length=565

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/565 (67%), Positives = 460/565 (81%), Gaps = 3/565 (1%)
 Frame = +3

Query  1353  NLLVYPPEDVVYGDYAYEIWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGS  1532
             N+  Y PE V+YGDY Y+ WDEQL+K +LGFF  +NMRVDVV+KS   S D Q EPWFGS
Sbjct  1     NMHFYSPEHVIYGDYVYKTWDEQLLKQVLGFFIPENMRVDVVSKSFLKSEDFQNEPWFGS  60

Query  1533  QYVEEYIPSSLLELWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCD---GGNAPKCIL  1703
             +Y EE I  +L+ELW++PPEID SLHLP+KN+FIPSDFSIRA     D      +P CI+
Sbjct  61    RYTEEDISQNLMELWRNPPEIDASLHLPSKNEFIPSDFSIRASETCADEFANSTSPSCIV  120

Query  1704  DEPLMKFWYKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQAS  1883
             DE L+KFWYK DNTFK+PRANTYFR++LKG Y+++++ +L+ELF+ LLKDELNEI YQAS
Sbjct  121   DEALIKFWYKPDNTFKVPRANTYFRISLKGGYADVKSCVLSELFIHLLKDELNEITYQAS  180

Query  1884  VAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKN  2063
             +AKLETSV+  GD LELKVYGFN KLPVLLSK  +V  SF P DDRF VIKEDM+RTLKN
Sbjct  181   IAKLETSVNYVGDMLELKVYGFNEKLPVLLSKFFSVAKSFMPTDDRFKVIKEDMKRTLKN  240

Query  2064  TNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNM  2243
              NMKPL+H++YLRLQVLC+SF+D +EKL  LN L L DLKAF+P LLSQLY+EGLCHGN+
Sbjct  241   FNMKPLSHSTYLRLQVLCESFYDADEKLHYLNDLCLDDLKAFIPGLLSQLYVEGLCHGNL  300

Query  2244  LEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYF  2423
              +EEA++IS+IF   F V PLP E+RH E V+CLPSGA+LVRDV VKNK + NSV ELYF
Sbjct  301   SKEEAISISNIFKMNFPVNPLPIELRHAERVICLPSGANLVRDVSVKNKSEKNSVAELYF  360

Query  2424  QIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQ  2603
             Q E + G   IKLKAL+DLF+EIVEEP F++LRTKEQLGYVV+CSPRVTYR+ GFCF +Q
Sbjct  361   QFEQDFGLGSIKLKALIDLFEEIVEEPFFNQLRTKEQLGYVVECSPRVTYRVFGFCFCIQ  420

Query  2604  SSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQ  2783
             SSEY+P+YLQGRIDNF+N  +E+LD LD DSFEN+KSGL+AKLLEKDPSL+YE+NRLW Q
Sbjct  421   SSEYNPVYLQGRIDNFLNGLEELLDGLDGDSFENYKSGLVAKLLEKDPSLTYESNRLWNQ  480

Query  2784  IVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDA  2963
             IVDKRY+FD S+KEA+EL +I K D++EWY TY K P PKCRRL ++VWGCNT  K+++ 
Sbjct  481   IVDKRYIFDFSKKEADELANITKHDVVEWYKTYFKPPSPKCRRLLIQVWGCNTDLKEAET  540

Query  2964  SMEPAKVIKDPTAFKKSSEFYPSFC  3038
               +  +VI D  AFK  S+FYPSFC
Sbjct  541   PPKSVEVITDAAAFKLQSKFYPSFC  565



>ref|XP_010501347.1| PREDICTED: nardilysin-like [Camelina sativa]
Length=860

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/533 (68%), Positives = 437/533 (82%), Gaps = 12/533 (2%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGG+SNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  188   LEHMLFMGSTEFPDENEYDSYLSKHGGASNAYTEMEHTCYHFEVKREFLRGALKRFSQFF  247

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMERE+LAVDSEFNQ +QND CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  248   VAPLMKTEAMERELLAVDSEFNQAIQNDLCRLQQLQCYTSAKGHPFNRFAWGNKKSLSGA  307

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD+LESWV+ELF  VK G  ++ +   
Sbjct  308   MENGVDLRECIVKLYKEYYHGGLMKLVVIGGESLDMLESWVVELFGAVKNGSKIRPTLEA  367

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKL+ LEAVKDVHIL+L+WTLP LR  Y++K EDYLAHLLGHEG+GSL  FLK
Sbjct  368   EGPIWKGGKLFRLEAVKDVHILDLTWTLPPLRHAYVKKPEDYLAHLLGHEGRGSLHSFLK  427

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+K+++IIG+VYQYLKLLR+VSPQ
Sbjct  428   GRGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKVYDIIGYVYQYLKLLRDVSPQ  487

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKDI  1436
             EWIFKELQDIG M+F+F EE+P D+YAAEL+EN+L YP E V+YGDY Y+ WD +LI+D+
Sbjct  488   EWIFKELQDIGNMDFKFAEEQPADDYAAELSENMLAYPVEHVIYGDYVYQTWDPKLIEDL  547

Query  1437  LGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLHLP  1616
             +GFF   NMR+DVV+KS+  S + Q EPWFGS+Y+EE +P SL+E W +P E+D SLHLP
Sbjct  548   MGFFTPKNMRIDVVSKSI-KSEEFQQEPWFGSRYIEEDVPLSLMETWTNPSEVDASLHLP  606

Query  1617  AKNDFIPSDFSIRADTISCD--GGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             +KN FIP DFSIRA     D    + P+CI+DEP MKFWYKLD TFK+PRANTYFR+ LK
Sbjct  607   SKNQFIPCDFSIRAINSDVDPKTQSPPRCIIDEPFMKFWYKLDETFKVPRANTYFRINLK  666

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGF  1949
             GAY++++N LLTELF+ LLKDE  E +           V   G +L  +V+GF
Sbjct  667   GAYASVKNCLLTELFINLLKDETKEQL---------GYVVECGPRLTYRVHGF  710


 Score =   242 bits (618),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 153/207 (74%), Gaps = 6/207 (3%)
 Frame = +3

Query  2418  YFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFR  2597
             YF+I  +     +K   L +LF  ++++       TKEQLGYVV+C PR+TYR+ GFCF 
Sbjct  660   YFRINLKGAYASVKNCLLTELFINLLKD------ETKEQLGYVVECGPRLTYRVHGFCFC  713

Query  2598  VQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLW  2777
             VQSS+Y P++L GR++NFI   + +L+ LD++SFE+++SG+IA+LLEKDPSL  ETN LW
Sbjct  714   VQSSKYGPVHLLGRVENFIKKIEGLLEQLDEESFEDYRSGVIARLLEKDPSLLSETNELW  773

Query  2778  GQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDS  2957
              QIVDKRYMFD S KEAEEL+SI+K D+I+WY TY ++  PKCRRL+VRVWGC+T  K+S
Sbjct  774   SQIVDKRYMFDFSHKEAEELRSIQKKDVIKWYKTYFRESSPKCRRLAVRVWGCDTNMKES  833

Query  2958  DASMEPAKVIKDPTAFKKSSEFYPSFC  3038
                 +  +VI D  AFK +S+FYPS C
Sbjct  834   QTDEKSVQVIADAIAFKSTSQFYPSLC  860



>ref|XP_001760921.1| predicted protein [Physcomitrella patens]
 gb|EDQ74310.1| predicted protein [Physcomitrella patens]
Length=981

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/823 (42%), Positives = 522/823 (63%), Gaps = 5/823 (1%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGST+FPDENEYD +LS+HGG+SNAYT+ E TC++F+V+   L  AL RF+QFF
Sbjct  119   LEHMLFMGSTKFPDENEYDKFLSQHGGNSNAYTDQEFTCFYFDVRNRNLRDALDRFAQFF  178

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPLVK +AM+RE+ A++SEF Q   ND  RL Q+QC+T+ P HPF+RF WGNKKSL  D
Sbjct  179   LSPLVKVDAMDREIQAIESEFVQAAGNDMNRLCQVQCYTALPSHPFHRFSWGNKKSLHDD  238

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
                +G+++R ++ +LYH++Y   +MKLVI+GG++LD L++WV+ LF  +K+G   +    
Sbjct  239   PVNKGIDMRAKLLQLYHEDYRAGRMKLVILGGDSLDTLQNWVVSLFGQIKEGGDGRLIIH  298

Query  894   LETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFL  1073
              E  IW+  ++Y + A  + +++ L++ LP L   YL K  DY  H++GHEG+GSLL  L
Sbjct  299   GERRIWEPNRMYRVAAGTEQNLVALNFPLPCLETAYLTKPHDYFGHIIGHEGQGSLLALL  358

Query  1074  KTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSP  1253
             + KGW  S++AG GD G+  + + ++F + I LT+ G++ + E+IG ++QYLK+LR + P
Sbjct  359   RRKGWARSMTAGCGDNGLETNQMLFLFTIRITLTNHGVEHVMEVIGLLFQYLKMLRSLGP  418

Query  1254  QEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIKD  1433
             QEWIF+E   +  + F   E+  QD+Y A LA N+ +Y    V+YGDYA++IWD  +I +
Sbjct  419   QEWIFQEQNAVSKLNFEHFEDPAQDDYVASLATNMFLYTKAHVLYGDYAHDIWDPAMITE  478

Query  1434  ILGFFRADNMRVDVVTKSLN-NSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
             +L      NMR D++    +  SSDVQ EPWF + +  E IP++LL+LW DPP +D SL 
Sbjct  479   LLAQLIPVNMRADLLLHRFDKTSSDVQMEPWFETAFTVETIPTALLKLWADPPCVDSSLR  538

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             L   N FIP D +I       DG   P C+LD   +K W++ +     PR N  F +   
Sbjct  539   LQEPNMFIPHDITIVPS--KEDGSKNPSCLLDSAALKVWHRCNPILNTPRVNACFSIMFW  596

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
                  + +A+L EL+++ L ++LNE +Y A VAKLETS+SL G ++ELK++GF+ KLPVL
Sbjct  597   PPTKKIIDAVLAELYLIRLSNQLNETLYLADVAKLETSLSLSGYRIELKIFGFSEKLPVL  656

Query  1971  LSKVLAVTVSFSPKDDRFLVIK-EDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEkl  2147
               K+ +   + +  +  F V+  E +    K  N KP++HA+YL  Q L K FWDV+ + 
Sbjct  657   AQKIASQMQNLASTELEFKVLTVEVLAEEYKRANEKPIDHAAYLLTQALSKRFWDVDHRY  716

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHK  2327
               L  L+  D   F+ +L  + YIE    GN  +++A+ ++ IF       P P + R  
Sbjct  717   NCLQILAFQDFTKFVANLFCKTYIECFVDGNATKKQALALAKIFKEALVSCPFPLQERPT  776

Query  2328  EYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPL  2507
               V+ LP+G  ++   +VK + + NSVV  YFQ+  + G + ++L++L+ LF +I+ EP 
Sbjct  777   NCVVRLPTGTSMLYMEKVKCEFEKNSVVHSYFQLGQDRGKDSMRLRSLMTLFIDIISEPF  836

Query  2508  FDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLD  2687
             F++LRTKEQ+GYVVD +    + +LG  F VQS++Y P Y++ RI+ FI    ++L ++ 
Sbjct  837   FNQLRTKEQIGYVVDLADEDLHGVLGISFMVQSAKYSPAYIESRINAFIKTIPKMLKDMK  896

Query  2688  DDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
             D  F++ K  LIA+      +L  E+N  W QI   RY+  L+
Sbjct  897   DTEFQSHKESLIAEKQGYPSTLIDESNDFWEQIWTHRYIAKLT  939



>ref|XP_005650450.1| hypothetical protein COCSUDRAFT_27509 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25906.1| hypothetical protein COCSUDRAFT_27509 [Coccomyxa subellipsoidea 
C-169]
Length=1020

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/916 (40%), Positives = 537/916 (59%), Gaps = 40/916 (4%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDEN+YD+YL  HGGS+NA+TE E T YHF+ K + L+GAL+RFSQFF
Sbjct  109   LEHMLFMGSEQFPDENDYDAYLQSHGGSANAFTELEFTNYHFDCKPDALHGALQRFSQFF  168

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL KA+A+EREV AVD+EF+ V Q+DS RL QL+CHTS  GH + +F WGN+KSL D 
Sbjct  169   VAPLCKADALEREVNAVDNEFSGVQQDDSMRLAQLRCHTSHEGHIYRKFTWGNRKSLVDC  228

Query  717   -TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVK--KGDMVKSS  887
                +G+++R ++ + Y +NY   +M L ++GGE LD L+ WVLELFS V   +G   + S
Sbjct  229   PAAKGIDVRSELVQYYKENYSAERMCLAVLGGEPLDTLQQWVLELFSAVPCGRGPRPEFS  288

Query  888   SRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
             + +   + + G+L+ + AV+  H L +++ LPSL   Y  KAEDY++HL+GHEG GSLL 
Sbjct  289   NLISATVSQGGRLHMMPAVRQGHQLTVTFQLPSLLTAYREKAEDYVSHLVGHEGSGSLLS  348

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKI----FEIIGFVYQYLKL  1235
              LK  G  +++SAGV + G  R+S  ++F ++I LT++GL+         +GF++ YL++
Sbjct  349   ALKAAGLASNLSAGVSESGYERNSALFVFDVTITLTEAGLRAAPGNGLATVGFLFGYLQM  408

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWD  1415
             LR V PQ+W+F EL  I  ++FRF EEE   EY A +A ++  Y PE  + G + Y+ WD
Sbjct  409   LRTVGPQQWVFDELAAIANLKFRFAEEEDACEYVARIAADMPHYAPEHALCGPHLYDTWD  468

Query  1416  EQLIKDILGFFR--------ADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLE  1571
               L++ + G+             +R  VVT  L       C   F   YV   +P+ L+ 
Sbjct  469   PSLVRKLQGYSSPIYLKCTLTACIRTGVVTHQL-------CHDRFELPYVSLPLPAELVR  521

Query  1572  LWKDPPEIDV-SLHLPAKNDFIPSDFSIRADT---ISCDG----GNAPKCILDEPLMKFW  1727
              W++P E  + +L LP +N +IP+DF++R+      S +G       P+ I D P ++ W
Sbjct  522   SWEEPSEAMMRALSLPPRNHYIPTDFTLRSAGNADASSNGIQPLATPPQLIADAPGLQVW  581

Query  1728  YKLDNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV  1907
             +KLD+TF++P+A  Y  +T K AY + R A  T L + LL+D L E  Y A VA L   V
Sbjct  582   HKLDSTFEVPKAVAYINITSKAAYESPRAAAATHLAMKLLEDTLCETTYLADVAGLGYDV  641

Query  1908  SLYG-DKLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLN  2084
                G   +E+KV GF+HK+ +L S ++   VS       F  I+E + R  +N NMKP  
Sbjct  642   WPEGLSGIEIKVEGFSHKMALLTSTIVQQLVSLKADPQSFDRIREVLARKYQNANMKPDR  701

Query  2085  HASYLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVN  2264
             HASYLRL+ L K  W V+    +L  L L    AFLP L    +I  L  GN+  ++A+ 
Sbjct  702   HASYLRLRAL-KHLWHVDN---ILLELKLLTPAAFLPRLFRDTHITALLQGNLTADDAME  757

Query  2265  ISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVG  2444
             I+S   + F    +PA  R  + V  LP  + L+    VKN  +  SV E+Y       G
Sbjct  758   IASSVRAAFPDGIMPAAERPLDRVAMLPQASSLLHRAPVKNAEEDCSVAEVYLM----AG  813

Query  2445  SELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPI  2624
                ++L+A +DL ++++ EP +D+LRTKEQLGY V  S R+T+ ILGF F V S+ + P 
Sbjct  814   PNEVRLRAALDLLEQVLSEPFYDQLRTKEQLGYSVHASTRLTHGILGFAFVVVSATFGPG  873

Query  2625  YLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYM  2804
             +   RI+ F+      LD L  D  ++ +  LIA   +KD +L+ E +R W QI  KRY 
Sbjct  874   HADERIEAFLRGFAARLDALSVDELDSNRQALIAAKTQKDHTLADEADRNWEQISSKRYD  933

Query  2805  FDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKV  2984
             F   E+E   L+ +   +L   +   L    P+ R+L+V V G    +K + A+ +   +
Sbjct  934   FLAREEEVAALEQLTVEELQGVFKALLVPGGPERRKLAVHVVGKPFAQKLTSAAPDGCTM  993

Query  2985  IKDPTAF-KKSSEFYP  3029
             + D   F + SS++ P
Sbjct  994   LSDLAKFWEDSSKYAP  1009



>gb|AET00720.2| insulin-degrading enzyme [Medicago truncatula]
Length=961

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/876 (41%), Positives = 519/876 (59%), Gaps = 34/876 (4%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHML  GS +F ++ +Y SY+S+HGGS++ +T TEH  + F+V  +FL GAL+RF+  F
Sbjct  74    LEHMLVEGSQKFSEKKDYLSYISEHGGSTDEFTNTEHCNFSFQVNGKFLKGALRRFAHIF  133

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNR-FFWGNKKSLSD  713
             + PL+  E +E EV AV+SEFN+  +        L CHTS  GHP+N  F  GN+ SL  
Sbjct  134   IEPLLSKEILEAEVNAVESEFNERKEEWKLVHDGLLCHTSREGHPYNNVFLCGNRGSLMG  193

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               +   +L +++ K +   Y+  KMKLVII GETLD L+ W+ +LF ++KK    K  SR
Sbjct  194   EKDDCDDLHKEVLKFHRKEYHAEKMKLVIISGETLDGLQGWIEKLFDSIKKCPAKKVESR  253

Query  894   L------ETPIWKAGKLYW--LEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEG  1049
                    + P+WK+G+ Y   LE + + +IL +SW L SLR  Y  K + Y+++ L  EG
Sbjct  254   KRKRILSKRPVWKSGEQYHIVLETL-NTNILVVSWILLSLRNVYEHKPDRYISYFLNQEG  312

Query  1050  KGSLLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYL  1229
              GSL+  LK KG   S++A +GD   H    A IF + I LT+SG+ +I +IIG +Y+YL
Sbjct  313   TGSLISLLKDKGLAKSLTAEIGDGICH---TANIFSIRIGLTNSGILEINKIIGLIYEYL  369

Query  1230  KLLREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEI  1409
              LLR+ SP EW+FKE+Q +G + F F EE  Q EYA +L+ENLL YPP+ V+Y D+ YE 
Sbjct  370   TLLRD-SPPEWMFKEIQSVGELAFNFGEENDQREYAVKLSENLLQYPPKHVIYADHLYEK  428

Query  1410  WDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQCE---PWFGSQYVEEYIPSSLLELWK  1580
             W+E LIK +LG+F  +NMR+ V T      S+++     PWFG  Y  + I  SL++ WK
Sbjct  429   WNEPLIKQVLGYFLPENMRIYVYT----GGSEMEVSKLVPWFGIPYSVQDIEESLMKFWK  484

Query  1581  DPPEIDVSLHLPAKNDFIPSDFSIR-ADTISCDGGN--APKCILDEPLMKFWYKLDNTFK  1751
             +  E    L LP KN+FIP + SI   D +  D  N   PKCI DE  MK WYK D T K
Sbjct  485   ETQEAHEPLGLPCKNEFIPYNTSIDVGDIVDEDFSNMTPPKCIFDEDSMKLWYKRDCTSK  544

Query  1752  LPRANTYFRVTL-KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKL  1928
              P A  Y ++   KG + N +   L+ELF+  L+D+LNE++ +A +A L T +      L
Sbjct  545   APFACIYIQIKYSKGVWDNAKTCALSELFISFLRDKLNEVISKAQMAMLNTKLRFIDGML  604

Query  1929  ELKVYGFNHKLPVLLSKVLAVTVSFSPKDD-RFLVIKEDMERTLKNTNMKPLNHASYLRL  2105
             E+KV+G    LP LLSK+L+   SF P DD R+ ++KE+ E +L   N       + LR 
Sbjct  605   EVKVFGHKEMLPSLLSKILSEVNSFMPTDDGRYELVKENAESSLMEDNDDNEFLETLLRE  664

Query  2106  QVLCKSFWDVEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTS  2285
              +  K     +E +  L++LSL D+  F+ ++ SQ +IEGL HGN+ E++A  I  I   
Sbjct  665   HIYVK-----DELVNYLHNLSLDDVTEFIEEIRSQTFIEGLVHGNLSEDDANKIYKIVKQ  719

Query  2286  YFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLK  2465
              F    LP   RH E VMCL    + V  V         S  +LY QI P + + + K+ 
Sbjct  720   IFPNKSLPIVPRHVERVMCLTPKTNFV--VNYSGMSSVISTAQLYIQIRPNLFNSIKKM-  776

Query  2466  ALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRID  2645
             AL+DLFD IVE+P +DR+R +E LGY V       + + GFCF + SS+++P YLQ RI+
Sbjct  777   ALLDLFDVIVEKPFYDRIRREENLGYTVQSYSSEIHNVWGFCFDIASSDHEPYYLQHRIE  836

Query  2646  NFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKE  2825
              F++  +++ ++LD  +F+ ++  L+ K L+   SL  E+ ++W +I       ++++K 
Sbjct  837   EFVDGLEKVFEDLDSKTFKKYRRSLVDKKLQGCSSLEDESCQVWKEISKYSGNINITQKV  896

Query  2826  AEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG  2933
             AE+LK I K DL+ +Y  Y K+    CRRL + VW 
Sbjct  897   AEQLKQITKDDLMRFYRKYFKKSSGNCRRLKINVWS  932



>gb|KFM22670.1| Insulin-degrading enzyme [Auxenochlorella protothecoides]
Length=1042

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/910 (37%), Positives = 524/910 (58%), Gaps = 35/910 (4%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS +FPDEN++DS+L+ HGG+SNA TE   T ++F+ K   L GAL+RFSQFF
Sbjct  107   LEHMLFMGSEKFPDENDFDSFLTAHGGASNACTENA-TTFYFDCKPSALQGALQRFSQFF  165

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLS-D  713
             V+PL+KA+A+EREV AVD+EF  V Q+D CR QQL+ HT+ PGH  ++F WGN++SL+ +
Sbjct  166   VAPLIKADALEREVQAVDNEFTGVAQSDGCRAQQLRAHTARPGHELSKFGWGNRRSLAQE  225

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
                 GV++R  + + Y   Y   +M LV++GGETLD LE+WV + F  V  G   + S  
Sbjct  226   PAAAGVDVRGGLVRHYTQQYSAERMNLVLLGGETLDELEAWVRDEFRGVPGGRGPRPSYA  285

Query  894   LETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFL  1073
                  ++ G+LY L+AV+  H L+L++ LP L  +Y +KA+DYL+HL+GHEG+GSLL  L
Sbjct  286   EAGFPFQGGRLYCLQAVRQAHHLQLTFQLPCLHAEYRKKADDYLSHLIGHEGRGSLLSAL  345

Query  1074  KTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLK----KIFEIIGFVYQYLKLLR  1241
             K++GW + +S GV ++    S+  Y+F + I LT++GL          +  V+ YL+LLR
Sbjct  346   KSRGWASELSGGVTEQ----STAFYLFDIVISLTEAGLAHGSGAGLACVELVFAYLELLR  401

Query  1242  EVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQ  1421
             +  PQ+W ++E+ ++  M+FRF EE+        L+ ++  YPPE  + GDY +E+WDE+
Sbjct  402   KSGPQKWAWEEMANVAAMKFRFQEEDDVSNLVTNLSMDMHRYPPEHTLVGDYVHELWDEK  461

Query  1422  LIKDILGFFRADNMRVDV-------VTKSLNNS-SDVQ--CEPWFGSQYVEEYIPSSLLE  1571
             LI  +L       +R+D+       V K+L +   D++   EPWF  QYVE  IP  LLE
Sbjct  462   LIASLLDSMTPQTVRIDIQTSKYEEVCKALASEIPDIKQGVEPWFDFQYVEAVIPGDLLE  521

Query  1572  LWKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAP-----KCILDEPLMKFWYKL  1736
              W+     +  + LP  N F+P+DFS+  +         P       ++DEP ++ W K 
Sbjct  522   RWQGARATE-DMSLPPPNHFVPTDFSLCCEEAKLPAEEGPFPAPPALLVDEPGLRLWSKT  580

Query  1737  DNTFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLY  1916
             D+TF+LPR   +FR++    Y    +A    L + LL+D L E  Y A VA L  +    
Sbjct  581   DSTFRLPRTTAHFRLSSPALYDTPASAARAHLLLKLLEDRLCETSYLAEVAGLNCNTWFE  640

Query  1917  GDK-LELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHAS  2093
             G   +++KV GF+H+LP L+  V          ++ F  + E ++   +N NMKP  HA+
Sbjct  641   GRAGIDIKVEGFSHRLPALVDAVFGTLRELDVTEEVFARVLEGLQLKYRNMNMKPHKHAT  700

Query  2094  YLRLQVLCKSFWDVEEklcllnslsladlkaFLPDLLSQ----LYIEGLCHGNMLEEEAV  2261
             YLRL  L +S W   + L  L++++LAD++AFL  LL       ++E L HGN+     +
Sbjct  701   YLRLLSLKESMWQASDILKELDAMTLADVRAFLSSLLGDASHTCHLEALVHGNVPPRATL  760

Query  2262  NISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEV  2441
             +++    S       PA  R  E  + LP+G  L+    V+N  + NSV E+Y Q     
Sbjct  761   DLARSVRSVLGPCATPASARPLERAVELPAGGPLLHRAGVRNGEEENSVAEVYRQ----A  816

Query  2442  GSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDP  2621
             G + ++ +ALVDL +++V EP +D LRTKEQLGY V    R+T+ +LGF   V S  + P
Sbjct  817   GRDGVRARALVDLVEQLVGEPCYDTLRTKEQLGYSVHSGMRLTHGLLGFAVVVVSGVHGP  876

Query  2622  IYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRY  2801
              YL+ RI  F+      L  + ++ FEN ++ +I+  + K  S+  E + +W  +  ++Y
Sbjct  877   AYLESRILEFLAGFVSTLRGMHEEEFENHRAAVISAKMLKHRSMVEEADGMWEAVTSQKY  936

Query  2802  MFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAK  2981
              FD   +E E L+ +   ++  +Y   +       R+LSV V G   Q + S  + E   
Sbjct  937   DFDARAREVEVLQQLTLPEVKAFYEECIAPSASTLRQLSVHVVGKAHQAELSADAGEGVT  996

Query  2982  VIKDPTAFKK  3011
             ++ DP++  +
Sbjct  997   LLSDPSSLHQ  1006



>emb|CDY15592.1| BnaA08g28760D [Brassica napus]
Length=702

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/461 (62%), Positives = 363/461 (79%), Gaps = 11/461 (2%)
 Frame = +3

Query  1674  DGGNAPKCILDEPLMKFWYK------LDNTFKLPRANTYFRVTLKGAYSNLRNALLTELF  1835
             +G +  +CI+   L K +Y       LD TFK+PRANTYFR+ LKGAY +++N LLTELF
Sbjct  247   NGVDLRECIMK--LYKEYYHGGLMKLLDETFKVPRANTYFRINLKGAYGSVKNCLLTELF  304

Query  1836  VLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVLLSKVLAVTVSFSPKD  2015
             + LLKDELNEI+YQA+  KLETS+S+YGDKLELKV+GFN K+P LLSK+LA+  SF P  
Sbjct  305   INLLKDELNEIIYQAT--KLETSLSMYGDKLELKVFGFNEKIPALLSKILAIAKSFIPSL  362

Query  2016  DRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWDVEEklcllnslsladlkaFLP  2195
             DRF VIKE+MER L+NTNMKPLNH++YLRLQ+LCK  +D EEKL +LN LSL DL +F+P
Sbjct  363   DRFKVIKENMERGLRNTNMKPLNHSTYLRLQLLCKRIYDSEEKLSVLNDLSLTDLNSFIP  422

Query  2196  DLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAEMRHKEYVMCLPSGADLVRDV  2375
             ++ SQ++IE LCHGN+ E+EAVNIS+IF +  +V PLP + RH E + C P  A LVRDV
Sbjct  423   EVRSQIFIEALCHGNLSEDEAVNISNIFKNSLTVEPLPVKSRHGEQITCFPLSAKLVRDV  482

Query  2376  QVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDC  2555
              VKNK +TNSVVELY+QIEPE      ++KA++DLF EI+EEPLF++LRTKEQLGYVV+C
Sbjct  483   NVKNKSETNSVVELYYQIEPEEAKS-TRMKAVLDLFSEIIEEPLFNQLRTKEQLGYVVEC  541

Query  2556  SPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLL  2735
              PR+TYR+ GFCF VQSS+Y P++L GRIDNFI D + +L+ LD++SFE+++SGLI KLL
Sbjct  542   GPRLTYRVHGFCFCVQSSKYGPVHLLGRIDNFIKDIEGMLEQLDEESFEDYRSGLIGKLL  601

Query  2736  EKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRL  2915
             EKDPSL  ETN LW QIVDKRYMFD S+KEAEEL+SI K D+++WY TY K+  PK RRL
Sbjct  602   EKDPSLLSETNELWSQIVDKRYMFDYSQKEAEELRSIEKKDVMKWYKTYFKESSPKSRRL  661

Query  2916  SVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             +VRVWGCNT  K++    +  +VI D  AFK +S+FYPS C
Sbjct  662   AVRVWGCNTNMKETQTDPKSVQVIADAVAFKSTSKFYPSLC  702


 Score =   266 bits (679),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  357  VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
            +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  125  LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  184

Query  537  VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
            V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQCHTSA GHPFNRF WGNKKSLS A
Sbjct  185  VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCHTSAKGHPFNRFSWGNKKSLSGA  244

Query  717  TERGVNLREQIFKLYHDNYYGRKMKLV  797
             E GV+LRE I KLY + Y+G  MKL+
Sbjct  245  MENGVDLRECIMKLYKEYYHGGLMKLL  271



>ref|XP_008344802.1| PREDICTED: nardilysin-like [Malus domestica]
Length=531

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/331 (79%), Positives = 293/331 (89%), Gaps = 0/331 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVK EFL GAL+RFSQFF
Sbjct  134   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTEAEHTCYHFEVKPEFLKGALRRFSQFF  193

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             VSPLVK EAMEREV A+DSEFNQVLQNDSCRL+Q+QCHT+APGHPFNRF WGNKKSL DA
Sbjct  194   VSPLVKIEAMEREVQAIDSEFNQVLQNDSCRLEQIQCHTAAPGHPFNRFCWGNKKSLVDA  253

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLE WV+EL+  VKKG  VK   + 
Sbjct  254   MEKGINLREQILKLYKDYYHGGLMKLVVIGGESLDVLEDWVVELYGNVKKGPQVKLEFKA  313

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK GKLY LEAV+DV+IL L+WT P L +DYL+K EDYLAHLLGHEG+GSL F+LK
Sbjct  314   EGPIWKVGKLYRLEAVRDVNILNLTWTFPCLHQDYLKKPEDYLAHLLGHEGRGSLHFYLK  373

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+GW TS+SAGVGDEGMHRSS+AY+F MSIHLTDSGL+KI EII +VYQY+KLL +VSPQ
Sbjct  374   TRGWATSLSAGVGDEGMHRSSVAYVFRMSIHLTDSGLEKISEIICYVYQYIKLLHQVSPQ  433

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELA  1349
             EWIF+ELQDIG M+FRF EE+PQD+YAAELA
Sbjct  434   EWIFRELQDIGNMDFRFAEEQPQDDYAAELA  464



>ref|XP_007146874.1| hypothetical protein PHAVU_006G0775000g, partial [Phaseolus vulgaris]
 gb|ESW18868.1| hypothetical protein PHAVU_006G0775000g, partial [Phaseolus vulgaris]
Length=539

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/331 (80%), Positives = 297/331 (90%), Gaps = 1/331 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS EFPDENEYDSYLSKHGGSSNAYTETE+TCYHFEVKREFL GALKRFSQFF
Sbjct  210   LEHMLFMGSDEFPDENEYDSYLSKHGGSSNAYTETEYTCYHFEVKREFLKGALKRFSQFF  269

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPLVK EAMEREVLAVDSEFNQVLQND+CRLQQLQCHTSA  HP NRFFWGNKKSL DA
Sbjct  270   ISPLVKMEAMEREVLAVDSEFNQVLQNDACRLQQLQCHTSAHNHPLNRFFWGNKKSLVDA  329

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NLREQI KLY D Y+G  MKLV+IGGE+LDVLESWV+ELF  VKKG      S +
Sbjct  330   MEKGINLREQILKLYGDYYHGGLMKLVVIGGESLDVLESWVVELFGAVKKGQANPVFS-M  388

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E PIWK+GK+Y LEAVKDVHIL+LSWTLP L + YL+K EDYLAHLLGHEG+GSLL FLK
Sbjct  389   EGPIWKSGKVYRLEAVKDVHILDLSWTLPCLHQQYLKKPEDYLAHLLGHEGRGSLLSFLK  448

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
             T+G  TS+SAGVG+EG++RSSIAY+F MSIHLTDSG++KIF+IIGFVYQYLKLLR+ SPQ
Sbjct  449   TRGLATSLSAGVGEEGIYRSSIAYVFVMSIHLTDSGIEKIFDIIGFVYQYLKLLRQDSPQ  508

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELA  1349
             EWIFKELQ+IG M+FRF+EE+PQD+YAAELA
Sbjct  509   EWIFKELQNIGNMDFRFVEEQPQDDYAAELA  539



>gb|KDO49702.1| hypothetical protein CISIN_1g0017302mg, partial [Citrus sinensis]
 gb|KDO49703.1| hypothetical protein CISIN_1g0017302mg, partial [Citrus sinensis]
 gb|KDO49704.1| hypothetical protein CISIN_1g0017302mg, partial [Citrus sinensis]
 gb|KDO49705.1| hypothetical protein CISIN_1g0017302mg, partial [Citrus sinensis]
Length=453

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/331 (79%), Positives = 293/331 (89%), Gaps = 0/331 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFE+KREFL GAL RFSQFF
Sbjct  123   LEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEIKREFLKGALMRFSQFF  182

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQCHTS  GH FN+FFWGNKKSL  A
Sbjct  183   ISPLMKVEAMEREVLAVDSEFNQALQNDACRLQQLQCHTSQLGHAFNKFFWGNKKSLIGA  242

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E+G+NL+EQI KLY + Y G  MKLV+IGGE LD L+SWV+ELF+ V+KG  +K    +
Sbjct  243   MEKGINLQEQIMKLYMNYYQGGLMKLVVIGGEPLDTLQSWVVELFANVRKGPQIKPQFTV  302

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             E  IWKA KL+ LEAVKDVHIL+L+WTLP L ++YL+K+EDYLAHLLGHEG+GSL  FLK
Sbjct  303   EGTIWKACKLFRLEAVKDVHILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGRGSLHSFLK  362

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              +GW TSISAGVGDEGMHRSSIAYIF MSIHLTDSGL+KIF+IIGFVYQY+KLLR+VSPQ
Sbjct  363   GRGWATSISAGVGDEGMHRSSIAYIFVMSIHLTDSGLEKIFDIIGFVYQYIKLLRQVSPQ  422

Query  1257  EWIFKELQDIGFMEFRFIEEEPQDEYAAELA  1349
             +WIFKELQDIG MEFRF EE+PQD+YAAELA
Sbjct  423   KWIFKELQDIGNMEFRFAEEQPQDDYAAELA  453



>gb|KDO49706.1| hypothetical protein CISIN_1g0017302mg, partial [Citrus sinensis]
Length=315

 Score =   509 bits (1311),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 242/312 (78%), Positives = 274/312 (88%), Gaps = 0/312 (0%)
 Frame = +3

Query  414   SYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSPLVKAEAMEREVLAVDS  593
             SYLSKHGGSSNAYTETEHTCYHFE+KREFL GAL RFSQFF+SPL+K EAMEREVLAVDS
Sbjct  4     SYLSKHGGSSNAYTETEHTCYHFEIKREFLKGALMRFSQFFISPLMKVEAMEREVLAVDS  63

Query  594   EFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDATERGVNLREQIFKLYHDNY  773
             EFNQ LQND+CRLQQLQCHTS  GH FN+FFWGNKKSL  A E+G+NL+EQI KLY + Y
Sbjct  64    EFNQALQNDACRLQQLQCHTSQLGHAFNKFFWGNKKSLIGAMEKGINLQEQIMKLYMNYY  123

Query  774   YGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLETPIWKAGKLYWLEAVKDV  953
              G  MKLV+IGGE LD L+SWV+ELF+ V+KG  +K    +E  IWKA KL+ LEAVKDV
Sbjct  124   QGGLMKLVVIGGEPLDTLQSWVVELFANVRKGPQIKPQFTVEGTIWKACKLFRLEAVKDV  183

Query  954   HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLKTKGWVTSISAGVGDEGMHR  1133
             HIL+L+WTLP L ++YL+K+EDYLAHLLGHEG+GSL  FLK +GW TSISAGVGDEGMHR
Sbjct  184   HILDLTWTLPCLHQEYLKKSEDYLAHLLGHEGRGSLHSFLKGRGWATSISAGVGDEGMHR  243

Query  1134  SSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQEWIFKELQDIGFMEFRFIE  1313
             SSIAYIF MSIHLTDSGL+KIF+IIGFVYQY+KLLR+VSPQ+WIFKELQDIG MEFRF E
Sbjct  244   SSIAYIFVMSIHLTDSGLEKIFDIIGFVYQYIKLLRQVSPQKWIFKELQDIGNMEFRFAE  303

Query  1314  EEPQDEYAAELA  1349
             E+PQD+YAAELA
Sbjct  304   EQPQDDYAAELA  315



>pdb|3CWW|A Chain A, Crystal Structure Of Ide-Bradykinin Complex
 pdb|3CWW|B Chain B, Crystal Structure Of Ide-Bradykinin Complex
Length=990

 Score =   529 bits (1362),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 326/923 (35%), Positives = 519/923 (56%), Gaps = 58/923 (6%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  81    LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  140

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  141   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  200

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  201   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  259

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  260   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  319

Query  1068  FLKTKGWVTSISAG--VGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLR  1241
              LK+KGWV ++  G   G  G         F +++ LT+ GL  + +II  ++QY++ LR
Sbjct  320   ELKSKGWVNTLVGGQKAGARGF------MFFIINVDLTEEGLLHVEDIILHMFQYIQKLR  373

Query  1242  EVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQ  1421
                PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   
Sbjct  374   AEGPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPD  433

Query  1422  LIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDV  1601
             LI+ +L   R +N+RV +V+KS    +D + E W+G+QY +E IP +++  W++   ++ 
Sbjct  434   LIEMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDAVIAKWQN-AALNG  491

Query  1602  SLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRV  1781
                LP KN+FIP++F I    +       P  I D  + K W+K D+ F LP+AN  F  
Sbjct  492   KFKLPTKNEFIPTNFEILP--LEAAATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEF  549

Query  1782  TLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNH  1955
                 AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N 
Sbjct  550   FSPFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYND  607

Query  1956  KLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWD  2132
             K P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W 
Sbjct  608   KQPILLKKIIEKMATFEIDEARFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWT  667

Query  2133  VEEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPA  2312
              +E    L  ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I  +            
Sbjct  668   KDELKEALADVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTL-------  720

Query  2313  EMRHKEYVMCLPSGADLVRDVQV----------KNKLDTNSVVELYFQIEPEVGSELIKL  2462
              + H      LPS     R+VQ+          +N++  NS +E+Y+Q + +  SE    
Sbjct  721   -IEHAHTKPLLPSQLAAYREVQLPDRGWFVYQQRNEVHNNSGIEIYYQTDMQSTSE----  775

Query  2463  KALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRI  2642
                ++LF +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R+
Sbjct  776   NMFLELFAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRV  834

Query  2643  DNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEK  2822
             + F+   ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    
Sbjct  835   EAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNT  894

Query  2823  EAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASME  2972
             E   LK++ K+D+I++Y   L    P+  ++SV V           G    + D + S  
Sbjct  895   EVAYLKTLTKADIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQA  954

Query  2973  PA----KVIKDPTAFKKSSEFYP  3029
             PA    +VI++ TAFK+    +P
Sbjct  955   PALPQPEVIQNMTAFKRGLPLFP  977



>pdb|3QZ2|A Chain A, The Structure Of Cysteine-free Human Insulin Degrading 
Enzyme
 pdb|3QZ2|B Chain B, The Structure Of Cysteine-free Human Insulin Degrading 
Enzyme
 pdb|4DTT|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
(ide) In Complex With Compund 41367
 pdb|4DTT|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
(ide) In Complex With Compund 41367
 pdb|4IOF|A Chain A, Crystal Structure Analysis Of Fab-bound Human Insulin 
Degrading Enzyme (ide)
 pdb|4IOF|B Chain B, Crystal Structure Analysis Of Fab-bound Human Insulin 
Degrading Enzyme (ide)
 pdb|4IFH|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
(ide) In Complex With Compound Bdm44619
 pdb|4IFH|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
(ide) In Complex With Compound Bdm44619
Length=990

 Score =   528 bits (1359),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 329/917 (36%), Positives = 530/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  81    LEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  140

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  141   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  200

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  201   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  259

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  260   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  319

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  320   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  375

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  376   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  435

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  436   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  493

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  494   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  551

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  552   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  609

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  610   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  669

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  670   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  729

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  730   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  781

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  782   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  840

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    E   LK
Sbjct  841   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLK  900

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  901   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQAPALPQP  960

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  961   EVIQNMTEFKRGLPLFP  977



>pdb|4LTE|A Chain A, Structure Of Cysteine-free Human Insulin Degrading Enzyme 
In Complex With Macrocyclic Inhibitor
 pdb|4LTE|B Chain B, Structure Of Cysteine-free Human Insulin Degrading Enzyme 
In Complex With Macrocyclic Inhibitor
Length=978

 Score =   527 bits (1358),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 328/917 (36%), Positives = 530/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  69    LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  128

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  129   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  188

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  189   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  247

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  248   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  307

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  308   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  363

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  364   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  423

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  424   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  481

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  482   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  539

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  540   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  597

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  598   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  657

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  658   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  717

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  718   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  769

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  770   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  828

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    E   LK
Sbjct  829   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLK  888

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  889   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQAPALPQP  948

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  949   EVIQNMTEFKRGLPLFP  965



>pdb|3HGZ|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amylin
 pdb|3HGZ|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amylin
Length=969

 Score =   526 bits (1356),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 328/917 (36%), Positives = 530/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  68    LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  127

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  128   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  187

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  188   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  246

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  247   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  306

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  307   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  362

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  363   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  422

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  423   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  480

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  481   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  538

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  539   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  596

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  597   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  656

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  657   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  716

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  717   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  768

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  769   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  827

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    E   LK
Sbjct  828   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLK  887

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  888   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQAPALPQP  947

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  948   EVIQNMTEFKRGLPLFP  964



>pdb|2WBY|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Insulin
 pdb|2WBY|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Insulin
 pdb|2WC0|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Iodinated Insulin
 pdb|2WC0|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Iodinated Insulin
 pdb|3H44|A Chain A, Crystal Structure Of Insulin Degrading Enzyme In Complex 
With Macrophage Inflammatory Protein 1 Alpha
 pdb|3H44|B Chain B, Crystal Structure Of Insulin Degrading Enzyme In Complex 
With Macrophage Inflammatory Protein 1 Alpha
 pdb|3OFI|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Ubiquitin
 pdb|3OFI|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Ubiquitin
 pdb|3N56|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
(Ide) In Complex With Human B-Type Natriuretic Peptide (Bnp)
 pdb|3N56|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
(Ide) In Complex With Human B-Type Natriuretic Peptide (Bnp)
 pdb|3N57|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
(Ide) In Complex With Human Atrial Natriuretic Peptide (Anp)
 pdb|3N57|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
(Ide) In Complex With Human Atrial Natriuretic Peptide (Anp)
 pdb|2YPU|A Chain A, Human Insulin Degrading Enzyme E111q In Complex With 
Inhibitor Compound 41367
 pdb|2YPU|B Chain B, Human Insulin Degrading Enzyme E111q In Complex With 
Inhibitor Compound 41367
 pdb|4DWK|A Chain A, Structure Of Cystein Free Insulin Degrading Enzyme With 
Compound Bdm41671 ((s)-2-{2-[carboxymethyl-(3-phenyl-propyl)-amino]- 
Acetylamino}-3-(1h-imidazol-4-yl)-propionic Acid 
Methyl Ester)
 pdb|4DWK|B Chain B, Structure Of Cystein Free Insulin Degrading Enzyme With 
Compound Bdm41671 ((s)-2-{2-[carboxymethyl-(3-phenyl-propyl)-amino]- 
Acetylamino}-3-(1h-imidazol-4-yl)-propionic Acid 
Methyl Ester)
 pdb|4GS8|A Chain A, Structure Analysis Of Cysteine Free Insulin Degrading 
Enzyme (ide) With Compound Bdm43079 [{[(s)-2-(1h-imidazol-4-yl)-1-methylcarbamoyl- 
Ethylcarbamoyl]-methyl}-(3-phenyl-propyl)-amino]-acetic 
Acid
 pdb|4GS8|B Chain B, Structure Analysis Of Cysteine Free Insulin Degrading 
Enzyme (ide) With Compound Bdm43079 [{[(s)-2-(1h-imidazol-4-yl)-1-methylcarbamoyl- 
Ethylcarbamoyl]-methyl}-(3-phenyl-propyl)-amino]-acetic 
Acid
 pdb|4GSC|A Chain A, Structure Analysis Of Insulin Degrading Enzyme With 
Compound Bdm41559 ((s)-2-[2-(carboxymethyl-phenethyl-amino)-acetylamino]-3-(1h- 
Imidazol-4-yl)-propionic Acid Methyl Ester)
 pdb|4GSC|B Chain B, Structure Analysis Of Insulin Degrading Enzyme With 
Compound Bdm41559 ((s)-2-[2-(carboxymethyl-phenethyl-amino)-acetylamino]-3-(1h- 
Imidazol-4-yl)-propionic Acid Methyl Ester)
 pdb|4GSF|A Chain A, The Structure Analysis Of Cysteine Free Insulin Degrading 
Enzyme (ide) With (s)-2-{2-[carboxymethyl-(3-phenyl-propionyl)-amino]- 
Acetylamino}-3-(3h-imidazol-4-yl)-propionic 
Acid Methyl Ester
 pdb|4GSF|B Chain B, The Structure Analysis Of Cysteine Free Insulin Degrading 
Enzyme (ide) With (s)-2-{2-[carboxymethyl-(3-phenyl-propionyl)-amino]- 
Acetylamino}-3-(3h-imidazol-4-yl)-propionic 
Acid Methyl Ester
 pdb|4QLD|A Chain A, Crystal Structure Of Insulin Degrading Enzyme In Complex 
With Macrophage Inflammatory Protein 1 Beta
 pdb|4QLD|B Chain B, Crystal Structure Of Insulin Degrading Enzyme In Complex 
With Macrophage Inflammatory Protein 1 Beta
 pdb|4M1C|A Chain A, Crystal Structure Analysis Of Fab-bound Human Insulin 
Degrading Enzyme (ide) In Complex With Amyloid-beta (1-40)
 pdb|4M1C|B Chain B, Crystal Structure Analysis Of Fab-bound Human Insulin 
Degrading Enzyme (ide) In Complex With Amyloid-beta (1-40)
Length=990

 Score =   526 bits (1356),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 328/917 (36%), Positives = 530/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  81    LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  140

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  141   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  200

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  201   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  259

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  260   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  319

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  320   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  375

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  376   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  435

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  436   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  493

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  494   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  551

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  552   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  609

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  610   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  669

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  670   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  729

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  730   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  781

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  782   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  840

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    E   LK
Sbjct  841   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLK  900

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  901   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQAPALPQP  960

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  961   EVIQNMTEFKRGLPLFP  977



>pdb|3E4A|A Chain A, Human Ide-Inhibitor Complex At 2.6 Angstrom Resolution
 pdb|3E4A|B Chain B, Human Ide-Inhibitor Complex At 2.6 Angstrom Resolution
 pdb|2WK3|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amyloid-Beta (1-42)
 pdb|2WK3|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amyloid-Beta (1-42)
Length=1019

 Score =   526 bits (1354),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 328/917 (36%), Positives = 530/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  110   LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  169

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  170   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  229

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  230   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  288

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  289   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  348

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  349   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  404

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  405   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  464

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  465   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  522

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  523   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  580

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  581   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  638

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  639   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  698

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  699   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  758

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  759   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  810

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  811   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  869

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + WG+I+ ++Y FD    E   LK
Sbjct  870   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLK  929

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  930   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSNPVVGEFPAQNDINLSQAPALPQP  989

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  990   EVIQNMTEFKRGLPLFP  1006



>pdb|3E4Z|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Insulin-Like Growth Factor Ii
 pdb|3E4Z|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Insulin-Like Growth Factor Ii
Length=990

 Score =   522 bits (1345),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 326/917 (36%), Positives = 529/917 (58%), Gaps = 46/917 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             ++HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF
Sbjct  81    LQHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFF  140

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SD  713
             +SPL    A +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L + 
Sbjct  141   LSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETR  200

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSR  893
               + G+++R+++ K +   Y    M +V++G E+LD L + V++LFS V+  + V     
Sbjct  201   PNQEGIDVRQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKN-VPLPEF  259

Query  894   LETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
              E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL 
Sbjct  260   PEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  319

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  320   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAE  375

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+EL+D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  376   GPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLI  435

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++   
Sbjct  436   EMVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKF  493

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+AN  F    
Sbjct  494   KLPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKANLNFEFFS  551

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  ++ +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  552   PFAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  609

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  610   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  669

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P 
Sbjct  670   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPL  729

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  NS +E+Y+Q + +  SE       ++L
Sbjct  730   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNSGIEIYYQTDMQSTSE----NMFLEL  781

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  782   FAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIT  840

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++ +++F+     L  + L+K   LS E+ + +G+I+ ++Y FD    E   LK
Sbjct  841   MEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYYGEIISQQYNFDRDNTEVAYLK  900

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQ----------RKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V                + D + S  PA    
Sbjct  901   TLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQP  960

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  961   EVIQNMTEFKRGLPLFP  977



>ref|XP_004076931.1| PREDICTED: insulin-degrading enzyme-like [Oryzias latipes]
Length=977

 Score =   521 bits (1341),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 319/914 (35%), Positives = 509/914 (56%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+HGGS NA+T ++HT Y F+V  E L GAL RF+ FF+
Sbjct  70    EHMLFLGTEKYPKENEYSQFLSQHGGSDNAFTSSDHTNYFFDVSHEHLQGALDRFAPFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +RE+ AVDSE+ + L ND  RL QL+  T  P HPF +F  GNK +L +  
Sbjct  130   CPLFDESCKDRELNAVDSEYRKNLMNDDRRLFQLEKATCDPNHPFRKFRTGNKLTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E G+++R+++ K +   Y    M L ++G E+LD L S V++LF  V+  + V      
Sbjct  190   CEEGIDVRQELLKFHSTYYSANLMGLCVLGRESLDELTSMVVKLFGEVENKN-VPVPEFP  248

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  VKD+  L +++ +P L K Y  K   YL HL+GHE  GSL   
Sbjct  249   EHPFQEEHLRRIYKVVPVKDIRRLYVTFPIPDLHKYYKSKPGQYLGHLIGHEEPGSLFAE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK KGWV  + AG  ++          F + ++LT+ GL  + +I+  ++QY+  L    
Sbjct  309   LKAKGWVDGLLAGQKED----VRGFMFFKVRMNLTEEGLLHVDDIVLHLFQYIHKLHTEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEWIF+E +D+  + FRF ++E   +YA  +A +L  YP E+V+ G +  + +   LI+
Sbjct  365   PQEWIFEEYKDLKEVAFRFCDKERPRDYAYRVAGSLHYYPIEEVLSGKFTMDQFRPDLIQ  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L     DN+RV VV+KS    +D + E W+G+QY EE IP  +++ W + P ++ +  
Sbjct  425   TVLQKLTPDNVRVTVVSKSFEGQTD-RTEEWYGTQYKEEAIPDEVIQKWSN-PGLNPNFR  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KNDFIPS+F      +  D    P  I +  L + W+K D+TF+LP+   YF    +
Sbjct  483   LPTKNDFIPSNFETFP--VEEDAPAVPTLIKNTDLSRLWFKQDDTFRLPKLCQYFAFFSR  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  LT++F+ LLKD+LNE  Y A +A L+  +S   + + L V G++ K  +L
Sbjct  541   HLYTDPLHWNLTDMFIRLLKDDLNEYTYAAELAGLKYDISPQRNAITLSVRGYSDKQHIL  600

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++   VSF     RF +IKE+  R L N    +P+ HA++    ++ +  W  EE +
Sbjct  601   LQKIIEKMVSFQINQTRFDIIKEEYSRHLSNFRAERPITHAAFNVRLLMTELAWTKEELI  660

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVN----ISSIFTSYFSVPPLPAE  2315
               L+ +SL  L+AF   LLS+L+IE L HGN+ +E A+     +    T +    PLP  
Sbjct  661   EALDDVSLPRLQAFRAQLLSRLHIEALIHGNITKESALRMVQMVEDTLTEHAHTKPLPPN  720

Query  2316  MRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIV  2495
                    + +P G   V   Q +N++  +  +E+Y+Q + +          L++L  +I+
Sbjct  721   QLVFFREVQMPDGGWFVH--QQRNEVHKDCSIEIYYQTDMQSTHS----NMLLELLCQII  774

Query  2496  EEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEIL  2675
             +EP ++ LRTKEQLGY V    R    + G    +QS +  P YL+ R++ F+   +++L
Sbjct  775   KEPCYNTLRTKEQLGYSVSSGARRADGVQGLRISIQSKQA-PHYLESRVEAFLLSMEKLL  833

Query  2676  DNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKS  2855
             + + +++F+     L  + L+K   LS E  + WG+I  ++Y FD    E E LK++RK 
Sbjct  834   EEMSEEAFQKHIQALAIRRLDKPKKLSAECAKHWGEITSRQYQFDRDNMEVEHLKTLRKD  893

Query  2856  DLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPAK------VI  2987
             ++++++   L    PK R+LSV +           G ++Q+  +D S+ PA       VI
Sbjct  894   NILDFFSEQLTTRSPKRRKLSVHILSREMDACPAGGGSSQQ--TDGSLAPASSPPQPVVI  951

Query  2988  KDPTAFKKSSEFYP  3029
             +D T FK+S   +P
Sbjct  952   QDMTDFKRSLPLFP  965



>emb|CDX86509.1| BnaC08g01940D [Brassica napus]
Length=690

 Score =   509 bits (1311),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 270/310 (87%), Gaps = 0/310 (0%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS+EFPDENEYDSYLSKHGGSSNAYTE EHTCYHFEVKREFL GALKRFSQFF
Sbjct  120   LEHMLFMGSSEFPDENEYDSYLSKHGGSSNAYTEMEHTCYHFEVKREFLQGALKRFSQFF  179

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             V+PL+K EAMEREVLAVDSEFNQ LQND+CRLQQLQC+TSA GHPFNRF WGNKKSLS A
Sbjct  180   VAPLMKTEAMEREVLAVDSEFNQALQNDACRLQQLQCYTSAKGHPFNRFSWGNKKSLSGA  239

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              E GV+LRE I KLY + Y+G  MKLV+IGGE+LD LESWV+ELF  VK G  +  +   
Sbjct  240   MENGVDLRECIMKLYKEYYHGGLMKLVVIGGESLDTLESWVVELFGDVKNGSKIMPTLEA  299

Query  897   ETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             + PIW+ GKLY LEAVKDVH L+L+WTLP LR  Y++K EDYLAHLLGHEGKGSLL FLK
Sbjct  300   KGPIWEGGKLYRLEAVKDVHTLDLTWTLPPLRHAYVKKPEDYLAHLLGHEGKGSLLSFLK  359

Query  1077  TKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVSPQ  1256
              KGW TS+SAGVGD+G++RSS+AY+FGMSIHLTDSGL+KI++II + YQYLKLLR+ SPQ
Sbjct  360   GKGWATSLSAGVGDDGINRSSLAYVFGMSIHLTDSGLEKIYDIIAYTYQYLKLLRDASPQ  419

Query  1257  EWIFKELQDI  1286
             EWIFKELQDI
Sbjct  420   EWIFKELQDI  429


 Score =   321 bits (823),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 189/240 (79%), Gaps = 1/240 (0%)
 Frame = +3

Query  2319  RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIVE  2498
             +H E + C P  A LVRDV VKNK +TNSVVELY+QIEPE      ++KA++DLF EI+E
Sbjct  452   QHGEQITCFPLSAKLVRDVNVKNKSETNSVVELYYQIEPEEAKS-TRMKAVLDLFSEIIE  510

Query  2499  EPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKEILD  2678
             EPLF++LRTKEQLGYVV+C PR+TYR+ GFCF VQSS+Y P++L GRIDNFI D + +L+
Sbjct  511   EPLFNQLRTKEQLGYVVECGPRLTYRVHGFCFCVQSSKYGPVHLLGRIDNFIKDIEGMLE  570

Query  2679  NLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIRKSD  2858
              LD++SFE+++SGLI +LLEKDPSL  ETN LW QIVDKRYMFD S+KEAEEL+SI K D
Sbjct  571   QLDEESFEDYRSGLIGRLLEKDPSLLSETNELWSQIVDKRYMFDYSQKEAEELRSIEKKD  630

Query  2859  LIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTAFKKSSEFYPSFC  3038
             +++WY TY K+  PK RRL+VRVWGC+T  K++    +  +VI D  AFK +S+FYPS C
Sbjct  631   VMKWYKTYFKESSPKSRRLAVRVWGCDTNMKETQTDPKSVQVIADAVAFKSTSKFYPSLC  690



>ref|XP_007108768.1| PREDICTED: insulin-degrading enzyme isoform X2 [Physeter catodon]
 ref|XP_007108769.1| PREDICTED: insulin-degrading enzyme isoform X3 [Physeter catodon]
Length=978

 Score =   516 bits (1329),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_009243901.1| PREDICTED: insulin-degrading enzyme isoform X2 [Pongo abelii]
Length=1019

 Score =   516 bits (1330),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 322/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I    +  D    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTDFEILP--LEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDSTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_007471622.1| PREDICTED: insulin-degrading enzyme isoform X2 [Lipotes vexillifer]
Length=1019

 Score =   516 bits (1329),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 321/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   TIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_003755319.1| PREDICTED: insulin-degrading enzyme [Sarcophilus harrisii]
Length=1006

 Score =   516 bits (1328),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 523/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  + L GAL RF+QFF+
Sbjct  98    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHKHLEGALDRFAQFFL  157

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      EREV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  158   CPLFDESCKEREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  217

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
             T+ G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  218   TQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTELVVKLFSEVENKN-VPLPEFP  276

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  277   EHPFQEEHLRQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  336

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  337   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRTEG  392

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  393   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLAAEYLLEEFRPDLIE  452

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D Q E W+G+QY +E IP  ++E WK+  +++    
Sbjct  453   MVLDKLRPENVRVAIVSKSFEGQTD-QTEEWYGTQYKQEAIPDEVIEKWKN-ADLNGKFK  510

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  511   LPTKNEFIPTNFEILP--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  568

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  569   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  626

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  627   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  686

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  687   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNIAKQAALGVMQMVEDTLIEHAHTKPLL  746

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  747   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  798

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  799   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLSM  857

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++++++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  858   EKSIEDMNEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  917

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + +  PA    +
Sbjct  918   LSKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLTQAPALPQPE  977

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  978   VIENMTEFKRGLPLFP  993



>gb|AGZ80855.1| insulin-degrading protein enzyme 15b [Canis lupus familiaris]
Length=1019

 Score =   515 bits (1327),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 522/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF +EE    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDEERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_004794675.1| PREDICTED: insulin-degrading enzyme isoform X4 [Mustela putorius 
furo]
 ref|XP_004794676.1| PREDICTED: insulin-degrading enzyme isoform X5 [Mustela putorius 
furo]
Length=978

 Score =   514 bits (1323),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_007108767.1| PREDICTED: insulin-degrading enzyme isoform X1 [Physeter catodon]
Length=1019

 Score =   515 bits (1326),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_005698270.1| PREDICTED: insulin-degrading enzyme isoform X2 [Capra hircus]
Length=978

 Score =   514 bits (1323),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 522/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  541   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  600

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  601   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  660

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  661   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  720

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  721   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  772

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  773   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  831

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  832   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLT  891

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  892   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  951

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  952   QNMTEFKRGLPLFP  965



>ref|XP_004427886.1| PREDICTED: insulin-degrading enzyme isoform 1 [Ceratotherium 
simum simum]
Length=1019

 Score =   515 bits (1326),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYRSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D + E W+G+QY +E IP  +++ W+D  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQD-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEAAPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006733937.1| PREDICTED: insulin-degrading enzyme isoform X2 [Leptonychotes 
weddellii]
Length=1019

 Score =   514 bits (1325),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDNLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-HTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_004794674.1| PREDICTED: insulin-degrading enzyme isoform X3 [Mustela putorius 
furo]
Length=1003

 Score =   514 bits (1324),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  95    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  154

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  155   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  214

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  215   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  273

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  274   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  333

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  334   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  389

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  390   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  449

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  450   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  507

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  508   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  565

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  566   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  623

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  624   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  683

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  684   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  743

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  744   PSQLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  795

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  796   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  854

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  855   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  914

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  915   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  974

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  975   VIQNMTEFKRGLPLFP  990



>ref|XP_009008218.1| PREDICTED: insulin-degrading enzyme isoform X2 [Callithrix jacchus]
Length=1019

 Score =   514 bits (1325),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 522/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +  + P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_007664274.1| PREDICTED: insulin-degrading enzyme isoform X2 [Ornithorhynchus 
anatinus]
Length=978

 Score =   513 bits (1321),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
             T+ G+++R+++ K +   Y    M + ++G E+LD L S V++LFS V+  + V      
Sbjct  190   TKEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTSLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEHHLRQIYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKAKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRTEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y ++L   L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKLGGMLHYYPLEEVLAAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D Q E W+G+QY +E I   +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-QTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIPS+F I    +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPMKNEFIPSNFEIL--QLEKEAPSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIVEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I +Y   L    P+  ++SV V           G    + D + +  PA    +
Sbjct  890   LTKEDIIRFYKEMLAVEAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLAAAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ TAFK+S   +P
Sbjct  950   VIENMTAFKRSLPLFP  965



>ref|XP_007187555.1| PREDICTED: insulin-degrading enzyme isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=1019

 Score =   514 bits (1324),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_007664273.1| PREDICTED: insulin-degrading enzyme isoform X1 [Ornithorhynchus 
anatinus]
Length=991

 Score =   513 bits (1321),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  83    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  142

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  143   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  202

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
             T+ G+++R+++ K +   Y    M + ++G E+LD L S V++LFS V+  + V      
Sbjct  203   TKEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTSLVVKLFSEVENKN-VPLPEFP  261

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  262   EHPFQEHHLRQIYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  321

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  322   LKAKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRTEG  377

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y ++L   L  YP E+V+  +Y  E +   LI+
Sbjct  378   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKLGGMLHYYPLEEVLAAEYLLEEFRPDLIE  437

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D Q E W+G+QY +E I   +++ W++  +++    
Sbjct  438   MVLDKLRPENVRVAIVSKSFEGKTD-QTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  495

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIPS+F I    +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  496   LPMKNEFIPSNFEIL--QLEKEAPSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  553

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  554   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  611

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  612   ILLKKIVEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  671

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  672   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  731

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  732   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  783

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  784   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  842

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  843   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  902

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I +Y   L    P+  ++SV V           G    + D + +  PA    +
Sbjct  903   LTKEDIIRFYKEMLAVEAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLAAAPALPQPE  962

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ TAFK+S   +P
Sbjct  963   VIENMTAFKRSLPLFP  978



>ref|XP_005671342.1| PREDICTED: insulin-degrading enzyme isoform X2 [Sus scrofa]
Length=1019

 Score =   514 bits (1323),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 522/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMAEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_004794672.1| PREDICTED: insulin-degrading enzyme isoform X1 [Mustela putorius 
furo]
Length=1019

 Score =   514 bits (1323),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_004369990.1| PREDICTED: insulin-degrading enzyme [Trichechus manatus latirostris]
Length=1019

 Score =   514 bits (1323),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQQEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYVQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVGFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D + E W+G+QY +E IP  ++E W++  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIEKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  EE
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKEE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNIAKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   L+ E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLAAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D +    PA    +
Sbjct  931   LTKEDIIKFYQEMLAVDAPRRHKVSVHVLAREMDSCPAVGEFPCQNDVNLPQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_008155132.1| PREDICTED: insulin-degrading enzyme isoform X2 [Eptesicus fuscus]
Length=1019

 Score =   513 bits (1322),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 319/914 (35%), Positives = 518/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V+ LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVRLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQMYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDKGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ D++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTDEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AKVI  2987
             K D+I++Y   L    P+  ++SV V             + C      S A   P  +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPPLPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_008567216.1| PREDICTED: insulin-degrading enzyme [Galeopterus variegatus]
Length=978

 Score =   512 bits (1319),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKEKPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTDFEIL--SLEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGDFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_004794673.1| PREDICTED: insulin-degrading enzyme isoform X2 [Mustela putorius 
furo]
Length=1014

 Score =   513 bits (1321),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 310/866 (36%), Positives = 504/866 (58%), Gaps = 28/866 (3%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP G   V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDGGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRV  2927
             K D+I++Y   L    P+  ++SV V
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHV  958



>ref|XP_006073753.1| PREDICTED: insulin-degrading enzyme isoform X2 [Bubalus bubalis]
Length=1019

 Score =   513 bits (1321),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTDC-TEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_005566008.1| PREDICTED: insulin-degrading enzyme isoform X2 [Macaca fascicularis]
Length=1019

 Score =   513 bits (1321),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 520/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_010818077.1| PREDICTED: insulin-degrading enzyme isoform X1 [Bos taurus]
Length=1019

 Score =   513 bits (1321),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 522/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPMKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_002821024.1| PREDICTED: insulin-degrading enzyme isoform X1 [Pongo abelii]
Length=1019

 Score =   513 bits (1321),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 325/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I    +  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEILP--LEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDSTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_009008219.1| PREDICTED: insulin-degrading enzyme isoform X3 [Callithrix jacchus]
Length=978

 Score =   512 bits (1318),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_005269823.1| PREDICTED: insulin-degrading enzyme isoform X1 [Homo sapiens]
Length=1019

 Score =   513 bits (1320),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_009457216.1| PREDICTED: insulin-degrading enzyme isoform X2 [Pan troglodytes]
Length=1019

 Score =   513 bits (1320),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 521/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_005602422.1| PREDICTED: insulin-degrading enzyme isoform X2 [Equus caballus]
Length=1019

 Score =   513 bits (1320),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 518/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGKTDC-TEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AKVI  2987
             K D+I++Y   L    P+  ++SV V             + C      S A   P  +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPGLPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_010379622.1| PREDICTED: insulin-degrading enzyme isoform X2 [Rhinopithecus 
roxellana]
Length=1019

 Score =   513 bits (1320),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 520/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_002908213.1| nardilysin, putative [Phytophthora infestans T30-4]
 gb|EEY61296.1| nardilysin, putative [Phytophthora infestans T30-4]
Length=1069

 Score =   514 bits (1323),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 319/882 (36%), Positives = 487/882 (55%), Gaps = 40/882 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV    L  AL  F+ FF
Sbjct  138   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPAHLEPALDMFAHFF  197

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S   HP++RF WGN+KSL + 
Sbjct  198   ISPLLKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDVSPATHPYHRFSWGNRKSLQEL  257

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              E+ GV++R+QI   Y   Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  258   PEQMGVDVRQQILGFYDKYYSSNIMKLVVCGENTLDELEQWVTKSFSAIPNKHVDVPSFA  317

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  318   STGPPFGAQGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGLHHQKPSDYIASLLGHESEGS  377

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    +I   V++YL +
Sbjct  378   VLSHLKQRGWISAVTAGVTDTDGYDCGSYAAKFDITMKLTLEGISHWEDIAHAVFEYLHM  437

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    P+D++  D    
Sbjct  438   LRVNGCPEWVFDELAALADISFRFQEEDSAVEKCEELGEIMQSMFRVAPDDILRYDLLKG  497

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQC----EPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V++    S++ Q     E WFG +Y  E I  ++++ 
Sbjct  498   VFKKELTEEVLSHLTAESVCVSIVSQRFEESAEFQTQVIEEEWFGVRYSRENIADAVIQR  557

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDF----SIRADTISCDGGNAPKCILDEPLMKFWYKLDN  1742
             WK     +  LHLP  N FIP DF    SI A+ + C               K WYK D 
Sbjct  558   WKRAG-TNPKLHLPRPNQFIPRDFSLVDSIDAEDLVCGATK---------FGKLWYKPDR  607

Query  1743  TFKLPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGD  1922
              F  PRA+    + L    +N+ N +LT+L+V L++D LNE  Y A+VA+L  S+ +   
Sbjct  608   VFATPRAHVALLLHLPTVVANVDNWVLTQLYVKLVRDALNEYAYHANVAELMYSLQVKDS  667

Query  1923  KLELKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLR  2102
              LEL   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLR
Sbjct  668   GLELIFGGFNDKLHILVEVVVAALFGTEINEARFEVMREELMRESKNAITKVAQKAKYLR  727

Query  2103  LQVLCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSI  2276
             LQ+L K  + +EE L  +   +   LK ++ + L   + ++    HGN+    A  + + 
Sbjct  728   LQLLEKRSFALEECLDSIEDATEESLKKYVANELWAGKAWLASFAHGNIFHSVASKMVAS  787

Query  2277  FTSYFSVPPLPAEMRH--KEYVMCLP-SGADLVRDVQVKNKLDTNSVVELYFQIEPEVGS  2447
               +       P E+    +  +  +P +    +   + +NK +TN+ VELY+QI P    
Sbjct  788   VETQLQRVSAPLELHDFPRRLINAIPQTPVGFLLKERSENKSETNTQVELYYQIGPLT--  845

Query  2448  ELIKLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIY  2627
               ++  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y
Sbjct  846   --LRSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEY  903

Query  2628  LQGRIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMF  2807
             +   +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  F
Sbjct  904   ISACVDRFMIDFEEAIEMMADEHFHDHVQAQILLKLEPDHNLLETTHHYWYEITSRRLAF  963

Query  2808  DLSEKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG  2933
             DL  + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G
Sbjct  964   DLDAQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIG  1002



>ref|XP_007961754.1| PREDICTED: insulin-degrading enzyme isoform X3 [Chlorocebus sabaeus]
Length=1019

 Score =   512 bits (1319),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 320/914 (35%), Positives = 520/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L   ++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCNMTYLFIRLLKDDLKEYTYAARLSGLSYGIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK++ 
Sbjct  873   SIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKTLT  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----KVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +VI
Sbjct  933   KEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
             ++ T FK+    +P
Sbjct  993   QNMTEFKRGLPLFP  1006



>ref|XP_010969599.1| PREDICTED: insulin-degrading enzyme [Camelus bactrianus]
Length=992

 Score =   511 bits (1317),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  84    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  143

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  144   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  203

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  204   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  262

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  263   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  322

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  323   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  378

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  379   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  438

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  439   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  496

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  497   LPTKNEFIPTDFEIL--SLEKDATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  554

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  555   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  612

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  613   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  672

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  673   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  732

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  733   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  784

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  785   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  843

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  844   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  903

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S+A   P  +
Sbjct  904   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSEAPALPQPE  963

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  964   VIQNMTEFKRGLPLFP  979



>ref|XP_007471621.1| PREDICTED: insulin-degrading enzyme isoform X1 [Lipotes vexillifer]
Length=1019

 Score =   512 bits (1318),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKTIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_010331579.1| PREDICTED: insulin-degrading enzyme isoform X2 [Saimiri boliviensis 
boliviensis]
Length=978

 Score =   511 bits (1315),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_006183728.1| PREDICTED: insulin-degrading enzyme isoform X1 [Camelus ferus]
Length=978

 Score =   511 bits (1315),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTDFEIL--SLEKDATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S+A   P  +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSEAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_005698269.1| PREDICTED: insulin-degrading enzyme isoform X1 [Capra hircus]
Length=978

 Score =   510 bits (1314),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_003904048.2| PREDICTED: insulin-degrading enzyme [Papio anubis]
Length=978

 Score =   510 bits (1314),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPYQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_003994291.1| PREDICTED: insulin-degrading enzyme [Felis catus]
Length=1009

 Score =   511 bits (1316),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  101   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  160

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  161   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  220

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  221   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  279

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  280   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  339

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  340   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  395

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  396   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  455

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  456   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  513

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  514   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  571

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  572   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  629

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  630   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  689

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  690   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  749

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  750   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  801

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  802   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  860

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  861   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  920

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  921   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  980

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  981   VIQNMTEFKRGLPLFP  996



>ref|XP_002916150.1| PREDICTED: insulin-degrading enzyme-like [Ailuropoda melanoleuca]
 gb|EFB20895.1| hypothetical protein PANDA_004202 [Ailuropoda melanoleuca]
Length=1019

 Score =   511 bits (1317),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|ELR60073.1| Insulin-degrading enzyme, partial [Bos mutus]
Length=989

 Score =   510 bits (1314),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  81    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  140

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  141   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  200

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  201   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  259

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  260   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  319

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  320   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  375

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  376   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  435

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  436   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  493

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  494   LPMKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  551

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  552   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  609

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  610   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  669

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  670   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  729

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  730   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  781

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  782   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  840

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  841   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  900

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  901   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  960

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  961   VIQNMTEFKRGLPLFP  976



>ref|XP_008694470.1| PREDICTED: insulin-degrading enzyme [Ursus maritimus]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_010379624.1| PREDICTED: insulin-degrading enzyme isoform X3 [Rhinopithecus 
roxellana]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_009457217.1| PREDICTED: insulin-degrading enzyme isoform X3 [Pan troglodytes]
 gb|EAW50093.1| insulin-degrading enzyme, isoform CRA_c [Homo sapiens]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_005884105.1| PREDICTED: insulin-degrading enzyme [Myotis brandtii]
 ref|XP_006090090.1| PREDICTED: insulin-degrading enzyme [Myotis lucifugus]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 519/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V+ LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVRLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQMYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+ Y +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTHYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDKGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ D++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTDEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_006880401.1| PREDICTED: insulin-degrading enzyme isoform X2 [Elephantulus 
edwardii]
Length=1019

 Score =   511 bits (1316),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 523/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRSYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWEN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATSYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPCLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006733936.1| PREDICTED: insulin-degrading enzyme isoform X1 [Leptonychotes 
weddellii]
Length=1019

 Score =   511 bits (1316),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDNLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-HTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006073754.1| PREDICTED: insulin-degrading enzyme isoform X3 [Bubalus bubalis]
 ref|XP_006073755.1| PREDICTED: insulin-degrading enzyme isoform X4 [Bubalus bubalis]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTDC-TEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_005958915.1| PREDICTED: insulin-degrading enzyme [Pantholops hodgsonii]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_006755157.1| PREDICTED: insulin-degrading enzyme [Myotis davidii]
Length=978

 Score =   510 bits (1313),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 519/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V+ LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVRLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQMYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+ Y +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTHYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDKGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ D++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTDEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQPPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>gb|EGW00756.1| Insulin-degrading enzyme [Cricetulus griseus]
Length=978

 Score =   509 bits (1312),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  E++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEEVIQKWQN-AELNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKDATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLVEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLTM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  830   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPPQNDINLSEAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             V+ + T FK+    +P
Sbjct  950   VVHNMTEFKRGLPLFP  965



>ref|XP_002756448.1| PREDICTED: insulin-degrading enzyme isoform X1 [Callithrix jacchus]
Length=1019

 Score =   511 bits (1316),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|EHH19229.1| hypothetical protein EGK_19903, partial [Macaca mulatta]
Length=989

 Score =   510 bits (1313),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  81    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  140

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  141   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  200

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  201   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  259

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  260   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  319

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  320   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  375

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  376   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  435

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  436   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  493

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  494   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  551

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  552   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  609

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  610   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  669

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  670   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  729

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  730   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  781

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  782   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  840

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  841   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  900

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  901   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  960

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  961   VIQNMTEFKRGLPLFP  976



>ref|XP_008517845.1| PREDICTED: nardilysin isoform X2 [Equus przewalskii]
Length=1029

 Score =   511 bits (1316),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 311/900 (35%), Positives = 502/900 (56%), Gaps = 31/900 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHM+FMGS ++PDEN +D++L KHGGS NA T+ E T + F+V+R++   AL R++QFF
Sbjct  113   LEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFF  172

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             + PL+  +A++REV AVDSE+     +D+ R + L    + PGHP  +FFWGN ++L   
Sbjct  173   IHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHE  232

Query  717   TERG-VNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKS---  884
              +R  ++   ++ + +   Y    M LV+   ETLD LE WV E+FS +    + K    
Sbjct  233   PKRNNIDTHARLREFWMRYYSAHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPKPNFG  292

Query  885   --SSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
               +   +TP +   KLY +  ++ +H L ++W LP  ++ Y  K   Y++ L+GHEGKGS
Sbjct  293   HLTDPFDTPAF--NKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGS  350

Query  1059  LLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLL  1238
             +L +L+ K W  ++  G G+ G  ++S   +F +SI LTD G +  +E+   V+QYLK+L
Sbjct  351   ILSYLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYLKML  410

Query  1239  REVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDE  1418
             +++ P++ IF+E+Q I   EF + E+    EY   + EN+ +YP +D + GD     +  
Sbjct  411   QKLGPEKRIFEEIQKIEDNEFHYQEQTDPVEYVENMCENMQLYPLQDFLTGDQLLFEYKP  470

Query  1419  QLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEID  1598
             ++I + L         + +++ +     D++ E WFG+QY  E + +S  ELWK   E++
Sbjct  471   EVIAEALNQLVPPKANLVLLSGANEGKCDLK-EKWFGTQYSMEDVENSWAELWKTNFELN  529

Query  1599  VSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFR  1778
               LHLPA+N +I +DF ++A    C     P  I++ P    WYK DN FK+P+A   F 
Sbjct  530   PDLHLPAENKYIATDFMLKA--FDCPETEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFH  587

Query  1779  VTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHK  1958
             +       +  N +L ++FV +L   L E  Y+A VA+LE  +      L ++V GFNHK
Sbjct  588   LISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK  647

Query  1959  LPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWD-V  2135
             LP+L   ++     FS     F +I E +++T  N  +KP   A  +RL +L  + W  +
Sbjct  648   LPLLFQLIIDYLAEFSSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMI  707

Query  2136  EEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAE  2315
             ++   L++ LSL  L +F+ +  SQL++EGL  GN+   E+++         +  PL  E
Sbjct  708   DKYRALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFMPLEQE  767

Query  2316  MRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIV  2495
             M  +  V+ LPSG  L + V+  NK D NS V +Y+Q     G+  ++   L++L    +
Sbjct  768   MPVQFQVVELPSGHHLCK-VRALNKGDANSEVTVYYQ----SGTRSLREYTLMELLVMHM  822

Query  2496  EEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRV--QSSEYDPIYLQGRIDNFINDAKE  2669
             EEP FD LRTK+ LGY V  + R T  ILGF   V  Q+++Y+   +  +I+ F+++ +E
Sbjct  823   EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSNFEE  882

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++NL +D+F    + LI     +D  L  E +R W ++V ++Y+FD    E E LKS  
Sbjct  883   KIENLTEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS  942

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVWG---------CNTQRKDSDASMEPAKVIKDPTA  3002
             KSDL+ W+  +     P C+ L V V G          N   +DS++S E  ++   PT+
Sbjct  943   KSDLVNWFKAHRG---PGCKMLGVHVVGFGKYELEEDGNPSGEDSNSSCEVMQLTYLPTS  999



>ref|XP_006231375.1| PREDICTED: insulin-degrading enzyme isoform X1 [Rattus norvegicus]
Length=1019

 Score =   511 bits (1315),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 319/914 (35%), Positives = 517/914 (57%), Gaps = 42/914 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++RE++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVREELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEDVIQKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  D    P  I D  + K W+K D+ F LP+A   F    +
Sbjct  524   LPTKNEFIPTNFEILA--LEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSR  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHKLPVL  1970
               Y++  +  +T LF+ LLKD+L E  Y A ++ L  +++   + + L V G+N K P+L
Sbjct  582   YIYADPLHCTMTYLFLRLLKDDLKEYTYAARLSGLSYAIASGMNAILLSVKGYNDKQPIL  641

Query  1971  LSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEEkl  2147
             L K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E  
Sbjct  642   LKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELK  701

Query  2148  cllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPLPA  2312
               L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P LP+
Sbjct  702   EALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLLPS  761

Query  2313  EM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDE  2489
             ++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF +
Sbjct  762   QLVRYRE--VQLPDRGWFV--YQRRNEVHNNCGIEIYYQTDMQSTSE----NMFLELFCQ  813

Query  2490  IVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDAKE  2669
             I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   ++
Sbjct  814   IISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITMEK  872

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK++ 
Sbjct  873   AIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKTLS  932

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEP----AKVI  2987
             K D+I++Y   L    P+  ++SV V           G    + D + S  P     +VI
Sbjct  933   KDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDINLSEAPPLPQPEVI  992

Query  2988  KDPTAFKKSSEFYP  3029
              + T FK+    +P
Sbjct  993   HNMTEFKRGLPLFP  1006



>ref|XP_005566009.1| PREDICTED: insulin-degrading enzyme isoform X3 [Macaca fascicularis]
Length=978

 Score =   509 bits (1312),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_010972589.1| PREDICTED: insulin-degrading enzyme [Camelus dromedarius]
Length=1019

 Score =   511 bits (1315),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKDATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S+A   P  +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSEAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006880400.1| PREDICTED: insulin-degrading enzyme isoform X1 [Elephantulus 
edwardii]
Length=1019

 Score =   511 bits (1315),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 523/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRSYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWEN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATSYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPCLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_005225474.1| PREDICTED: insulin-degrading enzyme isoform X2 [Bos taurus]
 ref|XP_005890691.1| PREDICTED: insulin-degrading enzyme [Bos mutus]
 ref|XP_010818078.1| PREDICTED: insulin-degrading enzyme isoform X2 [Bos taurus]
Length=978

 Score =   509 bits (1312),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPMKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_004411034.1| PREDICTED: insulin-degrading enzyme [Odobenus rosmarus divergens]
Length=1019

 Score =   511 bits (1315),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTDC-TEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_003339995.2| PREDICTED: LOW QUALITY PROTEIN: insulin-degrading enzyme [Monodelphis 
domestica]
Length=1020

 Score =   511 bits (1315),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 325/917 (35%), Positives = 521/917 (57%), Gaps = 47/917 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  + L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHKHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      EREV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKEREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
             T+ G+++R+++ K +   Y    M + ++G ETLD L   V++LFS V+  + V      
Sbjct  231   TQEGIDVRQELLKFHSTFYSSNLMAICVLGRETLDELTELVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDV-HILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLF  1067
             E P  +    +LY +  +  + +I  + + +P L+K Y      YL HL+GHEG GSLL 
Sbjct  290   EHPFQEEHLRQLYKVVPIXSILYICIVPFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLS  349

Query  1068  FLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREV  1247
              LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR  
Sbjct  350   ELKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRTE  405

Query  1248  SPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLI  1427
              PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI
Sbjct  406   GPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPVEEVLAAEYLLEEFRPDLI  465

Query  1428  KDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSL  1607
             + +L   R +N+RV +V+KS    +D Q E W+G+QY +E IP  ++E WK+  +++   
Sbjct  466   EMVLDKLRPENVRVAIVSKSFEGQTD-QTEEWYGTQYKQEAIPDEVIEKWKN-ADLNGKF  523

Query  1608  HLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTL  1787
              LP KN+FIP++F I    +  +  + P  I D  + K W+K D+ F LP+A   F    
Sbjct  524   KLPTKNEFIPTNFEILP--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFS  581

Query  1788  KGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKL  1961
               AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K 
Sbjct  582   PFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQ  639

Query  1962  PVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVE  2138
             P+LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +
Sbjct  640   PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKD  699

Query  2139  EklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPP  2303
             E    L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P 
Sbjct  700   ELKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPL  759

Query  2304  LPAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDL  2480
             LP+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++L
Sbjct  760   LPSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLEL  811

Query  2481  FDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFIND  2660
             F +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+  
Sbjct  812   FCQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLS  870

Query  2661  AKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELK  2840
              ++ ++++++++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK
Sbjct  871   MEKSIEDMNEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLK  930

Query  2841  SIRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----  2978
             ++ K D+I++Y   L    P+  ++SV V           G    + D + S  PA    
Sbjct  931   TLSKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPALPQP  990

Query  2979  KVIKDPTAFKKSSEFYP  3029
             +VI++ T FK+    +P
Sbjct  991   EVIENMTEFKRGLPLFP  1007



>ref|XP_006147699.1| PREDICTED: insulin-degrading enzyme [Tupaia chinensis]
Length=978

 Score =   509 bits (1311),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 519/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEYAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPPLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_004701130.1| PREDICTED: insulin-degrading enzyme [Echinops telfairi]
Length=1019

 Score =   510 bits (1314),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ + +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLQFHSTYYSSNLMSICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++ +L 
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGNLK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
               Y +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FVYVDPLHYNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--IYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKGALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             +  ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   ERSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LSKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGVFPCQNDVNLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_007187554.1| PREDICTED: insulin-degrading enzyme isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=1019

 Score =   510 bits (1314),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|AGZ80854.1| insulin-degrading enzyme isoform 15a [Canis lupus familiaris]
Length=1019

 Score =   510 bits (1314),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E +P  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAVPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|ETI56709.1| hypothetical protein F443_00882 [Phytophthora parasitica P1569]
 gb|ETK96464.1| hypothetical protein L915_00823 [Phytophthora parasitica]
Length=1047

 Score =   511 bits (1316),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 498/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFRVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  ++++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEAIIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NSKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLINAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>pdb|2G47|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amyloid-Beta (1-40)
 pdb|2G47|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amyloid-Beta (1-40)
 pdb|2G48|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amylin
 pdb|2G48|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Amylin
 pdb|2G49|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Glucagon
 pdb|2G49|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme 
In Complex With Glucagon
 pdb|2G54|A Chain A, Crystal Structure Of Zn-Bound Human Insulin-Degrading 
Enzyme In Complex With Insulin B Chain
 pdb|2G54|B Chain B, Crystal Structure Of Zn-Bound Human Insulin-Degrading 
Enzyme In Complex With Insulin B Chain
 pdb|2G56|A Chain A, Crystal Structure Of Human Insulin-degrading Enzyme 
In Complex With Insulin B Chain
 pdb|2G56|B Chain B, Crystal Structure Of Human Insulin-degrading Enzyme 
In Complex With Insulin B Chain
 pdb|2JBU|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
Complexed With Co-Purified Peptides.
 pdb|2JBU|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
Complexed With Co-Purified Peptides.
 pdb|3E50|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Transforming Growth Factor-Alpha
 pdb|3E50|B Chain B, Crystal Structure Of Human Insulin Degrading Enzyme 
In Complex With Transforming Growth Factor-Alpha
Length=990

 Score =   509 bits (1311),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             +HMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  82    QHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  141

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  142   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  201

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  202   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  260

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  261   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  320

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  321   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  376

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  377   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  436

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  437   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  494

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  495   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  552

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  553   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  610

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  611   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  670

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  671   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  730

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  731   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  782

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  783   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  841

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  842   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  901

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  902   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  961

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  962   VIQNMTEFKRGLPLFP  977



>ref|XP_005602424.1| PREDICTED: insulin-degrading enzyme isoform X4 [Equus caballus]
Length=978

 Score =   509 bits (1310),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAVVSKSFEGKTDC-TEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPGLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_003783750.1| PREDICTED: insulin-degrading enzyme [Otolemur garnettii]
Length=1019

 Score =   510 bits (1313),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDPSCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLAAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATAYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W   E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKNE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNISKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGAFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006831204.1| PREDICTED: insulin-degrading enzyme [Chrysochloris asiatica]
Length=1019

 Score =   510 bits (1313),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + NDS RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDSWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRSLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVDTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHIFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E   +Y +++A  L +YP E+V+  +   E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRDYTSKIAGILHLYPLEEVLTAECLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L     DN+RV V++KS    +D + E W+G+QY +E IP  +++ W++  E++    
Sbjct  466   MVLDKLIPDNVRVAVISKSFEGKTD-RTEEWYGTQYKQEAIPDKVIKKWQN-AELNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP +F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPMNFEIL--SLEKEATQYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELADLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  +E       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTAE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++N+ +++F+     L    L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKAIENMTEEAFQKHIQALAICRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + +  PA    +
Sbjct  931   LTKEDIIKFYKEMLALDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLAQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_001925416.3| PREDICTED: insulin-degrading enzyme isoformX1 [Sus scrofa]
Length=1019

 Score =   510 bits (1313),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMAEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_005063707.1| PREDICTED: insulin-degrading enzyme [Mesocricetus auratus]
Length=1020

 Score =   510 bits (1313),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  112   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  171

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  172   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  231

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  232   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  290

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  291   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  350

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  351   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  406

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  407   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  466

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  E++    
Sbjct  467   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEEVIQKWQN-AELNGKFK  524

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  525   LPTKNEFIPTNFEIL--SLEKDATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  582

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  583   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  640

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  641   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  700

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  701   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  760

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  761   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  812

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  813   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLTM  871

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  872   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  931

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  932   LTKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDINLSEAPALPQPE  991

Query  2982  VIKDPTAFKKSSEFYP  3029
             V+ + T FK+    +P
Sbjct  992   VVHNMTEFKRGLPLFP  1007



>ref|XP_008155131.1| PREDICTED: insulin-degrading enzyme isoform X1 [Eptesicus fuscus]
Length=1019

 Score =   510 bits (1313),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V+ LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVRLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    ++Y +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQMYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDKGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ D++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTDEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPPLPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_004279447.1| PREDICTED: insulin-degrading enzyme isoform 1 [Orcinus orca]
Length=1019

 Score =   509 bits (1312),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTDC-TEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LREALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_005602423.1| PREDICTED: insulin-degrading enzyme isoform X3 [Equus caballus]
Length=1003

 Score =   509 bits (1311),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  95    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  154

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  155   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  214

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  215   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  273

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  274   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  333

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  334   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  389

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  390   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  449

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  450   MVLDKLRPENVRVAVVSKSFEGKTDC-TEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  507

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  508   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  565

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  566   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  623

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  624   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  683

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  684   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  743

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  744   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  795

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  796   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  854

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  855   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  914

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  915   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPGLPQPE  974

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  975   VIQNMTEFKRGLPLFP  990



>ref|XP_008061852.1| PREDICTED: insulin-degrading enzyme [Tarsius syrichta]
Length=1022

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 519/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  114   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  173

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  174   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  233

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  234   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  292

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  293   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  352

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  353   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  408

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  409   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  468

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  469   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  526

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   T+  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  527   LPTKNEFIPTNFEIL--TLEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  584

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  585   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELADLSYDLQNTIYG--MYLSVKGYNDKQP  642

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W   E
Sbjct  643   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKHE  702

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  703   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  762

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  763   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  814

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  815   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  873

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  874   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  933

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I +Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  934   LTKEDIIRFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  993

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  994   VIQNMTEFKRGLPLFP  1009



>ref|XP_005352247.1| PREDICTED: insulin-degrading enzyme [Microtus ochrogaster]
Length=1019

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  E++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEEVIQKWQN-AELNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             +++++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  871   EKVIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDVNLSEAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             V+ + T FK+    +P
Sbjct  991   VVHNMTEFKRGLPLFP  1006



>ref|NP_001069317.1| insulin-degrading enzyme precursor [Bos taurus]
 sp|Q24K02.1|IDE_BOVIN RecName: Full=Insulin-degrading enzyme; AltName: Full=Insulin 
protease; Short=Insulinase; AltName: Full=Insulysin [Bos taurus]
 gb|AAI14106.1| Insulin-degrading enzyme [Bos taurus]
 tpg|DAA14957.1| TPA: insulin-degrading enzyme [Bos taurus]
Length=1019

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPMKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|ETP26470.1| hypothetical protein F441_00858 [Phytophthora parasitica CJ01A1]
Length=1047

 Score =   510 bits (1314),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 498/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFRVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  ++++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEAIIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NPKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLINAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>ref|XP_001501085.2| PREDICTED: insulin-degrading enzyme isoform X1 [Equus caballus]
Length=1019

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGKTDC-TEEWYGTQYRQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPGLPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|NP_001245003.1| insulin-degrading enzyme [Macaca mulatta]
Length=1019

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_008890464.1| hypothetical protein PPTG_00747 [Phytophthora parasitica INRA-310]
 gb|ETN24399.1| hypothetical protein PPTG_00747 [Phytophthora parasitica INRA-310]
Length=1047

 Score =   510 bits (1314),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 498/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFGVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  ++++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEAIIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NPKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLINAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>ref|XP_007634397.1| PREDICTED: insulin-degrading enzyme isoform X1, partial [Cricetulus 
griseus]
Length=1044

 Score =   510 bits (1313),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  136   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  195

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  196   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPNHPFSKFGTGNKYTLETRP  255

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  256   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  314

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  315   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  374

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  375   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  430

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  431   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  490

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  E++    
Sbjct  491   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEEVIQKWQN-AELNGKFK  548

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  549   LPTKNEFIPTNFEIL--SLEKDATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  606

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  607   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  664

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  665   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  724

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  725   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLVEHAHTKPLL  784

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  785   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  836

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  837   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLTM  895

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  896   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  955

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  956   LTKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPPQNDINLSEAPALPQPE  1015

Query  2982  VIKDPTAFKKSSEFYP  3029
             V+ + T FK+    +P
Sbjct  1016  VVHNMTEFKRGLPLFP  1031



>ref|XP_005566007.1| PREDICTED: insulin-degrading enzyme isoform X1 [Macaca fascicularis]
Length=1019

 Score =   509 bits (1312),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_003462437.1| PREDICTED: insulin-degrading enzyme [Cavia porcellus]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKAKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGMLHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV VV+KS   ++D + E W+G+ Y +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAVVSKSFEGTTD-RTEEWYGTHYRQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIVA--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L  ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKDALEDVTLVRLKAFIPQLLSRLHIEALVHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMSEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P  +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPPLPHPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_010840502.1| PREDICTED: LOW QUALITY PROTEIN: insulin-degrading enzyme [Bison 
bison bison]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPMKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_507922.2| PREDICTED: insulin-degrading enzyme isoform X1 [Pan troglodytes]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|KFO29933.1| Insulin-degrading enzyme [Fukomys damarensis]
Length=978

 Score =   508 bits (1308),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  D V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKD-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGMLHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIVA--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKDALDDVTLLRLKAFIPQLLSRLHIEALVHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNLEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    PK  ++SV V             + C      S A   P  +
Sbjct  890   LTKEDIIKFYKEMLAVDAPKRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPPLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>pdb|2JG4|A Chain A, Substrate-Free Ide Structure In Its Closed Conformation
 pdb|2JG4|B Chain B, Substrate-Free Ide Structure In Its Closed Conformation
Length=990

 Score =   508 bits (1309),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  82    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  141

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  142   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  201

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  202   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  260

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  261   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  320

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  321   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  376

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  377   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  436

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  437   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  494

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  495   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  552

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  553   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  610

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  611   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  670

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  671   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  730

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  731   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  782

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLG++V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  783   CQIISEPCFNTLRTKEQLGFIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  841

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  842   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  901

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  902   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  961

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  962   VIQNMTEFKRGLPLFP  977



>ref|XP_007949454.1| PREDICTED: insulin-degrading enzyme [Orycteropus afer afer]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      EREV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKEREVNAVDSEHEKNVMNDAWRLFQLEKATGDPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEKWYGTQYKQEAILDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP+DF I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTDFEIL--SLEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEIHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLVTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LSKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIENMTEFKRGLPLFP  1006



>ref|NP_004960.2| insulin-degrading enzyme isoform 1 [Homo sapiens]
 sp|P14735.4|IDE_HUMAN RecName: Full=Insulin-degrading enzyme; AltName: Full=Abeta-degrading 
protease; AltName: Full=Insulin protease; Short=Insulinase; 
AltName: Full=Insulysin [Homo sapiens]
 gb|AAH96337.1| Insulin-degrading enzyme [Homo sapiens]
 gb|AAH96339.1| Insulin-degrading enzyme [Homo sapiens]
 gb|AAH96336.1| Insulin-degrading enzyme [Homo sapiens]
 gb|EAW50090.1| insulin-degrading enzyme, isoform CRA_a [Homo sapiens]
 gb|EAW50091.1| insulin-degrading enzyme, isoform CRA_a [Homo sapiens]
 dbj|BAI46055.1| insulin-degrading enzyme [synthetic construct]
 gb|AIC49009.1| IDE, partial [synthetic construct]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006073752.1| PREDICTED: insulin-degrading enzyme isoform X1 [Bubalus bubalis]
Length=1019

 Score =   509 bits (1311),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D   E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTDC-TEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_008758584.1| PREDICTED: insulin-degrading enzyme isoform X4 [Rattus norvegicus]
 pdb|3P7L|A Chain A, Rat Insulin Degrading Enzyme (Insulysin)
Length=978

 Score =   508 bits (1307),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 516/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++RE++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVREELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEDVIQKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILA--LEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQRRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  830   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEP----AK  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  P     +
Sbjct  890   LSKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDINLSEAPPLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI + T FK+    +P
Sbjct  950   VIHNMTEFKRGLPLFP  965



>ref|XP_008847842.1| PREDICTED: insulin-degrading enzyme [Nannospalax galili]
Length=1019

 Score =   509 bits (1310),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 518/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G ETLD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRDELLKFHSTYYSSNLMAICVLGRETLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPDEVIQKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIL--SLEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLNYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLLTM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>gb|ETM02885.1| hypothetical protein L917_00781 [Phytophthora parasitica]
Length=1047

 Score =   509 bits (1312),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 497/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFRVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  + ++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEATIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NPKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLINAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>ref|XP_004607424.1| PREDICTED: insulin-degrading enzyme [Sorex araneus]
Length=978

 Score =   508 bits (1307),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L   V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTDLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKAKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKEKPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRCDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGQTD-RTEEWYGTQYKQEAIPEDVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEILP--LEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYF-----SVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I  +          + P L
Sbjct  659   LKEALDDVTLPCLKAFIPQLLSRLHIEALLHGNITKQTALGIMQMVEDTLVEYAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDA-SMEPAK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A S+   +
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPSLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_003922440.2| PREDICTED: insulin-degrading enzyme isoform X1 [Saimiri boliviensis 
boliviensis]
Length=1043

 Score =   509 bits (1312),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 521/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  135   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  194

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  195   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  254

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  255   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDELTNLVVKLFSEVENKN-VPLPEFP  313

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  314   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  373

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  374   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  429

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  430   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  489

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  490   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  547

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  548   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  605

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  606   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  663

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  664   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  723

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  724   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  783

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  784   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  835

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  836   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLIAM  894

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  895   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNTEVAYLKT  954

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  955   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  1014

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  1015  VIQNMTEFKRGLPLFP  1030



>ref|XP_007961753.1| PREDICTED: insulin-degrading enzyme isoform X2 [Chlorocebus sabaeus]
Length=1019

 Score =   509 bits (1310),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_010630400.1| PREDICTED: insulin-degrading enzyme [Fukomys damarensis]
Length=1002

 Score =   508 bits (1308),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 324/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  94    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  153

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  154   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  213

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  D V      
Sbjct  214   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKD-VPLPEFP  272

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  273   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  332

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  333   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  388

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  389   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGMLHYYPLEEVLTAEYLLEEFRPDLIE  448

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E I   +++ W++  +++    
Sbjct  449   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAISDEVIKKWQN-ADLNGKFK  506

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  507   LPTKNEFIPTNFEIVA--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  564

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  565   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  622

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  623   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  682

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  683   LKDALDDVTLLRLKAFIPQLLSRLHIEALVHGNITKQAALGIMQMVEDTLIEHAHTKPLL  742

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  743   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  794

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  795   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  853

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  854   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNLEVAYLKT  913

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    PK  ++SV V             + C      S A   P  +
Sbjct  914   LTKEDIIKFYKEMLAVDAPKRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPPLPQPE  973

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  974   VIQNMTEFKRGLPLFP  989



>ref|XP_010379621.1| PREDICTED: insulin-degrading enzyme isoform X1 [Rhinopithecus 
roxellana]
Length=1019

 Score =   508 bits (1309),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I    +  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEILP--LEKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYHFDRDNTEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_006231376.1| PREDICTED: insulin-degrading enzyme isoform X2 [Rattus norvegicus]
 ref|XP_006231377.1| PREDICTED: insulin-degrading enzyme isoform X3 [Rattus norvegicus]
Length=988

 Score =   508 bits (1307),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 516/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  80    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  139

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  140   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  199

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++RE++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  200   NQEGIDVREELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  258

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  259   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  318

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  319   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  374

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  375   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  434

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  435   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEDVIQKWQN-ADLNGKFK  492

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  493   LPTKNEFIPTNFEILA--LEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  550

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  551   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  608

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  609   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  668

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  669   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  728

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  729   PSQLVRYRE--VQLPDRGWFV--YQRRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  780

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  781   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  839

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  840   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  899

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEP----AK  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  P     +
Sbjct  900   LSKDDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDINLSEAPPLPQPE  959

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI + T FK+    +P
Sbjct  960   VIHNMTEFKRGLPLFP  975



>ref|XP_008517844.1| PREDICTED: nardilysin isoform X1 [Equus przewalskii]
Length=1097

 Score =   511 bits (1315),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 311/900 (35%), Positives = 502/900 (56%), Gaps = 31/900 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHM+FMGS ++PDEN +D++L KHGGS NA T+ E T + F+V+R++   AL R++QFF
Sbjct  181   LEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFF  240

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             + PL+  +A++REV AVDSE+     +D+ R + L    + PGHP  +FFWGN ++L   
Sbjct  241   IHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHE  300

Query  717   TERG-VNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKS---  884
              +R  ++   ++ + +   Y    M LV+   ETLD LE WV E+FS +    + K    
Sbjct  301   PKRNNIDTHARLREFWMRYYSAHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPKPNFG  360

Query  885   --SSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
               +   +TP +   KLY +  ++ +H L ++W LP  ++ Y  K   Y++ L+GHEGKGS
Sbjct  361   HLTDPFDTPAF--NKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGS  418

Query  1059  LLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLL  1238
             +L +L+ K W  ++  G G+ G  ++S   +F +SI LTD G +  +E+   V+QYLK+L
Sbjct  419   ILSYLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYLKML  478

Query  1239  REVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDE  1418
             +++ P++ IF+E+Q I   EF + E+    EY   + EN+ +YP +D + GD     +  
Sbjct  479   QKLGPEKRIFEEIQKIEDNEFHYQEQTDPVEYVENMCENMQLYPLQDFLTGDQLLFEYKP  538

Query  1419  QLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEID  1598
             ++I + L         + +++ +     D++ E WFG+QY  E + +S  ELWK   E++
Sbjct  539   EVIAEALNQLVPPKANLVLLSGANEGKCDLK-EKWFGTQYSMEDVENSWAELWKTNFELN  597

Query  1599  VSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFR  1778
               LHLPA+N +I +DF ++A    C     P  I++ P    WYK DN FK+P+A   F 
Sbjct  598   PDLHLPAENKYIATDFMLKA--FDCPETEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFH  655

Query  1779  VTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHK  1958
             +       +  N +L ++FV +L   L E  Y+A VA+LE  +      L ++V GFNHK
Sbjct  656   LISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK  715

Query  1959  LPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWD-V  2135
             LP+L   ++     FS     F +I E +++T  N  +KP   A  +RL +L  + W  +
Sbjct  716   LPLLFQLIIDYLAEFSSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMI  775

Query  2136  EEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAE  2315
             ++   L++ LSL  L +F+ +  SQL++EGL  GN+   E+++         +  PL  E
Sbjct  776   DKYRALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFMPLEQE  835

Query  2316  MRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIV  2495
             M  +  V+ LPSG  L + V+  NK D NS V +Y+Q     G+  ++   L++L    +
Sbjct  836   MPVQFQVVELPSGHHLCK-VRALNKGDANSEVTVYYQ----SGTRSLREYTLMELLVMHM  890

Query  2496  EEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRV--QSSEYDPIYLQGRIDNFINDAKE  2669
             EEP FD LRTK+ LGY V  + R T  ILGF   V  Q+++Y+   +  +I+ F+++ +E
Sbjct  891   EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSNFEE  950

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++NL +D+F    + LI     +D  L  E +R W ++V ++Y+FD    E E LKS  
Sbjct  951   KIENLTEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS  1010

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVWG---------CNTQRKDSDASMEPAKVIKDPTA  3002
             KSDL+ W+  +     P C+ L V V G          N   +DS++S E  ++   PT+
Sbjct  1011  KSDLVNWFKAHRG---PGCKMLGVHVVGFGKYELEEDGNPSGEDSNSSCEVMQLTYLPTS  1067



>gb|ETM56185.1| hypothetical protein L914_00811 [Phytophthora parasitica]
 gb|ETP54467.1| hypothetical protein F442_00836 [Phytophthora parasitica P10297]
Length=1047

 Score =   509 bits (1311),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 497/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFRVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  + ++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEATIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NPKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLIHAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>gb|EDL41785.1| insulin degrading enzyme [Mus musculus]
Length=978

 Score =   507 bits (1306),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 321/916 (35%), Positives = 515/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL  A   +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDASCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++RE++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVREELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKAG--KLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L++ Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLRQLYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP   V+  +Y  E +   LI 
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGKLHYYPLNGVLTAEYLLEEFRPDLID  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEQWYGTQYKQEAIPEDIIQKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  D    P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIL--SLEKDATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ +      ++     + P L
Sbjct  659   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGVMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y +D    E   LK+
Sbjct  830   EKAIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNYDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEP----AK  2981
             + K D+I +Y   L    P+  ++SV V           G    + D + S  P     +
Sbjct  890   LTKDDIIRFYQEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPSQNDINLSEAPPLPQPE  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI + T FK+    +P
Sbjct  950   VIHNMTEFKRGLPLFP  965



>gb|ETL49820.1| hypothetical protein L916_00813 [Phytophthora parasitica]
 gb|ETO85374.1| hypothetical protein F444_00890 [Phytophthora parasitica P1976]
Length=1047

 Score =   509 bits (1311),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 320/895 (36%), Positives = 497/895 (56%), Gaps = 42/895 (5%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHMLFMGS ++PDENE++S+LS HGG SN  T+ E T Y FEV  + L  AL  F+ FF
Sbjct  116   LEHMLFMGSEKYPDENEFESFLSAHGGYSNGATDNEVTSYTFEVGPDHLEPALDMFAHFF  175

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             +SPL+KAEAM+RE+ A++SEF+Q  QND  R QQ+ C  S+  HP++RF WGNKKSL + 
Sbjct  176   ISPLMKAEAMDRELSAIESEFSQATQNDRIRTQQVLCDISSATHPYHRFGWGNKKSLQEI  235

Query  717   TER-GVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDM-VKSSS  890
              ++  V++R+QI + Y+  Y    MKLV+ G  TLD LE WV + FS +    + V S +
Sbjct  236   PKKMNVDVRQQILEFYNKYYSASIMKLVVCGENTLDELEQWVAKSFSAIPNKHVEVPSFA  295

Query  891   RLETPIWKAGK----LYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
                 P    G     L  +  V+D+H L L W +P +   + +K  DY+A LLGHE +GS
Sbjct  296   SAGPPFGARGAGAPFLCKIVPVRDIHTLHLDWMIPPVLGQHHQKPSDYIASLLGHESEGS  355

Query  1059  LLFFLKTKGWVTSISAGVGD-EGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKL  1235
             +L  LK +GW+++++AGV D +G    S A  F +++ LT  G+    EI+  V++YL +
Sbjct  356   VLSHLKERGWISAVTAGVTDTDGYDSGSYAAKFDITMKLTLEGISHWEEIVHAVFEYLHM  415

Query  1236  LREVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAE---NLLVYPPEDVVYGDYAYE  1406
             LR     EW+F EL  +  + FRF EE+   E   EL E   ++    PED++  D    
Sbjct  416   LRVHGCPEWVFDELAALADISFRFQEEDSAVERCEELGEIMQSMFRVAPEDILRYDLFKG  475

Query  1407  IWDEQLIKDILGFFRADNMRVDVVTKSLNNSSDVQ----CEPWFGSQYVEEYIPSSLLEL  1574
             ++ ++L +++L    A+++ V +V+++  +S + Q     E WF  +Y +E I  + ++ 
Sbjct  476   VFKKELAEEVLSHLTAESVCVSIVSQTFEDSVEFQKQAIKEEWFDVRYSKENITEATIQR  535

Query  1575  WKDPPEIDVSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEP-LMKFWYKLDNTFK  1751
             WK     +  LHLP  N FIP DFS+  D+   +G      + D     K WYK D  F 
Sbjct  536   WKSAGS-NPKLHLPRPNQFIPRDFSL-VDSTDVEG-----LVCDTTKFGKLWYKPDRVFA  588

Query  1752  LPRANTYFRVTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLE  1931
              PRA+    + L    +N+ N   T+L+V L++D LNE  Y A+VA+L  S+ +    LE
Sbjct  589   TPRAHVAMLIHLPSVVANVDNWSHTQLYVKLVRDALNEYAYHANVAELMYSLQVKESGLE  648

Query  1932  LKVYGFNHKLPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQV  2111
             L   GFN KL +L+  V+A        + RF V++E++ R  KN   K    A YLRLQ+
Sbjct  649   LIFGGFNDKLHILVEVVVAAVFGTEINEARFEVMREELMRESKNAITKVAQKAKYLRLQL  708

Query  2112  LCKSFWDVEEklcllnslsladlkaFLPDLL--SQLYIEGLCHGNMLEEEAVNISSIFTS  2285
             L    + +EE L  +   ++  LK ++ + L   + ++    HGN+    A  + +   S
Sbjct  709   LEIRSFSLEECLDSIEVATVESLKKYVSNELWAGKAWLASFAHGNISHAVASKMIANVES  768

Query  2286  YFSVPPLPAEMRH--KEYVMCLPSGA-DLVRDVQVKNKLDTNSVVELYFQIEPEVGSELI  2456
                    P ++R   +  +  +P      +   + +NK +TN+ VELY+QI P      +
Sbjct  769   QLQSVSAPLQLRDFPRRLINAIPQTPLGFLLKERSENKTETNTQVELYYQIGPLT----L  824

Query  2457  KLKALVDLFDEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQG  2636
             +  A  DL  +++EEPLFD LRTK++LGY V C+ RVT  ILGF   VQSS +   Y+  
Sbjct  825   RSLAYADLLHQLMEEPLFDTLRTKQELGYDVSCTVRVTNGILGFGVMVQSSLFAAEYITA  884

Query  2637  RIDNFINDAKEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLS  2816
              +D F+ D +E ++ + D+ F +     I   LE D +L   T+  W +I  +R  FD+ 
Sbjct  885   CVDRFMVDFEEAIEMMADEHFHDHIQAQILLKLEPDHNLLETTHHYWYEITSRRLAFDMD  944

Query  2817  EKEAEELKSIRKSDLIEWYHTYLKQPFPKCRRLSVRVWG--------CNTQRKDS  2957
              + A+E++++ KS++ + Y  ++ Q  PK  +L V+V G         + QRK++
Sbjct  945   AQLAKEMETLTKSEMAQHYREWILQS-PK--KLIVQVIGRGNPAEKIAHEQRKNA  996



>ref|XP_005333788.1| PREDICTED: insulin-degrading enzyme [Ictidomys tridecemlineatus]
Length=1019

 Score =   508 bits (1309),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 520/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  111   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  170

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  171   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  230

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  231   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  289

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  290   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  349

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  350   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  405

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  406   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  465

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  466   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  523

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  524   LPTKNEFIPTNFEIV--SLEKEATAYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  581

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  582   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLRYDLQNTIYG--MYLSVKGYNDKQP  639

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  640   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  699

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  700   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEYAHTKPLL  759

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  760   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  811

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  812   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  870

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  871   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  930

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  931   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  990

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  991   VIQNMTEFKRGLPLFP  1006



>ref|XP_004438604.1| PREDICTED: nardilysin isoform 3 [Ceratotherium simum simum]
Length=1099

 Score =   510 bits (1314),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 311/900 (35%), Positives = 501/900 (56%), Gaps = 31/900 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHM+FMGS ++PDEN +D++L KHGGS NA T+ E T + F+V+R++   AL R++QFF
Sbjct  183   LEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFF  242

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLSDA  716
             + PL+  +A++REV AVDSE+     +D+ R + L    + PGHP  +FFWGN ++L   
Sbjct  243   IHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHE  302

Query  717   TERG-VNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKS---  884
              +R  ++   ++ + +   Y    M LV+   ETLD LE WV E+FS +    + K    
Sbjct  303   PKRNSIDTHARLREFWMRYYSAHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPKPNFG  362

Query  885   --SSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
               +   +TP +   KLY +  ++ +H L ++W LP  ++ Y  K   Y++ L+GHEGKGS
Sbjct  363   HLTDPFDTPAF--NKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGS  420

Query  1059  LLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLL  1238
             +L +L+ K W  ++  G G+ G  ++S   +F +SI LTD G +  +E+   V+QYLK+L
Sbjct  421   ILSYLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYLKML  480

Query  1239  REVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDE  1418
             +++ P++ IF+E+Q I   EF + E+    EY   + EN+ +YP +D + GD     +  
Sbjct  481   QKLGPEKRIFEEIQKIEDNEFHYQEQTDPVEYVENMCENMQLYPLQDFLTGDQLLFEYKP  540

Query  1419  QLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEID  1598
             ++I + L         + +++ +     D++ E WFG+QY  E + +S  ELWK   E++
Sbjct  541   EVIAEALNQLVPQKANLVLLSGANEGKCDLK-EKWFGTQYSMEDVENSWAELWKTNFELN  599

Query  1599  VSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFR  1778
               LHLPA+N +I +DF ++A    C     P  I++ P    WYK DN FK+P+A   F 
Sbjct  600   PDLHLPAENKYIATDFMLKA--FDCPETEYPVKIVNTPQGCLWYKKDNKFKIPKAYIRFH  657

Query  1779  VTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHK  1958
             +       +  N +L ++FV +L   L E  Y+A VA+LE  +      L ++V GFNHK
Sbjct  658   LISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK  717

Query  1959  LPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWD-V  2135
             LP+L   ++     FS     F +I E +++T  N  +KP   A  +RL +L  + W  +
Sbjct  718   LPLLFQLIIDYLAEFSSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMI  777

Query  2136  EEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAE  2315
             ++   L++ LSL  L +F+ +  SQL++EGL  GN+   E+++         +  PL  E
Sbjct  778   DKYRALMDGLSLESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFMPLEQE  837

Query  2316  MRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIV  2495
             M  +  V+ LPSG  L + V+  NK D NS V +Y+Q     G+  ++   L++L    +
Sbjct  838   MPVQFQVVELPSGHHLCK-VRALNKGDANSEVTVYYQ----SGTRSLREYTLMELLVMHM  892

Query  2496  EEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRV--QSSEYDPIYLQGRIDNFINDAKE  2669
             EEP FD LRTK+ LGY V  + R T  ILGF   V  Q+++Y+   +  +I+ F++  +E
Sbjct  893   EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSEVVDKKIEEFLSSFEE  952

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++NL +D+F    + LI     +D  L  E +R W ++V ++Y+FD    E E LKS  
Sbjct  953   KIENLTEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS  1012

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVWG---------CNTQRKDSDASMEPAKVIKDPTA  3002
             KSDL+ W+  +     P C+ L V V G          N   +DS++S E  ++   PT+
Sbjct  1013  KSDLVNWFKAHRG---PGCKMLGVHVVGFGKYELEEDGNPSGEDSNSSCEVMQLTYLPTS  1069



>ref|XP_004020338.1| PREDICTED: insulin-degrading enzyme [Ovis aries]
Length=1067

 Score =   509 bits (1312),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 323/916 (35%), Positives = 522/916 (57%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  159   EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  218

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  219   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  278

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  279   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKN-VPLPEFP  337

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  338   EHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  397

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  398   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  453

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++A  L  YP E+V+  +Y  E +   LI+
Sbjct  454   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIE  513

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  514   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  571

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I   ++  +    P  I D  + K W+K D+ F LP+A   F     
Sbjct  572   LPTKNEFIPTNFEIL--SLEKEATPYPSLIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  629

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  630   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  687

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K++    +F   + RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  688   ILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  747

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  748   LKEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLL  807

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  808   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  859

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  860   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  918

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  919   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  978

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRVW----------GCNTQRKDSDASMEPA----K  2981
             + K D+I++Y   L    P+  ++SV V           G    + D + S  PA    +
Sbjct  979   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPE  1038

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  1039  VIQNMTEFKRGLPLFP  1054



>ref|XP_006238562.1| PREDICTED: nardilysin isoform X2 [Rattus norvegicus]
Length=1056

 Score =   509 bits (1311),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 309/891 (35%), Positives = 496/891 (56%), Gaps = 26/891 (3%)
 Frame = +3

Query  357   VEHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFF  536
             +EHM+FMGS ++PDEN +D++L KHGGS NA T+ E T + F+V+R++   AL R++QFF
Sbjct  141   LEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDRWAQFF  200

Query  537   VSPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSLS-D  713
             + PL+  +A++REV AVDSE+     +D+ R + L    + PGHP  +FFWGN ++L  +
Sbjct  201   IHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETLKHE  260

Query  714   ATERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKS---  884
               +  ++   ++ + +   Y    M LV+   ETLD LE WV E+FS +    + K    
Sbjct  261   PKKNNIDTHARLREFWMRYYSAHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPKPNFS  320

Query  885   --SSRLETPIWKAGKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGS  1058
               +   +TP +   KLY +  ++ +H L ++W LP  ++ Y  K   Y++ L+GHEGKGS
Sbjct  321   HLTDPFDTPAF--NKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGS  378

Query  1059  LLFFLKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLL  1238
             +L +L+ K W  ++  G G+ G  ++S   +F +SI LTD G +  +E+   V+QYLK+L
Sbjct  379   ILSYLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYLKML  438

Query  1239  REVSPQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDE  1418
             +++ P++ +F+E+Q I   EF + E+    EY   + EN+ +YP +D + GD     +  
Sbjct  439   QKLGPEKRVFEEIQKIEDNEFHYQEQTDPVEYVENMCENMQLYPRQDFLTGDQLLFEYKP  498

Query  1419  QLIKDILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEID  1598
             ++I + L         + +++ +     D++ E WFG+QY  E I +S  ELWK   +++
Sbjct  499   EVIAEALNQLVPQKANLVLLSGANEGRCDLK-EKWFGTQYSIEDIENSWTELWKSNFDLN  557

Query  1599  VSLHLPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFR  1778
               LHLPA+N +I +DF+++A    C     P  I++ P    WYK DN FK+P+A   F 
Sbjct  558   SDLHLPAENKYIATDFTLKA--FDCPETEYPAKIVNTPQGCLWYKKDNKFKIPKAYIRFH  615

Query  1779  VTLKGAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSVSLYGDKLELKVYGFNHK  1958
             +       +  N +L ++FV +L   L E  Y+A VA+LE  +      L ++V GFNHK
Sbjct  616   LISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK  675

Query  1959  LPVLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNMKPLNHASYLRLQVLCKSFWD-V  2135
             LP+L   ++     FS     F +I E +++T  N  +KP   A  +RL +L  S W  +
Sbjct  676   LPLLFQLIIDYLTEFSSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYSRWSMI  735

Query  2136  EEklcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNISSIFTSYFSVPPLPAE  2315
             ++   L++ LSL  L  F+ D  SQL++EGL  GN+   E+++         +  PL  E
Sbjct  736   DKYRALMDGLSLESLLNFVKDFKSQLFVEGLVQGNVTSTESMDFLRYVVDKLNFVPLERE  795

Query  2316  MRHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLFDEIV  2495
             M  +  V+ LPSG  L + V+  NK D NS V +Y+Q     G+  ++   L++L    +
Sbjct  796   MPVQFQVVELPSGHHLCK-VRALNKGDANSEVTVYYQ----SGTRSLREYTLMELLVMHM  850

Query  2496  EEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRV--QSSEYDPIYLQGRIDNFINDAKE  2669
             EEP FD LRTK+ LGY V  + R T  ILGF   V  Q+++Y+   +  +I+ F++  +E
Sbjct  851   EEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSETVDKKIEEFLSSFEE  910

Query  2670  ILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKSIR  2849
              ++NL +D+F    + LI     +D  L  E +R W ++V ++Y+FD    E E LKS  
Sbjct  911   KIENLTEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS  970

Query  2850  KSDLIEWYHTYLKQPFPKCRRLSVRVWGCNTQRKDSDASMEPAKVIKDPTA  3002
             KSDL+ W+  +     P  + LSV V G      + D     A V +DP +
Sbjct  971   KSDLVSWFKAHRG---PGSKMLSVHVVGYGKYELEEDG----APVCEDPNS  1014



>ref|XP_004900702.1| PREDICTED: insulin-degrading enzyme-like isoform X1 [Heterocephalus 
glaber]
Length=978

 Score =   507 bits (1305),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 322/916 (35%), Positives = 517/916 (56%), Gaps = 46/916 (5%)
 Frame = +3

Query  360   EHMLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFV  539
             EHMLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+
Sbjct  70    EHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFL  129

Query  540   SPLVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDA  716
              PL      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +  
Sbjct  130   CPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRP  189

Query  717   TERGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRL  896
              + G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+  + V      
Sbjct  190   NQEGIDVRQELLKFHSTYYSSNLMAICVLGRESLDDLTNLVIKLFSEVENKN-VPLPEFP  248

Query  897   ETPIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFF  1070
             E P  +    +LY +  +KD+  L +++ +P L+K Y      YL HL+GHEG GSLL  
Sbjct  249   EHPFQEEHLKQLYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSE  308

Query  1071  LKTKGWVTSISAGVGDEGMHRSSIAYIFGMSIHLTDSGLKKIFEIIGFVYQYLKLLREVS  1250
             LK+KGWV ++  G   EG  R  + +I  +++ LT+ GL  + +II  ++QY++ LR   
Sbjct  309   LKSKGWVNTLVGG-QKEGA-RGFMFFI--INVDLTEEGLLHVEDIILHMFQYIQKLRAEG  364

Query  1251  PQEWIFKELQDIGFMEFRFIEEEPQDEYAAELAENLLVYPPEDVVYGDYAYEIWDEQLIK  1430
             PQEW+F+E +D+  + FRF ++E    Y +++   L  YP E+V+  +Y  E +   LI+
Sbjct  365   PQEWVFQECKDLNAVAFRFKDKERPRGYTSKIXGILHYYPLEEVLTAEYLLEEFRPDLIE  424

Query  1431  DILGFFRADNMRVDVVTKSLNNSSDVQCEPWFGSQYVEEYIPSSLLELWKDPPEIDVSLH  1610
              +L   R +N+RV +V+KS    +D + E W+G+QY +E IP  +++ W++  +++    
Sbjct  425   MVLDKLRPENVRVAIVSKSFEGKTD-RTEEWYGTQYKQEAIPDEVIKKWQN-ADLNGKFK  482

Query  1611  LPAKNDFIPSDFSIRADTISCDGGNAPKCILDEPLMKFWYKLDNTFKLPRANTYFRVTLK  1790
             LP KN+FIP++F I A  +  +  + P  I D  + K W+K D+ F LP+A   F     
Sbjct  483   LPTKNEFIPTNFEIVA--LEKEATSYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSP  540

Query  1791  GAYSNLRNALLTELFVLLLKDELNEIVYQASVAKLETSV--SLYGDKLELKVYGFNHKLP  1964
              AY +  +  +  L++ LLKD LNE  Y A +A L   +  ++YG  + L V G+N K P
Sbjct  541   FAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYG--MYLSVKGYNDKQP  598

Query  1965  VLLSKVLAVTVSFSPKDDRFLVIKEDMERTLKNTNM-KPLNHASYLRLQVLCKSFWDVEE  2141
             +LL K+     +F     RF +IKE   R+L N    +P  HA Y    ++ +  W  +E
Sbjct  599   ILLKKITEKMATFEIDKKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDE  658

Query  2142  klcllnslsladlkaFLPDLLSQLYIEGLCHGNMLEEEAVNI-----SSIFTSYFSVPPL  2306
                 L+ ++L  LKAF+P LLS+L+IE L HGN+ ++ A+ I      ++     + P L
Sbjct  659   LKDALDDVTLLRLKAFIPQLLSRLHIEALIHGNITKQAALGIMQMVEDTLIEHAHTKPLL  718

Query  2307  PAEM-RHKEYVMCLPSGADLVRDVQVKNKLDTNSVVELYFQIEPEVGSELIKLKALVDLF  2483
             P+++ R++E  + LP     V   Q +N++  N  +E+Y+Q + +  SE       ++LF
Sbjct  719   PSQLVRYRE--VQLPDRGWFV--YQQRNEVHNNCGIEIYYQTDMQSTSE----NMFLELF  770

Query  2484  DEIVEEPLFDRLRTKEQLGYVVDCSPRVTYRILGFCFRVQSSEYDPIYLQGRIDNFINDA  2663
              +I+ EP F+ LRTKEQLGY+V   PR    I G  F +Q SE  P YL+ R++ F+   
Sbjct  771   CQIISEPCFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQ-SEKPPHYLESRVEAFLITM  829

Query  2664  KEILDNLDDDSFENFKSGLIAKLLEKDPSLSYETNRLWGQIVDKRYMFDLSEKEAEELKS  2843
             ++ ++++ +++F+     L  + L+K   LS E  + WG+I+ ++Y FD    E   LK+
Sbjct  830   EKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGEIISQQYNFDRDNIEVAYLKT  889

Query  2844  IRKSDLIEWYHTYLKQPFPKCRRLSVRV-------------WGCNTQRKDSDASMEP-AK  2981
             + K D+I++Y   L    P+  ++SV V             + C      S A   P   
Sbjct  890   LTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDVNLSQAPPLPQPD  949

Query  2982  VIKDPTAFKKSSEFYP  3029
             VI++ T FK+    +P
Sbjct  950   VIQNMTEFKRGLPLFP  965



>ref|XP_010379625.1| PREDICTED: insulin-degrading enzyme isoform X4 [Rhinopithecus 
roxellana]
Length=907

 Score =   504 bits (1299),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 321/914 (35%), Positives = 518/914 (57%), Gaps = 46/914 (5%)
 Frame = +3

Query  366   MLFMGSTEFPDENEYDSYLSKHGGSSNAYTETEHTCYHFEVKREFLYGALKRFSQFFVSP  545
             MLF+G+ ++P ENEY  +LS+H GSSNA+T  EHT Y+F+V  E L GAL RF+QFF+ P
Sbjct  1     MLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCP  60

Query  546   LVKAEAMEREVLAVDSEFNQVLQNDSCRLQQLQCHTSAPGHPFNRFFWGNKKSL-SDATE  722
             L      +REV AVDSE  + + ND+ RL QL+  T  P HPF++F  GNK +L +   +
Sbjct  61    LFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQ  120

Query  723   RGVNLREQIFKLYHDNYYGRKMKLVIIGGETLDVLESWVLELFSTVKKGDMVKSSSRLET  902
              G+++R+++ K +   Y    M + ++G E+LD L + V++LFS V+    V      E 
Sbjct  121   EGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKS-VPLPEFPEH  179

Query  903   PIWKA--GKLYWLEAVKDVHILELSWTLPSLRKDYLRKAEDYLAHLLGHEGKGSLLFFLK  1076
             P  +