BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22470_g2_i1 len=729 path=[901:0-73 21:74-107 55:108-150 98:151-182
1207:183-195 1220:196-236 1261:237-379 1404:380-411 1435:412-423
1048:424-472 478:473-728]

Length=729
                                                                      Score     E

ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        109   5e-42   
ref|XP_008337346.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    108   2e-41   
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    115   7e-39   
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative         97.8    2e-36   Ricinus communis
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg             103   7e-36   
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative         93.2    7e-36   Ricinus communis
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    103   1e-35   
ref|XP_002892873.1|  hypothetical protein ARALYDRAFT_471756           97.4    7e-35   
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  94.0    4e-34   
gb|ABB00360.1|  gibberellin 3-oxidase                                 92.0    1e-33   Fragaria x ananassa
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.0    3e-31   
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.8    5e-31   
dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     127   7e-31   Ipomoea nil [qian niu]
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g           84.3    8e-31   
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      84.3    1e-30   
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg           82.4    1e-30   
ref|XP_003533057.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.8    3e-30   
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      87.0    3e-30   
gb|KHN47796.1|  Gibberellin 3-beta-dioxygenase 1                      82.4    3e-30   
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      88.2    3e-30   
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.5    4e-30   
gb|EYU21574.1|  hypothetical protein MIMGU_mgv1a017804mg              90.1    5e-30   
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                        85.1    1e-29   Lactuca sativa [cultivated lettuce]
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg           85.5    3e-29   
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                       88.2    4e-29   Daucus carota [carrots]
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.7    4e-29   
ref|XP_003527798.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.8    5e-29   
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.3    1e-28   
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.9    5e-28   
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.9    1e-27   
ref|XP_003522638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.4    1e-27   
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  83.2    1e-27   
emb|CDY38660.1|  BnaC02g23190D                                        81.3    2e-27   
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.0    2e-27   
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.0    2e-27   
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  76.6    5e-27   
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      77.4    9e-27   
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.9    1e-26   
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg           78.2    1e-26   
emb|CDY37588.1|  BnaA02g19820D                                        76.6    1e-26   
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...  77.0    4e-26   Pisum sativum [garden pea]
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                        77.0    4e-26   Pisum sativum [garden pea]
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  82.0    4e-26   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ65443.1|  gibberellin 3-oxidase                                73.2    4e-26   
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                  76.3    6e-26   Pisum sativum [garden pea]
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                        76.3    7e-26   Pisum sativum [garden pea]
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  80.9    7e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.6    7e-26   
emb|CDM81908.1|  unnamed protein product                              80.9    8e-26   
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                        76.6    9e-26   Medicago falcata [sickle alfalfa]
gb|AAT49061.1|  GA 3-oxidase 2                                        82.0    1e-25   Hordeum vulgare subsp. vulgare [barley]
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  80.5    1e-25   Triticum aestivum [Canadian hard winter wheat]
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                        75.9    1e-25   Medicago sativa subsp. caerulea
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                        75.9    1e-25   Medicago sativa subsp. caerulea
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.9    2e-25   
emb|CAX46400.1|  putative GA3OX protein                               71.2    3e-25   Rosa lucieae [memorial rose]
ref|XP_007137070.1|  hypothetical protein PHAVU_009G097200g           74.3    4e-25   
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.3    6e-25   
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                        78.2    7e-25   Dasypyrum villosum
emb|CAH69705.1|  gibberellin 3-oxidase                                74.3    9e-25   Phaseolus coccineus [scarlet runner bean]
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                   73.9    1e-24   
ref|XP_006389781.1|  hypothetical protein EUTSA_v10019663mg           77.0    1e-24   
gb|AGQ42610.1|  GA3ox2                                                80.1    1e-24   
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.9    2e-24   
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      80.1    3e-24   Vitis vinifera
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  78.2    5e-24   
ref|XP_004968405.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  73.9    1e-23   
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.6    1e-23   
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.9    2e-23   
ref|XP_002455082.1|  hypothetical protein SORBIDRAFT_03g004020        73.2    2e-23   Sorghum bicolor [broomcorn]
ref|XP_004240225.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    2e-23   
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                 72.8    3e-23   
dbj|BAK06541.1|  predicted protein                                    76.6    3e-23   
gb|AAT49060.1|  GA 3-oxidase 1                                        75.5    3e-23   Hordeum vulgare subsp. vulgare [barley]
dbj|BAB17075.1|  GA 3beta-hydroxylase                                 75.1    4e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB62072.1|  GA 3beta-hydroxylase                                 75.1    4e-23   Oryza sativa [red rice]
ref|NP_001042186.1|  Os01g0177400                                     75.1    4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ACL54258.1|  unknown                                               80.1    4e-23   Zea mays [maize]
ref|XP_008647746.1|  PREDICTED: GA 3-oxidase 2 isoform X1             80.1    5e-23   
emb|CDP19027.1|  unnamed protein product                              75.1    6e-23   
ref|NP_001266453.1|  GA 3-oxidase 1                                   72.4    1e-22   
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                       76.3    2e-22   Lactuca sativa [cultivated lettuce]
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  68.2    2e-22   
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                        73.6    2e-22   
ref|XP_003569638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  71.6    2e-22   
ref|XP_010476647.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        103   3e-22   
ref|XP_006305164.1|  hypothetical protein CARUB_v10009532mg             103   3e-22   
ref|NP_173008.1|  gibberellin 3-beta-dioxygenase 1                      102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459098.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    102   4e-22   
gb|ADE18861.1|  putative 2-oxoglutarate dependent dioxygenase         72.4    5e-22   
gb|ADK71024.1|  gibberellin 3-beta-hydroxylase                        72.0    6e-22   
ref|XP_008445138.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.0    6e-22   
gb|AAF80661.1|AF074710_1  putative gibberellin 3 beta hydroxylase     66.2    7e-22   Citrullus lanatus [wild melon]
dbj|BAB62073.1|  GA 3beta-hydroxylase                                 71.6    7e-22   Oryza sativa [red rice]
emb|CDY36572.1|  BnaA06g10250D                                          101   9e-22   
ref|XP_010497240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    101   1e-21   
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                        71.2    1e-21   
ref|XP_002312162.1|  oxidoreductase family protein                    79.0    1e-21   Populus trichocarpa [western balsam poplar]
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                        70.5    1e-21   
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                        70.5    1e-21   
ref|XP_002465421.1|  hypothetical protein SORBIDRAFT_01g038520        90.1    2e-21   Sorghum bicolor [broomcorn]
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                        73.9    2e-21   
ref|XP_002519764.1|  1-aminocyclopropane-1-carboxylate oxidase, p...  70.9    2e-21   Ricinus communis
ref|XP_006416894.1|  hypothetical protein EUTSA_v10008008mg             100   2e-21   
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                        71.2    3e-21   
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                        71.6    3e-21   
emb|CDP04846.1|  unnamed protein product                              74.3    4e-21   
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                        71.2    4e-21   
dbj|BAQ02990.1|  gibberellin 3-oxidase                                99.8    4e-21   
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                     68.2    4e-21   
ref|XP_011047646.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...  77.4    4e-21   
emb|CDY01001.1|  BnaC05g41990D                                        72.8    5e-21   
gb|ABY49032.1|  GA3-oxidase                                           66.6    5e-21   Ehrharta erecta
ref|XP_008660253.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  88.6    5e-21   
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                        69.3    5e-21   
ref|NP_001054798.1|  Os05g0178100                                     71.2    5e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78618.1|  hypothetical protein OsI_18664                        71.2    5e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004984849.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   92.0    5e-21   
ref|XP_004963513.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  69.3    5e-21   
gb|KFK43811.1|  hypothetical protein AALP_AA1G176200                  99.8    5e-21   
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                        71.2    5e-21   
gb|EEE62526.1|  hypothetical protein OsJ_17324                        72.0    5e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32333.1|  hypothetical protein JCGZ_13258                       99.4    6e-21   
gb|AFA35958.1|  gibberellin 3-oxidase                                 96.3    6e-21   
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                        71.2    7e-21   
ref|XP_009148952.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      99.4    8e-21   
ref|NP_001275523.1|  gibberellin 3-beta-dioxygenase 1-like            65.1    8e-21   
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                        71.2    9e-21   
ref|XP_011035927.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   80.5    9e-21   
emb|CDY39663.1|  BnaC05g11920D                                        99.0    9e-21   
ref|XP_006355629.1|  PREDICTED: protein SRG1-like                     65.1    1e-20   
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like       73.9    1e-20   
gb|KGN62901.1|  hypothetical protein Csa_2G379320                     65.5    1e-20   
dbj|BAM73280.1|  gibberellin 3 oxidase 1                              98.6    1e-20   
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                        71.2    1e-20   
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-20   
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                        67.8    1e-20   
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                        71.2    1e-20   
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                        69.3    1e-20   
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                        68.2    1e-20   
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                        69.7    1e-20   
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                        71.2    1e-20   
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                        69.7    1e-20   
ref|XP_009117822.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  98.2    1e-20   
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                        68.2    1e-20   
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                        70.9    2e-20   
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                        70.9    2e-20   
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                      75.9    2e-20   
gb|ACG46320.1|  gibberellin 3-beta-dioxygenase 2-2                    80.1    2e-20   Zea mays [maize]
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                        68.2    2e-20   
ref|XP_006451038.1|  hypothetical protein CICLE_v10010731mg           95.9    2e-20   
ref|NP_001146525.1|  GA 3-oxidase 2                                   79.7    2e-20   Zea mays [maize]
gb|KDO80406.1|  hypothetical protein CISIN_1g043986mg                 95.9    2e-20   
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                        68.2    2e-20   
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                        67.8    2e-20   
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                        67.0    2e-20   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                       70.5    2e-20   
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                        67.8    2e-20   
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-20   
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                        66.6    2e-20   
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                        67.8    2e-20   
ref|XP_008667799.1|  PREDICTED: uncharacterized protein LOC100273...  86.3    2e-20   
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                        68.9    3e-20   
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                        67.0    3e-20   
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                        67.0    3e-20   
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                        69.3    3e-20   
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                        68.9    3e-20   
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                        68.2    3e-20   
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                        68.2    3e-20   
ref|NP_001141508.1|  uncharacterized protein LOC100273620             86.3    3e-20   Zea mays [maize]
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                        67.0    3e-20   
gb|ABY49029.1|  GA3-oxidase                                           65.5    3e-20   Luziola fluitans [southern watergrass]
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                        67.4    3e-20   
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1          69.3    3e-20   
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1          69.7    3e-20   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2          69.7    3e-20   
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                        67.4    3e-20   
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                        67.0    3e-20   
ref|XP_011077657.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   75.5    3e-20   
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
ref|XP_006429403.1|  hypothetical protein CICLE_v10012026mg           79.7    4e-20   
emb|CDX81720.1|  BnaC08g38810D                                        97.1    4e-20   
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                        68.9    4e-20   
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                        68.6    4e-20   
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                        67.4    4e-20   
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                        71.6    4e-20   
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                        68.6    4e-20   
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg           76.6    4e-20   
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                        68.6    4e-20   
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                        67.0    4e-20   
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|KDP21184.1|  hypothetical protein JCGZ_21655                       65.5    5e-20   
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                     65.1    5e-20   
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                        67.0    5e-20   
ref|XP_008442413.1|  PREDICTED: protein SRG1-like                     79.7    5e-20   
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                        67.0    6e-20   
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                        68.6    6e-20   
emb|CDP06475.1|  unnamed protein product                              75.9    6e-20   
gb|KCW74246.1|  hypothetical protein EUGRSUZ_E02883                   68.6    6e-20   
ref|XP_002987280.1|  hypothetical protein SELMODRAFT_450789           67.0    6e-20   
ref|XP_002989203.1|  hypothetical protein SELMODRAFT_450793           67.0    6e-20   
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                        67.0    6e-20   
ref|XP_011095018.1|  PREDICTED: leucoanthocyanidin dioxygenase        76.3    6e-20   
gb|ABX10776.1|  gibberellin 3-oxidase-like protein                    67.0    6e-20   Selaginella moellendorffii
gb|AFN53718.1|  putative flavonol synthase                            62.8    7e-20   
ref|XP_010423451.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  73.6    7e-20   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                       64.3    7e-20   
ref|XP_007026685.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  85.1    7e-20   
emb|CDY08545.1|  BnaA05g27810D                                        69.7    8e-20   
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                        66.6    8e-20   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                     70.1    8e-20   
gb|EMT22046.1|  Flavonol synthase/flavanone 3-hydroxylase             82.4    8e-20   
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                     67.8    8e-20   
gb|EYU22811.1|  hypothetical protein MIMGU_mgv1a008725mg              84.7    8e-20   
gb|ABY49025.1|  GA3-oxidase                                           63.5    8e-20   Oryza officinalis
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                 96.3    8e-20   
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                     67.4    9e-20   
gb|ABY49031.1|  GA3-oxidase                                           63.2    9e-20   Rhynchoryza subulata
ref|XP_002976806.1|  hypothetical protein SELMODRAFT_105948           75.5    9e-20   
ref|XP_002980534.1|  hypothetical protein SELMODRAFT_112786           75.5    9e-20   
ref|XP_004233861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    9e-20   
ref|XP_006287961.1|  hypothetical protein CARUB_v10001196mg           73.2    1e-19   
ref|XP_004302589.1|  PREDICTED: protein SRG1-like                     78.6    1e-19   
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                        68.6    1e-19   
ref|XP_006646452.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   80.9    1e-19   
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                     63.9    1e-19   
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  95.9    1e-19   
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                     63.2    1e-19   
ref|XP_010491092.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  72.8    1e-19   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  68.6    1e-19   
gb|KCW74243.1|  hypothetical protein EUGRSUZ_E02880                   68.6    1e-19   
gb|ABY49024.1|  GA3-oxidase                                           62.8    1e-19   Oryza punctata
ref|XP_006399020.1|  hypothetical protein EUTSA_v10013861mg           71.6    1e-19   
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                        67.0    1e-19   
gb|ABY49028.1|  GA3-oxidase                                           62.4    1e-19   Oryza granulata
gb|EMS47228.1|  putative 2-oxoglutarate/Fe(II)-dependent dioxygenase  83.2    1e-19   
ref|XP_002519769.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  69.3    1e-19   Ricinus communis
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                        67.0    1e-19   
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                        67.0    1e-19   
gb|ABY49026.1|  GA3-oxidase                                           62.0    2e-19   Oryza australiensis
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  70.1    2e-19   Ricinus communis
gb|AAM61665.1|  leucoanthocyanidin dioxygenase-like protein           70.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg           71.2    2e-19   
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  95.5    2e-19   
ref|XP_002976797.1|  2-oxoacid dioxygenase                            76.3    2e-19   
ref|XP_008805332.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  79.7    2e-19   
ref|XP_006574190.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  77.4    2e-19   
ref|XP_010691866.1|  PREDICTED: flavanone 3-dioxygenase-like          75.1    2e-19   
gb|ABY49027.1|  GA3-oxidase                                           62.8    2e-19   Oryza brachyantha
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                   69.3    2e-19   
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like       73.9    2e-19   
ref|NP_196179.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...  70.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  80.1    2e-19   
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                        94.7    3e-19   Nicotiana tabacum [American tobacco]
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                     69.7    3e-19   
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  94.7    3e-19   
ref|XP_002871172.1|  oxidoreductase                                   71.2    3e-19   
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                        64.3    3e-19   
ref|XP_002981651.1|  2-oxoacid-dependent dioxygenase                  68.9    3e-19   
ref|XP_002980524.1|  2-oxoacid dioxygenase                            76.3    3e-19   
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  94.4    3e-19   
ref|XP_008377587.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      94.7    3e-19   
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative         94.4    3e-19   
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                     65.5    3e-19   
gb|KHG06473.1|  Protein SRG1 -like protein                            75.1    3e-19   
gb|KHN44118.1|  Leucoanthocyanidin dioxygenase                        76.6    4e-19   
ref|NP_001275108.1|  gibberellin 3-beta-hydroxylase 1                 94.4    4e-19   
ref|XP_010452466.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  73.9    4e-19   
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1          71.6    4e-19   
ref|NP_001233848.1|  3b-hydroxylase                                   94.4    4e-19   
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2          71.6    4e-19   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988  68.6    4e-19   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                     64.7    4e-19   
ref|XP_009146748.1|  PREDICTED: leucoanthocyanidin dioxygenase        69.7    4e-19   
ref|XP_010031167.1|  PREDICTED: protein SRG1-like                     82.0    4e-19   
gb|AGN95009.1|  gibberellin 3-beta-dioxygenase                        94.0    5e-19   
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                     65.1    5e-19   
ref|XP_002315155.1|  oxidoreductase family protein                    74.7    5e-19   
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...  69.7    5e-19   
ref|XP_009122344.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.1    5e-19   
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                 93.6    6e-19   
ref|XP_002967867.1|  2-oxoacid-dependent dioxygenase                  67.4    6e-19   
gb|ACT99991.1|  gibberellin 3-oxidase                                 93.6    6e-19   
ref|XP_009783758.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  74.3    6e-19   
ref|XP_011006564.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   79.3    6e-19   
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  93.6    7e-19   
ref|XP_006494095.1|  PREDICTED: codeine O-demethylase-like isofor...  69.3    7e-19   
ref|XP_004514213.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   77.8    7e-19   
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  93.6    7e-19   
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2          68.2    7e-19   
ref|NP_001049794.1|  Os03g0289800                                     79.7    7e-19   
ref|XP_004170094.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   81.3    8e-19   
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg           93.2    8e-19   
gb|EAY89569.1|  hypothetical protein OsI_11101                        79.7    8e-19   
ref|XP_006355575.1|  PREDICTED: protein SRG1-like                     61.6    8e-19   
dbj|BAD91162.1|  gibberellin 3-beta hydroxylase                       93.6    8e-19   
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                     68.9    8e-19   
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  93.2    8e-19   
gb|KDP24441.1|  hypothetical protein JCGZ_25005                       73.6    8e-19   
gb|ABO70984.1|  gibberellin 3-oxidase 2                               93.2    8e-19   
ref|XP_004137903.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   80.9    8e-19   
ref|XP_010537951.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  93.2    8e-19   
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                     93.2    8e-19   
gb|ACN89834.1|  gibberellin 3-oxidase                                 93.2    8e-19   
ref|XP_011019104.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   76.3    8e-19   
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  93.2    9e-19   
ref|XP_009419671.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  78.2    9e-19   
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  93.2    9e-19   
ref|XP_003561738.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  80.1    9e-19   
gb|ABY49030.1|  GA3-oxidase                                           61.2    1e-18   
ref|XP_007024019.1|  Gibberellin 3-oxidase 1, putative                93.2    1e-18   
gb|ACN89835.1|  gibberellin 3-oxidase                                 93.2    1e-18   
ref|XP_010920851.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  77.0    1e-18   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                     65.5    1e-18   
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                     69.3    1e-18   
ref|XP_010920852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  77.0    1e-18   
ref|XP_006356177.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  92.8    1e-18   
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                 92.8    1e-18   
ref|XP_009610870.1|  PREDICTED: protein SRG1-like                     65.1    1e-18   
ref|XP_008228615.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      92.8    1e-18   
gb|KCW74257.1|  hypothetical protein EUGRSUZ_E02903                   69.3    1e-18   
ref|XP_006407467.1|  hypothetical protein EUTSA_v10022012mg           68.2    1e-18   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                     68.9    1e-18   
gb|KHF98196.1|  Protein SRG1 -like protein                            67.8    1e-18   
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  92.8    1e-18   
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1          71.6    1e-18   
gb|EYU24845.1|  hypothetical protein MIMGU_mgv1a013030mg              69.7    1e-18   
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like            68.6    1e-18   
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  92.8    1e-18   
ref|XP_010057204.1|  PREDICTED: protein SRG1-like                     67.0    1e-18   
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                     67.0    2e-18   
dbj|BAG32267.1|  gibberellin 3-oxidase                                92.4    2e-18   
ref|XP_003520449.2|  PREDICTED: leucoanthocyanidin dioxygenase-like   78.2    2e-18   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  70.1    2e-18   
gb|KCW74239.1|  hypothetical protein EUGRSUZ_E02878                   70.1    2e-18   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                     69.3    2e-18   
gb|KHN42516.1|  Leucoanthocyanidin dioxygenase                        77.4    2e-18   
gb|KDP21180.1|  hypothetical protein JCGZ_21651                       66.6    2e-18   
dbj|BAB91484.1|  flavanone-3-hydroxylase                              62.8    2e-18   
ref|XP_009788475.1|  PREDICTED: protein SRG1-like                     72.8    2e-18   
ref|XP_010253753.1|  PREDICTED: protein SRG1-like                     77.8    2e-18   
ref|XP_009130890.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  72.8    2e-18   
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  69.7    2e-18   
gb|KHG25230.1|  Protein SRG1 -like protein                            70.1    2e-18   
ref|XP_007025218.1|  Senescence-related gene 1, putative              66.2    2e-18   
gb|KDP44756.1|  hypothetical protein JCGZ_01256                       77.0    2e-18   
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  67.0    2e-18   
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                     63.9    2e-18   
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg           92.0    2e-18   
ref|XP_010919592.1|  PREDICTED: S-norcoclaurine synthase 1-like       76.3    2e-18   
ref|XP_009772022.1|  PREDICTED: protein SRG1-like                     63.9    2e-18   
emb|CDP18939.1|  unnamed protein product                              92.0    2e-18   
ref|XP_007215556.1|  hypothetical protein PRUPE_ppa007336mg           92.0    2e-18   
ref|XP_006300190.1|  hypothetical protein CARUB_v10016426mg           68.6    2e-18   
ref|XP_004249657.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  67.0    2e-18   
emb|CDX80966.1|  BnaC03g02200D                                        71.2    3e-18   
ref|XP_002308223.2|  hypothetical protein POPTR_0006s10210g           72.8    3e-18   
gb|KEH23177.1|  leucoanthocyanidin dioxygenase-like protein           75.1    3e-18   
ref|XP_008243604.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...  76.6    3e-18   
emb|CBI30795.3|  unnamed protein product                              67.4    3e-18   
ref|XP_006355570.1|  PREDICTED: protein SRG1-like                     65.9    3e-18   
gb|KFK24976.1|  hypothetical protein AALP_AA8G050500                  72.8    3e-18   
gb|EAY77129.1|  hypothetical protein OsI_05094                        72.0    3e-18   
ref|XP_007140275.1|  hypothetical protein PHAVU_008G098500g           75.1    3e-18   
emb|CBI22799.3|  unnamed protein product                              76.6    3e-18   
ref|NP_974614.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  65.9    3e-18   
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                     67.0    3e-18   
ref|NP_001045319.1|  Os01g0935400                                     71.6    3e-18   
ref|XP_002264807.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  77.0    3e-18   
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                  91.7    3e-18   
ref|XP_004232992.1|  PREDICTED: protein SRG1                          63.5    3e-18   
ref|NP_001233855.1|  3b-hydroxylase                                   91.3    4e-18   
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg           91.3    4e-18   
ref|XP_006338984.1|  PREDICTED: protein SRG1-like                     66.6    4e-18   
ref|XP_004233001.1|  PREDICTED: protein SRG1-like                     67.0    4e-18   
ref|NP_194260.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  65.1    4e-18   
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  91.3    4e-18   
ref|XP_010464819.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.9    4e-18   
dbj|BAE99802.1|  SRG1-like protein                                    65.1    4e-18   
gb|EYU41904.1|  hypothetical protein MIMGU_mgv1a008689mg              72.0    4e-18   
gb|AAN87570.1|  gibberellin 3-oxidase                                 91.7    4e-18   
ref|XP_008802804.1|  PREDICTED: S-norcoclaurine synthase 1-like       70.9    4e-18   
gb|KDP21182.1|  hypothetical protein JCGZ_21653                       64.7    5e-18   
ref|XP_006432904.1|  hypothetical protein CICLE_v10001623mg           68.6    5e-18   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg           68.6    5e-18   
ref|XP_009621091.1|  PREDICTED: protein SRG1-like                     71.2    5e-18   
ref|XP_002882718.1|  oxidoreductase                                   65.9    5e-18   
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1          63.5    5e-18   
gb|AFS18537.1|  gibberellin 3-oxidase                                 91.3    5e-18   
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  90.9    5e-18   
emb|CDY14105.1|  BnaC02g02220D                                        71.2    5e-18   
ref|XP_009382428.1|  PREDICTED: S-norcoclaurine synthase 1-like       75.5    5e-18   
ref|XP_009757227.1|  PREDICTED: protein SRG1-like isoform X2          65.5    5e-18   
ref|XP_009757223.1|  PREDICTED: protein SRG1-like isoform X1          65.5    6e-18   
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2          68.2    6e-18   
ref|XP_010487452.1|  PREDICTED: protein SRG1-like                     65.5    6e-18   
gb|AHW42458.1|  GA2ox8                                                70.9    6e-18   
emb|CDY24860.1|  BnaA08g14500D                                        63.5    6e-18   
gb|AEK70423.1|  GA3ox1                                                90.9    6e-18   
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  90.9    6e-18   
ref|XP_004500496.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  73.6    6e-18   
ref|XP_006651274.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  81.3    6e-18   
emb|CDY04960.1|  BnaAnng01420D                                        71.2    6e-18   
ref|XP_010057208.1|  PREDICTED: protein SRG1-like                     65.1    6e-18   
ref|XP_010937853.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  77.0    7e-18   
ref|XP_010937852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  77.0    7e-18   
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  90.5    7e-18   
emb|CDP03734.1|  unnamed protein product                              64.3    7e-18   
ref|XP_010067530.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   66.2    7e-18   
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  90.5    7e-18   
ref|XP_010516190.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  71.6    7e-18   
gb|AEK70424.1|  GA3ox2                                                90.5    8e-18   
gb|KHG03816.1|  Leucoanthocyanidin dioxygenase                        73.2    8e-18   
emb|CDY39986.1|  BnaC06g40640D                                        87.0    8e-18   
ref|XP_009125612.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  71.2    8e-18   
ref|XP_011084903.1|  PREDICTED: protein SRG1-like                     75.9    8e-18   
ref|XP_004307670.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  75.9    8e-18   
ref|XP_010039168.1|  PREDICTED: protein SRG1                          76.3    9e-18   
gb|KCW49451.1|  hypothetical protein EUGRSUZ_K02978                   76.3    9e-18   
ref|XP_002323582.1|  hypothetical protein POPTR_0016s12440g           74.7    9e-18   
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein        90.5    9e-18   
ref|XP_002302051.1|  hypothetical protein POPTR_0002s04060g           60.1    9e-18   
ref|XP_008370097.1|  PREDICTED: protein SRG1-like                     74.3    9e-18   
ref|XP_002528471.1|  Naringenin,2-oxoglutarate 3-dioxygenase, put...  74.7    9e-18   
ref|XP_011019103.1|  PREDICTED: thebaine 6-O-demethylase-like         72.4    9e-18   
gb|KCW79673.1|  hypothetical protein EUGRSUZ_C01027                   60.1    1e-17   
ref|XP_009595967.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  71.2    1e-17   
ref|XP_002992201.1|  2-oxoacid dioxygenase                            79.0    1e-17   
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                     60.1    1e-17   
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  90.1    1e-17   
ref|XP_010059077.1|  PREDICTED: codeine O-demethylase-like            70.1    1e-17   
ref|XP_002887835.1|  predicted protein                                90.1    1e-17   
gb|ABK23247.1|  unknown                                               71.6    1e-17   
ref|XP_009406925.1|  PREDICTED: protein SRG1-like                     73.6    1e-17   
ref|XP_011085301.1|  PREDICTED: protein SRG1-like                     62.4    1e-17   
gb|KHG08200.1|  S-norcoclaurine synthase 1                            78.2    1e-17   
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                     64.3    1e-17   
ref|XP_009377752.1|  PREDICTED: protein SRG1-like                     73.9    1e-17   
ref|XP_001759966.1|  predicted protein                                65.5    1e-17   
ref|XP_010327726.1|  PREDICTED: leucoanthocyanidin dioxygenase is...  72.8    1e-17   
ref|XP_001768518.1|  predicted protein                                69.7    1e-17   
gb|ABK24855.1|  unknown                                               72.8    1e-17   
dbj|BAQ20604.1|  gibberellin 3 oxidase 1                              65.5    1e-17   
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                         90.1    1e-17   
ref|XP_009382429.1|  PREDICTED: S-norcoclaurine synthase 1-like       70.9    1e-17   
ref|XP_010504468.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  70.1    1e-17   
ref|XP_002983980.1|  2-oxogluatarate-iron(II)-dependent oxygenase     64.7    1e-17   
gb|ABK26685.1|  unknown                                               73.9    1e-17   
ref|XP_006355573.1|  PREDICTED: protein SRG1-like                     64.3    1e-17   
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein    90.1    1e-17   
ref|XP_010543724.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  72.4    1e-17   
ref|XP_009765337.1|  PREDICTED: protein SRG1-like                     67.4    1e-17   
ref|XP_002533635.1|  Leucoanthocyanidin dioxygenase, putative         74.3    1e-17   
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  90.1    1e-17   
ref|XP_009128433.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2      89.7    1e-17   
ref|XP_008238358.1|  PREDICTED: S-norcoclaurine synthase 1-like       72.8    1e-17   
ref|XP_004506753.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   72.8    1e-17   
emb|CDX72185.1|  BnaC08g26890D                                        72.0    1e-17   
ref|XP_002964234.1|  oxidoreductase                                   65.5    1e-17   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2          68.2    1e-17   
emb|CDY37589.1|  BnaA02g19810D                                        89.7    1e-17   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2          67.4    1e-17   
ref|XP_007008952.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  71.2    1e-17   
ref|XP_007039569.1|  S-norcoclaurine synthase 1, putative             77.0    1e-17   
gb|KCW79671.1|  hypothetical protein EUGRSUZ_C01023                   59.3    2e-17   
ref|XP_010104366.1|  S-norcoclaurine synthase 1                       75.9    2e-17   
dbj|BAB91486.1|  flavanone-3-hydroxylase                              59.3    2e-17   
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                   89.7    2e-17   
ref|XP_006355571.1|  PREDICTED: protein SRG1-like                     66.6    2e-17   
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                    89.4    2e-17   
gb|KDO78008.1|  hypothetical protein CISIN_1g018099mg                 68.6    2e-17   
ref|XP_007141760.1|  hypothetical protein PHAVU_008G223500g           74.7    2e-17   
ref|XP_002878055.1|  oxidoreductase                                   70.1    2e-17   
ref|XP_007218194.1|  hypothetical protein PRUPE_ppa007719mg           77.0    2e-17   
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  89.4    2e-17   
gb|ABG46320.1|  gibberellin 3-oxidase 1                               89.7    2e-17   
ref|XP_006468196.1|  PREDICTED: protein SRG1-like                     68.6    2e-17   
ref|XP_010050489.1|  PREDICTED: protein SRG1-like                     59.3    2e-17   
gb|AAB64347.1|  gibberellin 2beta,3beta-hydroxylase                   61.2    2e-17   
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     68.9    2e-17   
ref|XP_011026002.1|  PREDICTED: hyoscyamine 6-dioxygenase-like        64.7    2e-17   
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  89.4    2e-17   
ref|XP_006355628.1|  PREDICTED: protein SRG1-like                     63.5    2e-17   
gb|KCW74258.1|  hypothetical protein EUGRSUZ_E02905                   67.0    2e-17   
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                     64.7    2e-17   
gb|AFN53719.1|  putative Fe(II) oxygenase superfamily protein         67.0    2e-17   
emb|CDP18107.1|  unnamed protein product                              61.2    2e-17   
ref|XP_002309144.1|  hypothetical protein POPTR_0006s10200g           72.0    2e-17   
ref|XP_007158816.1|  hypothetical protein PHAVU_002G184400g           64.7    2e-17   



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score =   109 bits (273),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV     +WV V PIP ALVVNV D+M I SNGQFKS  HRA+V++  +RIS+ +F+GP 
Sbjct  262  QVLLDGIRWVPVHPIPGALVVNVGDLMHILSNGQFKSAVHRAVVNEVHHRISMAYFYGPP  321

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
            +D+K S    L+     +Y  ++WKEY   K  HF KALEVI+T+ ++
Sbjct  322  MDVKIS---PLIDHNHPLYRPVTWKEYLEYKATHFDKALEVIRTDAEK  366


 Score = 89.4 bits (220),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +2

Query  89   ALFVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS---AFLHFNSYKK  259
            A F  A+  + Y++++ GLA+K+  L+  +LGL+ EDV WLK K+ S   A L  NSY  
Sbjct  174  ANFCGAM--EEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKNRSGPRALLQLNSYPV  231

Query  260  CPDPTRALGMVPHTDSSLITLLYQSN  337
            CPDPTRA+G+ PHTDSSL+TLL QS+
Sbjct  232  CPDPTRAIGLAPHTDSSLLTLLNQSS  257



>ref|XP_008337346.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Malus domestica]
Length=205

 Score =   108 bits (271),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV     +WV   PIP ALVVNV D+M I SNGQFKS  HRA+V++  +RIS+ +F+GP 
Sbjct  83   QVLVDGIRWVPAHPIPGALVVNVGDLMHILSNGQFKSAAHRAVVNEVHHRISMAYFYGPP  142

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQTN  668
            +D+K S    L+     +Y  ++WKEY   K  HF KALEVI+T+
Sbjct  143  MDVKIS---PLIDHNHPLYQPVTWKEYLDYKATHFXKALEVIRTD  184


 Score = 87.8 bits (216),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS---AFLHFNSYKKCPDPTRAL  283
            ++ Y++++ GLA+K+  L+  +LGL+ EDV WLK K++S     L  NSY  CPDPTRA+
Sbjct  1    MEEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKNSSRPQTVLQLNSYPVCPDPTRAM  60

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDSSL+TLL QS+
Sbjct  61   GLAPHTDSSLLTLLNQSS  78



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   115 bits (288),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    W+ V+PIP ALVVNV D+M I SNG+FK+  HRA+V++  +RISI +F+GP 
Sbjct  241  QVFQEGIGWMSVQPIPGALVVNVGDLMHILSNGRFKTTIHRAVVNELHHRISIAYFYGPP  300

Query  534  IDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQTN  668
             D+K S  +KL+ G+D   +Y  ++WKEY GIKG HF +ALE+I+ +
Sbjct  301  YDVKISPLMKLI-GQDHPPLYRPVTWKEYLGIKGTHFNRALELIRND  346


 Score = 72.8 bits (177),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS--KSTSAF---LHFNSYKKCPDPT  274
            +++ Y++++ GL+ K+  L+  +LGL +EDV WL    +S++ F   L  N Y  CPDPT
Sbjct  156  VMEEYQKKMKGLSGKLIRLMLGSLGLDKEDVKWLNRPKRSSTNFPQVLQLNYYPVCPDPT  215

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTD+S+ T+L Q +
Sbjct  216  RAMGLAPHTDTSVFTVLNQCD  236



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score = 97.8 bits (242),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    WV V P+ DALVVN+ D+M I SNG+FK  +H+A+V++  +RIS+ +F+GP 
Sbjct  244  QVFKEGIGWVPVSPVDDALVVNIGDLMHIISNGRFKCAQHQAVVNKTRHRISVAYFYGPP  303

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQTN  668
             D+K S  ++LV      +Y  ++WKEY   K ++F KAL+ I+ +
Sbjct  304  GDVKISPLMQLVDFDHPVLYCPVTWKEYLDAKAIYFDKALDFIKND  349


 Score = 82.4 bits (202),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +2

Query  125  KEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF----LHFNSYKKCPDPTRALGMV  292
            ++++ GL+ +I  ++FK+LGL+EEDV +L  K  S +    L  NSY KCPDP RA+G+ 
Sbjct  165  QKEMKGLSERIIGIMFKSLGLNEEDVKFLGLKDGSQYPQGALQLNSYPKCPDPDRAMGLA  224

Query  293  PHTDSSLITLLYQSNTNS  346
            PHTDSSLIT+L+Q   + 
Sbjct  225  PHTDSSLITVLHQGGVSG  242



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score =   103 bits (258),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W  V P   ALVVNV D+M I SNG FKSV HRAIV++  +RISI +F+GP 
Sbjct  229  QVLVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPP  288

Query  534  IDLKFSFPLKLV-KGRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
             D+K S  +KL+      +Y  ++WKEY G K  HF KALE+I+ +  E
Sbjct  289  WDVKISPLMKLIDHNHPPLYQPVTWKEYLGYKATHFNKALELIRNDGGE  337


 Score = 74.7 bits (182),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y+ ++ GLA K+  L+ ++LGL+ EDV WL+   +   L  NSY  CPDPTRA+G+
Sbjct  151  VMEEYQMEMKGLAAKLIELMLRSLGLNNEDVKWLRHPRS--LLQLNSYPVCPDPTRAMGL  208

Query  290  VPHTDSS  310
             PHTDSS
Sbjct  209  APHTDSS  215



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score = 93.2 bits (230),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    W+ V P+  ALVVN+ D+M I SNG+FK  +H+A+V++  +RIS+ +F+GP 
Sbjct  244  QVFKDGIGWMPVCPVDGALVVNIGDLMHIISNGRFKCAQHQAVVNKTHHRISVAYFYGPP  303

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQTND  671
             D+K S  ++LV      +Y  ++WKEY   K ++F KAL+ I++++
Sbjct  304  GDVKISPLMQLVDFDHPVLYRPVTWKEYLDAKTIYFDKALDFIKSDE  350


 Score = 85.1 bits (209),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF----LHFNSYKKCPDPTRA  280
            V  Y++++ GL+ +I  L+FK+LGL EEDV +L  K  S +    L  NSY KCPDP RA
Sbjct  161  VKAYQKEMKGLSERIIGLMFKSLGLIEEDVKFLGLKDESQYPQGALQLNSYPKCPDPDRA  220

Query  281  LGMVPHTDSSLITLLYQSNTNS  346
            +G+ PHTDSSLIT+L+Q   + 
Sbjct  221  MGLAPHTDSSLITVLHQDGVSG  242



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score =   103 bits (257),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W  V P   ALVVNV D+M I SNG FKSV HRAIV++  +RISI +F+GP 
Sbjct  228  QVLVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPP  287

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
             D+K S PL  +     +Y  ++WKEY G K  HF KALE+I+ +  E
Sbjct  288  WDVKIS-PLMKLTDHPPLYQPVTWKEYLGYKATHFNKALELIRNDGGE  334


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y++++ GLA K+  L+ ++LGL+ EDV WL    +   L  NSY  CPDPTRA+G+
Sbjct  150  VMEEYQKEMKGLAAKLIELMLRSLGLNNEDVKWLTHPQS--LLQLNSYPVCPDPTRAMGL  207

Query  290  VPHTDSS  310
             PHTDSS
Sbjct  208  APHTDSS  214



>ref|XP_002892873.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69132.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 97.4 bits (241),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = +3

Query  342  TVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFF  521
            T   QVF  +  WV V P+P +LVVNV D+  I SNG FKSV HRA V+Q   R+S+ F 
Sbjct  246  TAGLQVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFL  305

Query  522  FGPKIDLKFSFPLKLVKGRD-SMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
            +GP+ D+K S   KLV   +  +Y  ++W EY   K  HF KAL +I+ + +E
Sbjct  306  WGPQSDIKISPVPKLVSPVELPLYRSVTWTEYLRTKATHFNKALSMIRNHREE  358


 Score = 77.8 bits (190),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L  K+LG+SEEDV+W    S      A L  N Y  CP+P R
Sbjct  166  IVEEYEEQMKKLASKLMWLALKSLGVSEEDVEWASLNSDLNWAQAALQLNHYPVCPEPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+L Q+NT
Sbjct  226  AMGLAAHTDSTLLTILCQNNT  246



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 94.0 bits (232),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+  ALV+N+ D++ I SNG++++V HRAIV+++  R+S+ + +GP 
Sbjct  246  QVLREGAGWLTVPPVAGALVINIGDLIHILSNGEYQNVLHRAIVNRSQQRLSVAYLYGPP  305

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
            I+++ S   KLV     S+Y  ++WKEY GIKG  + KAL  I+ +D +
Sbjct  306  INVQISPHSKLVTPSHPSLYRPVTWKEYLGIKGKLYNKALSSIKFHDHQ  354


 Score = 78.6 bits (192),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+ ++  LA ++  LIF +LG+S+EDV W   K      S  L  NSY  CPDP+R
Sbjct  162  MVEEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGGFEDASNALQLNSYPACPDPSR  221

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+  HTDS+L+T+++QSN
Sbjct  222  AMGLAEHTDSTLLTIIHQSN  241



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score = 92.0 bits (227),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+  ALV+N+ D++ I SNG++++V HRAIV+++  R+S+ + +GP 
Sbjct  246  QVLREGAGWLTVPPVAGALVINIGDLIHILSNGEYQNVFHRAIVNRSQQRLSVAYLYGPP  305

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDDE  677
            I+++ S   KLV     S+Y  ++WKEY GI+G  + KAL  I+ +D +
Sbjct  306  INVQISPHSKLVTPSHPSLYRPVTWKEYLGIEGKLYNKALSSIKFHDHQ  354


 Score = 78.2 bits (191),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+ ++  LA ++  LIF +LG+S+EDV W   K      S  L  NSY  CPDP+R
Sbjct  162  MVEEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGDFEDASNALQLNSYPACPDPSR  221

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+  HTDS+L+T+++QSN
Sbjct  222  AMGLAEHTDSTLLTIIHQSN  241



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score = 84.0 bits (206),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF     W  ++P+P ALV+NV D+M I SNG + SV HR +V +A +RIS+ + +GP 
Sbjct  249  QVFREGTGWFTIQPVPGALVINVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPP  308

Query  534  IDLKFSFPLKLVKGRDS-MY-PLISWKEYRGIKGVHFGKALEVIQTND  671
              +K +   KLV   +S +Y P+ +W EY   K    GKAL  ++  D
Sbjct  309  AAVKIAPLAKLVGPSNSPLYPPVTNWNEYISTKAKLKGKALPSLRLYD  356


 Score = 79.3 bits (194),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK----STSAFLHFNSYKKCPDPTR  277
            + + ++ ++  LA ++  L+  +LG+S++DV+W   K    + SA   FNSY  CPDP R
Sbjct  165  ITEEFEREIKRLASRLVWLMLASLGISKDDVEWDGPKGDDQNASAVFQFNSYPSCPDPDR  224

Query  278  ALGMVPHTDSSLITLLYQSNTN  343
             LG+VPHTDSSL+++++QSN +
Sbjct  225  TLGLVPHTDSSLVSIVHQSNID  246



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score = 82.8 bits (203),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    WV V+P+P A+ VN+ D+  I SNG F +V+HR +V+    R+S  +F+ P 
Sbjct  241  QVFKEGAGWVLVQPVPGAITVNLGDIFHILSNGVFTTVRHR-VVATPIRRLSFAYFYAPP  299

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQT  665
             D   S  L    G    Y  +S KEY GIKG HF KAL VIQ 
Sbjct  300  GDFIVSPVLSKDFGEVPRYQTLSVKEYVGIKGKHFEKALSVIQN  343


 Score = 79.0 bits (193),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLK-SKSTSAFLHFNSYKKCPDPTRALGMVP  295
            +Y+ QL  L  ++  +IFK+L ++ E+V WLK ++  S  L  N Y  CPDPTRA+G+ P
Sbjct  163  HYRSQLKALTEQLIRIIFKSLNINPEEVAWLKDTEGLSIGLQLNCYPPCPDPTRAMGIAP  222

Query  296  HTDSSLITLLYQSNTNS  346
            HTD+SLIT+L QS  + 
Sbjct  223  HTDTSLITILQQSKVSG  239



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 13/150 (9%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT T  ++L Y  +    +Q V+ PN  WVDVKPI DA+VVN+ D+MQI SNG+FKSV H
Sbjct  217  HTDTSLVTLLYQTSNIRGLQ-VYGPNLNWVDVKPISDAIVVNLGDLMQIISNGRFKSVLH  275

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRD-SMYPLISWKEYRGIKGVHFGKAL  650
            RAIVS+A  RIS+ +FFG   +++ S  LKL+KG +  MY  ISW EY  IK  +F K+L
Sbjct  276  RAIVSEAHNRISVGYFFGSSKNVEISPSLKLIKGSEFPMYKPISWNEYLDIKNKYFNKSL  335

Query  651  EVIQTND-----------DEAPRGSRV*AF  707
            E+I  N            DEAP GS V A 
Sbjct  336  EMIGFNSDVEKSNALASGDEAPLGSEVEAI  365


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 5/85 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSE-EDVDWLK----SKSTSAFLHFNSYKKCPDPT  274
            ++D+Y+E++ GLA KI +L+FK+LGLS  EDV+W +    S ST A+L  N Y KCPDPT
Sbjct  150  VIDDYQEKMRGLAEKIAALMFKSLGLSPGEDVEWFEPNGLSNSTQAYLQMNWYPKCPDPT  209

Query  275  RALGMVPHTDSSLITLLYQSNTNSG  349
            RA+G+  HTD+SL+TLLYQ++   G
Sbjct  210  RAMGLAQHTDTSLVTLLYQTSNIRG  234



>ref|XP_007135716.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
 gb|ESW07710.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
Length=374

 Score = 84.3 bits (207),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +  + WV + P+   LV+N+ D++ I SNG + SV HR  V+++  R S+ + +GP 
Sbjct  249  QVLKDGEGWVALPPLAGGLVINIGDLLHILSNGLYPSVLHRVRVNRSRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++ S   KLV  GR S++  ++W EY G K  HF KAL  ++
Sbjct  309  TNVEISPNEKLVGPGRPSLFQSVTWNEYLGKKAKHFNKALSAVR  352


 Score = 76.6 bits (187),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y+  +  LA K+  L+  +LG+S+ED+ W   +       A LH NSY  CPDP R
Sbjct  165  IVKEYEAAMKKLAAKLMCLVLASLGISKEDIKWAGPRGEFNGACAALHLNSYPSCPDPDR  224

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+Q+N + 
Sbjct  225  AMGLAAHTDSTLLTILHQNNVSG  247



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score = 84.3 bits (207),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V P+P ALVV V D+  I SNG+FKSV HR +V+++  R+S  +F GP   +  S 
Sbjct  248  RWVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSAAYFCGPPAGVTVSP  307

Query  555  PLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
              KLV  GR   Y  ++W EY G+K   F KAL  I+
Sbjct  308  IEKLVGPGRAPAYRAVTWAEYLGLKRELFDKALATIE  344


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPTR  277
            ++ Y  ++  LA ++  L+  +LGLS+E+V+W           +  L  NSY  CPDP R
Sbjct  152  IERYDREMKALAGRLIRLMLLSLGLSDEEVEWAGQGGELPPDLAGVLRLNSYPACPDPDR  211

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+GM  H DSSL+T+LYQS+T+ 
Sbjct  212  AMGMAAHADSSLVTILYQSSTSG  234



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score = 82.4 bits (202),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    WV V+P+P A+ VN+ D   I SNG F +V+HR + ++   R+S  +F+ P 
Sbjct  241  QVFKEGAGWVLVQPVPGAITVNLGDFFHILSNGVFTTVRHRVVATRIR-RLSFAYFYAPP  299

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQT  665
             D   S  L    G    Y  +S KEY GIKG HF KAL VIQ 
Sbjct  300  GDFIVSPVLSKDFGEVPRYQTLSVKEYVGIKGKHFEKALSVIQN  343


 Score = 78.6 bits (192),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLK-SKSTSAFLHFNSYKKCPDPTRALGMVP  295
            +Y+ QL  L  ++  +IFK+L ++ ++V WLK S+  S  L  N Y  CPDPTRA+G+ P
Sbjct  163  HYRSQLKALTEQLIRIIFKSLNINPDEVAWLKESQGLSIGLQLNCYPPCPDPTRAMGIAP  222

Query  296  HTDSSLITLLYQSNTNS  346
            HTD+SLIT+L QS  + 
Sbjct  223  HTDTSLITVLQQSKVSG  239



>ref|XP_003533057.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=375

 Score = 82.8 bits (203),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +  + WV V P+P  LV+NV D++ I SNG + SV HR  V++   R S+ + +GP 
Sbjct  250  QVLKEGEGWVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPP  309

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++ S  +KLV   R  +Y  ++W EY G K   F KAL  ++
Sbjct  310  TNVQISPQVKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVR  353


 Score = 77.0 bits (188),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y+  +  LA K+  L+  +LG+ +ED+ W   K       A LH+NSY  CPDP R
Sbjct  166  IVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKWAGPKGEFNGACAALHWNSYPSCPDPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+Q+N N 
Sbjct  226  AMGLAAHTDSTLLTILHQNNVNG  248



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score = 87.0 bits (214),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V P+P ALVV V D+  I SNG+FKSV HR +V+++  R+S+ +F GP   ++ S 
Sbjct  249  RWVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSVAYFSGPPAGVRVSP  308

Query  555  PLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQTNDD  674
              KLV  GR   Y  ++W EY G+K   F KAL  I+  ++
Sbjct  309  IGKLVGPGRAPAYRAVTWAEYLGLKRKLFDKALATIEMPEE  349


 Score = 72.4 bits (176),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +++ Y + +  LA ++ +L+  +LGL  E+++W           +  L  NSY  CPDP 
Sbjct  152  VIERYDQVMKALAGRLITLMLLSLGLRHEELEWAGQTGKLLPDLAGVLRLNSYPACPDPD  211

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+GM  H DSSL+T+LYQS+T+ 
Sbjct  212  RAMGMAAHADSSLLTILYQSSTSG  235



>gb|KHN47796.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=375

 Score = 82.4 bits (202),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +  + WV V P+P  LV+NV D++ I SNG + SV HR  V++   R S+ + +GP 
Sbjct  250  QVLKEGEGWVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPP  309

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++ S  +KLV   R  +Y  ++W EY G K   F KAL  ++
Sbjct  310  TNVQISPQVKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVR  353


 Score = 77.0 bits (188),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y+  +  LA K+  L+  +LG+ +ED+ W   K       A LH+NSY  CPDP R
Sbjct  166  IVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKWAGPKGEFNGACAALHWNSYPSCPDPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+Q+N N 
Sbjct  226  AMGLAAHTDSTLLTILHQNNVNG  248



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score = 88.2 bits (217),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F+    WV VKP+P  LVVNV D++ I SNG+ +S  H+A+V++   R SI + +GP 
Sbjct  226  QMFKEGTGWVLVKPVPGLLVVNVGDLLHILSNGKLRSSLHQALVNKNKSRFSIAYLWGPS  285

Query  534  IDLKFSFPLKLVKGRD-SMYPLISWKEYRGIKGVHFGKALEVIQTN  668
             D+  S   KLV   + +MY  ++WKEY  +K  HF KAL +I+ +
Sbjct  286  GDIDISPISKLVSPIEPAMYRPVTWKEYLEMKARHFDKALSMIKAS  331


 Score = 71.2 bits (173),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ Y+E++  LA K+  LI  ++G++EED+ W         S S  +  N Y  CP+P 
Sbjct  141  IIEEYEEEMQKLAGKLMGLILGSIGVTEEDIKWTGPNNSGLGSGSGAIRLNHYPVCPEPD  200

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            +A+G+  HTDS+++T+L+Q+N 
Sbjct  201  QAMGLAAHTDSTMVTILHQNNA  222



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score = 80.5 bits (197),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 4/109 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF     W  ++P+P ALVVNV D+M I SNG + SV HR +V +A +RIS+ + +GP 
Sbjct  249  QVFREGTGWFTIQPVPGALVVNVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPP  308

Query  534  IDLKFSFPLKLVKG--RDSMY-PLISWKEYRGIKGVHFGKALEVIQTND  671
              +K + PL+ + G     +Y P+ +W EY   K    GKAL  ++  D
Sbjct  309  AAVKIA-PLEKLFGPSHPPLYPPVTNWNEYISTKAKLKGKALPSLRLYD  356


 Score = 78.6 bits (192),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK----STSAFLHFNSYKKCPDPTR  277
            + + +++++  LA ++  L+  +LG+S++DV+W   K    + SA   FNSY  CPDP R
Sbjct  165  ITEEFEKEIKKLASRLMWLMLASLGISKDDVEWDGPKGDDQNASAVFQFNSYPSCPDPDR  224

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
             LG+VPHTDSSL+++++QSN + 
Sbjct  225  TLGLVPHTDSSLVSIVHQSNIDG  247



>gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Erythranthe guttata]
Length=380

 Score = 90.1 bits (222),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +3

Query  348  VQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFG  527
            +Q + E   +WV V+P P ALVV+V D+M I SNG + SV HRA+V++  +R+S+ + +G
Sbjct  255  LQVLREGGNRWVTVEPHPGALVVHVGDLMHILSNGSYPSVLHRAVVNRTRHRLSVAYLYG  314

Query  528  PKIDLKFSFPLKLVKGRD-SMYPLISWKEYRGIKGVHFGKALEVIQ  662
            P   +K S   KLV   +  MY  ++W EY G K  HF KAL  ++
Sbjct  315  PPPGVKISPLSKLVDQYNPPMYRPVTWSEYLGTKAKHFDKALTSVR  360


 Score = 68.6 bits (166),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLS--EEDVDWLKSKSTS-------AFLHFNSYKKCP  265
            +++Y++++  LA ++  L+  +LG++  EE+V W   K  S       A L  NSY  CP
Sbjct  168  IEDYEKEMKKLAGRLMWLMLGSLGITKEEEEVKWADPKEESESGSGCAAALQMNSYPACP  227

Query  266  DPTRALGMVPHTDSSLITLLYQSN  337
            DP RA+G+  HTDS+++T+L+QSN
Sbjct  228  DPDRAMGLAAHTDSTILTVLHQSN  251



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score = 85.1 bits (209),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            WV VKPI  ALVVN+ D++QI SNG + SV HRA+V++  +R+S+ + +GP  +++ +  
Sbjct  243  WVTVKPIAGALVVNIGDLIQILSNGLYSSVLHRAMVNRTQHRLSVAYLYGPPSNVRIAPL  302

Query  558  LKLVKG-RDSMYPLISWKEYRGIKGVHFGKAL  650
             KL       +Y  ++W EY G K  HF KAL
Sbjct  303  SKLTDNVHPPLYRPVTWSEYLGTKAKHFNKAL  334


 Score = 72.8 bits (177),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS----KSTSAFLHFNSYKKCPDPTR  277
            +++ Y +++  L+ ++  LI  +LG+ + D+ W       K   A L  NSY  CPDP R
Sbjct  152  VIEEYNKEMNKLSNRVMWLILGSLGIKKGDIKWANQEGEIKEACAALQLNSYPSCPDPDR  211

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+QSNT+ 
Sbjct  212  AMGLAAHTDSTLLTILHQSNTSG  234



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score = 85.5 bits (210),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+ DALVVNV DM+ I SNG + SV HRA+ ++ + R+SI +F+G  
Sbjct  247  QVLREGTGWVTVPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATRKN-RLSIAYFYGLP  305

Query  534  IDLKFSFPLKLVKG--RDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             DL+ S PL+ + G  +  +Y  ISW EY  +K  HF KAL  ++
Sbjct  306  SDLQIS-PLENLVGPSQPPLYRSISWSEYLRMKAKHFNKALSFVR  349


 Score = 70.5 bits (171),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWL----KSKSTSAFLHFNSYKKCPDPTR  277
            +V+ YK+++  LA ++  LI ++LG + ED+ W       K   + L+FN Y  CPDP R
Sbjct  163  VVEEYKKEMKKLAERLMCLILRSLGTTREDIKWAGLNGDFKDHPSPLNFNYYPACPDPDR  222

Query  278  ALGMVPHTDSSLITLLYQSNTNSG  349
            A+G+  HTDSSL T+L Q N+ SG
Sbjct  223  AMGLAAHTDSSLFTILCQ-NSVSG  245



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score = 88.2 bits (217),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F     W+ V P+ DALVVNV D++ I SNG+F SV H+ IVS+  +RIS+ +F+GP+
Sbjct  244  QIFRDGVGWIAVAPVRDALVVNVGDLLHILSNGRFPSVYHQVIVSEKEHRISVAYFYGPR  303

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             D + + PL  ++    +Y  +S KE+ GIK  H  KAL  ++
Sbjct  304  TDAQVA-PLSRIEV--PIYRSLSVKEFIGIKAKHLDKALSFVR  343


 Score = 67.4 bits (163),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKS--KSTSAFLHFNSYKKCPDPTRA  280
            ++D Y++++  LA +I  L+ K+L +SEED+  W  S   S +  L  NSY  CP+P+RA
Sbjct  160  VIDVYQKKMKELAHQILLLLLKSLEISEEDITSWAASTHDSNNGALQLNSYPCCPNPSRA  219

Query  281  LGMVPHTDSSLITLLYQSNTNSG  349
            +G+ PHTDS L+T+L Q++ +S 
Sbjct  220  IGLAPHTDSLLLTILSQTHDSSA  242



>ref|XP_003529820.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN01362.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=378

 Score = 79.7 bits (195),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +  + WV V P+   LV+NV D++ I SNG + SV HR  V++   R S+ + +GP 
Sbjct  248  QVLKEGEGWVAVPPLHGGLVINVGDLLHILSNGLYPSVLHRVRVNRTQQRFSVAYLYGPP  307

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++ S  +KLV   R ++Y  ++W EY G K   F KAL  ++
Sbjct  308  ANVQISPHVKLVGPTRPALYRPVTWNEYLGTKANLFNKALSAVR  351


 Score = 75.9 bits (185),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y+  +  LA K+  L+  +LG+++ED  W   K       A LH NSY  CPDP R
Sbjct  164  IVVEYEAAMKKLAAKLMCLMLASLGITKEDTKWAGPKGEFNGACAALHLNSYPSCPDPDR  223

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+Q+N N 
Sbjct  224  AMGLAAHTDSTLLTILHQNNVNG  246



>ref|XP_003527798.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN16493.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=347

 Score = 77.8 bits (190),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            L++NY++Q+  LA ++T ++F  + +SEE   W+ + + S  +  N Y  CP+P RA+G+
Sbjct  168  LMENYEKQMKVLAERLTQMMFSLMDISEEKTKWVGASNISGAVQLNFYPSCPEPNRAMGL  227

Query  290  VPHTDSSLITLLYQS  334
             PHTD+SL T+L+QS
Sbjct  228  APHTDTSLFTILHQS  242


 Score = 77.8 bits (190),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F+  K+WV V P P+ LVV+  D++ I SN +F+S  HR  V+    R S+ +F+ P 
Sbjct  248  QIFKEGKEWVPVHPHPNTLVVHTGDLLHIISNARFRSALHRVTVNSTRERYSVAYFYSPP  307

Query  534  IDLKFSFPL--KLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQT  665
            +D   S PL   + + RD     ++ KEY GIK  +FG+AL +I T
Sbjct  308  LDYVVS-PLVDSVARFRD-----VTVKEYIGIKAKNFGEALSLIST  347



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score = 81.3 bits (199),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDW--LKSKSTSAFLHFNSYKKCPDPTRAL  283
            ++++Y++++  L+ ++ ++I K LG+SE DVDW  L+S + +A L  NSY +CPDP +A+
Sbjct  165  VMEDYQDKMKALSERLLAMILKYLGMSEHDVDWPRLRSNACTA-LQLNSYPRCPDPRQAM  223

Query  284  GMVPHTDSSLITLLYQSNTNSG  349
            G+ PHTD+ L+T+L+Q+++  G
Sbjct  224  GLAPHTDTFLLTILHQNHSAHG  245


 Score = 73.2 bits (178),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV    + WV V P+  ALVVNV DM+ I SN  F SV HRAI S+ ++R+++ +F+GP 
Sbjct  247  QVHREGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRAIPSENTHRLTVGYFYGPP  306

Query  534  IDLKFS--FPLKLVKGRD--SMYPLISWKEYRGIKGVHFGKALEVIQ  662
             D        L    GR+  + +  ++ K+Y  +K  +  KAL +I+
Sbjct  307  TDFHVGPIHRLTQASGREDAAQFRSVTVKDYIQMKAKNLDKALSMIR  353



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score = 80.9 bits (198),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDW--LKSKSTSAFLHFNSYKKCPDPTRAL  283
            ++++Y++++  L+ ++ ++I K LG+SE DVDW  L+S + +A L  NSY +CPDP +A+
Sbjct  165  VMEDYQDKMKALSERLLAMILKYLGISEHDVDWPRLRSNACTA-LQLNSYPRCPDPRQAM  223

Query  284  GMVPHTDSSLITLLYQSNTNSG  349
            G+ PHTD+ L+T+L+Q+++  G
Sbjct  224  GLAPHTDTFLLTILHQNHSAHG  245


 Score = 71.2 bits (173),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV    + WV V P+  ALVVNV DM+ I SN  F SV HR I S+ ++R+++ +F+GP 
Sbjct  247  QVHMEGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPP  306

Query  534  IDLKFS--FPLKLVKGRD--SMYPLISWKEYRGIKGVHFGKALEVIQ  662
             D        L    GR+  + +  I+ K+Y  +K  +  KAL +I+
Sbjct  307  TDFHVGPIHELTQASGREDAARFRSITVKDYVQMKAENLEKALSMIR  353



>ref|XP_004290878.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 75.9 bits (185),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST---SAFLHFNSYKKCPDPTRAL  283
            +D Y++Q+  LA ++  ++FK L +S+E+VDW    +    SAF   NSY  CPDPT+AL
Sbjct  156  MDEYQKQVKALAEQLIRIVFKFLSISQEEVDWFDDPTNMCPSAF-QLNSYPPCPDPTQAL  214

Query  284  GMVPHTDSSLITLLY  328
            G+ PHTD SL T+L+
Sbjct  215  GLPPHTDGSLFTILH  229


 Score = 75.1 bits (183),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    W+ V+P P+A +VN+ D++ I SNG+F SV HRA V Q  +RIS  +F+ P 
Sbjct  236  QVFKEGVGWITVQPNPEAFIVNLGDVLHIMSNGRFVSVLHRAAVIQKDHRISAAYFYWPP  295

Query  534  IDLKFSFPLKLVKGRDS----MYPLISWKEYRGIKGVHFGKALEVIQ  662
            +D   S P+      DS     Y  ++ KEY  IK  H    L VI+
Sbjct  296  MDFTIS-PILSKNSADSEQVPKYRSVTLKEYHVIKTKHCQDTLSVIR  341



>ref|XP_003522638.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN08099.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=341

 Score = 77.4 bits (189),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            L++NY++Q+  LA ++T +IF  + +SEE   W+ + + S  +  N Y  CP+P RA+G+
Sbjct  162  LMENYEKQMKVLADRLTEMIFNLMDISEEKRKWVGASNISEAVQLNFYPSCPEPNRAMGL  221

Query  290  VPHTDSSLITLLYQSN  337
             PHTD+SL T+L+QS 
Sbjct  222  APHTDTSLFTILHQSQ  237


 Score = 73.6 bits (179),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 61/106 (58%), Gaps = 8/106 (8%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F+  K WV V P P+ LVV+  D++ I SN +F+   HR  V++   R S+ +F+ P 
Sbjct  242  QIFKEGKGWVPVHPHPNTLVVHTGDLLHIISNARFRCALHRVTVNRTWERYSVAYFYSPP  301

Query  534  IDLKFSFPL--KLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQT  665
            +D   S PL   + + RD     ++ KEY GIK  +FG+AL  I T
Sbjct  302  MDYVVS-PLVHSVARFRD-----VTVKEYIGIKAKNFGEALSFIST  341



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 83.2 bits (204),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 66/108 (61%), Gaps = 5/108 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V P+P ALVVNV D+  I SNG+F+SV HRAIV++   RIS+ +F+GP    K + 
Sbjct  250  RWVTVPPLPGALVVNVGDLSHILSNGRFQSVTHRAIVNRTQTRISVAYFYGPPAHFKIA-  308

Query  555  PLKLVKG--RDSMYPLISWKEYRGIKGVHFGKALEVIQ--TNDDEAPR  686
            P++ + G  +   Y  ++W EY  +K   + +AL  I+  T  +E  R
Sbjct  309  PIEKLMGPQQGPAYRAVTWPEYLTLKRRLYNQALASIRLPTEGEEESR  356


 Score = 67.0 bits (162),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 6/84 (7%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWL------KSKSTSAFLHFNSYKKCPDPT  274
            ++ Y   +  L  ++  L+  +LGLSE ++DW         ++ +  +  NSY  CPDP 
Sbjct  153  IEEYTSWMKPLGCRLMLLMLASLGLSEGEIDWAVPSNDTTHEAPAPVIQLNSYPACPDPD  212

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+G+  HTDSSL T+LYQ +   
Sbjct  213  RAMGLAEHTDSSLFTVLYQGSVRG  236



>emb|CDY38660.1| BnaC02g23190D [Brassica napus]
Length=351

 Score = 81.3 bits (199),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFF-GP  530
            QVF+    WV V+PIP  LVVN+ D+  I SNG+F SV HRA V+Q   RISI + + GP
Sbjct  241  QVFKEESGWVTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNQTKSRISIAYLWGGP  300

Query  531  KIDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQ  662
              D+K S P+  + G     +Y  ++W EY  IK   F KAL+ I+
Sbjct  301  AGDVKIS-PISKIVGPVGPYLYRPVTWSEYLRIKFEVFDKALDAIR  345


 Score = 68.9 bits (167),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLK------SKSTSAFLHFNSYKKCPDP  271
            +++ YK ++  LA ++ S I  +LG++ +D++W +      SK     +  N Y  CP+P
Sbjct  155  IIEEYKGEMENLANRLLSCILGSLGVTVDDIEWAQKTEKSGSKMGRGVIRLNHYPVCPEP  214

Query  272  TRALGMVPHTDSSLITLLYQSN  337
             RA+G+  HTDS L+T+L+QSN
Sbjct  215  ERAMGLAAHTDSCLLTILHQSN  236



>ref|XP_008231797.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=356

 Score = 79.0 bits (193),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    W  V P+P A+VVNV D+M I SNG + SV HR +V+Q   R+S+ + +GP 
Sbjct  245  QVFQEGTGWFTVPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQQRLSVVYTYGPP  304

Query  534  IDLKFS-FPLKLVKGRDSMY-PLISWKEYRGIKGVHFGKALEVIQ  662
             ++  S  P  L     ++Y P+ +W EY   K    GKAL  ++
Sbjct  305  DNVPISPIPKLLSASHPALYPPVTNWSEYIDTKTKLKGKALASLR  349


 Score = 71.2 bits (173),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS---TSAFLHFNSYKKCPDPTRA  280
            + + Y ++L  L+ ++  ++  +LG+S+EDV W   K     +  L  NSY  CPDP R 
Sbjct  162  ITEEYDKELGRLSSRLMWIMLASLGISKEDVKWSGPKGDNHEAHVLQLNSYPACPDPDRV  221

Query  281  LGMVPHTDSSLITLLYQS  334
            +G+VPHTDS+L+T+++QS
Sbjct  222  MGLVPHTDSTLVTIVHQS  239



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score = 82.0 bits (201),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS-AFLHFNSYKKCPDPTRALG  286
            ++++Y++++  L+ ++ ++I K LG+SE D+DW + +S + A L  NSY +CPDP +A+G
Sbjct  165  VMEDYQDKMKALSERLLAMILKYLGISEHDIDWPRLRSNACAALQLNSYPRCPDPRQAMG  224

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PHTD+ L+T+L+Q+++  G
Sbjct  225  LAPHTDTFLLTILHQNHSAHG  245


 Score = 67.8 bits (164),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV    + WV V P+  ALVVN+ DM+ I SN  F SV HR I S+  +R+++ +F+GP 
Sbjct  247  QVHMEGRGWVPVFPMNGALVVNLGDMLHIMSNAMFPSVVHRVIPSEKRHRLTVGYFYGPP  306

Query  534  IDLKFS--FPLKLVKGRD--SMYPLISWKEYRGIKGVHFGKALEVIQ  662
             D        L    GR+  + +  ++ K+Y  +K  +  KAL +I+
Sbjct  307  TDFHVGPIHGLTQSSGREDAARFRSVTVKDYVQMKAKNLDKALSMIR  353



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score = 76.6 bits (187),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R SI + +GP 
Sbjct  249  QVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSIAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KLV   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHTKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYVR  352


 Score = 72.0 bits (175),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y+E +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  165  IVLQYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKACAAMQLNSYPSCPDPDR  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLAPHTDSTFLTILSQND  244



>ref|XP_009128435.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Brassica rapa]
Length=351

 Score = 77.4 bits (189),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFF-GP  530
            QVF+    WV V+PIP  LVVN+ D+  I SNG+F SV HRA V++   RISI + + GP
Sbjct  241  QVFKEESGWVTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGP  300

Query  531  KIDLKFSFPLKLVKG--RDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
              +++ S P+  + G     +Y  ++W EY  IK   F KAL+ I+
Sbjct  301  AGEVEIS-PISKIVGPVGPCLYRPVTWSEYLRIKFEVFDKALDAIR  345


 Score = 70.5 bits (171),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLK------SKSTSAFLHFNSYKKCPDP  271
            +++ YK ++  LA ++ S I  +LG++ +D++W K      SK   + +  N Y  CP+P
Sbjct  155  IIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKMGQSVIRLNHYPVCPEP  214

Query  272  TRALGMVPHTDSSLITLLYQSN  337
             RA+G+  HTDS L+T+L+QSN
Sbjct  215  ERAMGLAAHTDSCLLTILHQSN  236



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score = 75.9 bits (185),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  249  QVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KLV   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHTKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYVR  352


 Score = 71.6 bits (174),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST----SAFLHFNSYKKCPDPTR  277
            +V  Y+E +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  165  IVLQYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKGCAAIQLNSYPSCPDPDR  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLAPHTDSTFLTILSQND  244



>ref|XP_007221040.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
 gb|EMJ22239.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
Length=356

 Score = 78.2 bits (191),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF+    W  V P+P A+VVNV D+M I SNG + SV HR +V+Q   R+S+ + +GP 
Sbjct  245  QVFQEGTGWFTVPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQPRLSVVYTYGPP  304

Query  534  IDLKFS-FPLKLVKGRDSMY-PLISWKEYRGIKGVHFGKALEVIQ  662
             ++  S  P  L     ++Y P+ +W EY   K    GKAL  ++
Sbjct  305  DNVPISPIPKLLSASHPALYPPVTNWSEYIDTKTKLKGKALASLR  349


 Score = 68.9 bits (167),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS---TSAFLHFNSYKKCPDPTRA  280
            + + Y ++L  L  ++  ++  +LG+S+EDV W   K     +  L  NSY  CPDP RA
Sbjct  162  ITEEYDKELGRLCSRLMWIMLASLGISKEDVKWSGPKGDNQEAHVLQLNSYPACPDPDRA  221

Query  281  LGMVPHTDSSLITLLYQS  334
            +G+V HTDS+L+T+++QS
Sbjct  222  MGLVAHTDSTLVTIVHQS  239



>emb|CDY37588.1| BnaA02g19820D [Brassica napus]
Length=351

 Score = 76.6 bits (187),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 63/105 (60%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFF-GP  530
            QVF+    WV V+PIP  LVVN+ D+  I SNG+F SV HRA V++   RISI + + GP
Sbjct  241  QVFKEESGWVTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGP  300

Query  531  KIDLKFSFPLKLVKG--RDSMYPLISWKEYRGIKGVHFGKALEVI  659
              +++ S P+  + G     +Y  ++W EY  IK   F KAL+ I
Sbjct  301  AGEVEIS-PISKIVGPVGPCLYRPVTWSEYLRIKFEVFDKALDAI  344


 Score = 70.1 bits (170),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLK------SKSTSAFLHFNSYKKCPDP  271
            +++ YK ++  LA ++ S I  +LG++ +D++W K      SK   + +  N Y  CP+P
Sbjct  155  IIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKMGQSVIRLNHYPVCPEP  214

Query  272  TRALGMVPHTDSSLITLLYQSN  337
             RA+G+  HTDS L+T+L+QSN
Sbjct  215  ERAMGLAAHTDSCLLTILHQSN  236



>sp|O24648.1|G3OX_PEA RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; AltName: Full=Gibberellin 3 beta-hydroxylase 
1 [Pisum sativum]
 gb|AAB65829.1| 2-oxoglutarate-dependent dioxygenase [Pisum sativum]
 gb|AAC49792.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 77.0 bits (188),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  249  QVNREGSGWITVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KL+   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSVR  352


 Score = 68.6 bits (166),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA  +  L+  +LG+++ED+ W  SK+      A L  NSY  CPDP  
Sbjct  165  IVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDH  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLAPHTDSTFLTILSQND  244



>gb|AAC86820.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
 gb|AAC49793.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 77.0 bits (188),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  249  QVNREGSGWITVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KL+   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSVR  352


 Score = 68.6 bits (166),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA  +  L+  +LG+++ED+ W  SK+      A L  NSY  CPDP  
Sbjct  165  IVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDH  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLTPHTDSTFLTILSQND  244



>sp|Q3I410.1|G3O22_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-2; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-2; AltName: Full=Gibberellin 
3-oxidase 2-2 [Triticum aestivum]
 gb|AAZ94378.1| gibberellin 3-oxidase 2-2 [Triticum aestivum]
Length=370

 Score = 82.0 bits (201),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (62%), Gaps = 5/107 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV D+ QI +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIKGVHF---GKALEV--IQTNDDEA  680
              + + G  + Y  ++W EY G++   F     AL++  I T++D A
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVRKKAFTTGASALKMVAISTDNDAA  361


 Score = 63.5 bits (153),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>dbj|BAJ65443.1| gibberellin 3-oxidase [Torenia fournieri]
Length=184

 Score = 73.2 bits (178),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y++++  LA ++  L+  +LG++++DV W K+  ++  L  NSY  CPDP RA+G+
Sbjct  23   VIEEYEKEMEKLAGRLMWLMLGSLGITKDDVKWAKAGCSA--LQLNSYPACPDPDRAMGL  80

Query  290  VPHTDSSLITLLYQSNTNS  346
              HTDS++ T+L+Q+NT+ 
Sbjct  81   AAHTDSTIFTILHQNNTSG  99


 Score = 72.4 bits (176),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF     WV V P+  ALV+NV D++ I SNG ++SV HRA+V++  +R+S  + +GP 
Sbjct  101  QVFREGNGWVTVPPLTGALVINVGDLLHILSNGLYQSVLHRAVVNRTRHRLSAAYLYGPP  160

Query  534  IDLKFSFPLKLV-KGRDSMY  590
              +K S   KLV +G   MY
Sbjct  161  SGVKISPLSKLVDQGHPPMY  180



>gb|AAC96017.1| defective gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96015.1| gibberellin 3B-hydroxylase [Pisum sativum]
Length=374

 Score = 76.3 bits (186),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  249  QVNREGSGWITVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KL+   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSVR  352


 Score = 68.6 bits (166),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA  +  L+  +LG+++ED+ W  SK+      A L  NSY  CPDP  
Sbjct  165  IVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDH  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLAPHTDSTFLTILSQND  244



>gb|AAC49794.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 76.3 bits (186),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  249  QVNREGSGWITVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  308

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             +++     KL+   +  +Y  ++W EY G K  HF KAL  ++
Sbjct  309  SNVEICPHAKLIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSVR  352


 Score = 68.6 bits (166),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA  +  L+  +LG+++ED+ W  SK+      A L  NSY  CPDP  
Sbjct  165  IVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPSCPDPDH  224

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  225  AMGLAPHTDSTFLTILSQND  244



>sp|Q3I409.1|G3O23_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-3; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-3; AltName: Full=Gibberellin 
3-oxidase 2-3 [Triticum aestivum]
 gb|AAZ94379.1| gibberellin 3-oxidase 2-3 [Triticum aestivum]
Length=369

 Score = 80.9 bits (198),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV D+ QI +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRESDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIK  626
              + + G  + Y  ++W EY G++
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVR  338


 Score = 63.9 bits (154),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>ref|XP_006366661.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 81.6 bits (200),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + N+ W  + P+  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  243  QILKKNQVWTSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  302

Query  531  KIDLKFSFPLKLVKGRDSM-----YPLISWKEYRGIKGVHFGKALEVIQ  662
            ++D   S  + LV   D++     Y  +  KEY  +K  H  K   +I+
Sbjct  303  QVD---SMIVPLVSSEDNVGAIPKYRNVKVKEYLDLKAKHLEKVFSMIR  348


 Score = 63.2 bits (152),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++++  L+ ++  LI   L  S+E    +KS  ++  L  NSY  CP+P  ALG+
Sbjct  164  VMENYQKKMKALSFQLWLLILNYLQPSQEHS--IKSFESTGALQLNSYPCCPNPNHALGL  221

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  222  APHTDSLFLTILHQTNNTKG  241



>emb|CDM81908.1| unnamed protein product [Triticum aestivum]
Length=369

 Score = 80.9 bits (198),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV D+ QI +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRESDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIK  626
              + + G  + Y  ++W EY G++
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVR  338


 Score = 63.5 bits (153),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score = 76.6 bits (187),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  252  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  311

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVI  659
             +++     KLV   +  +Y  ++W EY G K  HF KAL  +
Sbjct  312  SNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSV  354


 Score = 67.8 bits (164),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  171  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  230

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  231  LAPHTDSTFLTILSQND  247



>gb|AAT49061.1| GA 3-oxidase 2 [Hordeum vulgare subsp. vulgare]
 dbj|BAD51997.1| gibberellin 3beta-hydroxylase [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 82.0 bits (201),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 3/105 (3%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV D+  I +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGDLFHILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIKGVHF---GKALEVIQTNDDEA  680
              + + G  + Y  ++W EY G++   F     AL+++  + D+A
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVRKKAFTTGASALKMVAISTDDA  359


 Score = 62.0 bits (149),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRVLADKLLELFLVALGLTGEQVAAVESEHKIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>sp|Q3I411.1|G3O21_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-1; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-1; AltName: Full=Gibberellin 
3-oxidase 2-1 [Triticum aestivum]
 gb|AAZ94377.1| gibberellin 3-oxidase 2-1 [Triticum aestivum]
Length=370

 Score = 80.5 bits (197),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV D+ QI +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIK  626
              + + G  + Y  ++W EY G++
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVR  338


 Score = 63.5 bits (153),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEHKIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 75.9 bits (185),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  252  QVQGEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  311

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVI  659
             +++     KLV   +  +Y  ++W EY G K  HF KAL  +
Sbjct  312  SNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSV  354


 Score = 67.8 bits (164),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  171  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  230

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  231  LAPHTDSTFLTILSQND  247



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 75.9 bits (185),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  252  QVQGEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  311

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVI  659
             +++     KLV   +  +Y  ++W EY G K  HF KAL  +
Sbjct  312  SNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSV  354


 Score = 67.8 bits (164),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  171  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  230

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  231  LAPHTDSTFLTILSQND  247



>ref|XP_006361220.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 80.9 bits (198),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + ++ W  + P+  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  243  QILKKDQGWTSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  302

Query  531  KIDLKFSFPLKLVKGRDSM-----YPLISWKEYRGIKGVHFGKALEVIQ  662
            ++D   S  + LV  +D++     Y  +  KEY  +K  H  K   +I+
Sbjct  303  QVD---SMIVPLVSSKDNVGVVPKYRNVKVKEYLDLKAKHLEKVFSMIR  348


 Score = 62.0 bits (149),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++++  L+ ++  LI   L  S+E    +KS  +   L  NSY  CP+P  ALG+
Sbjct  164  VMENYQKKIKALSFQLWLLILNYLQPSQEHS--IKSFESRRALQLNSYPCCPNPNHALGL  221

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  222  APHTDSLFLTILHQTNNTKG  241



>emb|CAX46400.1| putative GA3OX protein [Rosa lucieae]
Length=240

 Score = 71.2 bits (173),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y++++  LA K+  LI  +LG+ +EDV W   K      S  +  NSY  CPDP R
Sbjct  71   MVEEYEKEMKRLAGKLMWLILGSLGIPKEDVIWAGPKGDFEDASNAVQLNSYPACPDPNR  130

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+++++Q+N + 
Sbjct  131  AMGLAEHTDSTLLSIIHQTNISG  153


 Score = 71.2 bits (173),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      W+ V P+P ALVVN+ D+  I SNG + +V HRAIV+++  R+SI + +GP 
Sbjct  155  QVLHEGAGWLTVPPVPGALVVNIGDLTHILSNGVYHNVLHRAIVNRSQQRLSIAYLYGPP  214

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWK  608
              ++ S   KLV      +Y  I+WK
Sbjct  215  ASVQISPQSKLVTPSHPPLYRPITWK  240



>ref|XP_007137070.1| hypothetical protein PHAVU_009G097200g [Phaseolus vulgaris]
 gb|ESW09064.1| hypothetical protein PHAVU_009G097200g [Phaseolus vulgaris]
Length=344

 Score = 74.3 bits (181),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 0/110 (0%)
 Frame = +3

Query  336  TPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISIT  515
            TP+   Q+F+  K W+ V+P P+AL+V+  D + I SNG+F S  HR ++++   R S+ 
Sbjct  235  TPSSGLQIFKEGKGWIPVQPHPEALIVHTGDFLHIMSNGRFCSPVHRVMLNENRKRYSMA  294

Query  516  FFFGPKIDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQT  665
            +F+ P ID   S  +       + +  ++ KEY GIK   F  +L  I T
Sbjct  295  YFYSPPIDYVVSPSVTKDLNSAARFREVTVKEYIGIKAQKFADSLSFIST  344


 Score = 67.8 bits (164),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++NY++++  +A ++T ++   L +SEE   W+ +  TS  L  N Y  CP+P RA+G+ 
Sbjct  163  MENYEKKMQIIAKRLTEMMCDVLKISEEKRKWIGASDTSGALQLNFYPSCPEPNRAMGLA  222

Query  293  PHTDSSLITLL  325
            PHTD+S+ T++
Sbjct  223  PHTDTSMFTIV  233



>ref|XP_006338004.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 84.3 bits (207),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + ++ W  + P+  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  243  QILKKDQGWTSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  302

Query  531  KIDLKFSFPLKLVKGRDSM---YPLISWKEYRGIKGVHFGKALEVIQ  662
            ++D   S PL   K  D +   Y  +  KEY G+K  H  K   +I+
Sbjct  303  QVDSMIS-PLVSSKDNDGVVLKYRNVKVKEYLGLKAKHLEKVFSMIR  348


 Score = 57.4 bits (137),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++++  L+ ++   I   L  S+ D   + S   +  L  NSY  CP+P  ALG+
Sbjct  163  VMENYQKKMKVLSFQLCLFILNYLQPSQ-DQHSINSFEFAGALQLNSYPCCPNPNHALGL  221

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  222  APHTDSLFLTILHQTNNTKG  241



>gb|ABV64512.1| gibberellin 3-beta-hydroxylase [Dasypyrum villosum]
Length=368

 Score = 78.2 bits (191),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A+VVNV  + QI +NG+F SV HRA+V++ S RIS+ +F GP   +K + 
Sbjct  255  RWVTVPAVPGAMVVNVGGLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKVAP  314

Query  555  PLKLVKGRDSMYPLISWKEYRGIK  626
              + + G  + Y  ++W EY G++
Sbjct  315  LREALAGTPAAYRAVTWPEYMGVR  338


 Score = 63.2 bits (152),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L   ALGL+ E V  ++S+     + +A +H N Y KCPDP 
Sbjct  162  VMEEFHREMRALADKLLELFLVALGLTVEQVAAVESEQQIAETMTATMHLNWYPKCPDPK  221

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  222  RALGLIAHTDSGFFTFVLQS  241



>emb|CAH69705.1| gibberellin 3-oxidase [Phaseolus coccineus]
Length=340

 Score = 74.3 bits (181),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (57%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  TPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISIT  515
            +P+   Q+++  K W+ V+P P+AL+V++ D+  I SNG+F S  HR  +S+   R SI 
Sbjct  231  SPSTGLQLYKEEKGWISVQPHPEALIVHLGDLAHIISNGRFCSPLHRVTLSETCKRYSIA  290

Query  516  FFFGPKIDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
            +F+ P ID   S  +       + +  ++ KEY  IK  HFG ++  ++
Sbjct  291  YFYSPPIDHVLSPFVTEDDKSAAQFRPVTVKEYIAIKAQHFGNSISFVK  339


 Score = 66.6 bits (161),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            +++Y++++  LA ++T ++F  L +SEE   W+ ++     +  N Y  CP+P R +G+ 
Sbjct  159  MEDYEKKMKILAERVTEILFDLLNVSEEKRKWVDAEDKGTAIQLNFYPSCPEPNRTMGLA  218

Query  293  PHTDSSLITLLYQSNTN  343
            PHTD+S+IT++   +T 
Sbjct  219  PHTDTSIITIVQSPSTG  235



>ref|XP_003597810.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 ref|XP_003597814.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 gb|AES68061.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=371

 Score = 73.9 bits (180),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  246  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  305

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVI  659
             +++     KLV   +  +Y  ++W EY G K  +F KAL  +
Sbjct  306  SNVEICPHEKLVGPTQPPLYRSVTWNEYLGTKAKYFNKALSSV  348


 Score = 66.6 bits (161),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  165  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  224

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  225  LAPHTDSTFLTILSQND  241



>ref|XP_006389781.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
 gb|ESQ27067.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
Length=351

 Score = 77.0 bits (188),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFF-GP  530
            QVF     WV V+P+P ALVVN+ D+  I SNG+  SV HRA V+    RISI + + GP
Sbjct  241  QVFREECGWVTVEPVPGALVVNIGDLFHILSNGKIPSVIHRARVNHNRSRISIAYLWGGP  300

Query  531  KIDLKFSFPLKLVKG--RDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
              D++   P+  + G    S+Y  I+W EY  IK   F KAL+ I+
Sbjct  301  AGDVEIR-PISKIVGPVGPSLYRPITWNEYLRIKYQVFDKALDAIR  345


 Score = 63.5 bits (153),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWL------KSKSTSAFLHFNSYKKCPDP  271
            +++ Y+ ++  LA ++   I  +LG++ +D++W        SK     +  N Y  CP+P
Sbjct  155  IIEEYEGEMEKLASRLLCCILGSLGVTVDDIEWAYKAKNSGSKVGRRAIRLNHYPVCPEP  214

Query  272  TRALGMVPHTDSSLITLLYQSN  337
             RA+G+  HTDS+++T+L+QSN
Sbjct  215  ERAIGLAAHTDSTILTILHQSN  236



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score = 80.1 bits (196),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+      W+ V P+  ALVVNV D++ I SNG++ SV HRA+V+QA +RIS+ +F+GP 
Sbjct  248  QILRDGVGWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPP  307

Query  534  IDLKFSFPLKLVKGRDSM----YPLISWKEYRGIKGVHFGKALEVIQ  662
             D   S    LV     +    Y  +S KEY  +K  H  KAL +++
Sbjct  308  ADSLISPLCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLLR  354


 Score = 60.5 bits (145),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVD----WLKSKSTSAFLHFNSYKKCPDPTR  277
            ++++Y++++  LA  +  +  ++L +S+E+          K+ +  L  NSY  CPDP R
Sbjct  164  VMEDYQKKMKELAESLLHIFLESLDISKEEYRSTTIQRGHKACNTALQLNSYPPCPDPNR  223

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS L T+++QS+T+ 
Sbjct  224  AMGLAPHTDSLLFTIVHQSHTSG  246



>ref|XP_008461418.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=353

 Score = 73.9 bits (180),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV    K WV V+P+ DALVV V DM+ I +NG +    H+A+V+Q   R+S  FFFG  
Sbjct  230  QVLIEGKGWVTVEPVKDALVVQVGDMLHILTNGLYSPSVHQAVVNQTHDRMSTAFFFGTP  289

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             + + S   KLV   R  MYP ++W +Y   K   F + L  I+
Sbjct  290  KNTEVSPLKKLVTPTRPLMYPTVTWADYLSKKYELFEETLPSIR  333


 Score = 65.9 bits (159),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS----KSTSAFLHFNSYKKCPDPTR  277
            L + Y +++  L  K+  L    LG++ ED++W  S    K+++  L  NSY  CP+P  
Sbjct  147  LAEEYLKEMKNLCGKVMWLTLGELGITPEDINWAGSDGEFKTSNQALRMNSYPVCPEPDE  206

Query  278  ALGMVPHTDSSLITLLYQS  334
            ++G+ PH+DSS++T+LYQ+
Sbjct  207  SIGLPPHSDSSVLTVLYQT  225



>ref|XP_002282411.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI20992.3| unnamed protein product [Vitis vinifera]
Length=355

 Score = 80.1 bits (196),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+      W+ V P+  ALVVNV D++ I SNG++ SV HRA+V+QA +RIS+ +F+GP 
Sbjct  248  QILRDGVGWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPP  307

Query  534  IDLKFSFPLKLVKGRDSM----YPLISWKEYRGIKGVHFGKALEVIQ  662
             D   S    LV     +    Y  +S KEY  +K  H  KAL +++
Sbjct  308  ADSLISPLCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLLR  354


 Score = 58.9 bits (141),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVD----WLKSKSTSAFLHFNSYKKCPDPTR  277
            ++++Y++++  LA  +  +  ++L +S+E+          ++ +  L  NSY  CPDP R
Sbjct  164  VMEDYQKKMKELAESLLHIFLESLDISKEEYRSTTIQRGREACNTALQLNSYPPCPDPNR  223

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS L T+++QS+T+ 
Sbjct  224  AMGLAPHTDSLLFTIVHQSHTSG  246



>ref|XP_004253252.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score = 78.2 bits (191),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + +  W  + P+  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  243  QILKKDLGWTSITPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  302

Query  531  KIDLKFSFPLKLVKGRDSM-----YPLISWKEYRGIKGVHFGKALEVIQ  662
            ++D   S  + LV  +D++     Y  +  KEY  +K  H  K   +I+
Sbjct  303  QVD---SVIVPLVSSKDNVGVVPKYRNVKVKEYIDLKAKHMEKVFSMIR  348


 Score = 60.5 bits (145),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++ +Y++++  L+ ++  LI   L  S+E    +KS  ++  L  NSY  CP+P  ALG+
Sbjct  164  VMGDYQKKMKALSFQLWMLILNYLQPSQEHS--IKSFESTGALQLNSYPCCPNPNHALGL  221

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  222  APHTDSLFLTILHQTNNTKG  241



>ref|XP_004968405.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-2-like [Setaria italica]
Length=382

 Score = 73.9 bits (180),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  366  PNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLK  545
            PN+ WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP    K
Sbjct  254  PNR-WVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDLDRISLGYFLGPPPHAK  312

Query  546  FSFPLKLV--KGRDSMYPLISWKEYRGIK  626
             + PL+ V   GR   Y  ++W EY G++
Sbjct  313  VA-PLREVVPPGRAPAYRAVTWPEYMGVR  340


 Score = 63.5 bits (153),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E V  ++++     + +A +H N Y +CPDP 
Sbjct  163  VMEEFHKEMRALADRLLELFLRALGLTGEQVGAVEAERRIGETMTATMHLNWYPRCPDPR  222

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  223  RALGLIAHTDSGFFTFVLQS  242



>ref|XP_004229097.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=348

 Score = 81.6 bits (200),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (61%), Gaps = 5/107 (5%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + ++ W  + P+  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  242  QILKKDQGWTSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  301

Query  531  KIDLKFSFPLKLVKGRDSM---YPLISWKEYRGIKGVHFGKALEVIQ  662
            +++   S PL   +  D +   Y  ++ KEY G+K  H  K   +I+
Sbjct  302  QVESIIS-PLVSSQDNDGVVLKYRNVTVKEYLGLKAKHLEKVFSMIR  347


 Score = 55.8 bits (133),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY+ ++  L+ ++   I   L  S E    + S      L  NSY  CP+P  ALG+
Sbjct  163  VMENYQTKMKVLSFQLCMFILNYLQPSHEHS--INSFEFEGALQLNSYPCCPNPYHALGL  220

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  221  APHTDSLFLTILHQTNNTKG  240



>ref|XP_006355748.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 75.9 bits (185),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 60/107 (56%), Gaps = 4/107 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + ++ W  + PI  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  242  QILKKDQGWTSIAPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  301

Query  531  KIDLKFSFPLKLVKGRDSMYP---LISWKEYRGIKGVHFGKALEVIQ  662
            ++D      +   K    + P    +  KEY  +K  H  K   +I+
Sbjct  302  QVDSTIVPLVSFEKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLIR  348


 Score = 60.8 bits (146),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++++  L+ ++  LI   L  S+E +  + S   +  L  NSY  CP+P  ALG+
Sbjct  163  VMENYQKKMKALSFQLWLLILNYLQPSQEHL--INSFEFTQALQLNSYPCCPNPNHALGL  220

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  221  APHTDSLFLTILHQTNNTKG  240



>ref|XP_002455082.1| hypothetical protein SORBIDRAFT_03g004020 [Sorghum bicolor]
 gb|EES00202.1| hypothetical protein SORBIDRAFT_03g004020 [Sorghum bicolor]
Length=389

 Score = 73.2 bits (178),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +3

Query  372  KKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS  551
             +WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP    K +
Sbjct  257  DRWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDLDRISLGYFLGPPPHAKVA  316

Query  552  FPLK--LVKGRDSMYPLISWKEYRGIK  626
             PL+  +  GR   Y  ++W EY G++
Sbjct  317  -PLREAVPPGRTPAYRAVTWPEYMGVR  342


 Score = 63.5 bits (153),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + + +  LA K+  L   ALGL++E V  ++++     + +A +H N Y +CPDP 
Sbjct  165  VMEEFHKHMRALADKLLELFLMALGLTDEQVGGVEAERRIAETMTATMHLNWYPRCPDPR  224

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  225  RALGLIAHTDSGFFTFVLQS  244



>ref|XP_004240225.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score = 77.0 bits (188),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 4/108 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIP-DALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            Q+ + +++W  + PI  DAL+VNV D++ I SNG+F SV HR +V Q  +R+S+ +FFGP
Sbjct  242  QILKKDQEWTSITPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGP  301

Query  531  KIDLKFSFPLKLVKGRDSMYP---LISWKEYRGIKGVHFGKALEVIQT  665
            ++D      +   K    + P    +  KEY  +K  H  K   +I++
Sbjct  302  QVDSTIVPLVSFDKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLIRS  349


 Score = 59.7 bits (143),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++++  L+ ++   I   L  S+E +  + S   +  L  NSY  CP+P  ALG+
Sbjct  163  VMENYQKKMKALSFQLWLFILNYLQPSQEHL--INSFEFTQALQLNSYPCCPNPNHALGL  220

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PHTDS  +T+L+Q+N   G
Sbjct  221  APHTDSLFLTILHQTNNTKG  240



>ref|XP_010112080.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC32577.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=404

 Score = 72.8 bits (177),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 27/122 (22%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            WV V+P+  ALVVNV D++ I SNG+F SV HRA+V+Q   R+S  +F+GP  D   S  
Sbjct  281  WVPVRPVAGALVVNVGDLLHIMSNGRFPSVVHRAVVNQTRQRLSFAYFYGPPTDFTVSPL  340

Query  558  LK------LVKGRDS---------------------MYPLISWKEYRGIKGVHFGKALEV  656
            L       ++   D                      +Y  ++ KEY GIK  +  KAL +
Sbjct  341  LSDHNNMMIINKSDHHHNLMISSSTARGQRPLDVLPLYRSVTVKEYVGIKAKNLDKALSL  400

Query  657  IQ  662
            I+
Sbjct  401  IR  402


 Score = 63.2 bits (152),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 21/101 (21%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEED----VDWLK-----------------SKST  226
            +++ Y++Q+  LA K+   I K+L +  ++    ++WL                  S + 
Sbjct  162  VMETYQKQMKTLAEKLLPTILKSLNIHNQEQQVLLNWLSTNTSSSSTSKSKENTITSTTP  221

Query  227  SAFLHFNSYKKCPDPTRALGMVPHTDSSLITLLYQSNTNSG  349
               L  NSY  CPDP RA+G+ PHTD+ L+T+L+Q+ T++G
Sbjct  222  CTALQLNSYPSCPDPNRAMGLAPHTDTFLLTILHQTQTDAG  262



>dbj|BAK06541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 76.6 bits (187),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 69/117 (59%), Gaps = 14/117 (12%)
 Frame = +3

Query  366  PNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLK  545
            P  +WV+V  +P AL+VN+ D+ QI +NG+F+SV HR +V++   RIS+ +F  P  D+K
Sbjct  253  PADRWVEVPAVPGALIVNIGDLFQILTNGRFRSVYHRVVVNRERERISVAYFLIPPADVK  312

Query  546  FSFPLK-LVKGRDSMYPLISWKEYRGIK---------GVHFGK---ALEVIQTNDDE  677
             + PLK +V G   +Y  ++W E   ++          + FGK   AL+++  + DE
Sbjct  313  VA-PLKEVVGGGKPVYRALTWSESIVVRKEAFANHGADLEFGKGRTALDMLSISSDE  368


 Score = 59.3 bits (142),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L   ALGL+ E +  ++++     S +  +H N Y KCPDPT
Sbjct  161  VMEEFLKEMRSLANRLMELFLVALGLTAEQIAGVEAEHNLTESMTETMHLNWYPKCPDPT  220

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RALG+  HTDS   T + Q+  
Sbjct  221  RALGLKGHTDSGFFTFVMQNQV  242



>gb|AAT49060.1| GA 3-oxidase 1 [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 75.5 bits (184),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 14/117 (12%)
 Frame = +3

Query  366  PNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLK  545
            P  +WV+V  +P AL+VN+ D+ QI +NG+F+SV HR +V++   RIS+ +F  P  D+K
Sbjct  257  PVDRWVEVPAVPGALIVNIGDLFQILTNGRFRSVYHRVVVNRERERISVAYFLIPPADVK  316

Query  546  FSFPLK-LVKGRDSMYPLISWKEYRGIK---------GVHFGK---ALEVIQTNDDE  677
             + PLK +V G    Y  ++W E   ++          + FGK   AL+++  + DE
Sbjct  317  VA-PLKEVVGGGKPAYRALTWSESIVVRKEAFANHGADLEFGKGRTALDMLSISSDE  372


 Score = 60.5 bits (145),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L   ALGL+ E +  ++++     S +  +H N Y KCPDPT
Sbjct  165  VMEEFLKEMRSLANRLMELFLVALGLTAEQIAGVEAEHNLTESMTETMHLNWYPKCPDPT  224

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RALG+  HTDS   T + QS  
Sbjct  225  RALGLKGHTDSGFFTFVLQSQV  246



>dbj|BAB17075.1| GA 3beta-hydroxylase [Oryza sativa Japonica Group]
 dbj|BAB62155.1| GA 3beta-hydroxylase [Oryza sativa Japonica Group]
 dbj|BAF03047.1| GA 3beta-hydroxylase [Oryza sativa Japonica Group]
 gb|EAZ10757.1| hypothetical protein OsJ_00594 [Oryza sativa Japonica Group]
Length=373

 Score = 75.1 bits (183),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS-  551
            +WV V  +  A VVNV D+  I +NG+F SV HRA+V++   R+S+ +F GP  D + + 
Sbjct  253  RWVAVPAVAGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAP  312

Query  552  FPLKLVKGRDSMYPLISWKEYRGIKGVHF---GKALEVIQT  665
             P  +  GR   Y  ++W EY  ++   F   G AL+++ T
Sbjct  313  LPEAVPAGRSPAYRAVTWPEYMAVRKKAFATGGSALKMVST  353


 Score = 60.5 bits (145),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E+V  ++++       +A +H N Y +CP+P 
Sbjct  160  VMEEFHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPR  219

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  220  RALGLIAHTDSGFFTFVLQS  239



>dbj|BAB62072.1| GA 3beta-hydroxylase [Oryza sativa (indica cultivar-group)]
 gb|EAY72759.1| hypothetical protein OsI_00624 [Oryza sativa Indica Group]
Length=373

 Score = 75.1 bits (183),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS-  551
            +WV V  +  A VVNV D+  I +NG+F SV HRA+V++   R+S+ +F GP  D + + 
Sbjct  253  RWVAVPAVAGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAP  312

Query  552  FPLKLVKGRDSMYPLISWKEYRGIKGVHF---GKALEVIQT  665
             P  +  GR   Y  ++W EY  ++   F   G AL+++ T
Sbjct  313  LPEAVPAGRSPAYRAVTWPEYMAVRKKAFATGGSALKMVST  353


 Score = 60.5 bits (145),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E+V  ++++       +A +H N Y +CP+P 
Sbjct  160  VMEEFHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPR  219

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  220  RALGLIAHTDSGFFTFVLQS  239



>ref|NP_001042186.1| Os01g0177400 [Oryza sativa Japonica Group]
 dbj|BAB62154.1| GA 3beta-hydroxylase [Oryza sativa]
 dbj|BAF04100.1| Os01g0177400 [Oryza sativa Japonica Group]
Length=370

 Score = 75.1 bits (183),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS-  551
            +WV V  +  A VVNV D+  I +NG+F SV HRA+V++   R+S+ +F GP  D + + 
Sbjct  250  RWVAVPAVAGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAP  309

Query  552  FPLKLVKGRDSMYPLISWKEYRGIKGVHF---GKALEVIQT  665
             P  +  GR   Y  ++W EY  ++   F   G AL+++ T
Sbjct  310  LPEAVPAGRSPAYRAVTWPEYMAVRKKAFATGGSALKMVST  350


 Score = 60.5 bits (145),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E+V  ++++       +A +H N Y +CP+P 
Sbjct  157  VMEEFHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPR  216

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  217  RALGLIAHTDSGFFTFVLQS  236



>gb|ACL54258.1| unknown [Zea mays]
 gb|AFW77314.1| hypothetical protein ZEAMMB73_624467 [Zea mays]
Length=380

 Score = 80.1 bits (196),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V + D+ Q+ +NG+F+S  HRA+VS+   RIS+ +F  P  D+  + 
Sbjct  266  RWVTVPAPPGALIVMLGDLFQVLTNGRFRSPIHRAVVSRERERISVPYFLCPPEDMTVA-  324

Query  555  PL--KLVKGRDSMYPLISWKEYRGIKGVHFGK---ALEVIQTNDDEAPRGSRV  698
            PL   L+ GR +++  ++W EY  +K   FG    ALE++Q   DE  +G R 
Sbjct  325  PLASALLPGRKAVFRAVTWPEYMEVKHKVFGTDAPALEMLQLQVDEEEQGERA  377


 Score = 55.5 bits (132),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 50/97 (52%), Gaps = 9/97 (9%)
 Frame = +2

Query  65   NDDVYIIAALFVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST------  226
             DD      +   + +++ Y  ++  L  ++  L F ALGL+  DV +   ++       
Sbjct  158  GDDYLRFWCMRAPSDVMEEYDREMRALGGRLLDLFFMALGLT--DVQFATGETERRIRET  215

Query  227  -SAFLHFNSYKKCPDPTRALGMVPHTDSSLITLLYQS  334
             +A +H   Y +CP+P RA+G+  HTDS  ITL+ QS
Sbjct  216  WTATMHPILYPRCPEPERAIGLTAHTDSGFITLIMQS  252



>ref|XP_008647746.1| PREDICTED: GA 3-oxidase 2 isoform X1 [Zea mays]
 gb|ACF84235.1| unknown [Zea mays]
 gb|AFW77315.1| hypothetical protein ZEAMMB73_624467 [Zea mays]
Length=374

 Score = 80.1 bits (196),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V + D+ Q+ +NG+F+S  HRA+VS+   RIS+ +F  P  D+  + 
Sbjct  260  RWVTVPAPPGALIVMLGDLFQVLTNGRFRSPIHRAVVSRERERISVPYFLCPPEDMTVA-  318

Query  555  PL--KLVKGRDSMYPLISWKEYRGIKGVHFGK---ALEVIQTNDDEAPRGSRV  698
            PL   L+ GR +++  ++W EY  +K   FG    ALE++Q   DE  +G R 
Sbjct  319  PLASALLPGRKAVFRAVTWPEYMEVKHKVFGTDAPALEMLQLQVDEEEQGERA  371


 Score = 55.1 bits (131),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 9/82 (11%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-------SAFLHFNSYKKCPD  268
            +++ Y  ++  L  ++  L F ALGL+  DV +   ++        +A +H   Y +CP+
Sbjct  167  VMEEYDREMRALGGRLLDLFFMALGLT--DVQFATGETERRIRETWTATMHPILYPRCPE  224

Query  269  PTRALGMVPHTDSSLITLLYQS  334
            P RA+G+  HTDS  ITL+ QS
Sbjct  225  PERAIGLTAHTDSGFITLIMQS  246



>emb|CDP19027.1| unnamed protein product [Coffea canephora]
Length=348

 Score = 75.1 bits (183),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 3/102 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F     WV V PI  ALVVN+ ++M I SNG+F S++HR  V+Q  +RIS+ +F  P 
Sbjct  247  QIFHDGIGWVTVSPIEGALVVNLGNLMDILSNGKFPSIQHRVFVNQIRHRISVAYFCFPP  306

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVI  659
             D + +      K    +Y  ++ KE+  I+  H   AL VI
Sbjct  307  TDSQVA---PFAKSECPIYSSLTVKEFLQIRAKHMEDALSVI  345


 Score = 59.7 bits (143),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++NY++ +  LA ++  L+ K L +SE++++W  S S  A L  NS+  CPDP   +G+
Sbjct  169  VMENYQKMMKSLAHQLLLLMLKWLEVSEDELNWKLSMSQDA-LQLNSFPACPDPKSTIGL  227

Query  290  VPHTDSSLITLLYQSN  337
             PHTDS L+T+L+QS+
Sbjct  228  APHTDSMLMTVLHQSH  243



>ref|NP_001266453.1| GA 3-oxidase 1 [Zea mays]
 gb|AFS50158.1| GA 3-oxidase 1 [Zea mays]
 gb|AFS50159.1| GA 3-oxidase 1 [Zea mays]
 tpg|DAA53193.1| TPA: hypothetical protein ZEAMMB73_823410 [Zea mays]
Length=382

 Score = 72.4 bits (176),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP    K + 
Sbjct  257  RWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDLDRISLGYFLGPPPHAKVA-  315

Query  555  PLK--LVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
            PL+  +  GR   Y  ++W EY G++   F      ++
Sbjct  316  PLREAVPPGRAPAYRAVTWPEYMGVRKKAFTTGASALK  353


 Score = 61.6 bits (148),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + + +  LA K+  L   ALGL++E    ++++     + +A +H N Y +CPDP 
Sbjct  164  VMEEFHKHMRALADKLLELFLMALGLTDEQASAVEAERRIAETMTATMHLNWYPRCPDPR  223

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  224  RALGLIAHTDSGFFTFVMQS  243



>dbj|BAB12439.1| gibberellin 3b-hydroxylase No3 [Lactuca sativa]
Length=345

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            ++F     W  V PI  A VVNV D++ IFSN +F  V HRA+V+Q+ +RIS+ +F+GP 
Sbjct  245  EIFVEGLGWSPVCPIEGAFVVNVGDLLHIFSNAKFPVVYHRAVVNQSKHRISVAYFYGPP  304

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
            I+   +    L   +D  +  +  KEY  +K  H  KAL +I+
Sbjct  305  IESTLA---PLSNYQDPCFRSLLVKEYIRLKATHNDKALSLIR  344


 Score = 57.0 bits (136),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS-KSTSAFLHFNSYKKCPDPTRALGM  289
            +D+Y+ Q+  LA K+  L  + L +++E+++W  S   ++  L  NSY  CP+P+R LG+
Sbjct  165  MDDYQNQMKLLAHKLLLLSLQTLDVTQEEINWATSTHGSNGALQLNSYPSCPNPSRTLGL  224

Query  290  VPHTDSSLITLLYQ  331
             PHTDS L+T+L Q
Sbjct  225  APHTDSLLLTILNQ  238



>ref|XP_004291422.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=353

 Score = 68.2 bits (165),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 61/109 (56%), Gaps = 7/109 (6%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F  +  W+ V+P+  AL VN+ D + I SNG+F +V HR +V+    R S  +F+GP 
Sbjct  247  QIFRDDVGWISVQPVRGALTVNIGDFLHILSNGRFVNVLHRVVVNSIQ-RFSAAYFYGPP  305

Query  534  IDLKFSFPL---KLVKGRDSM--YPLISWKEYRGIKGVHFGKALEVIQT  665
             D   S PL    L    +++  Y  ++ KE+ G+K  H  + L +++T
Sbjct  306  SDFLIS-PLLSETLCDSEEAVARYRSVTAKEFIGMKAKHLDRTLSLLKT  353


 Score = 65.1 bits (157),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS--------AFLHFNSYKKCPD  268
            +D Y++Q+  L  ++  +I K+L +S + + WLKS+ +           L  NSY  CP+
Sbjct  161  MDEYQKQMKALIEQLIHIILKSLNISSQKLSWLKSQCSGHCTSTTPGTALQLNSYPPCPN  220

Query  269  PTRALGMVPHTDSSLITLLYQSNTN  343
            P RA+G+  HTD+SL+T+L Q+ T+
Sbjct  221  PNRAMGLAQHTDTSLVTIL-QAQTS  244



>gb|ADK71017.1| gibberellin 3-beta-hydroxylase [Trigonella gladiata]
Length=301

 Score = 73.6 bits (179),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+ SL+  +LG+++ED+ W  SK+      SA L  NSY  CPDP 
Sbjct  134  IVLQYDETMKKLAGKLMSLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSCPDPD  193

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
             A+G+ PHTDS+ +T+L Q++ + 
Sbjct  194  HAMGLAPHTDSTFLTILSQNDISG  217


 Score = 59.3 bits (142),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HRA+V++   R S+ + +GP 
Sbjct  219  QVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPHAKLV  290



>ref|XP_003569638.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-2-like [Brachypodium 
distachyon]
Length=385

 Score = 71.6 bits (174),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 4/99 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V++ S+R+S+ +F GP    +   
Sbjct  260  RWVAVPAVPGAFVVNVGDLFSILTNGRFHSVFHRAVVNKESHRVSLGYFLGPPAQTRVG-  318

Query  555  PLK--LVKGR-DSMYPLISWKEYRGIKGVHFGKALEVIQ  662
            PL+  L   R   MY  ++W EY  ++   F      +Q
Sbjct  319  PLEEALTPARPKPMYRPVTWPEYMTVRKKAFATGDSALQ  357


 Score = 61.2 bits (147),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS-----KSTSAFLHFNSYKKCPDPT  274
            +++ +  ++  LA K+  L  +ALGL+ ++   +++     ++ +A  H N Y +CPDP 
Sbjct  167  VMEEFHREMRLLADKLLGLFLRALGLTADEALAVEATHRIAETMTATTHLNWYPRCPDPK  226

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RALG++PHTDS   T + QS  
Sbjct  227  RALGLIPHTDSGYFTFVLQSQV  248



>ref|XP_010476647.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Camelina sativa]
 gb|ADE80896.1| GA3ox1-like protein [Camelina sativa]
Length=358

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  W+ V P+P +LVVNV D+  I SNG FKSV H
Sbjct  232  HTDSTLLTILYQNNTAGL--QVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFKSVLH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV   +S +Y  ++W+EY   K  HF KAL
Sbjct  290  RARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPLESPLYRSVTWREYLQTKATHFNKAL  349

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  350  SMIRNHREE  358


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+E++  LA K+  L   +LG++EEDV+W +  S      A L  N Y  CP+P R
Sbjct  166  IVEEYEERMKKLASKLMWLALNSLGVTEEDVEWARLTSDLSWAQAALQLNHYPVCPEPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+LYQ+NT
Sbjct  226  AMGLAAHTDSTLLTILYQNNT  246



>ref|XP_006305164.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
 gb|EOA38062.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
Length=362

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  236  HTDSTLLTILYQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLH  293

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV   D+ +Y  ++W EY   K  HF KAL
Sbjct  294  RARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPVDTPLYRSVTWTEYLQTKATHFNKAL  353

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  354  SMIRNHKEE  362


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS----AFLHFNSYKKCPDPTR  277
            +V+ Y+E++  LA K+  L   +LG+SEEDV W    S S    A L  N Y  CP P R
Sbjct  170  IVEEYEERMKKLASKLMWLALSSLGVSEEDVQWASLNSDSNWAQAALQLNHYPVCPQPDR  229

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+LYQ+NT
Sbjct  230  AMGLAAHTDSTLLTILYQNNT  250



>ref|NP_173008.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
 sp|Q39103.2|G3OX1_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; Short=AtGA3ox1; AltName: Full=Gibberellin 3 
beta-hydroxylase 1 [Arabidopsis thaliana]
 gb|AAF71980.1|AC013453_5 GA4 protein [Arabidopsis thaliana]
 gb|AAC37506.1| GA4 [Arabidopsis thaliana]
 gb|AAO64762.1| At1g15550 [Arabidopsis thaliana]
 dbj|BAE99582.1| Gibberillin 3 beta-hydroxylase [Arabidopsis thaliana]
 gb|AEE29335.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
Length=358

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  WV V P P +LVVNV D+  I SNG FKSV H
Sbjct  232  HTDSTLLTILYQNNTAGL--QVFRDDLGWVTVPPFPGSLVVNVGDLFHILSNGLFKSVLH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV   +S +Y  ++WKEY   K  HF KAL
Sbjct  290  RARVNQTRARLSVAFLWGPQSDIKISPVPKLVSPVESPLYQSVTWKEYLRTKATHFNKAL  349

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  350  SMIRNHREE  358


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+E +  LA K+  L   +LG+SEED++W    S      A L  N Y  CP+P R
Sbjct  166  IVEEYEEHMKKLASKLMWLALNSLGVSEEDIEWASLSSDLNWAQAALQLNHYPVCPEPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+LYQ+NT
Sbjct  226  AMGLAAHTDSTLLTILYQNNT  246



>ref|XP_010459098.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  W+ V P+P +LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILYQNNTAGL--QVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV   +S +Y  ++W+EY   K  HF KAL
Sbjct  291  RARVNQTRARLSVAFLWGPQSDIKISPVSKLVSPLESPLYRSVTWREYLQTKATHFNKAL  350

Query  651  EVIQTNDDE  677
             +I  + +E
Sbjct  351  SMIGNHREE  359


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +V+ Y+E++  LA K+  L   +LG+SEEDV+W    S       A L  N Y  CP+P 
Sbjct  166  IVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLNSADLSWAQAALQLNHYPVCPEPD  225

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RA+G+  HTDS+L+T+LYQ+NT
Sbjct  226  RAMGLAAHTDSTLLTILYQNNT  247



>gb|ADE18861.1| putative 2-oxoglutarate dependent dioxygenase [Avena sativa]
Length=372

 Score = 72.4 bits (176),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +3

Query  375  KWVDV-KPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS  551
            +WV V   + DA VVNV D+ QI +NG+F SV HRA+V++ S RIS+ +F GP  D K +
Sbjct  254  RWVTVPADVQDAFVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFHGPPADTKVA  313

Query  552  FPLKLVKGRDS---MYPLISWKEYRGIK  626
             PL+   GR      Y  ++W EY  ++
Sbjct  314  -PLREAVGRTGGKPAYRAVTWPEYMAVR  340


 Score = 59.3 bits (142),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 47/80 (59%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  L+ ++  L   ALGL+ E    ++++     + +A +H N Y KCPDP 
Sbjct  161  VMEEFHGEMRALSDRLMELFLAALGLTGEQAAAVEAEHRIAETMTATMHLNWYPKCPDPK  220

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  221  RALGLIAHTDSGFFTFVLQS  240



>gb|ADK71024.1| gibberellin 3-beta-hydroxylase [Trifolium incarnatum]
Length=299

 Score = 72.0 bits (175),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  138  IVLQYDETMKKLAEKLMLLMLDSLGITKEDIKWASSKAQFEKACAAMQLNSYPICPDPDR  197

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L QS+ + 
Sbjct  198  AMGLAPHTDSTFLTILSQSDISG  220


 Score = 59.7 bits (143),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+P  LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  222  QVQREGFGWVTVPPLPGGLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPP  281

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  282  SNVEICPHAKLV  293



>ref|XP_008445138.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=351

 Score = 67.0 bits (162),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF------LHFNSYKKCPDP  271
            +++ Y+ Q+ GL  +I  LI K LG+SEE++  L + +  +       L  NSY  CPDP
Sbjct  159  VMEEYQRQMKGLGERIIRLILKFLGISEEEMMKLLTSTDESIGKPYMALRLNSYPPCPDP  218

Query  272  TRALGMVPHTDSSLITLLYQSNTNS  346
             + +G+  HTD+SL T+L+Q  +N 
Sbjct  219  GQVMGLAAHTDTSLCTILHQVRSNG  243


 Score = 64.3 bits (155),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQ-ASYRISITFFFGP  530
            Q+F+    WV + P+   LVVNV D++ I SNG+F S+ HR ++ +   +R S+ +F+ P
Sbjct  245  QIFKDGTGWVPLSPMSGTLVVNVGDLLHILSNGRFTSILHRVMIQENKEHRFSLAYFYDP  304

Query  531  KIDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQ  662
              D+  S   K +       +Y  ++ KEY  IK    G  L  I+
Sbjct  305  PGDIYISPYCKPLSDTPQFPLYRSVNVKEYFAIKAKKMGSGLPAIK  350



>gb|AAF80661.1|AF074710_1 putative gibberellin 3 beta hydroxylase [Citrullus lanatus subsp. 
vulgaris]
Length=349

 Score = 66.2 bits (160),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSA-----FLHFNSYKKCPDP  271
            +++ Y+ Q+ GL  +I  LIFK L +SEE++   L S   SA      L  NSY  CPDP
Sbjct  157  VMEEYQSQMKGLGERIIRLIFKFLDISEEEMMKLLTSTDESAGKPYMALRLNSYPPCPDP  216

Query  272  TRALGMVPHTDSSLITLLYQSNTNS  346
            +R +G+  HTD+SL T+++Q+  + 
Sbjct  217  SRVMGLAAHTDTSLFTIVHQARHDG  241


 Score = 65.1 bits (157),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQ-ASYRISITFFFGP  530
            QVF+    WV + P+   L+VNV D++ I SNG+F S+ HR ++ +   +R S+ +F+ P
Sbjct  243  QVFKDGTGWVPLSPMSGTLIVNVGDILHILSNGRFPSILHRVMIHENKEHRFSLAYFYDP  302

Query  531  KIDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQ  662
              DL  S   K +       +Y  ++ KEY  IK    GK L  I+
Sbjct  303  PGDLYISPYCKPLSESPQIPLYRCVNVKEYFTIKAKKEGKGLSAIK  348



>dbj|BAB62073.1| GA 3beta-hydroxylase [Oryza sativa (indica cultivar-group)]
Length=379

 Score = 71.6 bits (174),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V V D+  + +NG+F SV HRA+V++   RIS+ +F GP  D+K + 
Sbjct  271  RWVTVPGTPGALIVVVGDLFHVLTNGRFHSVFHRAVVNRERDRISMPYFLGPPADMKVT-  329

Query  555  PLKLVKGRDS--MYPLISWKEYRGIKGVHFG---KALEVIQTNDDE  677
            PL      +S  +Y  ++W EY  ++   FG    AL +I+   +E
Sbjct  330  PLVAAGSPESKAVYQAVTWPEYMAVRDKLFGTNISALSMIRVAKEE  375


 Score = 59.7 bits (143),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = +2

Query  95   FVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS------TSAFLHFNSYK  256
            F SA+  + Y   +  L  ++ ++ FKALGL+  D    +++       TS+ +H N + 
Sbjct  174  FCSAM--EEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSSTIHLNMFP  231

Query  257  KCPDPTRALGMVPHTDSSLITLLYQS  334
            +CPDP R +G+  HTDS   T + QS
Sbjct  232  RCPDPDRVVGLAAHTDSGFFTFILQS  257



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ +   T  +  QVF  +  WV V P+PD+LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILHQNNTAGL--QVFRDDLGWVTVPPVPDSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV    S +Y  ++W EY   K  HF +AL
Sbjct  291  RARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHFNEAL  350

Query  651  EVIQTNDDE  677
             +I+ + DE
Sbjct  351  SMIKNDIDE  359


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG+SEED+ W  +        + L  N Y  CP+P R
Sbjct  167  IVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANPDLNWAQSALQLNHYPVCPEPDR  226

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+L+Q+NT
Sbjct  227  AMGLAAHTDSTLLTILHQNNT  247



>ref|XP_010497240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  W+ V P+P +LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILYQNNTAGL--QVFRDDLGWITVPPVPGSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV   +S +Y  ++WK+Y   K  HF KAL
Sbjct  291  RARVNQTRARLSVDFLWGPQSDIKISPVPKLVSPLESPLYRSVTWKKYLQTKATHFNKAL  350

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  351  SMIRNHREE  359


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +V+ Y+E++  LA K+  L   +LG+SEEDV+W    S       A L  N Y  CP+P 
Sbjct  166  IVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLNSADLSWAQAALQLNHYPVCPEPD  225

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RA+G+  HTDS+L+T+LYQ+NT
Sbjct  226  RAMGLAAHTDSTLLTILYQNNT  247



>gb|ADK71022.1| gibberellin 3-beta-hydroxylase [Trigonella spruneriana]
Length=301

 Score = 71.2 bits (173),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+S+ED+ W  SK+      SA +  NSY  CPDP 
Sbjct  138  IVLQYDETMKKLAGKLMLLMLDSLGISKEDIKWASSKAQFDENASAAMQLNSYPSCPDPD  197

Query  275  RALGMVPHTDSSLITLLYQSN  337
             A+G+ PHTDS+ +T+L Q++
Sbjct  198  HAMGLAPHTDSTFLTILSQND  218


 Score = 59.3 bits (142),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HRA+V++   R S+ + +GP 
Sbjct  223  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPP  282

Query  534  IDLKFSFPLKLV  569
             +++    +KLV
Sbjct  283  SNVEICPHVKLV  294



>ref|XP_002312162.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE89529.1| oxidoreductase family protein [Populus trichocarpa]
Length=358

 Score = 79.0 bits (193),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            ++ W+ VKP P A +VN+ D +Q+ SN  +KSV+HR IV+ +  R+S+ FF+ PK D+  
Sbjct  254  DENWITVKPAPHAFIVNIGDQIQVLSNATYKSVEHRVIVNSSKERVSLAFFYNPKSDIPI  313

Query  549  SFPLK--LVKGRDSMYPLISWKEYR  617
              PLK  L   R  +YP +++ EYR
Sbjct  314  E-PLKELLAPDRPPLYPAMTFDEYR  337


 Score = 51.6 bits (122),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y +QL+ L  ++  ++   LGL EE + +    ++  A L  N Y KCP P  ALG
Sbjct  168  VLDEYGKQLVKLCGRLMKILSINLGLGEERLQNAFGGENIGACLRVNFYPKCPQPDLALG  227

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            +  H+D   ITLL   N   G
Sbjct  228  LSSHSDPGGITLLLPDNHVPG  248



>gb|ADK71019.1| gibberellin 3-beta-hydroxylase [Trigonella kotschyi]
Length=297

 Score = 70.5 bits (171),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      SA +  NSY  CPDP 
Sbjct  137  IVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDEKASAAMQLNSYPSCPDPD  196

Query  275  RALGMVPHTDSSLITLLYQSN  337
             A+G+ PHTDS+ +T+L Q++
Sbjct  197  HAMGLAPHTDSTFLTILSQND  217


 Score = 60.1 bits (144),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV + +  WV V P+   LVVNV D+  I SNG + SV HRA+V++   R S+ + +GP 
Sbjct  222  QVQQEDFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPP  281

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  282  SNVEICPHAKLV  293



>gb|ADK71010.1| gibberellin 3-beta-hydroxylase [Trigonella calliceras]
Length=299

 Score = 70.5 bits (171),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG++++D+ W  SK+     + A +  NSY  CPDP 
Sbjct  136  IVLQYDEPMKKLAGKLMWLMLDSLGITKDDIKWASSKAQFEEKSCAAMQLNSYPSCPDPD  195

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  196  RAMGLAPHTDSTFLTILSQND  216


 Score = 60.1 bits (144),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HRA+V++   R S+ + +GP 
Sbjct  221  QVQREGLGWVTVPPLXGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPP  280

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  281  SNVEICPHAKLV  292



>ref|XP_002465421.1| hypothetical protein SORBIDRAFT_01g038520 [Sorghum bicolor]
 gb|EER92419.1| hypothetical protein SORBIDRAFT_01g038520 [Sorghum bicolor]
Length=383

 Score = 90.1 bits (222),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV  P+ +W+ V P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+
Sbjct  259  QVRSPDGQWIIVDPVPDAFIVNVGDQIQVLSNASYKSVEHRVTVSAAEDRLSMAFFYNPR  318

Query  534  IDLKFS-FPLKLVKGRDSMYPLISWKEY------RGIKGVHFGKALEVIQTNDDEAPRGS  692
             DL  +  P  +  GR ++YP +++ EY      RG+ G    ++L+  QT    A  GS
Sbjct  319  SDLPIAPMPELVGPGRPALYPEMTFDEYRVFIRQRGLAGKAQLQSLQANQTAAAAAAAGS  378


 Score = 40.0 bits (92),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 34/72 (47%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y E+++ L  ++  L+   LGL    +   +       A L  N Y +CP P   LG+
Sbjct  178  EEYGEEVLQLCRRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRVNLYPRCPQPELTLGV  237

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  238  AGHSDPGGMTML  249



>gb|ADK71014.1| gibberellin 3-beta-hydroxylase [Trigonella cretica]
Length=296

 Score = 73.9 bits (180),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            ++  Y E +  LA K+  L+  +LG+++ED+ W  SK+      SA L  NSY  CPDP 
Sbjct  133  IILQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKASAVLQLNSYPSCPDPD  192

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+G+ PHTDS+ +T+L Q++ + 
Sbjct  193  RAMGLAPHTDSTFLTILSQNDISG  216


 Score = 56.6 bits (135),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVN+ D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  218  QVQREGFGWVTVPPLHGGLVVNIGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  277

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  278  SNVEIGPHAKLV  289



>ref|XP_002519764.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF42737.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=213

 Score = 70.9 bits (172),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            W+ V+PIP+A ++N+ DM++I +NG ++S++HRA +S A  R+SI  F+ PK D   +  
Sbjct  108  WIPVQPIPNAFIINIGDMLEILTNGIYRSIEHRATISSAKERLSIATFYNPKFDGYLAPA  167

Query  558  LKLVKGRD-SMYPLISWKEY------RGIKGVHFGKALEVIQTND  671
              L+  +  + +  IS+ +Y      R + G  F + L  IQ N+
Sbjct  168  PSLITAKTPAAFERISFADYFQGYVSRELDGKSFIQVLR-IQNNE  211


 Score = 58.9 bits (141),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +2

Query  77   YIIAALFVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYK  256
            YI + L+     ++ Y E+L  LA KI  L+ KA+G+  +++  L  +   A +  N Y 
Sbjct  10   YICSPLYHPEDAIETYSEELKSLAHKIFDLVAKAVGMKPDEMKELFEEGWQA-MRMNCYP  68

Query  257  KCPDPTRALGMVPHTDSSLITLLYQSNTNSG  349
             CP P   +G+ PH+D++ +T+L Q N   G
Sbjct  69   PCPQPDLVIGLKPHSDATGLTILLQVNDVVG  99



>ref|XP_006416894.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
 gb|ESQ35247.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
Length=361

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  W+ V PIP +LVVNV D+  I +NG FKSV H
Sbjct  234  HTDSTLLTILYQNNTAGL--QVFRDDLGWITVPPIPGSLVVNVGDLFHILTNGLFKSVLH  291

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D K S   KLV    S +Y  ++W EY   K VHF KAL
Sbjct  292  RARVNQTRSRLSVAFLWGPQSDTKISPVPKLVSPVGSPLYRSVTWTEYLRTKAVHFNKAL  351

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  352  SMIRNHKEE  360


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKST-----SAFLHFNSYKKCPDPT  274
            +V+ Y+EQ+  LA K+  L   +LG++E+D+ W     +      + L  N Y  CP P 
Sbjct  167  IVEEYEEQMQKLASKLMWLALNSLGVTEDDIKWASVDDSDLNWAQSALQLNHYPVCPQPD  226

Query  275  RALGMVPHTDSSLITLLYQSNT  340
            RA+G+  HTDS+L+T+LYQ+NT
Sbjct  227  RAMGLAAHTDSTLLTILYQNNT  248



>gb|ADK71013.1| gibberellin 3-beta-hydroxylase [Trigonella corniculata]
Length=297

 Score = 71.2 bits (173),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  134  IVLQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPD  193

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  194  RAMGLAPHTDSTFLTILSQND  214


 Score = 58.2 bits (139),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  219  QVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPNAKLV  290



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score = 71.6 bits (174),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A + FNSY  CPDP RA+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQFNSYPSCPDPDRAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 57.4 bits (137),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV     +WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGFEWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPS  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>emb|CDP04846.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 74.3 bits (181),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 3/103 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            Q+F     WV V PI  ALV+N+ ++M I SNG+F  + HRA V+Q  +RIS+ +F  P 
Sbjct  244  QIFRDGFGWVTVSPIEGALVINLGNLMDILSNGKFSGILHRAFVNQIRHRISVAYFCYPP  303

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALEVIQ  662
             D + +      K    +Y  ++ KEY  I+  H   AL +I+
Sbjct  304  ADSQVA---PFAKSECPIYSSLTVKEYLEIRAKHMEDALSMIR  343


 Score = 54.3 bits (129),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y++ +  LA ++  L+ K L +SE++++W  S +    L  NS+  CPDP   +G+
Sbjct  169  VMETYQKMMNSLAHQLLLLMLKWLEVSEDELNWKLSNA----LFLNSFPACPDPKSTIGL  224

Query  290  VPHTDSSLITLLYQSN  337
             PHTDS LIT+L+QS 
Sbjct  225  APHTDSLLITILHQSQ  240



>gb|ADK71009.1| gibberellin 3-beta-hydroxylase [Trigonella bicolor]
Length=300

 Score = 71.2 bits (173),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      SA L  NSY  CPDP 
Sbjct  137  IVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDENASAALQLNSYPSCPDPD  196

Query  275  RALGMVPHTDSSLITLLYQSN  337
             A+G+ PHTDS+ +T+L Q++
Sbjct  197  HAMGLAPHTDSTFLTILSQND  217


 Score = 57.8 bits (138),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  222  QVQQEGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  281

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  282  SNVEICPHAKLV  293



>dbj|BAQ02990.1| gibberellin 3-oxidase [Rorippa aquatica]
Length=356

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 3/127 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  WV V P+P +LVVNV D++ I SNG FKSV H
Sbjct  232  HTDSTLLTILYQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLLHILSNGLFKSVLH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R S+ F +GP+ D++ S   KLV   +S +Y  ++W  Y  IK  HF KAL
Sbjct  290  RARVNQTRSRFSVAFLWGPQSDIQISPIPKLVGPFESPLYQSVTWTHYLQIKATHFNKAL  349

Query  651  EVIQTND  671
             +I+  D
Sbjct  350  SMIERKD  356


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS----AFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L+  +LG+SEEDV W +  S S    A L  N Y  CP P +
Sbjct  166  IVEEYEEQMRKLASKLLWLVLNSLGVSEEDVKWARLNSDSNWAQAALQLNHYPVCPQPDQ  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+LYQ+NT
Sbjct  226  AMGLAAHTDSTLLTILYQNNT  246



>ref|XP_009772021.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=358

 Score = 68.2 bits (165),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 9/106 (8%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            W+ V P+P+A +VNV D ++IFSNG ++S++HR++VS    RISI  F  PK+D +   P
Sbjct  253  WIPVLPLPNAFIVNVGDSLEIFSNGIYRSIEHRSVVSAVKERISIATFHSPKLDGELG-P  311

Query  558  LKLVKGRDS--MYPLISWKEY------RGIKGVHFGKALEVIQTND  671
             K +   DS  ++  I+  EY      R + G  +   + +   ND
Sbjct  312  AKSLITADSPPIFKTINVHEYFRGFFTRKLDGKSYVDTVRITCEND  357


 Score = 60.5 bits (145),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y E++  LAMK+  L+ KALG+  E+V+ L  K   + +  N Y  CP P   +G+ 
Sbjct  167  IEAYSEEVKELAMKVLDLLGKALGIEAEEVNNLFGKGMQS-VRMNYYPPCPQPELVMGLC  225

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  + +L Q N   G
Sbjct  226  PHSDACALAILLQVNETDG  244



>ref|XP_011047646.1| PREDICTED: leucoanthocyanidin dioxygenase-like isoform X1 [Populus 
euphratica]
Length=357

 Score = 77.4 bits (189),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            ++ W+ VKP P A +VN+ D +Q+ SN  +KSV+HR IV+ +  R+S+ FF+ PK D+  
Sbjct  254  DENWITVKPAPHAFIVNIGDQIQVLSNATYKSVEHRVIVNSSKERVSLAFFYNPKSDIPI  313

Query  549  SFPLK--LVKGRDSMYPLISWKEYR  617
              PLK  +   R  +YP +++ EYR
Sbjct  314  E-PLKELVAPDRPPLYPAMTFDEYR  337


 Score = 51.2 bits (121),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y +QL+ L  ++  ++   LGL EE + +    ++  A L  N Y KCP P  ALG
Sbjct  168  VLDEYGKQLVKLCGRLMKVLSINLGLEEERLQNAFGGENIGACLRVNFYPKCPQPDLALG  227

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            +  H+D   ITLL   N   G
Sbjct  228  LSSHSDPGGITLLLPDNHVPG  248



>emb|CDY01001.1| BnaC05g41990D [Brassica napus]
Length=405

 Score = 72.8 bits (177),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            W+ V  +P+A VVN+ D MQI SN  +KS +HR IV+    R+S+ FF+ PK D++    
Sbjct  302  WITVNALPNAFVVNLGDQMQILSNSIYKSSEHRVIVNSQKERVSLAFFYNPKSDIRIQPL  361

Query  558  LKLVKGRD-SMYPLISWKEYR  617
             +L+   +  +YP +S+ EYR
Sbjct  362  EQLISSTNPPLYPPLSYDEYR  382


 Score = 55.8 bits (133),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            +VD Y E+L+ L  ++  ++   LG++EE + +    +  SA +  N Y KCP P  ALG
Sbjct  213  VVDEYGEELVKLGERLMRILSSNLGVNEEQLQEAFGGEDFSACMRVNYYPKCPRPELALG  272

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D   IT+L   +  +G
Sbjct  273  LSPHSDPGGITILLPDDQVAG  293



>gb|ABY49032.1| GA3-oxidase [Ehrharta erecta]
Length=260

 Score = 66.6 bits (161),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++ GLA K+  L  +ALGL+ E +  ++++     + +A +H N Y +CPDP 
Sbjct  116  VMEEFHKEMRGLAGKLLELFLEALGLTGEQIGAVEAEQKLGETMTATMHLNWYPRCPDPA  175

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  176  RALGLIAHTDSGFFTFVLQS  195


 Score = 62.0 bits (149),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  372  KKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
             +WV V   P A VVNV D+  I +NG+F SV HRA+V++ S RIS+ +F GP
Sbjct  208  DRWVAVPATPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDSDRISLGYFLGP  260



>ref|XP_008660253.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Zea 
mays]
 gb|AFW88710.1| hypothetical protein ZEAMMB73_081304 [Zea mays]
Length=407

 Score = 88.6 bits (218),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 69/118 (58%), Gaps = 4/118 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV  P+ +W+ V P+PDA +VN+ D +Q+ SN  +KSV+HR  VS    R+S+ FF+ P+
Sbjct  266  QVRGPDGQWIIVDPVPDAFIVNIGDQIQVLSNAAYKSVEHRVTVSATEDRLSMAFFYNPR  325

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYRGI---KGVHFGKALEVIQTNDDEAPRGSR  695
             DL  +   +LV  GR ++YP +++ EYR     +G+     LE +Q     A  G R
Sbjct  326  SDLPIAPMAELVGPGRPALYPEMTFDEYRVFIRQRGLAGKAQLESMQKAAATAADGGR  383


 Score = 40.0 bits (92),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 34/72 (47%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y E+++ L  ++  L+   LGL    +   +       A L  N Y +CP P   LG+
Sbjct  185  EEYGEEVLHLCRRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRINFYPRCPQPELTLGV  244

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  245  AGHSDPGGMTML  256



>gb|ADK70954.1| gibberellin 3-beta-hydroxylase [Medicago arabica]
Length=297

 Score = 69.3 bits (168),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG+S ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  138  YDEAMKKLAGKLMWLMLDSLGISMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  197

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+L+T+L Q++
Sbjct  198  LAPHTDSTLLTILSQND  214


 Score = 59.3 bits (142),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG F SV HR +V++   R S+ + +GP 
Sbjct  219  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPHEKLV  290



>ref|NP_001054798.1| Os05g0178100 [Oryza sativa Japonica Group]
 gb|AAT77356.1| putative gibberellin 3 beta-hydroxylase [Oryza sativa Japonica 
Group]
 dbj|BAF16712.1| Os05g0178100 [Oryza sativa Japonica Group]
 dbj|BAH00227.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score = 71.2 bits (173),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V V D+  + +NG+F SV HRA+V++   RIS+ +F GP  D+K + 
Sbjct  276  RWVTVPGTPGALIVVVGDLFHVLTNGRFHSVFHRAVVNRERDRISMPYFLGPPADMKVT-  334

Query  555  PLKLVKGRDS--MYPLISWKEYRGIKGVHFG---KALEVIQTNDDE  677
            PL      +S  +Y  ++W EY  ++   FG    AL +I+   +E
Sbjct  335  PLVAAGSPESKAVYQAVTWPEYMAVRDKLFGTNISALSMIRVAKEE  380


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = +2

Query  95   FVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKK  259
            F SA+  + Y   +  L  ++ ++ FKALGL+  D    +++     + ++ +H N + +
Sbjct  180  FCSAM--EEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSTIHLNMFPR  237

Query  260  CPDPTRALGMVPHTDSSLITLLYQS  334
            CPDP R +G+  HTDS   T + QS
Sbjct  238  CPDPDRVVGLAAHTDSGFFTFILQS  262



>gb|EEC78618.1| hypothetical protein OsI_18664 [Oryza sativa Indica Group]
Length=381

 Score = 71.2 bits (173),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V V D+  + +NG+F SV HRA+V++   RIS+ +F GP  D+K + 
Sbjct  273  RWVTVPGTPGALIVVVGDLFHVLTNGRFHSVFHRAVVNRERDRISMPYFLGPPADMKVT-  331

Query  555  PLKLVKGRDS--MYPLISWKEYRGIKGVHFG---KALEVIQTNDDE  677
            PL      +S  +Y  ++W EY  ++   FG    AL +I+   +E
Sbjct  332  PLVAAGSPESKAVYQAVTWPEYMAVRDKLFGTNISALSMIRVAKEE  377


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 7/85 (8%)
 Frame = +2

Query  95   FVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKK  259
            F SA+  + Y   +  L  ++ ++ FKALGL+  D    +++     + ++ +H N + +
Sbjct  177  FCSAM--EEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSTIHLNMFPR  234

Query  260  CPDPTRALGMVPHTDSSLITLLYQS  334
            CPDP R +G+  HTDS   T + QS
Sbjct  235  CPDPDRVVGLAAHTDSGFFTFILQS  259



>ref|XP_004984849.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Setaria italica]
Length=378

 Score = 92.0 bits (227),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV  P+ +W+ V+P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+
Sbjct  252  QVRSPDGQWITVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEERLSMAFFYNPR  311

Query  534  IDLKFS-FPLKLVKGRDSMYPLISWKEYR  617
             DL  +  P  +  GR ++YP +++ EYR
Sbjct  312  SDLPIAPMPELVAPGRPALYPEMTFDEYR  340


 Score = 36.6 bits (83),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (46%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF--LHFNSYKKCPDPTRALGM  289
            + Y E+++ L  ++  L+   LGL    +      +      +  N Y +CP P   LG+
Sbjct  171  EEYGEEVVQLCRRVMRLLSSGLGLEAGRLQEAFGGAGGEGACMRVNFYPRCPQPELTLGV  230

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  231  AAHSDPGGMTML  242



>ref|XP_004963513.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-3-like [Setaria italica]
Length=367

 Score = 69.3 bits (168),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P ALVV + D+ Q+ +NG+F+S  HRA+V++   RIS+ +F GP  D+K + 
Sbjct  253  RWVTVPAPPGALVVVLGDLFQVLTNGRFRSALHRAVVNRERDRISVPYFLGPPADMKVA-  311

Query  555  PLKLV--KGRDSMYPLISWKEYRGIK  626
            PL      G  + +  ++W+EY  I+
Sbjct  312  PLAAAVPPGTKAAFRGVTWREYLEIR  337


 Score = 59.3 bits (142),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ +  ++  L +++  ++F ALGL++  +   +++     + +A  H N Y +CP P 
Sbjct  160  VMEEHHAEMRALGVRLLDMLFGALGLTDAQIAAGETEREIRETLTATTHLNMYPRCPQPE  219

Query  275  RALGMVPHTDSSLITLLYQS  334
            RA+GM  HTDS  IT++ QS
Sbjct  220  RAIGMAAHTDSGFITIILQS  239



>gb|KFK43811.1| hypothetical protein AALP_AA1G176200 [Arabis alpina]
Length=358

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  Q+F  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  232  HTDSSLLTILYQNNTAGL--QLFRDDIGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D K S   KLV   +S +Y  ++W EY   K  HF KAL
Sbjct  290  RARVNQTRSRLSVAFLWGPQSDTKISPVPKLVSPFESPLYRSVTWTEYLRTKATHFNKAL  349

Query  651  EVIQTNDDE  677
             +I+ + +E
Sbjct  350  SMIRNHREE  358


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+E +  LA K+  L   +LG+SEED+ W +  S      A L  N Y  CP P R
Sbjct  166  IVEEYEEHMQKLASKLMWLALNSLGVSEEDIKWARLNSDYNWAQAALQLNHYPVCPQPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDSSL+T+LYQ+NT
Sbjct  226  AMGLAAHTDSSLLTILYQNNT  246



>gb|ADK71018.1| gibberellin 3-beta-hydroxylase [Trigonella glabra]
Length=294

 Score = 71.2 bits (173),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A +  NSY  CPDP 
Sbjct  134  IVLQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAAMQLNSYPSCPDPD  193

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  194  RAMGLAPHTDSTFLTILSQND  214


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  219  QVQREGLGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPHAKLV  290



>gb|EEE62526.1| hypothetical protein OsJ_17324 [Oryza sativa Japonica Group]
Length=201

 Score = 72.0 bits (175),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V V D+  + +NG+F SV HRA+V++   RIS+ +F GP  D+K + 
Sbjct  93   RWVTVPGTPGALIVVVGDLFHVLTNGRFHSVFHRAVVNRERDRISMPYFLGPPADMKVT-  151

Query  555  PLKLVKGRDS--MYPLISWKEYRGIKGVHFG---KALEVIQTNDDE  677
            PL      +S  +Y  ++W EY  ++   FG    AL +I+   +E
Sbjct  152  PLVAAGSPESKAVYQAVTWPEYMAVRDKLFGTNISALSMIRVAKEE  197


 Score = 56.6 bits (135),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPTR  277
            ++ Y   +  L  ++ ++ FKALGL+  D    +++     + ++ +H N + +CPDP R
Sbjct  1    MEEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSTIHLNMFPRCPDPDR  60

Query  278  ALGMVPHTDSSLITLLYQS  334
             +G+  HTDS   T + QS
Sbjct  61   VVGLAAHTDSGFFTFILQS  79



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L+L +      +  QVF     WV V P+  ALVVN+ D+MQI SNG+FKSV H
Sbjct  216  HTDSTLLTLVHQNNASGL--QVFREGSGWVPVHPVDGALVVNIGDLMQILSNGRFKSVLH  273

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVK-GRDSMYPLISWKEYRGIKGVHFGKAL  650
            RA+V++  +R S+  F+GP +D + S  + L+      +Y  +SWKEY   K +HF K L
Sbjct  274  RAVVNETYHRTSVVHFYGPPMDAEVSPLMHLIDFDHPVLYRAVSWKEYLDAKKIHFDKTL  333

Query  651  EVIQTNDDEAPRGSR  695
            + I+ +    P+   
Sbjct  334  DFIKQDALGVPKNGH  348


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 60/84 (71%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTS-----AFLHFNSYKKCPDPT  274
            +V+ Y++++ GL+ ++  L+FK+LGL++EDV W  +KS +     + L  NSY  CP+  
Sbjct  149  VVEEYQKEMKGLSERLIGLMFKSLGLAQEDVKWFTTKSETQHQPQSVLQLNSYPICPEAG  208

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            +A+G+ PHTDS+L+TL++Q+N + 
Sbjct  209  QAMGLAPHTDSTLLTLVHQNNASG  232



>gb|AFA35958.1| gibberellin 3-oxidase, partial [Nicotiana attenuata]
Length=150

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ +   T  +  QVF+    WV V P+P ALV+NV D++ I SNG + SV H
Sbjct  9    HTDSTILTILHQNNTSGL--QVFKEGNGWVTVPPLPGALVINVGDLLHILSNGLYPSVLH  66

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLV-KGRDSMYPLISWKEYRGIKGVHFGKAL  650
            RA+V++  +R+S+ + +GP   +K S   KLV +G   +Y  ++W EY G K  HF KAL
Sbjct  67   RAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQGHPPLYRPVTWSEYLGTKAKHFDKAL  126

Query  651  EVIQ  662
              ++
Sbjct  127  SSVR  130



>gb|ADK71027.1| gibberellin 3-beta-hydroxylase [Trifolium subterraneum]
Length=272

 Score = 71.2 bits (173),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA K+  L+  +LG+++ED  W  SK+      A L  NSY  CPDP R
Sbjct  113  IVLQYDETMKKLAEKLMLLMLDSLGITKEDFKWAGSKAQFEKACAALQLNSYPICPDPDR  172

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L QS+ + 
Sbjct  173  AMGLAPHTDSTFLTILSQSDISG  195


 Score = 56.6 bits (135),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  197  QVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  256

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  257  SNVEICPHAKLV  268



>ref|XP_009148952.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Brassica rapa]
Length=359

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ +   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILHQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV    S +Y  ++W EY   K  HF +AL
Sbjct  291  RARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHFNEAL  350

Query  651  EVIQTNDDE  677
             +I+ + DE
Sbjct  351  SMIKNDIDE  359


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG+SEED+ W  +        + L  N Y  CP+P R
Sbjct  167  IVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANPDLNWAQSALQLNHYPVCPEPDR  226

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+L+Q+NT
Sbjct  227  AMGLAAHTDSTLLTILHQNNT  247



>ref|NP_001275523.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 ref|XP_004160775.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCG14217.1| GA 3-oxidase [Cucumis sativus]
Length=350

 Score = 65.1 bits (157),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF------LHFNSYKKCPDP  271
            +++ Y+ ++ GL  +I  LI K LG+SEE++  L + +  +       L  NSY  CPDP
Sbjct  158  VMEEYQREMKGLGERIIRLILKFLGISEEEMMKLLTSTDESIGKPHMALRLNSYPPCPDP  217

Query  272  TRALGMVPHTDSSLITLLYQSNTNS  346
             + +G+  HTD+SL T+L+Q   N 
Sbjct  218  GQVMGLAAHTDTSLCTILHQVGNNG  242


 Score = 62.4 bits (150),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQ-ASYRISITFFFGP  530
            Q+F+    WV + P+   L+VN+ D++ I SNG+F S+ HR ++ +   +R S+ +F+ P
Sbjct  244  QIFKDGTGWVPLSPMSGTLIVNIGDLLHILSNGRFPSILHRVMIQENKEHRFSLAYFYDP  303

Query  531  KIDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQ  662
              ++  S   K +       +Y  ++ KEY  IK    GK L  I+
Sbjct  304  PGEIYISPYCKPLSDTPQFPLYRSVNVKEYFAIKAKKTGKGLPAIK  349



>gb|ADK71005.1| gibberellin 3-beta-hydroxylase [Melilotus indicus]
Length=299

 Score = 71.2 bits (173),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            ++  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  137  IILQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAALQLNSYPSCPDPD  196

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+G+ PHTDS+ +T+L Q++ + 
Sbjct  197  RAMGLAPHTDSTFMTILSQNDISG  220


 Score = 56.6 bits (135),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  222  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  281

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  282  SNVEICPHAKLV  293



>ref|XP_011035927.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Populus euphratica]
Length=358

 Score = 80.5 bits (197),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            +  W+ VKP+PDA +VN+ D +Q+ SN   KSV+HR +V+ +  R+S+ FF+ P+ D+  
Sbjct  254  DGNWITVKPVPDAFIVNIGDQIQVLSNATCKSVEHRVMVNSSEERLSLAFFYNPRSDIPI  313

Query  549  SFPLK--LVKGRDSMYPLISWKEYR  617
              PLK  +  GR  +YP +++ EYR
Sbjct  314  E-PLKELVAPGRPPLYPAMTFDEYR  337


 Score = 47.0 bits (110),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y +QL+ L  K+  ++   LGL EE + +    ++  A L  N Y KCP P   LG
Sbjct  168  VLDEYGKQLVELCGKLMKVLSINLGLGEEQLQNAFGGENIGACLRVNFYPKCPQPDLTLG  227

Query  287  MVPHTDSSLITLL  325
            +  H+D   +TLL
Sbjct  228  LSSHSDPGGMTLL  240



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ +   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILHQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D+K S   KLV    S +Y  ++W EY   K  HF +AL
Sbjct  291  RARVNQTRSRLSVAFLWGPQSDIKISPVPKLVSPVGSPLYRSVTWTEYLRTKATHFNEAL  350

Query  651  EVIQTNDDE  677
             +I+ + DE
Sbjct  351  SMIRNHIDE  359


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF----LHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG+SEED+ W  + S S +    L  N Y  CP+P R
Sbjct  167  IVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANSDSDWAQSALQLNHYPVCPEPDR  226

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+L+Q+NT
Sbjct  227  AMGLAAHTDSTLLTILHQNNT  247



>ref|XP_006355629.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 65.1 bits (157),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            +  W+ V   PDA VVN+ D+++I +NG +KS++HRAIV++   RISI  FF PK+D
Sbjct  256  DGAWIPVPYRPDAFVVNIGDILEIVTNGIYKSIEHRAIVNEDKERISIATFFSPKLD  312


 Score = 62.8 bits (151),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y   L  LAMKI  ++ + LG+  E+++ L  K  +  +  N Y  CP P R +G+ 
Sbjct  171  LEQYSTALKELAMKILYMMARVLGMKAEELNVLFEKDATQMMRLNYYPPCPQPDRVMGIC  230

Query  293  PHTDS-SLITLLYQSNTNSG  349
            PHTDS +L+ +L Q N   G
Sbjct  231  PHTDSIALLAILLQVNETEG  250



>ref|XP_008373604.1| PREDICTED: S-norcoclaurine synthase 1-like [Malus domestica]
Length=357

 Score = 73.9 bits (180),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            N +WV VKP+P A +VN+ D+++I SNG++KS++HRA+V+    R+SI  F  P +    
Sbjct  254  NGRWVPVKPVPSAFIVNIGDIIEIMSNGEYKSIEHRAVVNTERERLSIAAFHSPNLRTAI  313

Query  549  SFPLKLVKGRDSMYPLISWKEY  614
                 LVK   + Y  +S +EY
Sbjct  314  GPLPDLVKDNAANYKTVSSEEY  335


 Score = 53.5 bits (127),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            +D Y E+L  + + I  LI K LGL+ E+++ +    T   L  N Y  C   +R +G+ 
Sbjct  171  LDKYSEELQQVTLYIWKLICKNLGLNSEEMESMFEDGTQG-LRMNYYPPCQQASRVMGLT  229

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  +TLL Q N   G
Sbjct  230  PHSDAVGLTLLVQVNEVQG  248



>gb|KGN62901.1| hypothetical protein Csa_2G379320 [Cucumis sativus]
Length=192

 Score = 65.5 bits (158),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF------LHFNSYKKCPDPT  274
            ++ Y+ ++ GL  +I  LI K LG+SEE++  L + +  +       L  NSY  CPDP 
Sbjct  1    MEEYQREMKGLGERIIRLILKFLGISEEEMMKLLTSTDESIGKPHMALRLNSYPPCPDPG  60

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            + +G+  HTD+SL T+L+Q   N 
Sbjct  61   QVMGLAAHTDTSLCTILHQVGNNG  84


 Score = 62.0 bits (149),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQ-ASYRISITFFFGP  530
            Q+F+    WV + P+   L+VN+ D++ I SNG+F S+ HR ++ +   +R S+ +F+ P
Sbjct  86   QIFKDGTGWVPLSPMSGTLIVNIGDLLHILSNGRFPSILHRVMIQENKEHRFSLAYFYDP  145

Query  531  KIDLKFSFPLKLVKGRDS--MYPLISWKEYRGIKGVHFGKALEVIQ  662
              ++  S   K +       +Y  ++ KEY  IK    GK L  I+
Sbjct  146  PGEIYISPYCKPLSDTPQFPLYRSVNVKEYFAIKAKKTGKGLPAIK  191



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ +   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  233  HTDSTLLTILHQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVLH  290

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R S+ F +GP+ D+K S   KLV   +S +Y  ++W EY   K  HF +AL
Sbjct  291  RARVNQTRSRFSVAFLWGPQSDIKISPVPKLVSLVESPLYRSVTWTEYLRTKATHFNEAL  350

Query  651  EVIQTNDDE  677
             +I+ + DE
Sbjct  351  SMIRNHIDE  359


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG+SEED+ W  +        + L  N Y  CP+P R
Sbjct  167  IVEEYEEQMQTLASKLMWLSLTSLGVSEEDIKWATANPDLNWAQSALQLNHYPVCPEPDR  226

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+  HTDS+L+T+L+Q+NT
Sbjct  227  AMGLAAHTDSTLLTILHQNNT  247



>gb|ADK71006.1| gibberellin 3-beta-hydroxylase [Trigonella anguina]
Length=298

 Score = 71.2 bits (173),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W+ SK+       A +  NSY  CPDP 
Sbjct  135  IVLQYGETMKKLAGKLMWLMLDSLGITKEDIKWVCSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  195  RAMGLAPHTDSTFLTILSQND  215


 Score = 55.8 bits (133),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGIGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEIWPHAKLV  291



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score = 69.3 bits (168),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP R
Sbjct  137  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDR  196

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  197  AMGLAPHTDSTFLTILSQND  216


 Score = 57.8 bits (138),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  221  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  280

Query  534  IDLKFSFPLKLV  569
             +++ S   KLV
Sbjct  281  SNVEISPHEKLV  292



>gb|ADK71001.1| gibberellin 3-beta-hydroxylase [Medicago suffruticosa]
Length=288

 Score = 67.8 bits (164),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  132  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  191

Query  284  GMVPHTDSSLITLLYQS  334
            G+ PHTDS+L+T+L Q+
Sbjct  192  GLAPHTDSTLLTILSQN  208


 Score = 59.3 bits (142),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGSYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71008.1| gibberellin 3-beta-hydroxylase [Trigonella balansae]
Length=302

 Score = 71.2 bits (173),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A +  NSY  CPDP 
Sbjct  137  IVLQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAAMQLNSYPSCPDPD  196

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  197  RAMGLAPHTDSTFLTILSQND  217


 Score = 55.8 bits (133),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  222  QVQREGLGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  281

Query  534  IDLKFSFPLKL  566
             +++     KL
Sbjct  282  SNVEICPHAKL  292



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score = 69.3 bits (168),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP R
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDR  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 57.8 bits (138),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++ S   KLV
Sbjct  280  SNVEISPHEKLV  291



>gb|ADK70983.1| gibberellin 3-beta-hydroxylase [Medicago papillosa]
Length=298

 Score = 68.2 bits (165),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 58.9 bits (141),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV+V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQXEGSGWVNVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ADK71007.1| gibberellin 3-beta-hydroxylase [Trigonella arabica]
Length=294

 Score = 69.7 bits (169),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A +  NSY  CPDP 
Sbjct  131  IVLQYDEIMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEKACAAMQLNSYPSCPDPD  190

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+G+ PHTDS+ +T+L Q++ + 
Sbjct  191  RAMGLAPHTDSTFLTILSQNDISG  214


 Score = 57.0 bits (136),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVN+ D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  216  QVQREGLGWVTVPPLHGGLVVNIGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  275

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  276  SNVEICPHAKLV  287



>gb|ADK71025.1| gibberellin 3-beta-hydroxylase [Trifolium microdon]
Length=300

 Score = 71.2 bits (173),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  139  IVLQYDEAMKKLAEKLMLLMLDSLGITKEDIIWASSKAQFEKACAAMQLNSYPICPDPDR  198

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L QS+
Sbjct  199  AMGLAPHTDSTFLTILSQSD  218


 Score = 55.8 bits (133),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  223  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPP  282

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  283  SNVEICPHAKLV  294



>gb|ADK70975.1| gibberellin 3-beta-hydroxylase [Medicago marina]
Length=275

 Score = 69.7 bits (169),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SKS     T A +  NSY  CPDP  
Sbjct  125  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKSQFDEKTCAAMQLNSYPSCPDPDH  184

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  185  AMGLAPHTDSTFLTILSQND  204


 Score = 57.4 bits (137),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  209  QVQREGSGWVTVSPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTHQRFSVAYLYGPP  268

Query  534  IDLKF  548
             +++ 
Sbjct  269  SNVEI  273



>ref|XP_009117822.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Brassica rapa]
 emb|CDY68965.1| BnaA09g57140D [Brassica napus]
Length=358

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  232  HTDSTLLTILYQNNTAGL--QVFRDDFGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVIH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA V+Q   R+S+ F +GP+ D K S   KLV   +S +Y  ++W EY   K  HF KAL
Sbjct  290  RARVNQTRPRLSVAFLWGPRSDTKISPVPKLVSPDESPLYRSVTWTEYLRTKATHFNKAL  349

Query  651  EVIQTNDDE  677
             +I+ + ++
Sbjct  350  SMIRNHREK  358


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG++EED+ W    S      + L  N Y  CP+P R
Sbjct  166  IVEQYEEQMQKLASKLMWLSLNSLGVTEEDIKWATVSSDLNWAQSALQLNHYPVCPEPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+ PHTDS+L+T+LYQ+NT
Sbjct  226  AMGLAPHTDSTLLTILYQNNT  246



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score = 68.2 bits (165),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDH  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 58.9 bits (141),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHXKLV  291



>gb|ADK71015.1| gibberellin 3-beta-hydroxylase [Trigonella elliptica]
Length=282

 Score = 70.9 bits (172),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  131  IVLQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPD  190

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+  T+L Q++
Sbjct  191  RAMGLAPHTDSTFFTILSQND  211


 Score = 56.2 bits (134),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  216  QVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  275

Query  534  IDLKF  548
             +++ 
Sbjct  276  SNVEI  280



>gb|ADK71021.1| gibberellin 3-beta-hydroxylase [Trigonella sp. TU 33879]
Length=274

 Score = 70.9 bits (172),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  124  IVLQYDETMKKLAGKLMWLMLDSLGITKEDIKWACSKAQFDEQACAALQLNSYPSCPDPD  183

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+  T+L Q++
Sbjct  184  RAMGLAPHTDSTFFTILSQND  204


 Score = 55.8 bits (133),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  209  QVQQEGLGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  268

Query  534  IDLKF  548
             +++ 
Sbjct  269  SNVEI  273



>gb|KHN44143.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=309

 Score = 75.9 bits (185),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  L  K+  L+  +LG+++ED+ W  SK     T A L  NSY  CPDP R
Sbjct  160  IVKRYDEAMKKLVGKLMWLMLDSLGITKEDLKWAGSKGQFKKTCAALQLNSYPTCPDPDR  219

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+  HTDS+L+T+L+Q+N N 
Sbjct  220  AMGLAAHTDSTLLTILHQNNVNG  242


 Score = 50.8 bits (120),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 4/59 (7%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            QV +  + WV V P+P  LV+NV D++ I SNG + SV HR  V     RI    + GP
Sbjct  244  QVLKEGEGWVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVKGFQLRI----YVGP  298



>gb|ACG46320.1| gibberellin 3-beta-dioxygenase 2-2 [Zea mays]
Length=371

 Score = 80.1 bits (196),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V + D+ Q+ +NG+F+S  HRA+VS+   RIS+ +F  P  D+  + 
Sbjct  257  RWVTVPAPPGALIVMLGDLFQVLTNGRFRSPIHRAVVSRERERISVPYFLCPPEDMTVA-  315

Query  555  PL--KLVKGRDSMYPLISWKEYRGIKGVHFGK---ALEVIQTNDDEAPRGSRV  698
            PL   L+ GR +++  ++W EY  +K   FG    ALE++Q   DE  +G R 
Sbjct  316  PLASALLPGRKAVFRAVTWPEYMEVKHKVFGTDAPALEMLQLQVDEEEQGERA  368


 Score = 46.6 bits (109),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 41/79 (52%), Gaps = 6/79 (8%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKK----CPDPTR  277
            +++ Y  ++  L  ++  L F ALGL+  DV +   ++        +       CP+P R
Sbjct  167  VMEEYDREMRALGGRLLDLFFMALGLT--DVQFATGETERRIRETWTATMHPILCPEPER  224

Query  278  ALGMVPHTDSSLITLLYQS  334
            A+G+  HTDS  ITL+ QS
Sbjct  225  AIGLTAHTDSGFITLIMQS  243



>gb|ADK70986.1| gibberellin 3-beta-hydroxylase [Medicago polyceratia]
Length=291

 Score = 68.2 bits (165),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+ ++LG++ ED+ W  SK+      +A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLESLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.5 bits (140),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>ref|XP_006451038.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
 gb|ESR64278.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
Length=193

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L+  Y   T  +  QV+  N  WV V P+  ALVV V D+MQI  NG+FKS  H
Sbjct  66   HTDSSLLTSLYQGNTSGL--QVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRFKSALH  123

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA+V+   +RIS  +F+GP  D+K S  +KL       +Y  ++W+EY   K  HF KA+
Sbjct  124  RALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATHFNKAI  183

Query  651  EVIQ  662
            E+I+
Sbjct  184  ELIR  187


 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLK----SKSTSAFLHFNSYKKCPDPTRALGM  289
            Y+++L GLA KI  L+F++LGL++ED+ W K     KS    L  NSY  CPDP RA+G+
Sbjct  4    YQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMGL  63

Query  290  VPHTDSSLITLLYQSNTNS  346
             PHTDSSL+T LYQ NT+ 
Sbjct  64   APHTDSSLLTSLYQGNTSG  82



>ref|NP_001146525.1| GA 3-oxidase 2 [Zea mays]
 gb|ACL54212.1| unknown [Zea mays]
 gb|AFS50160.1| GA 3-oxidase 2 [Zea mays]
 gb|AFW77316.1| gibberellin 3-beta-dioxygenase 2-2 [Zea mays]
Length=371

 Score = 79.7 bits (195),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +WV V   P AL+V + D+ Q+ +NG+F+S  HRA+VS+   RIS+ +F  P  D+  + 
Sbjct  257  RWVTVPAPPGALIVMLGDLFQVLTNGRFRSPIHRAVVSRERERISVPYFLCPPEDMTVA-  315

Query  555  PL--KLVKGRDSMYPLISWKEYRGIKGVHFGK---ALEVIQTNDDEAPRGSRV  698
            PL   L+ GR +++  ++W EY  +K   FG    ALE++Q   DE  +G R 
Sbjct  316  PLASALLPGRKAVFRAVTWPEYMEVKHKVFGTDAPALEMLQLQVDEEEQGERA  368


 Score = 46.6 bits (109),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 41/79 (52%), Gaps = 6/79 (8%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKK----CPDPTR  277
            +++ Y  ++  L  ++  L F ALGL+  DV +   ++        +       CP+P R
Sbjct  167  VMEEYDREMRALGGRLLDLFFMALGLT--DVQFATGETERRIRETWTATMHPILCPEPER  224

Query  278  ALGMVPHTDSSLITLLYQS  334
            A+G+  HTDS  ITL+ QS
Sbjct  225  AIGLTAHTDSGFITLIMQS  243



>gb|KDO80406.1| hypothetical protein CISIN_1g043986mg, partial [Citrus sinensis]
Length=195

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L+  Y   T  +  QV+  N  WV V P+  ALVV V D+MQI  NG+FKS  H
Sbjct  68   HTDSSLLTSLYQGNTSGL--QVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRFKSALH  125

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA+V+   +RIS  +F+GP  D+K S  +KL       +Y  ++W+EY   K  HF KA+
Sbjct  126  RALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATHFNKAI  185

Query  651  EVIQ  662
            E+I+
Sbjct  186  ELIR  189


 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLK----SKSTSAFLHFNSYKKCPDPTRALGM  289
            Y+++L GLA KI  L+F++LGL++ED+ W K     KS    L  NSY  CPDP RA+G+
Sbjct  6    YQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMGL  65

Query  290  VPHTDSSLITLLYQSNTNS  346
             PHTDSSL+T LYQ NT+ 
Sbjct  66   APHTDSSLLTSLYQGNTSG  84



>gb|ADK70966.1| gibberellin 3-beta-hydroxylase [Medicago hybrida]
 gb|ADK70996.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=295

 Score = 68.2 bits (165),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  138  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  197

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  198  LAPHTDSTFLTILSQND  214


 Score = 58.5 bits (140),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  219  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPHEKLV  290



>gb|ADK70997.1| gibberellin 3-beta-hydroxylase [Medicago saxatilis]
Length=293

 Score = 67.8 bits (164),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 58.5 bits (140),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 59.3 bits (142),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG F SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|KDP21181.1| hypothetical protein JCGZ_21652 [Jatropha curcas]
Length=366

 Score = 70.5 bits (171),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            KW+ VKP+P+A VVN+ DMM+I SNG ++S++HRA V+    RIS   F+ PK+D
Sbjct  259  KWIPVKPLPNAFVVNIGDMMEIVSNGVYRSIEHRATVNSTKERISAATFYTPKLD  313


 Score = 55.5 bits (132),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y  ++  LA+KI   I KAL +  E++  L +    + +  N Y  CP+P +A+G+ 
Sbjct  174  LETYATEMKKLAIKILGQIAKALKMDTEEMKELTNDGYQS-MRMNYYPPCPEPEKAIGLT  232

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+ ++T+L Q N   G
Sbjct  233  PHSDADILTILLQLNEIEG  251



>gb|ADK70971.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=292

 Score = 67.8 bits (164),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMCLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.5 bits (140),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71026.1| gibberellin 3-beta-hydroxylase [Trifolium semipilosum]
Length=269

 Score = 71.2 bits (173),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  124  IVLQYDETMKKLAEKLMLLMLDSLGITKEDIIWANSKAQFENACAAMQLNSYPICPDPDR  183

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L QS+
Sbjct  184  AMGLAPHTDSTFLTILSQSD  203


 Score = 55.1 bits (131),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            QV      WV V PI   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP
Sbjct  208  QVQREGFGWVTVPPIHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGP  266



>gb|ADK71016.1| gibberellin 3-beta-hydroxylase [Trigonella foenum-graecum]
Length=292

 Score = 66.6 bits (161),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+      SA L  NSY  CPDP 
Sbjct  129  IVLQYDETMKILAGKLMFLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSCPDPD  188

Query  275  RALGMVPHTDSSLITLLYQSN  337
             A+G+  HTDS+ +T+L Q++
Sbjct  189  HAMGLARHTDSTFLTILSQND  209


 Score = 59.7 bits (143),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV   +  WV V P+   LVVNV D+  I SNG + SV HRA+V++   R S+ + +GP 
Sbjct  214  QVQREDFGWVTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHAKLV  285



>gb|ADK70995.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=298

 Score = 67.8 bits (164),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDH  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 58.2 bits (139),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>ref|XP_008667799.1| PREDICTED: uncharacterized protein LOC100273620 isoform X1 [Zea 
mays]
 tpg|DAA44842.1| TPA: hypothetical protein ZEAMMB73_078381 [Zea mays]
Length=376

 Score = 86.3 bits (212),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV  P+ +W+ V+P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+
Sbjct  251  QVRSPDGQWIVVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEDRLSMAFFYNPR  310

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYR  617
             DL  +   +LV   R ++YP +++ EYR
Sbjct  311  SDLPIAPMAELVGPDRPALYPEMTFDEYR  339


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 34/72 (47%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y E+++ L  ++  L+   LGL    +   +       A L  N Y +CP P   LG+
Sbjct  170  EEYGEEVLQLCRRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRVNFYPQCPQPELTLGV  229

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  230  AGHSDPGGMTML  241



>gb|ADK71004.1| gibberellin 3-beta-hydroxylase [Melilotus albus]
Length=302

 Score = 68.9 bits (167),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            ++  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  139  IILQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAALQLNSYPSCPDPD  198

Query  275  RALGMVPHTDSSLITLLYQSN  337
             A+G+ PHTDS+ +T+L Q++
Sbjct  199  HAMGLAPHTDSTFLTILSQND  219


 Score = 57.4 bits (137),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D   I SNG + SV HR +V++   R S+ + +GP 
Sbjct  224  QVQREGSGWVTVPPLHGGLVVNVGDXFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  283

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  284  SNVEIGPHAKLV  295



>gb|ADK70962.1| gibberellin 3-beta-hydroxylase [Medicago daghestanica]
Length=290

 Score = 67.0 bits (162),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  135  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  194

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  195  LAPHTDSTFLTILSQND  211


 Score = 59.3 bits (142),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG F SV HR +V++   R S+ + +GP 
Sbjct  216  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPP  275

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  276  SNVEICPHEKLV  287



>gb|ADK71000.1| gibberellin 3-beta-hydroxylase [Medicago soleirolii]
Length=281

 Score = 67.0 bits (162),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  121  VLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  180

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L Q++ + 
Sbjct  181  AMGLAPHTDSTFLTILSQNDISG  203


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV     +WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  205  QVQREGSEWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  264

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  265  SNVEICPHEKLV  276



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score = 69.3 bits (168),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP RA+G
Sbjct  140  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDRAMG  199

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  200  LAPHTDSTFLTILSQND  216


 Score = 56.6 bits (135),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   ++S+ + +GP 
Sbjct  221  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRGLVNRTRQKVSVAYLYGPP  280

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  281  SNVEICPHEKLV  292



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score = 68.9 bits (167),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+      +A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+L+T+L Q++
Sbjct  199  LAPHTDSTLLTILSQND  215


 Score = 57.0 bits (136),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ADK70994.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=295

 Score = 68.2 bits (165),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  138  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  197

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  198  LAPHTDSTFLTILSQND  214


 Score = 58.2 bits (139),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  219  QVQXEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  279  SNVEICPHEKLV  290



>gb|ADK70993.1| gibberellin 3-beta-hydroxylase [Medicago sativa]
Length=298

 Score = 68.2 bits (165),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED++W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 57.8 bits (138),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQGEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>ref|NP_001141508.1| uncharacterized protein LOC100273620 [Zea mays]
 gb|ACF86518.1| unknown [Zea mays]
Length=315

 Score = 86.3 bits (212),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV  P+ +W+ V+P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+
Sbjct  190  QVRSPDGQWIVVEPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEDRLSMAFFYNPR  249

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYR  617
             DL  +   +LV   R ++YP +++ EYR
Sbjct  250  SDLPIAPMAELVGPDRPALYPEMTFDEYR  278


 Score = 39.7 bits (91),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 34/72 (47%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y E+++ L  ++  L+   LGL    +   +       A L  N Y +CP P   LG+
Sbjct  109  EEYGEEVLQLCRRVMRLLSSGLGLEAGRLQAAFGGEGGEGACLRVNFYPQCPQPELTLGV  168

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  169  AGHSDPGGMTML  180



>gb|ADK70981.1| gibberellin 3-beta-hydroxylase [Medicago noeana]
Length=297

 Score = 67.0 bits (162),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQQEGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ABY49029.1| GA3-oxidase [Luziola fluitans]
Length=262

 Score = 65.5 bits (158),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA K+  L  KALGL+ E++  ++++     + +A +H N Y +CPDP 
Sbjct  118  VMEEFHKEMRTLAGKVLELFLKALGLTGEEIAGVEAERRIGETMTATMHLNWYPRCPDPH  177

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  178  RALGLIAHTDSGFFTFVLQS  197


 Score = 60.5 bits (145),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V+    RIS+ +F GP
Sbjct  211  RWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNADMDRISLGYFLGP  262



>gb|ADK70963.1| gibberellin 3-beta-hydroxylase [Medicago fischeriana]
Length=281

 Score = 67.4 bits (163),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+      +A +  NSY  CPDP  
Sbjct  123  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDH  182

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  183  AMGLAPHTDSTFLTILSQND  202


 Score = 58.2 bits (139),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  207  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  266

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  267  SNVEICPHEKLV  278



>ref|XP_010057195.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74240.1| hypothetical protein EUGRSUZ_E02879 [Eucalyptus grandis]
Length=359

 Score = 69.3 bits (168),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            KWV VKP+P+A VVNV D+++I +NG ++S++HRA+V+    R+SI  F  PK++ K   
Sbjct  258  KWVSVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVNSVKERLSIAAFHSPKLEGKCGP  317

Query  555  PLKLV-KGRDSMYPLISWKEY-RGI  623
               L+ + + +++  I   +Y RG+
Sbjct  318  AASLITQEKPALFRRIGMADYLRGL  342


 Score = 56.6 bits (135),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++D Y  +L  LAMKI  L+ KAL +  +D+  L  +   A L  N Y  CP P    G+
Sbjct  172  VLDEYSSELRDLAMKILLLMAKALQMEPKDMIELFDEGRQA-LRMNYYPPCPRPELVTGL  230

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+DS+ +T+L Q N   G
Sbjct  231  TPHSDSTGLTILLQVNEMEG  250



>ref|XP_010057206.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74250.1| hypothetical protein EUGRSUZ_E02891 [Eucalyptus grandis]
Length=370

 Score = 69.7 bits (169),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            KWV VKP+P+A VVNV D+++I +NG ++S++HRA ++    R+S   F+GPK+D
Sbjct  258  KWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATINSMKERLSFATFYGPKLD  312


 Score = 56.2 bits (134),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y  +L  LAMKI  L+ K L +  +DV  L      A L  N Y  CP P   +G+
Sbjct  172  VLEKYSSELRDLAMKILLLVAKPLKMDTKDVIELFDGGRQA-LRMNYYPPCPRPELVIGL  230

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+D+S +T+L Q N   G
Sbjct  231  TPHSDASALTILLQVNEMEG  250



>ref|XP_010057207.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=363

 Score = 69.7 bits (169),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            KWV VKP+P+A VVNV D+++I +NG ++S++HRA ++    R+S   F+GPK+D
Sbjct  251  KWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATINSMKERLSFATFYGPKLD  305


 Score = 56.2 bits (134),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y  +L  LAMKI  L+ K L +  +DV  L      A L  N Y  CP P   +G+
Sbjct  165  VLEKYSSELRDLAMKILLLVAKPLKMDTKDVIELFDGGRQA-LRMNYYPPCPRPELVIGL  223

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+D+S +T+L Q N   G
Sbjct  224  TPHSDASALTILLQVNEMEG  243



>gb|ADK70999.1| gibberellin 3-beta-hydroxylase [Medicago shepardii]
Length=292

 Score = 67.4 bits (163),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+      +A +  NSY  CPDP  A+G
Sbjct  133  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHAMG  192

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  193  LAPHTDSTFLTILSQND  209


 Score = 58.2 bits (139),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71003.1| gibberellin 3-beta-hydroxylase [Medicago turbinata]
Length=288

 Score = 67.0 bits (162),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  131  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  190

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDS+ +T+L Q++
Sbjct  191  GLAPHTDSTFLTILSQND  208


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV   +  WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  213  QVQREDSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  272

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  273  SNVEICPHEKLV  284



>ref|XP_011077657.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Sesamum indicum]
Length=361

 Score = 75.5 bits (184),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
            +W+ V PIP+A +VN+ D +Q+ SNG +KSV+HR IV+    R+S+  F+ PK D+    
Sbjct  258  RWLTVTPIPNAFIVNLGDQLQVVSNGNYKSVEHRVIVNSVKERVSLALFYNPKGDILMKP  317

Query  555  PLKLV-KGRDSMYPLISWKEYR  617
              +LV K    +YP +++ EYR
Sbjct  318  AEQLVTKDHPPLYPPMTFDEYR  339


 Score = 50.4 bits (119),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            LV  Y ++++ +  K+  ++   LGL EE + +    +  SA +  N Y KCP P   LG
Sbjct  170  LVGEYSKEVVKVGEKMMKILSSNLGLEEEYLQEAFGGEEMSACMRINYYPKCPQPELTLG  229

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D   +TLL      SG
Sbjct  230  LSPHSDPGGLTLLLPDENVSG  250



>gb|ADK70965.1| gibberellin 3-beta-hydroxylase [Medicago heyniana]
Length=293

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  131  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPEH  190

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L Q++ + 
Sbjct  191  AMGLAPHTDSTFLTILSQNDISG  213


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  215  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  274

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  275  SNVEICPHEKLV  286



>ref|XP_006429403.1| hypothetical protein CICLE_v10012026mg [Citrus clementina]
 ref|XP_006481048.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Citrus sinensis]
 gb|ESR42643.1| hypothetical protein CICLE_v10012026mg [Citrus clementina]
 gb|KDO56655.1| hypothetical protein CISIN_1g017934mg [Citrus sinensis]
Length=363

 Score = 79.7 bits (195),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
             W+ VKP+P+A +VN+ D +Q+ SN  +KSV+HR IV+    R+S+ FF+ PK DL    
Sbjct  261  NWITVKPVPNAFIVNIGDQIQVLSNAIYKSVEHRVIVNSEKDRVSLAFFYNPKSDLLIE-  319

Query  555  PLK--LVKGRDSMYPLISWKEYR  617
            P+K  + + R ++YP +++ EYR
Sbjct  320  PMKEFVTRNRPALYPPMTYDEYR  342


 Score = 45.8 bits (107),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 41/84 (49%), Gaps = 7/84 (8%)
 Frame = +2

Query  110  LVDNYKEQLM---GLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTR  277
            LV  Y E L+   G+ MK+ S+    LGL E+   +    +   A L  N Y KCP P  
Sbjct  173  LVSEYGENLVKLCGVLMKVLSI---NLGLQEDQFQNAFGGEEIGACLRVNFYPKCPQPDL  229

Query  278  ALGMVPHTDSSLITLLYQSNTNSG  349
             LG+ PH+D   +TLL      +G
Sbjct  230  TLGLSPHSDPGGMTLLLPDENVAG  253



>emb|CDX81720.1| BnaC08g38810D [Brassica napus]
Length=358

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y   T  +  QVF  +  WV V P+P +LVVNV D+  I SNG FKSV H
Sbjct  232  HTDSTLLTILYQNNTAGL--QVFRDDLGWVTVPPVPGSLVVNVGDLFHILSNGLFKSVIH  289

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            R  V+Q   R+S+ F +GP+ D K S   KLV   +S +Y  ++W EY   K  HF KAL
Sbjct  290  RVRVNQTRPRLSVAFLWGPRSDTKISPVPKLVSPDESPLYRSVTWTEYLRTKATHFNKAL  349

Query  651  EVIQTNDDE  677
             +I+ + ++
Sbjct  350  SMIRNHREK  358


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V+ Y+EQ+  LA K+  L   +LG+SEED+ W +  S      + L  N Y  CP+P R
Sbjct  166  IVEQYEEQMQKLASKLMWLSLNSLGVSEEDIKWARVSSDLNWAQSALQLNHYPVCPEPDR  225

Query  278  ALGMVPHTDSSLITLLYQSNT  340
            A+G+ PHTDS+L+T+LYQ+NT
Sbjct  226  AMGLAPHTDSTLLTILYQNNT  246



>gb|ADK70974.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=275

 Score = 68.9 bits (167),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  120  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  179

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q+N
Sbjct  180  AMGLAPHTDSTFLTILSQNN  199


 Score = 56.6 bits (135),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  204  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  263

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  264  SNVEICPHEKLV  275



>gb|AGH39958.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=293

 Score = 68.6 bits (166),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  131  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  190

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q+N
Sbjct  191  AMGLAPHTDSTFLTILSQNN  210


 Score = 57.0 bits (136),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  215  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  274

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  275  SNVEICPHEKLV  286



>gb|ADK70998.1| gibberellin 3-beta-hydroxylase [Medicago secundiflora]
Length=291

 Score = 67.4 bits (163),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+      +A +  NSY  CPDP  A+G
Sbjct  133  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPDHAMG  192

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  193  LAPHTDSTFLTILSQND  209


 Score = 58.2 bits (139),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV   +  WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREDSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTYQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71011.1| gibberellin 3-beta-hydroxylase [Trigonella caerulea]
Length=294

 Score = 71.6 bits (174),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  131  IVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVENACAALQLNSYPSCPDPD  190

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+ PHTDS+ +T+L Q++
Sbjct  191  RAMGLAPHTDSTFLTILSQND  211


 Score = 53.9 bits (128),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV +    WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +G  
Sbjct  216  QVQQEGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGAP  275

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  276  SNVEICPHEKLV  287



>gb|ADK70973.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=292

 Score = 68.6 bits (166),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q+N
Sbjct  190  AMGLAPHTDSTFLTILSQNN  209


 Score = 56.6 bits (135),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>ref|XP_007209291.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
 gb|EMJ10490.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
Length=358

 Score = 76.6 bits (187),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            N KWV +KP+P AL+VN+ D+++I SNG++KS++HRA+V+    R+SI  F  P + +  
Sbjct  255  NGKWVPIKPVPGALIVNIGDIIEILSNGEYKSIEHRAVVNTERERLSIAGFHSPNM-MSM  313

Query  549  SFPL-KLVKGRDSMYPLISWKEY  614
              PL  LVK + + Y  IS +EY
Sbjct  314  IGPLPDLVKEKAANYKAISNEEY  336


 Score = 48.5 bits (114),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (51%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            +D Y  +L  +   +  LI K LGL+ E +  +    T   L  N Y  CP  +R +G+ 
Sbjct  172  LDKYSVELQEVTKYLWKLICKNLGLNSEKLASMFEDGTQG-LRMNYYPPCPQASRVMGLT  230

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  +TLL Q N   G
Sbjct  231  PHSDAVGLTLLIQVNDVQG  249



>gb|ADK70964.1| gibberellin 3-beta-hydroxylase [Medicago granadensis]
Length=292

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK70972.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=289

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71020.1| gibberellin 3-beta-hydroxylase [Trigonella macrorrhyncha]
Length=271

 Score = 68.6 bits (166),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  110  IVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVEKACAALQLNSYPSCPDPD  169

Query  275  RALGMVPHTDSSLITLLYQSNTNS  346
            RA+G+  HTDS+ +T+L Q++ + 
Sbjct  170  RAMGLAAHTDSTFLTILSQNDISG  193


 Score = 56.6 bits (135),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  195  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRYSVAYLYGPP  254

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  255  SNVEICPHAKLV  266



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  125  VLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  184

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  185  AMGLAPHTDSTFLTILSQND  204


 Score = 58.2 bits (139),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  209  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  268

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  269  SNVEICPHEKLV  280



>gb|ADK70979.1| gibberellin 3-beta-hydroxylase [Medicago monantha]
Length=285

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  127  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  186

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L Q++ + 
Sbjct  187  AMGLAPHTDSTFLTILSQNDISG  209


 Score = 58.2 bits (139),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  211  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  270

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  271  SNVEICPHEKLV  282



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSCPDPDH  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 58.2 bits (139),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  136  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  195

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  196  AMGLAPHTDSTFLTILSQND  215


 Score = 58.5 bits (140),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++  +R S+ + +GP 
Sbjct  220  QVQREGXGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRHRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
              ++     KLV
Sbjct  280  SKVEICPHEKLV  291



>gb|ADK70988.1| gibberellin 3-beta-hydroxylase [Medicago praecox]
Length=293

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  137  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  196

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  197  LAPHTDSTFLTILSQND  213


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  218  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTHQRFSVAYLYGPP  277

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  278  SNVEICPHEKLV  289



>gb|ADK70969.1| gibberellin 3-beta-hydroxylase [Medicago italica]
Length=288

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  131  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  190

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDS+ +T+L Q++
Sbjct  191  GLAPHTDSTFLTILSQND  208


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  213  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  272

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  273  SNVEICPHEKLV  284



>gb|ADK70960.1| gibberellin 3-beta-hydroxylase [Medicago ciliaris]
Length=292

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  132  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  191

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDS+ +T+L Q++
Sbjct  192  GLAPHTDSTFLTILSQND  209


 Score = 58.5 bits (140),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK70968.1| gibberellin 3-beta-hydroxylase [Medicago intertexta]
Length=289

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  132  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  191

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDS+ +T+L Q++
Sbjct  192  GLAPHTDSTFLTILSQND  209


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|KDP21184.1| hypothetical protein JCGZ_21655 [Jatropha curcas]
Length=369

 Score = 65.5 bits (158),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            W+ VKPIP+A ++N+ DM++I +NG ++S++HRA +S    R+SI  F  PK D +    
Sbjct  262  WIPVKPIPNAFIINIGDMLEIVTNGIYRSIEHRATISSNKERLSIATFHNPKFDAELVAA  321

Query  558  LKLV  569
              LV
Sbjct  322  SSLV  325


 Score = 59.7 bits (143),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF--LHFNSYKKCPDPTRALG  286
            ++ Y E+L G+A KI  L+ KALG+ E  VD+++      +  +  N Y  CP P   +G
Sbjct  175  IEAYSEELQGVANKIFKLVIKALGIME--VDYIRELFEEGWQAMRMNYYPSCPQPDLVIG  232

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D++ +T+L+Q N   G
Sbjct  233  LKPHSDATGLTILFQLNDIVG  253



>gb|ADK70961.1| gibberellin 3-beta-hydroxylase [Medicago constricta]
Length=273

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  113  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  172

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L Q++ + 
Sbjct  173  AMGLAPHTDSTFLTILSQNDISG  195


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  197  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  256

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  257  SNVEICPHEKLV  268



>gb|ADK70978.1| gibberellin 3-beta-hydroxylase [Medicago monantha]
Length=292

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>ref|XP_009610880.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=355

 Score = 65.1 bits (157),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            W+ + P+P+A VVNV D ++IFSNG ++S++HR++VS    RISI  F  P++D
Sbjct  252  WIPILPLPNAFVVNVGDSLEIFSNGIYRSIEHRSVVSAVKERISIATFHSPRLD  305


 Score = 60.1 bits (144),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            +D Y E++  LAMK+  ++ KA+G+  E+V+ L  K   + +  N Y  CP P   +G+ 
Sbjct  166  IDAYSEEVKELAMKVLKVLGKAVGIKAEEVNNLFEKGMQS-MRMNYYPPCPQPDLVMGLC  224

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  + +L Q N   G
Sbjct  225  PHSDACALAILLQVNETEG  243



>gb|ADK70982.1| gibberellin 3-beta-hydroxylase [Medicago orbicularis]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>gb|ADK70989.1| gibberellin 3-beta-hydroxylase [Medicago prostrata]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 58.2 bits (139),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRRRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>ref|XP_008442413.1| PREDICTED: protein SRG1-like [Cucumis melo]
 gb|ADN33792.1| oxidoreductase 2OG-fe(II) oxygenase family protein [Cucumis melo 
subsp. melo]
Length=348

 Score = 79.7 bits (195),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 4/90 (4%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV + N  W+ V PIP+A +VN+ D +Q+ SNG +KSVKHR +V+    R+S+ FF+ PK
Sbjct  246  QVLKGND-WITVDPIPNAFLVNIGDQIQVLSNGIYKSVKHRVMVNPKKERVSLAFFYNPK  304

Query  534  IDLKFSFPLK--LVKGRDSMYPLISWKEYR  617
             DL    P K  L K R S++P +++ EYR
Sbjct  305  SDLIIE-PAKELLTKDRPSLFPSMTFDEYR  333


 Score = 45.1 bits (105),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 2/82 (2%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV--DWLKSKSTSAFLHFNSYKKCPDPTRAL  283
            L++ Y ++++ + +K+   +   LGL EE +   +   K     +  N Y KCP P   L
Sbjct  163  LIEEYGDEVVKVCVKLMKGLSMGLGLEEEYLLNAFGGEKGIGGSMRANMYPKCPQPDLTL  222

Query  284  GMVPHTDSSLITLLYQSNTNSG  349
            G+ PH+D   IT+L       G
Sbjct  223  GLSPHSDPGGITILLADQNVPG  244



>gb|ADK70991.1| gibberellin 3-beta-hydroxylase [Medicago rigidula]
Length=291

 Score = 67.0 bits (162),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  130  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSCPDPDH  189

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  190  AMGLAPHTDSTFLTILSQND  209


 Score = 58.2 bits (139),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVN+ D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGSGWVTVPPLHGGLVVNIGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHEKLV  285



>gb|ADK71012.1| gibberellin 3-beta-hydroxylase [Trigonella coerulescens]
Length=289

 Score = 68.6 bits (166),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPT  274
            +V  Y E +  LA K+  L+  +LG+++ED+ W  SK+       A L  NSY  CPDP 
Sbjct  127  IVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVEKACAALQLNSYPSCPDPD  186

Query  275  RALGMVPHTDSSLITLLYQSN  337
            RA+G+  HTDS+ +T+L Q++
Sbjct  187  RAMGLAAHTDSTFLTILSQND  207


 Score = 56.2 bits (134),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  212  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRYSVAYLYGPP  271

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  272  SNVEICPHAKLV  283



>emb|CDP06475.1| unnamed protein product [Coffea canephora]
Length=349

 Score = 75.9 bits (185),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  372  KKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS  551
            +KW+ VKP+P+A +VN+ D +Q+ SN +++SV+HR IV+    R+S+ FF+ P+ DL   
Sbjct  246  RKWITVKPVPNAFIVNIGDQIQVLSNARYRSVEHRVIVNSVKERVSLAFFYNPRGDLLVQ  305

Query  552  -FPLKLVKGRDSMYPLISWKEYR  617
              P  + +   ++Y  +++ EYR
Sbjct  306  PAPELVAEDSPALYSPMTYNEYR  328


 Score = 49.3 bits (116),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDW-LKSKSTSAFLHFNSYKKCPDPTRALG  286
            LV  Y E+L+ L  K+T ++   LGL EE +      +   A L  N Y KCP P   LG
Sbjct  159  LVGKYNEELVKLCGKLTKILSLNLGLKEEYLQQAFGGEEVGACLRINFYPKCPQPDLTLG  218

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            +  H+D   +TLL      +G
Sbjct  219  LSSHSDPGGMTLLLPDENVAG  239



>gb|KCW74246.1| hypothetical protein EUGRSUZ_E02883 [Eucalyptus grandis]
Length=282

 Score = 68.6 bits (166),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS  551
            KWV +KP+P+A VVNV D+++I  NG ++S++HRA+V+    R+SI  F+ PK++ +F 
Sbjct  181  KWVSLKPLPNAFVVNVGDILEIVMNGTYRSIEHRAMVNSMMERLSIAAFYSPKLEGEFG  239


 Score = 56.2 bits (134),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++D Y  +L  LAMKI  L+ KAL +  +D+  L  +   A L  N Y  CP P    G+
Sbjct  95   VLDEYSSELRDLAMKILLLMAKALQMEPKDMIELFDEGRQA-LRMNYYPPCPRPELVTGL  153

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+DS+ +T+L Q N   G
Sbjct  154  TPHSDSTGLTILLQVNEMEG  173



>ref|XP_002987280.1| hypothetical protein SELMODRAFT_450789 [Selaginella moellendorffii]
 gb|EFJ11595.1| hypothetical protein SELMODRAFT_450789 [Selaginella moellendorffii]
Length=372

 Score = 67.0 bits (162),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
              KW+ +KP+P A V+ V DM+Q+ SN  F S  HRA+V++   R+S+ +FF P   +  
Sbjct  276  GDKWIAIKPVPGAFVIQVGDMLQLMSNNVFHSALHRALVNERFERLSLVYFFTPPPTVSI  335

Query  549  SFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALE  653
              P+   K    +Y  ++W EY  +K   F  AL+
Sbjct  336  C-PIHPSK---PLYRCLTWNEYLQVKAKLFMGALD  366


 Score = 57.8 bits (138),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMVP  295
            + Y + + GLA+ IT LI   L  SEE +     ++    +H N Y  CP P+ A+G+  
Sbjct  195  EEYDKAMRGLALLITDLILHGLEASEERIH-QHIRNFWGMIHMNFYPPCPSPSEAMGLAS  253

Query  296  HTDSSLITLLYQSNTNS  346
            HTDSS +T+++Q +   
Sbjct  254  HTDSSCLTIMHQGSVGG  270



>ref|XP_002989203.1| hypothetical protein SELMODRAFT_450793 [Selaginella moellendorffii]
 gb|EFJ09797.1| hypothetical protein SELMODRAFT_450793 [Selaginella moellendorffii]
Length=372

 Score = 67.0 bits (162),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
              KW+ +KP+P A V+ V DM+Q+ SN  F S  HRA+V++   R+S+ +FF P   +  
Sbjct  276  GDKWIAIKPVPGAFVIQVGDMLQLMSNNVFHSALHRALVNERFERLSLVYFFTPPPTVSI  335

Query  549  SFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALE  653
              P+   K    +Y  ++W EY  +K   F  AL+
Sbjct  336  C-PIHPSK---PLYRCLTWNEYLQVKAKLFMGALD  366


 Score = 57.8 bits (138),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMVP  295
            + Y + + GLA+ IT LI   L  SEE +     ++    +H N Y  CP P+ A+G+  
Sbjct  195  EEYDKAMRGLALLITDLILHGLEASEERIH-QHIRNFWGMIHMNFYPPCPSPSEAMGLAS  253

Query  296  HTDSSLITLLYQSNTNS  346
            HTDSS +T+++Q +   
Sbjct  254  HTDSSCLTIMHQGSVGG  270



>gb|ADK70990.1| gibberellin 3-beta-hydroxylase [Medicago radiata]
Length=298

 Score = 67.0 bits (162),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRALG  286
            Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+G
Sbjct  139  YDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAMG  198

Query  287  MVPHTDSSLITLLYQSN  337
            + PHTDS+ +T+L Q++
Sbjct  199  LAPHTDSTFLTILSQND  215


 Score = 57.8 bits (138),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  220  QVQREGSGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  279

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  280  SNVEICPHEKLV  291



>ref|XP_011095018.1| PREDICTED: leucoanthocyanidin dioxygenase [Sesamum indicum]
Length=359

 Score = 76.3 bits (186),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
             +KW+ V P+P+A +VN+ D +++ SNG +KSV+HR IV+    R+SI  F+ P+ D+  
Sbjct  255  GEKWITVDPVPNAFIVNIGDQLEVLSNGNYKSVEHRVIVNSEKERVSIALFYNPRGDMLI  314

Query  549  SFPLKLV-KGRDSMYPLISWKEYR  617
                +LV + R  +YP   + EYR
Sbjct  315  KPADELVTEDRPPLYPPTVYDEYR  338


 Score = 48.5 bits (114),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 41/81 (51%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            +V  Y  +++ L  ++  ++   LGL EE + +    +   A +  N Y KCP P   LG
Sbjct  169  MVGEYCREVVELGGRLMKILSSNLGLEEEYLQEAFGGEEFGACMRVNYYPKCPQPDLTLG  228

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D   +TLL+     SG
Sbjct  229  LSPHSDPGGMTLLFPDENVSG  249



>gb|ABX10776.1| gibberellin 3-oxidase-like protein [Selaginella moellendorffii]
Length=371

 Score = 67.0 bits (162),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
              KW+ +KP+P A V+ V DM+Q+ SN  F S  HRA+V++   R+S+ +FF P   +  
Sbjct  275  GDKWIAIKPVPGAFVIQVGDMLQLMSNNVFHSALHRALVNERFERLSLVYFFTPPPTVSI  334

Query  549  SFPLKLVKGRDSMYPLISWKEYRGIKGVHFGKALE  653
              P+   K    +Y  ++W EY  +K   F  AL+
Sbjct  335  C-PIHPSK---PLYRCLTWNEYLQVKAKLFMGALD  365


 Score = 57.8 bits (138),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMVP  295
            + Y + + GLA+ IT LI   L  SEE +     ++    +H N Y  CP P+ A+G+  
Sbjct  194  EEYDKAMRGLALLITDLILHGLEASEERIH-QHIRNFWGMIHMNFYPPCPSPSEAMGLAS  252

Query  296  HTDSSLITLLYQSNTNS  346
            HTDSS +T+++Q +   
Sbjct  253  HTDSSCLTIMHQGSVGG  269



>gb|AFN53718.1| putative flavonol synthase [Linum usitatissimum]
Length=234

 Score = 62.8 bits (151),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + KWV +KP+ +A VVN+ D+M+I SNG ++S++HRA V+  S R+S+  F+  K++   
Sbjct  122  DGKWVPIKPLLNAFVVNIGDIMEIMSNGVYRSIEHRAAVNPTSERLSVATFYSCKLNCTL  181

Query  549  SFPLKLV  569
                 LV
Sbjct  182  GPATSLV  188


 Score = 62.0 bits (149),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y E+L  LA++I S + KALG+   +++ + S    + +  N Y  CP+P +A+G  
Sbjct  39   LETYSEELKRLALRILSYMSKALGMDVHEMEDMFSDGVQS-MRMNYYPPCPEPDKAIGFT  97

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  +T+LYQ N   G
Sbjct  98   PHSDADALTILYQLNDTEG  116



>ref|XP_010423451.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Camelina 
sativa]
Length=375

 Score = 73.6 bits (179),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            N  W+ VKP P A +VN+ D +QI SN  +KSV+HR IV+    R+S+ FF+ PK D+  
Sbjct  269  NDTWITVKPHPHAFIVNIGDQIQILSNATYKSVEHRVIVNSNKERVSLAFFYNPKSDIPI  328

Query  549  SFPLKLVKGRD-SMYPLISWKEYR  617
                +LV   +  +YP +++ +YR
Sbjct  329  QPLQELVSAHNPPLYPPMTFDQYR  352


 Score = 50.8 bits (120),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y ++L+ L+ +I  ++   LGL ++   D    ++  A L  N Y KCP P  ALG
Sbjct  183  VIDEYGKELVNLSGRIMRVLSTNLGLKDDKFQDAFGGENIGACLRVNYYPKCPRPELALG  242

Query  287  MVPHTDSSLITLL  325
            + PH+D   +T+L
Sbjct  243  LSPHSDPGGMTIL  255



>gb|KDP22220.1| hypothetical protein JCGZ_26051 [Jatropha curcas]
Length=363

 Score = 64.3 bits (155),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            W+ VKPIP+A ++N+ DM++I +NG + S++HRA ++ +  R+SI  F  PK D
Sbjct  256  WIPVKPIPNAFIINIGDMLEILTNGIYPSIEHRATINSSKERLSIATFHNPKFD  309


 Score = 60.5 bits (145),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAF--LHFNSYKKCPDPTRALG  286
            ++ Y E+L GLA KI +L+ KALG+ E  VD++       +  +  N Y  CP P   +G
Sbjct  169  IEAYSEELQGLANKIFNLVIKALGILE--VDYITESFEKGWQAMRMNYYPPCPQPELVMG  226

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D+S +T+L+Q N   G
Sbjct  227  VNPHSDASGLTILFQLNDVVG  247



>ref|XP_007026685.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOY07187.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=360

 Score = 85.1 bits (209),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            N KW+ VKP+P+A +VNV D +Q+ SNG +KSV+HR IV+ A  R+S+ FF+ PK DL  
Sbjct  256  NGKWITVKPVPNAFIVNVGDQLQVLSNGIYKSVEHRVIVNSAKDRVSLAFFYNPKSDLLI  315

Query  549  SFPLKLV-KGRDSMYPLISWKEYR  617
                +LV K R ++Y  +++ EYR
Sbjct  316  EPAKELVSKDRPALYNPMTFDEYR  339


 Score = 39.7 bits (91),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 40/84 (48%), Gaps = 7/84 (8%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLK----SKSTSAFLHFNSYKKCPDPTR  277
            LV  Y  +++ L  ++   +   LGL E   D+L+     +   A L  N Y KCP P  
Sbjct  170  LVAEYGAEVVKLCGRLLKAMSTNLGLPE---DYLQKAFGGEDIGACLRVNFYPKCPQPDL  226

Query  278  ALGMVPHTDSSLITLLYQSNTNSG  349
             LG+  H+D   +T+L   +  +G
Sbjct  227  TLGLSSHSDPGAMTILLPDHDVAG  250



>emb|CDY08545.1| BnaA05g27810D [Brassica napus]
Length=405

 Score = 69.7 bits (169),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSFP  557
            W+ V  +P+A VVN+ D MQI SN  +KS +HR IV+    R+S+ FF+ PK D+     
Sbjct  302  WITVNALPNAFVVNLGDQMQILSNSIYKSSEHRVIVNSQKERVSLAFFYNPKSDIPIQPL  361

Query  558  LKLVKGRD-SMYPLISWKEYR  617
             +L+   +  +YP +S+ +YR
Sbjct  362  EQLISSTNPPLYPPMSYDQYR  382


 Score = 54.7 bits (130),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            +VD Y E+L+ L   +  ++   LG++EE + +    +  SA +  N Y KCP P  ALG
Sbjct  213  VVDEYGEELVKLGESLMRILSSNLGVNEEQLQEAFGGEDFSACMRVNYYPKCPRPELALG  272

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D   IT+L   +  +G
Sbjct  273  LSPHSDPGGITILLPDDQVAG  293



>gb|ADK70992.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=292

 Score = 66.6 bits (161),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  135  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  194

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  195  AMGLAPHTDSTFLTILSQND  214


 Score = 57.8 bits (138),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  219  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPP  278

Query  534  IDLKFSFPLKLV  569
             +++ S   KLV
Sbjct  279  SNVEISPHEKLV  290



>ref|XP_010057205.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74248.1| hypothetical protein EUGRSUZ_E02888 [Eucalyptus grandis]
Length=370

 Score = 70.1 bits (170),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            KWV VKP+P+A VVNV D+++I +NG ++S++HRA V+    R+S   F+GPK+D
Sbjct  258  KWVPVKPLPNAFVVNVGDILEIVTNGTYRSIEHRATVNSMKERLSFATFYGPKLD  312


 Score = 54.3 bits (129),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++  Y  +L  LAMKI  L+ K L +  +DV  L      A L  N Y  CP P   +G+
Sbjct  172  VLQKYSSELRDLAMKILLLMAKPLKMDTKDVMELFDGGRQA-LRMNYYPPCPRPELVIGL  230

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+D+S +T+L Q N   G
Sbjct  231  TPHSDASALTILLQVNEMEG  250



>gb|EMT22046.1| Flavonol synthase/flavanone 3-hydroxylase [Aegilops tauschii]
Length=368

 Score = 82.4 bits (202),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + +W+ V P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+ D+  
Sbjct  259  DGQWITVDPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEERLSLAFFYNPRSDVPV  318

Query  549  SFPLKLVK-GRDSMYPLISWKEYR  617
            +   +LV  GR  +YP +++ EYR
Sbjct  319  APMAELVAPGRPVLYPEMTFDEYR  342


 Score = 42.4 bits (98),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 36/72 (50%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y EQ++ L  +++ ++ K LGL    +   +       A +  N Y +CP P   LG+
Sbjct  174  EEYGEQVVKLCRRVSKVLSKGLGLDGGRLQAAFGGEGGEGACMRVNFYPRCPQPELTLGV  233

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  234  AAHSDPGGMTML  245



>ref|XP_010057201.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74244.1| hypothetical protein EUGRSUZ_E02881 [Eucalyptus grandis]
Length=359

 Score = 67.8 bits (164),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            KWV VKP+P+A VVNV D+++I +NG ++S++HRA+V+    R+SI  F  PK++
Sbjct  258  KWVSVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVNSMKERLSIAAFHSPKLE  312


 Score = 56.6 bits (135),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++D Y  +L  LAMKI  L+ KAL +  +D+  L  +   AF   N Y  CP P    G+
Sbjct  172  VLDEYSSELRDLAMKILLLMAKALQMEFKDMIELFDEGRQAF-RMNYYPPCPRPELVTGL  230

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+DS+ +T+L Q N   G
Sbjct  231  TPHSDSTGLTILLQVNEMEG  250



>gb|EYU22811.1| hypothetical protein MIMGU_mgv1a008725mg [Erythranthe guttata]
Length=364

 Score = 84.7 bits (208),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 1/95 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QVF  NK W  VKP P+ALV+N+ D     SNG +KS +HRA+V++   R+S+ FF  PK
Sbjct  251  QVFSKNK-WKSVKPRPNALVINLGDTFAALSNGVYKSCEHRAVVNEKMARVSLVFFMCPK  309

Query  534  IDLKFSFPLKLVKGRDSMYPLISWKEYRGIKGVHF  638
             D     P +LVK R  +YP   W EY G    H+
Sbjct  310  EDKVIVPPKELVKKRQRLYPDFKWSEYLGFTQKHY  344


 Score = 39.7 bits (91),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (53%), Gaps = 5/78 (6%)
 Frame = +2

Query  104  ALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKS--KSTSAFLHFNSYKKCPDPTR  277
             L+ + Y E +  L++ I  ++  +LG++     + K   +  S+ +  N Y  C +P  
Sbjct  170  GLIFEKYCEAMKKLSLTIMEILGISLGVNRS---YFKEFFEDGSSIMRCNFYPPCQEPDL  226

Query  278  ALGMVPHTDSSLITLLYQ  331
            ALG  PH D + +T+L+Q
Sbjct  227  ALGTGPHCDPTALTILHQ  244



>gb|ABY49025.1| GA3-oxidase [Oryza officinalis]
Length=260

 Score = 63.5 bits (153),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E+V  ++++     + +A +H N Y +CPDP 
Sbjct  116  VMEEFHKEMRRLADELLELFLRALGLTGEEVAGIEAERRIAETMTATMHLNWYPRCPDPR  175

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  176  RALGLIAHTDSGFFTFVLQS  195


 Score = 60.8 bits (146),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            +WV V  +P A +VNV D+  I +NG+F SV HRA+V++   RIS+ +F GP
Sbjct  209  RWVAVPAVPGAFIVNVGDLFHILTNGRFHSVYHRAVVNRDRDRISLGYFLGP  260



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L++ Y       VQ+  + +  WV V  +  AL+VN+ D+M I SNG+FKS  H
Sbjct  231  HTDSSLLTVLYQSCMGLQVQR--KEDIGWVPVHTVDGALIVNLGDLMHIMSNGRFKSAMH  288

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLV-KGRDSMYPLISWKEYRGIKGVHFGKAL  650
            RA+V++  +R+S+ +F GP  + K S  ++++   R  MY  ++WKEY  I+  HF KAL
Sbjct  289  RAVVNKTHHRVSVAYFCGPPKEEKISSLIQMIDDDRPRMYRGVTWKEYLEIRAAHFDKAL  348

Query  651  EVIQTND-DEA  680
            E I+ N+ D+A
Sbjct  349  EFIKNNNIDDA  359


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK----STSAFLHFNSYKKCPDPTR  277
            +++ Y++++ GL+ K+  LI ++LG++ ED+ W   K    S  A L  NSY  CPDPTR
Sbjct  165  VMEMYQKEMKGLSEKLLELILRSLGVNYEDIKWANPKNGLSSYQALLQLNSYPVCPDPTR  224

Query  278  ALGMVPHTDSSLITLLYQS  334
            A+G+ PHTDSSL+T+LYQS
Sbjct  225  AMGLAPHTDSSLLTVLYQS  243



>ref|XP_010057211.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74256.1| hypothetical protein EUGRSUZ_E02902 [Eucalyptus grandis]
Length=363

 Score = 67.4 bits (163),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + KWV VKP+P A +VNV D+++I +NG ++S++HRA V+    R+SI  FF P++D + 
Sbjct  253  DGKWVPVKPLPGAFIVNVGDIVEIMTNGIYQSIEHRAAVNAVKERVSIATFFSPRMDAEI  312

Query  549  S  551
             
Sbjct  313  G  313


 Score = 57.0 bits (136),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            +D Y +++  LA+K+  LI KALG+  +D++ +  +     +  N Y  CP P  A+G+ 
Sbjct  170  LDAYSKEMQALAIKLLYLIVKALGIEAKDLEGMFEEGLQG-MRMNYYPPCPQPELAIGLN  228

Query  293  PHTDSSLITLLYQSNTNSG  349
             H+D+  IT+L Q N   G
Sbjct  229  SHSDADAITILLQVNEMEG  247



>gb|ABY49031.1| GA3-oxidase [Rhynchoryza subulata]
Length=260

 Score = 63.2 bits (152),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA K+  L  +ALGL+ E +  ++++     + +A +H N Y +CPDP 
Sbjct  116  VMEEFHKEMRELADKLLELFLRALGLTGEQIAGVEAEKKIGETMTATMHLNWYPRCPDPQ  175

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  176  RALGLIAHTDSGFFTFVLQS  195


 Score = 61.2 bits (147),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP
Sbjct  209  RWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRISLGYFLGP  260



>ref|XP_002976806.1| hypothetical protein SELMODRAFT_105948 [Selaginella moellendorffii]
 gb|ABX10769.1| gibberellin 20-oxidase-like protein [Selaginella moellendorffii]
 gb|EFJ21916.1| hypothetical protein SELMODRAFT_105948 [Selaginella moellendorffii]
Length=397

 Score = 75.5 bits (184),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + +W+ VKP PD  V+N+ D+ Q ++NG++KSV+HRA+V+Q   R+S+ FF+GP+ D   
Sbjct  293  DGRWIAVKPRPDTFVINLGDVFQAWTNGRYKSVEHRAVVNQKQGRLSMVFFYGPQEDYVI  352

Query  549  SFPLKLVKGRDSMYPL----ISWKEYRGIK  626
            + P +L+   D  +PL     +W +Y   +
Sbjct  353  TPPDELI---DEDHPLRYRPFTWGDYSAAR  379


 Score = 48.9 bits (115),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMVPH  298
             Y  ++  L   +  LI  +LGL          +S+S F  +N Y  CP P++ALG++ H
Sbjct  213  RYHAEMEKLGQSVVQLIALSLGLERRTFSRHFEESSSTF-RWNHYPPCPLPSKALGLLAH  271

Query  299  TDSSLITLLYQSNTNS  346
            +D S IT+L+Q +   
Sbjct  272  SDPSAITILHQDSVGG  287



>ref|XP_002980534.1| hypothetical protein SELMODRAFT_112786 [Selaginella moellendorffii]
 gb|EFJ18185.1| hypothetical protein SELMODRAFT_112786 [Selaginella moellendorffii]
Length=397

 Score = 75.5 bits (184),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + +W+ VKP PD  V+N+ D+ Q ++NG++KSV+HRA+V+Q   R+S+ FF+GP+ D   
Sbjct  293  DGRWIAVKPRPDTFVINLGDVFQAWTNGRYKSVEHRAVVNQKQGRLSMVFFYGPQEDYVI  352

Query  549  SFPLKLVKGRDSMYPL----ISWKEYRGIK  626
            + P +L+   D  +PL     +W +Y   +
Sbjct  353  TPPDELI---DEDHPLRYRPFTWGDYSAAR  379


 Score = 48.9 bits (115),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMVPH  298
             Y  ++  L   +  LI  +LGL          +S+S F  +N Y  CP P++ALG++ H
Sbjct  213  RYHAEMEKLGQSVVQLIALSLGLERRTFSRHFEESSSTF-RWNHYPPCPLPSKALGLLAH  271

Query  299  TDSSLITLLYQSNTNS  346
            +D S IT+L+Q +   
Sbjct  272  SDPSAITILHQDSVGG  287



>ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 
[Solanum lycopersicum]
Length=1114

 Score = 62.4 bits (150),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  83   IAALFVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKC  262
            + A F  AL  + Y   L  LAMKI  ++ +ALG+  ED++ L  +  +  +  N Y  C
Sbjct  162  LPASFRDAL--EQYSRTLKELAMKILYVMARALGMKTEDMNVLFEQDGTQMMRINYYPPC  219

Query  263  PDPTRALGMVPHTDSSLITLLYQSNTNSG  349
            P P R +G+ PHTD+  + +L Q N   G
Sbjct  220  PQPERVMGLCPHTDAIGLAILLQVNETEG  248


 Score = 62.0 bits (149),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            W  V  +PDA VVN+ D+++I +NG +KS +HRAIV++   RISI  F  P +D
Sbjct  257  WTPVPYLPDAFVVNIGDILEILTNGIYKSTEHRAIVNEDKERISIATFLSPNLD  310


 Score = 62.0 bits (149),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = +2

Query  83    IAALFVSALLVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKC  262
             + A F  AL  + Y   L  LAMKI  ++ +ALG+  ED++ L  +  +  +  N Y  C
Sbjct  920   LPASFRDAL--EQYSRALKELAMKILYVMARALGMKTEDMNVLFEQDGTQMMRINYYPPC  977

Query  263   PDPTRALGMVPHTDSSLITLLYQSNTNSG  349
             P P R +G+ PHTD+  + +L Q N   G
Sbjct  978   PQPERVMGLCPHTDAIGLAILLQVNETEG  1006


 Score = 52.4 bits (124),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +3

Query  378   WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
             W+ V  +PDA VVN+ D+++I +NG +KS+ H         RISI  FF PK+D
Sbjct  1015  WIPVPYLPDAFVVNIGDILEIVTNGIYKSIDH-----GDKERISIATFFSPKLD  1063


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 10/76 (13%)
 Frame = +3

Query  327  TKATPTVVQQVFEPNKK----------WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHR  476
            T + P V+  +F+ N+           WV +KP+P+AL+VN+ DMM+I SNG ++S++HR
Sbjct  597  THSDPGVLTILFQLNETEGLQVRKDDIWVPIKPLPNALIVNIGDMMEILSNGVYRSIEHR  656

Query  477  AIVSQASYRISITFFF  524
            AIV+    R+S+  F+
Sbjct  657  AIVNSNEERLSVATFY  672


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/80 (33%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            +++ Y +++  LA  I   + KAL + EE++  L S    + +  N Y  CP+P RA+G+
Sbjct  537  VLEAYCKEIKSLARIIVCQLTKALRMDEEEMRDLFSDGMQS-MRMNYYPPCPEPNRAIGL  595

Query  290  VPHTDSSLITLLYQSNTNSG  349
              H+D  ++T+L+Q N   G
Sbjct  596  STHSDPGVLTILFQLNETEG  615



>ref|XP_006287961.1| hypothetical protein CARUB_v10001196mg [Capsella rubella]
 gb|EOA20859.1| hypothetical protein CARUB_v10001196mg [Capsella rubella]
Length=375

 Score = 73.2 bits (178),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            +  W+ VKP P A +VN+ D +QI SN  +KSV+HR IV+    R+S+ FF+ PK D+  
Sbjct  269  DDTWITVKPHPHAFIVNIGDQIQILSNSTYKSVEHRVIVNSDKERVSLAFFYNPKSDIPI  328

Query  549  SFPLKLVKGRD-SMYPLISWKEYR  617
                +LV  R   +YP +++ +YR
Sbjct  329  QPLQELVSARSPPLYPPMTFDQYR  352


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y ++L+ L+ +I  ++   LGL E+   +    ++  A L  N Y KCP P  ALG
Sbjct  183  VIDEYGKELVNLSGRIMRVLSTNLGLQEDKFQEAFGGENIGACLRVNYYPKCPRPELALG  242

Query  287  MVPHTDSSLITLL  325
            + PH+D   +T+L
Sbjct  243  LSPHSDPGGMTVL  255



>ref|XP_004302589.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=357

 Score = 78.6 bits (192),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFSF  554
             WV VKP+P+A +VN+ D MQ+ SN  +KSV+HR IV+    R+S+  F+ PK DL    
Sbjct  255  NWVTVKPVPNAFIVNMGDQMQVLSNAIYKSVEHRVIVNSVKDRVSLAMFYNPKSDLLIEP  314

Query  555  PLKLVK-GRDSMYPLISWKEYR---GIKGVHFGKALEVIQTND  671
               LV   R ++YP +++ EYR     KG+     +E ++T++
Sbjct  315  AKALVTMDRPALYPAMTFDEYRIYIRTKGLCGKAQVESLKTHE  357


 Score = 45.8 bits (107),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 41/81 (51%), Gaps = 1/81 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            L++ Y E+   L  ++  ++   LGL E+ + +    ++  A L  N Y +CP P   LG
Sbjct  167  LIEEYGEEATKLCGRLVKMLSLNLGLGEDYLPNAFGGENVGACLRVNFYPRCPQPDLTLG  226

Query  287  MVPHTDSSLITLLYQSNTNSG  349
            + PH+D   +TLL      +G
Sbjct  227  ISPHSDPGGMTLLLPDEDVAG  247



>gb|ADK71023.1| gibberellin 3-beta-hydroxylase [Trifolium albopurpureum]
Length=292

 Score = 68.6 bits (166),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS----TSAFLHFNSYKKCPDPTR  277
            +V  Y   +  LA K+  L+  +LG+++ED+ W  SK+      A +  NSY  CPDP R
Sbjct  130  IVLQYDGAMKKLAEKLMLLMLDSLGITKEDIIWANSKAQFEKACAAMQLNSYPICPDPDR  189

Query  278  ALGMVPHTDSSLITLLYQSNTNS  346
            A+G+ PHTDS+ +T+L QS+ + 
Sbjct  190  AMGLAPHTDSTFLTILSQSDISG  212


 Score = 55.5 bits (132),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LV+NV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  214  QVQREGFGWVTVPPLHGGLVINVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPP  273

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  274  SNVEICPHAKLV  285



>ref|XP_006646452.1| PREDICTED: leucoanthocyanidin dioxygenase-like [Oryza brachyantha]
Length=380

 Score = 80.9 bits (198),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV   +  WV V+P+PDA +VNV D +QI SN  +KSV+HR IV+    RIS+  F+ P+
Sbjct  265  QVRRRDGHWVTVQPLPDAFIVNVGDQIQILSNSMYKSVEHRVIVNAEEERISLALFYNPR  324

Query  534  IDLKFSFPLKLVK-GRDSMYPLISWKEYR  617
             D+  +   +LV   R S+YP +++ EYR
Sbjct  325  GDIPVAPAPELVTPERPSLYPPMTFDEYR  353


 Score = 43.1 bits (100),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (51%), Gaps = 1/71 (1%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            + Y  +++G+  ++  L+  +LGL E    +        A L  N Y +CP P   LG+ 
Sbjct  185  EEYGGEVVGVCERVMRLLSASLGLEETRFQEAFGGAECGACLRANYYPRCPQPDLTLGLS  244

Query  293  PHTDSSLITLL  325
             H+D  ++T+L
Sbjct  245  AHSDPGVLTVL  255



>ref|XP_006355577.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=359

 Score = 63.9 bits (154),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            W  ++P+P+A +VNV D  +IFSNG +KS++HR++VS    RIS+  F  P++D
Sbjct  252  WTPIEPLPNAFIVNVGDAFEIFSNGIYKSIEHRSVVSSEKERISVATFQSPRLD  305


 Score = 59.7 bits (143),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y +++  L+MK+  ++ KALG+ E++V  L  +   + +  N Y  CP P + +G+ 
Sbjct  166  IEEYADEIKTLSMKVLEMLGKALGIDEKEVKSLFEEGMQS-MRMNYYPPCPQPDKVMGIT  224

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D++ +T+L Q N   G
Sbjct  225  PHSDATGLTILLQVNETQG  243



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +3

Query  294  HTLTPRLSLCYTKATPTVVQQVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKH  473
            HT +  L+  Y   T  +  QV+  N  WV V P+  ALVV V D+MQI  NG+FKS  H
Sbjct  228  HTDSSLLTSLYQGNTSGL--QVYRDNVGWVPVHPVSGALVVIVGDLMQITCNGRFKSALH  285

Query  474  RAIVSQASYRISITFFFGPKIDLKFSFPLKLVKGRDS-MYPLISWKEYRGIKGVHFGKAL  650
            RA+V+   +RIS  +F+GP  D+K S  +KL       +Y  ++W+EY   K  HF KA+
Sbjct  286  RALVNNTRHRISTAYFYGPPQDVKISPSVKLTDHDHPILYRPVTWREYLDAKATHFNKAI  345

Query  651  EVIQ  662
            E+I+
Sbjct  346  ELIR  349


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +2

Query  122  YKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK----STSAFLHFNSYKKCPDPTRALGM  289
            Y+++L GLA KI  L+F++LGL++ED+ W K K    S    L  NSY  CPDP RA+G+
Sbjct  166  YQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMGL  225

Query  290  VPHTDSSLITLLYQSNTNS  346
             PHTDSSL+T LYQ NT+ 
Sbjct  226  APHTDSSLLTSLYQGNTSG  244



>ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=355

 Score = 63.2 bits (152),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  WVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            W+ + P+P+A VVNV D ++IFSNG +KS++HR++V+    R+S+  F  P++D
Sbjct  255  WIPILPLPNAFVVNVGDALEIFSNGIYKSIEHRSVVNSERERMSVATFQNPRLD  308


 Score = 60.5 bits (145),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y +++  L+MK+  ++ KALG+ EE+V  +  +   + +  N Y  CP P + +G+ 
Sbjct  169  IEEYSKEVNELSMKVLEMLGKALGIDEEEVKSVFEEGMQS-MKMNYYPPCPQPEKVMGLC  227

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+DSS +T+L Q N   G
Sbjct  228  PHSDSSGLTILLQVNEIEG  246



>ref|XP_010491092.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Camelina 
sativa]
Length=387

 Score = 72.8 bits (177),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            N  W+ VKP P A +VN+ D +QI SN  +KSV+HR +V+    R+S+ FF+ PK D+  
Sbjct  281  NDTWITVKPHPHAFIVNIGDQIQILSNATYKSVEHRVVVNSNKERVSLAFFYNPKSDIPI  340

Query  549  SFPLKLVKGRD-SMYPLISWKEYR  617
                +LV   +  +YP +++ +YR
Sbjct  341  QPLQELVSAHNPPLYPPMTFDQYR  364


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y ++L+ L+ +I  ++   LGL ++   D    ++  A L  N Y KCP P  ALG
Sbjct  195  VIDEYGKELVNLSGRIMRVLSTNLGLKDDKFQDAFGGENIGACLRVNYYPKCPRPELALG  254

Query  287  MVPHTDSSLITLL  325
            + PH+D   +T+L
Sbjct  255  LSPHSDPGGMTIL  267



>ref|XP_010057202.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Eucalyptus grandis]
 gb|KCW74241.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=372

 Score = 68.6 bits (166),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 64/109 (59%), Gaps = 7/109 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS-  551
            KWV +KP+P+A VVNV D+++I +NG ++S++HRA V+  + R+S+  F+ PK++ +   
Sbjct  263  KWVPIKPLPNAFVVNVGDILEIVTNGNYRSIEHRATVNSTNERLSVATFYSPKLEGEMGP  322

Query  552  FPLKLVKGRDSMYPLISWKEY------RGIKGVHFGKALEVIQTNDDEA  680
             P  +   + +++  I   +Y      R ++G  +   +  IQ  +++ 
Sbjct  323  TPSLITPDKPALFRTIGVADYFKGFYSRELQGKSYLDIMRTIQGEENKG  371


 Score = 55.1 bits (131),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++D Y  +L  LAMKI  LI KAL +  +++  L  +     +  N Y  CP P  A+G+
Sbjct  177  VLDKYSTELQDLAMKILLLIAKALKMDTKEMIELFDEGLQ-MMRMNYYPPCPRPELAIGL  235

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+D++ +T+L Q N   G
Sbjct  236  TPHSDAAGVTILLQVNEVEG  255



>gb|KCW74243.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=282

 Score = 68.6 bits (166),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 64/109 (59%), Gaps = 7/109 (6%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKFS-  551
            KWV +KP+P+A VVNV D+++I +NG ++S++HRA V+  + R+S+  F+ PK++ +   
Sbjct  173  KWVPIKPLPNAFVVNVGDILEIVTNGNYRSIEHRATVNSTNERLSVATFYSPKLEGEMGP  232

Query  552  FPLKLVKGRDSMYPLISWKEY------RGIKGVHFGKALEVIQTNDDEA  680
             P  +   + +++  I   +Y      R ++G  +   +  IQ  +++ 
Sbjct  233  TPSLITPDKPALFRTIGVADYFKGFYSRELQGKSYLDIMRTIQGEENKG  281


 Score = 55.5 bits (132),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            ++D Y  +L  LAMKI  LI KAL +  +++  L  +     +  N Y  CP P  A+G+
Sbjct  87   VLDKYSTELQDLAMKILLLIAKALKMDTKEMIELFDEGLQ-MMRMNYYPPCPRPELAIGL  145

Query  290  VPHTDSSLITLLYQSNTNSG  349
             PH+D++ +T+L Q N   G
Sbjct  146  TPHSDAAGVTILLQVNEVEG  165



>gb|ABY49024.1| GA3-oxidase [Oryza punctata]
Length=260

 Score = 62.8 bits (151),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E+V  ++++     + +A +H N Y +CPDP 
Sbjct  116  VMEEFHKEMRRLADELLVLFLRALGLTGEEVAGVEAERRIAETMTATMHLNWYPRCPDPR  175

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  176  RALGLIAHTDSGFFTFVLQS  195


 Score = 61.2 bits (147),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP
Sbjct  209  RWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRISLGYFLGP  260



>ref|XP_006399020.1| hypothetical protein EUTSA_v10013861mg [Eutrema salsugineum]
 gb|ESQ40473.1| hypothetical protein EUTSA_v10013861mg [Eutrema salsugineum]
Length=371

 Score = 71.6 bits (174),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            +  W+ VKP P A +VN+ D +QI SN  +KSV+HR IV+    R+S+ FF+ PK D+  
Sbjct  267  DDTWITVKPHPHAFIVNIGDQIQILSNSTYKSVEHRVIVNSEKERVSLAFFYNPKSDIPI  326

Query  549  SFPLKLVKGRD-SMYPLISWKEYR  617
                +LV   +  +YP +++ +YR
Sbjct  327  QPLQELVSNHNPPLYPPMTFDQYR  350


 Score = 52.0 bits (123),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDV-DWLKSKSTSAFLHFNSYKKCPDPTRALG  286
            ++D Y ++L+ L+ +I  ++   LGL E+   D    ++  A L  N Y KCP P  ALG
Sbjct  181  VIDEYGKELVKLSGRIMRVLSSNLGLKEDKFQDAFGGENIGACLRVNYYPKCPRPELALG  240

Query  287  MVPHTDSSLITLL  325
            + PH+D   +T+L
Sbjct  241  LSPHSDPGGMTIL  253



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score = 67.0 bits (162),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  129  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  188

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  189  AMGLAPHTDSTFLTILSQND  208


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  213  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  272

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  273  SNVEICPHEKLV  284



>gb|ABY49028.1| GA3-oxidase [Oryza granulata]
Length=260

 Score = 62.4 bits (150),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (63%), Gaps = 5/80 (6%)
 Frame = +2

Query  110  LVDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSK-----STSAFLHFNSYKKCPDPT  274
            +++ + +++  LA ++  L  +ALGL+ E V  ++++     + +A +H N Y +CPDP 
Sbjct  116  VMEEFHKEMRRLADELLELFLRALGLTGEQVAGVEAERKIGETMTATMHLNWYPRCPDPR  175

Query  275  RALGMVPHTDSSLITLLYQS  334
            RALG++ HTDS   T + QS
Sbjct  176  RALGLIAHTDSGFFTFVLQS  195


 Score = 61.2 bits (147),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGP  530
            +WV V  +P A VVNV D+  I +NG+F SV HRA+V++   RIS+ +F GP
Sbjct  209  RWVAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRISLGYFLGP  260



>gb|EMS47228.1| putative 2-oxoglutarate/Fe(II)-dependent dioxygenase [Triticum 
urartu]
Length=253

 Score = 83.2 bits (204),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  NKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKIDLKF  548
            + +W+ V P+PDA +VNV D +Q+ SN  +KSV+HR  VS A  R+S+ FF+ P+ D+  
Sbjct  144  DGQWITVDPVPDAFIVNVGDQIQVLSNAAYKSVEHRVTVSAAEERLSLAFFYNPRSDVPV  203

Query  549  SFPLKLVK-GRDSMYPLISWKEYR  617
            +   +LV  GR ++YP +++ EYR
Sbjct  204  APMAELVAPGRPALYPEMTFDEYR  227


 Score = 40.4 bits (93),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (3%)
 Frame = +2

Query  116  DNYKEQLMGLAMKITSLIFKALGLSEEDVD--WLKSKSTSAFLHFNSYKKCPDPTRALGM  289
            + Y E+++ L  +++ ++ K LGL    +   +       A +  N Y +CP P   LG+
Sbjct  59   EEYGEEVVKLCRRVSKVLSKGLGLDGGRLQAAFGGEGGEGACMRVNFYPRCPQPELTLGV  118

Query  290  VPHTDSSLITLL  325
              H+D   +T+L
Sbjct  119  AAHSDPGGMTML  130



>ref|XP_002519769.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42742.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=363

 Score = 69.3 bits (168),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  KWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPKID  539
            +WV +KP+P+A VVN+ D+M+I SNG ++S++HRAIV+    R+SI  F+  K+D
Sbjct  257  RWVSIKPLPNAFVVNIGDIMEIVSNGVYRSIEHRAIVNSTKERLSIATFYSSKLD  311


 Score = 54.3 bits (129),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKSTSAFLHFNSYKKCPDPTRALGMV  292
            ++ Y  ++  LA+ I   + KAL + E+++  L S    + +  N Y  CP+P +A+G  
Sbjct  172  LETYSNEVKKLAIGILGHMAKALKMDEKELKELFSDGVQS-MRMNYYPPCPEPEKAIGFT  230

Query  293  PHTDSSLITLLYQSNTNSG  349
            PH+D+  +T+L+Q N   G
Sbjct  231  PHSDADALTILFQLNETEG  249



>gb|AGH39957.1| gibberellin 3-beta-hydroxylase [Medicago edgeworthii]
Length=293

 Score = 67.0 bits (162),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = +2

Query  113  VDNYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTR  277
            V  Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  
Sbjct  131  VLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDH  190

Query  278  ALGMVPHTDSSLITLLYQSN  337
            A+G+ PHTDS+ +T+L Q++
Sbjct  191  AMGLAPHTDSTFLTILSQND  210


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  215  QVQREGFGWVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPP  274

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  275  SNVEICPHEKLV  286



>gb|ADK70958.1| gibberellin 3-beta-hydroxylase [Medicago brachycarpa]
Length=293

 Score = 67.0 bits (162),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +2

Query  119  NYKEQLMGLAMKITSLIFKALGLSEEDVDWLKSKS-----TSAFLHFNSYKKCPDPTRAL  283
             Y E +  LA K+  L+  +LG++ ED+ W  SK+       A +  NSY  CPDP  A+
Sbjct  133  QYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPDHAM  192

Query  284  GMVPHTDSSLITLLYQSN  337
            G+ PHTDS+ +T+L Q++
Sbjct  193  GLAPHTDSTFLTILSQND  210


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  354  QVFEPNKKWVDVKPIPDALVVNVSDMMQIFSNGQFKSVKHRAIVSQASYRISITFFFGPK  533
            QV      WV V P+   LVVNV D+  I SNG + SV HR +V++   R S+ + +GP 
Sbjct  215  QVQREGFGWVTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRYSVAYLYGPP  274

Query  534  IDLKFSFPLKLV  569
             +++     KLV
Sbjct  275  SNVEICPHEKLV  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210457312932