BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22470_g1_i1 len=720 path=[1049:0-40 13:41-48 1097:49-127 98:128-159
2788:160-172 1220:173-213 2624:214-354 1404:355-386 1036:387-398
1048:399-447 1494:448-719]

Length=720
                                                                      Score     E

dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     115   6e-44   Ipomoea nil [qian niu]
ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      94.7    7e-35   
ref|XP_008337346.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  90.9    1e-32   
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative         88.2    3e-31   Ricinus communis
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative         91.7    6e-31   Ricinus communis
gb|KDP32333.1|  hypothetical protein JCGZ_13258                       91.3    9e-31   
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  81.6    1e-30   
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  94.4    1e-30   
gb|KDO80406.1|  hypothetical protein CISIN_1g043986mg                 93.2    3e-30   
ref|XP_006451038.1|  hypothetical protein CICLE_v10010731mg           93.2    3e-30   
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                   86.7    9e-30   Ipomoea nil [qian niu]
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                 85.1    2e-28   
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.3    3e-28   
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative         80.5    4e-28   
dbj|BAG48320.1|  gibberellin 3-oxidase1                               82.0    1e-27   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.2    1e-27   
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                        84.7    1e-27   Nicotiana tabacum [American tobacco]
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.7    1e-27   
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.8    2e-27   
ref|XP_011081703.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  89.4    3e-27   
emb|CDY39663.1|  BnaC05g11920D                                        80.5    3e-27   
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                         80.1    3e-27   Lactuca sativa [cultivated lettuce]
gb|ACT99991.1|  gibberellin 3-oxidase                                 83.2    4e-27   
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                 83.2    4e-27   
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.2    4e-27   
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.7    5e-27   
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.9    7e-27   
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein    84.7    8e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.1    1e-26   
ref|XP_006356177.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  83.2    1e-26   
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg           79.3    1e-26   
ref|NP_001233855.1|  3b-hydroxylase                                   83.2    2e-26   
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                        77.4    2e-26   Lactuca sativa [cultivated lettuce]
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.0    3e-26   
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  80.5    3e-26   
gb|ACN89835.1|  gibberellin 3-oxidase                                 81.6    3e-26   Solanum tuberosum subsp. andigenum
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.5    3e-26   
emb|CDY36572.1|  BnaA06g10250D                                        77.0    4e-26   
ref|XP_002303276.1|  gibberellin 3-beta-hydroxylase family protein    80.5    4e-26   Populus trichocarpa [western balsam poplar]
gb|AAR12160.1|  gibberellin 3-oxidase                                 80.5    5e-26   Populus tremula x Populus tremuloides
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  75.5    5e-26   
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.0    5e-26   
gb|ACN89834.1|  gibberellin 3-oxidase                                 79.0    5e-26   Solanum tuberosum subsp. andigenum
gb|AFS18537.1|  gibberellin 3-oxidase                                 82.0    6e-26   
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.6    6e-26   
gb|ABB00360.1|  gibberellin 3-oxidase                                 80.5    7e-26   Fragaria x ananassa
dbj|BAM73280.1|  gibberellin 3 oxidase 1                              76.6    7e-26   
ref|XP_008804067.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.1    8e-26   
ref|NP_001233848.1|  3b-hydroxylase                                   83.2    1e-25   
ref|NP_001275108.1|  gibberellin 3-beta-hydroxylase 1                 83.2    1e-25   
gb|AAO22518.1|  GA4                                                   83.2    1e-25   Brassica rapa subsp. pekinensis [bai cai]
dbj|BAJ65442.1|  gibberellin 3-oxidase                                77.8    2e-25   
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.8    2e-25   
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      79.3    2e-25   
emb|CDP18939.1|  unnamed protein product                              77.0    2e-25   
gb|ACF71491.1|  gibberellin 3-beta hydroxylase                        79.7    2e-25   Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAG32267.1|  gibberellin 3-oxidase                                84.0    3e-25   Allium fistulosum [Japanese bunching onion]
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.8    3e-25   
gb|AHC32022.1|  gibberellin 3-oxidase 1                               74.3    3e-25   
gb|AHC32023.1|  gibberellin 3-oxidase 2                               76.3    4e-25   
ref|XP_010249916.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    4e-25   
ref|XP_011039983.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.7    5e-25   
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg           73.6    6e-25   
gb|AEK70423.1|  GA3ox1                                                72.4    7e-25   
ref|XP_009400517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.0    7e-25   
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  78.2    1e-24   
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  80.9    1e-24   
dbj|BAJ65443.1|  gibberellin 3-oxidase                                80.5    1e-24   
gb|ABO70984.1|  gibberellin 3-oxidase 2                               78.2    1e-24   Nicotiana tabacum [American tobacco]
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                     77.8    2e-24   Nicotiana sylvestris
ref|XP_008347459.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  84.0    2e-24   
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.7    2e-24   
ref|XP_009355033.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  82.0    2e-24   
gb|KDP37169.1|  hypothetical protein JCGZ_06225                       78.6    2e-24   
gb|KDO58203.1|  hypothetical protein CISIN_1g043985mg                 74.3    3e-24   
ref|XP_009108486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      81.3    3e-24   
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  87.0    3e-24   
ref|XP_009372969.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.9    3e-24   
emb|CAX46400.1|  putative GA3OX protein                               82.0    3e-24   Rosa lucieae [memorial rose]
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein        70.5    4e-24   
emb|CDY38660.1|  BnaC02g23190D                                        77.8    5e-24   
dbj|BAG48321.1|  gibberellin 3-oxidase2                               76.6    5e-24   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CDY31424.1|  BnaC03g64000D                                        81.3    5e-24   
emb|CDX76441.1|  BnaA08g09590D                                        81.3    6e-24   
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                       73.2    7e-24   Daucus carota [carrots]
ref|XP_010537951.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  84.0    7e-24   
ref|XP_008350339.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.3    7e-24   
ref|XP_008387508.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.3    8e-24   
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4      79.3    9e-24   
emb|CDY37588.1|  BnaA02g19820D                                        79.0    9e-24   
ref|XP_008785607.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  81.6    1e-23   
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg           72.0    1e-23   
ref|XP_010925284.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.1    1e-23   
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg           91.7    2e-23   
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.7    2e-23   
ref|XP_006465424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.0    2e-23   
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                 75.1    2e-23   
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.3    2e-23   
ref|XP_007227245.1|  hypothetical protein PRUPE_ppa018007mg           91.3    2e-23   
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    2e-23   
ref|XP_010049018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  86.3    2e-23   
gb|AEK70424.1|  GA3ox2                                                76.6    3e-23   
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  87.8    3e-23   
gb|ABK28643.1|  unknown                                               79.0    3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193900.1|  gibberellin 3-beta-dioxygenase 3                    79.0    3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439443.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  80.5    4e-23   
ref|XP_010449018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...  79.7    5e-23   
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  89.4    5e-23   
ref|XP_010434144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      80.1    6e-23   
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    6e-23   
gb|AEW67998.1|  gibberellin 3 oxidase 1                               79.0    6e-23   
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  83.6    7e-23   
dbj|BAD30035.1|  gibberellin 3beta-hydroxylase1                       82.8    8e-23   Daucus carota [carrots]
ref|XP_010520599.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3      77.8    9e-23   
ref|XP_003543662.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  79.7    2e-22   
ref|XP_007150692.1|  hypothetical protein PHAVU_005G173500g           81.3    2e-22   
ref|XP_002869872.1|  gibberellin 3-oxidase 3                          76.3    2e-22   
ref|XP_008352044.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  85.5    2e-22   
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  67.8    2e-22   
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg           77.0    3e-22   
ref|XP_006285095.1|  hypothetical protein CARUB_v10006427mg           79.7    3e-22   
dbj|BAD30036.1|  gibberellin 3beta-hydroxylase2                       77.8    3e-22   Daucus carota [carrots]
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg           70.9    4e-22   
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg           78.2    4e-22   
gb|ABI64150.1|  gibberellin 3-oxidase                                 84.7    4e-22   Pisum sativum [garden pea]
ref|XP_008356836.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.8    7e-22   
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      76.3    9e-22   
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  65.5    1e-21   
ref|XP_008219863.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  87.8    1e-21   
ref|XP_002517539.1|  gibberellin 3-beta hydroxylase, putative         71.2    2e-21   Ricinus communis
gb|AAN87570.1|  gibberellin 3-oxidase                                 68.9    2e-21   Spinacia oleracea
ref|XP_002887835.1|  predicted protein                                76.6    3e-21   
ref|NP_001267625.1|  gibberellin 3-beta-dioxygenase 1-like            74.7    3e-21   
emb|CDY38661.1|  BnaC02g23180D                                        76.6    3e-21   
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                        77.8    3e-21   
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                  75.5    4e-21   
ref|XP_008461055.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...  73.2    4e-21   
ref|XP_002324270.1|  gibberellin 3 beta-hydroxylase family protein    79.0    5e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  65.5    6e-21   
ref|XP_008445137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.4    6e-21   
ref|XP_004291423.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  87.8    6e-21   
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      70.5    7e-21   
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  66.6    8e-21   
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  67.0    8e-21   
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  64.7    9e-21   
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                    74.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  68.6    1e-20   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81908.1|  unnamed protein product                              68.2    1e-20   
gb|KDP21184.1|  hypothetical protein JCGZ_21655                       72.4    2e-20   
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                        75.1    2e-20   
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                        75.5    2e-20   
gb|KDP32294.1|  hypothetical protein JCGZ_13219                       80.1    2e-20   
gb|AAC83647.1|  gibberellin 3 beta-hydroxylase                        74.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003588693.1|  Gibberellin 3-beta-dioxygenase                   81.3    2e-20   
ref|XP_006355575.1|  PREDICTED: protein SRG1-like                     72.8    2e-20   
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    3e-20   
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  68.2    3e-20   Triticum aestivum [Canadian hard winter wheat]
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...  68.2    3e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004291424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  66.6    3e-20   
ref|XP_010691237.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.0    4e-20   
ref|XP_011026517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  77.0    4e-20   
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                        74.7    4e-20   
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                        75.5    4e-20   Medicago sativa subsp. caerulea
ref|XP_003569638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  69.3    4e-20   
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                        75.5    4e-20   Medicago sativa subsp. caerulea
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.3    5e-20   
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                        76.6    5e-20   
ref|XP_008461419.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.9    5e-20   
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                        75.5    5e-20   
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                        75.9    6e-20   
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  63.5    6e-20   
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g           75.9    7e-20   
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                        73.9    7e-20   
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                        74.3    7e-20   
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg           64.3    8e-20   
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                        75.5    8e-20   
ref|XP_010670743.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  68.9    9e-20   
gb|AFN53718.1|  putative flavonol synthase                            67.8    9e-20   
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                        73.9    9e-20   Medicago falcata [sickle alfalfa]
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.9    1e-19   
ref|XP_004292966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  80.9    1e-19   
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                        74.3    1e-19   
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                        75.5    1e-19   
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                        73.6    1e-19   
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                        75.1    1e-19   
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like            62.4    1e-19   
gb|EPS71653.1|  gibberellin 3-oxidase                                 69.3    1e-19   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                       71.6    1e-19   
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...  73.9    1e-19   Pisum sativum [garden pea]
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                     68.6    1e-19   
emb|CAC83089.1|  gibberellin 3-oxidase                                75.1    1e-19   Cucurbita maxima [Boston marrow]
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  64.7    1e-19   
gb|KCW74243.1|  hypothetical protein EUGRSUZ_E02880                   64.7    2e-19   
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                        73.9    2e-19   Pisum sativum [garden pea]
gb|KGN62899.1|  hypothetical protein Csa_2G379300                     72.8    2e-19   
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  71.2    2e-19   
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                        73.9    2e-19   
ref|XP_003546239.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  74.3    2e-19   
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                        76.3    2e-19   
ref|NP_001274405.1|  gibberellin 3-beta-dioxygenase 1-like            72.4    2e-19   
emb|CBL59327.1|  Gibberellin 3-oxidase                                75.1    2e-19   
gb|ADE18861.1|  putative 2-oxoglutarate dependent dioxygenase         63.2    2e-19   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  64.7    2e-19   
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                     63.2    2e-19   
ref|XP_009396646.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  70.1    2e-19   
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                        67.8    2e-19   Dasypyrum villosum
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                 63.2    2e-19   
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                        74.3    2e-19   
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                        73.9    2e-19   
ref|XP_002519764.1|  1-aminocyclopropane-1-carboxylate oxidase, p...  67.0    2e-19   Ricinus communis
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                        74.3    2e-19   
ref|XP_009385827.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  73.9    2e-19   
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                  73.9    2e-19   Pisum sativum [garden pea]
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                        73.2    2e-19   
gb|AHW42464.1|  GA3ox2                                                75.5    2e-19   
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                        74.3    3e-19   
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                        73.2    3e-19   
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                        73.9    3e-19   Pisum sativum [garden pea]
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                        73.9    3e-19   
ref|XP_004968405.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  68.9    3e-19   
gb|AAT49061.1|  GA 3-oxidase 2                                        66.6    3e-19   Hordeum vulgare subsp. vulgare [barley]
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                        73.6    3e-19   
ref|XP_011095018.1|  PREDICTED: leucoanthocyanidin dioxygenase        65.1    3e-19   
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1          66.2    4e-19   
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                        73.6    4e-19   
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                        73.6    4e-19   
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                        73.6    4e-19   
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                        70.9    4e-19   
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                        73.2    4e-19   
gb|AGQ42610.1|  GA3ox2                                                62.0    4e-19   
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                        73.6    4e-19   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                       65.9    4e-19   
gb|ABY49032.1|  GA3-oxidase                                           70.9    4e-19   Ehrharta erecta
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                     68.2    4e-19   
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                        73.6    4e-19   
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  63.5    5e-19   
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like       62.8    5e-19   
ref|XP_006399020.1|  hypothetical protein EUTSA_v10013861mg           62.8    5e-19   
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                        73.2    5e-19   
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1          63.9    5e-19   
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                        73.2    5e-19   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2          64.3    5e-19   
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                        73.2    5e-19   
gb|EYU21920.1|  hypothetical protein MIMGU_mgv1a009050mg              73.9    5e-19   
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                   72.8    6e-19   
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
gb|ABY49029.1|  GA3-oxidase                                           72.4    6e-19   Luziola fluitans [southern watergrass]
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                        73.2    6e-19   
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                     62.8    6e-19   
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                        72.8    6e-19   
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                     68.9    6e-19   
ref|XP_008667799.1|  PREDICTED: uncharacterized protein LOC100273...  65.5    6e-19   
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...  64.3    7e-19   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                     68.2    7e-19   
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                        73.2    7e-19   
ref|NP_001141508.1|  uncharacterized protein LOC100273620             65.5    7e-19   Zea mays [maize]
ref|XP_006646452.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.1    8e-19   
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-19   
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-19   
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                        72.8    8e-19   
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                        72.0    8e-19   
ref|XP_006494095.1|  PREDICTED: codeine O-demethylase-like isofor...  64.3    8e-19   
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1      62.0    8e-19   
ref|XP_009419671.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  67.8    9e-19   
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                        72.4    9e-19   
ref|XP_007156523.1|  hypothetical protein PHAVU_003G293200g           63.5    9e-19   
ref|XP_008660253.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  60.8    9e-19   
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                        72.0    1e-18   
dbj|BAE99802.1|  SRG1-like protein                                    64.3    1e-18   
ref|NP_194260.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  64.3    1e-18   
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                     69.7    1e-18   
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                     66.2    1e-18   
ref|XP_002312162.1|  oxidoreductase family protein                    62.0    1e-18   
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                        73.2    1e-18   
gb|AAM61665.1|  leucoanthocyanidin dioxygenase-like protein           62.4    1e-18   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                     67.4    1e-18   
ref|XP_002519769.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  62.0    2e-18   
ref|NP_196179.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...  62.4    2e-18   
ref|XP_011077657.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   62.4    2e-18   
ref|XP_007158816.1|  hypothetical protein PHAVU_002G184400g           60.5    2e-18   
ref|XP_006287961.1|  hypothetical protein CARUB_v10001196mg           60.8    2e-18   
dbj|BAK06541.1|  predicted protein                                    64.3    2e-18   
ref|XP_006479401.1|  PREDICTED: protein SRG1-like                     67.0    2e-18   
ref|XP_010031167.1|  PREDICTED: protein SRG1-like                     65.1    2e-18   
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                       62.8    2e-18   
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                        71.6    2e-18   
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                        71.2    2e-18   
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-18   
gb|ABY49025.1|  GA3-oxidase                                           69.3    3e-18   
ref|XP_002976806.1|  hypothetical protein SELMODRAFT_105948           63.9    3e-18   
ref|XP_006355629.1|  PREDICTED: protein SRG1-like                     65.5    3e-18   
ref|XP_002519763.1|  Leucoanthocyanidin dioxygenase, putative         62.0    3e-18   
ref|XP_002465421.1|  hypothetical protein SORBIDRAFT_01g038520        61.2    3e-18   
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                     61.6    3e-18   
ref|XP_010096277.1|  Gibberellin 20 oxidase 1                         61.6    3e-18   
ref|XP_002980534.1|  hypothetical protein SELMODRAFT_112786           63.9    3e-18   
ref|XP_002871172.1|  oxidoreductase                                   61.6    3e-18   
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                        70.9    3e-18   
ref|XP_010920852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  64.3    3e-18   
ref|XP_010920851.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  64.3    3e-18   
ref|XP_010028519.1|  PREDICTED: protein SRG1-like isoform X1          63.5    3e-18   
ref|XP_006432900.1|  hypothetical protein CICLE_v10002117mg           60.8    3e-18   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                     60.8    3e-18   
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  62.4    3e-18   
ref|XP_011047646.1|  PREDICTED: leucoanthocyanidin dioxygenase-li...  60.5    3e-18   
ref|XP_008442413.1|  PREDICTED: protein SRG1-like                     63.2    3e-18   
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                     61.2    4e-18   
ref|XP_006494099.1|  PREDICTED: protein SRG1-like                     60.8    4e-18   
gb|AHW42463.1|  GA3ox1                                                62.4    4e-18   
gb|KCW74257.1|  hypothetical protein EUGRSUZ_E02903                   60.8    4e-18   
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                     60.8    4e-18   
emb|CDX89424.1|  BnaA01g14690D                                        61.2    4e-18   
gb|KHN44118.1|  Leucoanthocyanidin dioxygenase                        63.5    4e-18   
ref|XP_010057204.1|  PREDICTED: protein SRG1-like                     62.8    4e-18   
ref|XP_010423451.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  60.8    4e-18   
ref|XP_006574190.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  63.5    5e-18   
gb|AAT49060.1|  GA 3-oxidase 1                                        62.8    5e-18   
emb|CDY01001.1|  BnaC05g41990D                                        63.2    5e-18   
ref|XP_010491092.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  61.2    5e-18   
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                        72.0    5e-18   
gb|KCW55264.1|  hypothetical protein EUGRSUZ_I01191                   62.8    5e-18   
ref|XP_002878055.1|  oxidoreductase                                   61.2    5e-18   
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                        69.7    6e-18   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg           62.8    6e-18   
ref|XP_006432904.1|  hypothetical protein CICLE_v10001623mg           62.8    6e-18   
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                        72.0    6e-18   
ref|XP_006429403.1|  hypothetical protein CICLE_v10012026mg           63.2    6e-18   
gb|ABY49024.1|  GA3-oxidase                                           67.4    7e-18   
ref|XP_004233003.1|  PREDICTED: protein SRG1-like                     61.2    7e-18   
gb|KHN42516.1|  Leucoanthocyanidin dioxygenase                        64.7    7e-18   
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1          60.5    8e-18   
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2          60.5    8e-18   
ref|XP_011019104.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   62.8    8e-18   
ref|XP_004170094.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.5    8e-18   
ref|XP_002268288.1|  PREDICTED: protein SRG1                          62.0    9e-18   
gb|ACN60405.1|  anthocyanidin synthase                                65.1    9e-18   
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     59.3    9e-18   
gb|KHN25971.1|  Protein SRG1                                          58.9    9e-18   
gb|ABY49026.1|  GA3-oxidase                                           67.0    9e-18   
gb|ABY49023.1|  GA3-oxidase                                           70.5    9e-18   
gb|KGN45323.1|  hypothetical protein Csa_7G435480                     60.5    9e-18   
gb|EYU37721.1|  hypothetical protein MIMGU_mgv1a009032mg              60.1    9e-18   
emb|CBI16708.3|  unnamed protein product                              62.0    1e-17   
ref|XP_002967867.1|  2-oxoacid-dependent dioxygenase                  60.8    1e-17   
ref|XP_004984849.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   63.5    1e-17   
gb|KHF98196.1|  Protein SRG1 -like protein                            60.1    1e-17   
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                   63.9    1e-17   
ref|XP_004302589.1|  PREDICTED: protein SRG1-like                     60.8    1e-17   
gb|KCW74258.1|  hypothetical protein EUGRSUZ_E02905                   61.2    1e-17   
ref|XP_003608050.1|  Gibberellin 20 oxidase                           58.5    1e-17   
ref|XP_010690999.1|  PREDICTED: protein SRG1-like                     62.4    1e-17   
ref|XP_004137903.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   65.5    1e-17   
gb|KCW74246.1|  hypothetical protein EUGRSUZ_E02883                   64.7    1e-17   
gb|ABY49028.1|  GA3-oxidase                                           67.0    1e-17   
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.9    1e-17   
emb|CDP19027.1|  unnamed protein product                              64.7    1e-17   
ref|XP_002455082.1|  hypothetical protein SORBIDRAFT_03g004020        65.1    1e-17   
gb|ABY49031.1|  GA3-oxidase                                           67.0    1e-17   
ref|XP_002981651.1|  2-oxoacid-dependent dioxygenase                  59.7    1e-17   
gb|ADM47339.1|  gibberellin 3-oxidase 3                               73.6    1e-17   
gb|KHG06473.1|  Protein SRG1 -like protein                            65.1    1e-17   
emb|CDX92689.1|  BnaC07g39470D                                        60.1    1e-17   
ref|XP_002976797.1|  2-oxoacid dioxygenase                            59.3    1e-17   
gb|ACZ17543.1|  oxidoreductase                                        64.7    1e-17   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                     60.1    1e-17   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2          61.2    1e-17   
gb|KDP32875.1|  hypothetical protein JCGZ_12167                       59.7    1e-17   
ref|XP_010417722.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  67.8    1e-17   
ref|XP_003520449.2|  PREDICTED: leucoanthocyanidin dioxygenase-like   64.7    1e-17   
ref|XP_008802804.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.7    1e-17   
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                     59.3    1e-17   
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                     59.7    1e-17   
ref|XP_008243604.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...  63.9    1e-17   
ref|XP_010028518.1|  PREDICTED: thebaine 6-O-demethylase-like         59.7    1e-17   
gb|KCW55260.1|  hypothetical protein EUGRSUZ_I01187                   59.7    2e-17   
ref|XP_010498038.1|  PREDICTED: protein SRG1-like                     60.5    2e-17   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2          59.3    2e-17   
ref|XP_007140696.1|  hypothetical protein PHAVU_008G134100g           63.2    2e-17   
ref|XP_006338984.1|  PREDICTED: protein SRG1-like                     61.2    2e-17   
ref|XP_010919856.1|  PREDICTED: S-norcoclaurine synthase 1-like       60.5    2e-17   
gb|KDP24441.1|  hypothetical protein JCGZ_25005                       59.7    2e-17   
ref|XP_007211480.1|  hypothetical protein PRUPE_ppa007597mg           63.2    2e-17   
ref|NP_001266453.1|  GA 3-oxidase 1                                   63.5    2e-17   
gb|EYU41904.1|  hypothetical protein MIMGU_mgv1a008689mg              58.9    2e-17   
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1          59.3    2e-17   
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                        72.0    2e-17   
ref|NP_001239622.1|  uncharacterized protein LOC100809985             58.9    2e-17   
ref|XP_002440702.1|  hypothetical protein SORBIDRAFT_09g005400        69.3    2e-17   
emb|CDY11068.1|  BnaA03g47270D                                        58.5    2e-17   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                     62.8    2e-17   
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                        69.3    2e-17   
ref|XP_003567249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  63.5    2e-17   
ref|XP_009137512.1|  PREDICTED: protein SRG1-like                     58.5    2e-17   
emb|CDY24860.1|  BnaA08g14500D                                        61.2    2e-17   
ref|XP_010096279.1|  Flavonol synthase/flavanone 3-hydroxylase        62.0    2e-17   
ref|XP_010937852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  62.8    2e-17   
ref|XP_004514213.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   62.0    2e-17   
ref|XP_004136071.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  59.7    2e-17   
ref|XP_010937853.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  62.8    2e-17   
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1          61.2    2e-17   
ref|XP_011006564.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   64.3    2e-17   
ref|XP_009139101.1|  PREDICTED: protein SRG1-like isoform X1          59.7    2e-17   
ref|XP_010452466.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.5    2e-17   
ref|XP_007025218.1|  Senescence-related gene 1, putative              63.2    2e-17   
ref|XP_004963513.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  65.5    2e-17   
ref|XP_010459259.1|  PREDICTED: protein SRG1-like                     60.5    2e-17   
gb|KGN55023.1|  hypothetical protein Csa_4G622820                     58.5    2e-17   
ref|XP_004232992.1|  PREDICTED: protein SRG1                          60.1    2e-17   
ref|NP_001240998.1|  uncharacterized protein LOC100786574             58.5    2e-17   
emb|CDP20503.1|  unnamed protein product                              68.2    2e-17   
ref|XP_006423098.1|  hypothetical protein CICLE_v10028758mg           63.5    2e-17   
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2          62.8    3e-17   
emb|CDY14105.1|  BnaC02g02220D                                        58.2    3e-17   
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...  72.4    3e-17   
ref|XP_009772022.1|  PREDICTED: protein SRG1-like                     65.1    3e-17   
ref|XP_007009259.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  59.3    3e-17   
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  57.8    3e-17   
emb|CDP18107.1|  unnamed protein product                              68.6    3e-17   
ref|XP_002309144.1|  hypothetical protein POPTR_0006s10200g           61.6    3e-17   
emb|CDY04960.1|  BnaAnng01420D                                        58.2    3e-17   
ref|XP_009117731.1|  PREDICTED: protein SRG1-like                     59.3    3e-17   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  60.8    3e-17   
ref|XP_009130890.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.2    3e-17   
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  60.8    3e-17   
emb|CDP06475.1|  unnamed protein product                              59.7    3e-17   
ref|XP_002980524.1|  2-oxoacid dioxygenase                            58.2    3e-17   
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2          61.6    3e-17   
emb|CDY08545.1|  BnaA05g27810D                                        61.6    3e-17   
ref|XP_008789107.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  63.2    3e-17   
ref|XP_007214442.1|  hypothetical protein PRUPE_ppa024861mg           60.5    4e-17   
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg           57.8    4e-17   
gb|KFK24976.1|  hypothetical protein AALP_AA8G050500                  58.2    4e-17   
ref|XP_008789106.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  63.2    4e-17   
ref|XP_006302461.1|  hypothetical protein CARUB_v10020553mg           60.5    4e-17   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988  62.0    4e-17   
ref|XP_010690994.1|  PREDICTED: protein SRG1-like                     62.8    4e-17   
ref|XP_002269890.1|  PREDICTED: protein SRG1                          57.8    4e-17   
ref|XP_004229200.1|  PREDICTED: protein SRG1                          58.2    4e-17   
ref|XP_009783758.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.2    4e-17   
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                     61.2    4e-17   
ref|XP_010919592.1|  PREDICTED: S-norcoclaurine synthase 1-like       59.3    4e-17   
ref|XP_008463813.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  58.5    4e-17   
ref|NP_194261.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  60.8    4e-17   
gb|ABY49030.1|  GA3-oxidase                                           65.1    4e-17   
emb|CBI30780.3|  unnamed protein product                              57.8    4e-17   
ref|XP_003614575.1|  SRG1-like protein                                60.8    4e-17   
ref|XP_002883305.1|  oxidoreductase                                   60.1    5e-17   
gb|KHG25230.1|  Protein SRG1 -like protein                            60.5    5e-17   
gb|ADK70967.1|  gibberellin 3-beta-hydroxylase                        67.4    5e-17   
gb|EAZ06062.1|  hypothetical protein OsI_28301                        61.6    5e-17   
ref|XP_009140810.1|  PREDICTED: protein SRG1-like                     64.7    5e-17   
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                      77.0    5e-17   
ref|XP_010464819.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   62.4    5e-17   
emb|CAN72414.1|  hypothetical protein VITISV_032872                   60.5    5e-17   
ref|XP_009106760.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...  76.6    5e-17   
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                     60.8    5e-17   
ref|XP_006355623.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  59.7    5e-17   
ref|XP_003544081.1|  PREDICTED: leucoanthocyanidin dioxygenase-like   59.7    5e-17   
gb|KHN20840.1|  Codeine O-demethylase                                 59.7    5e-17   
dbj|BAQ02990.1|  gibberellin 3-oxidase                                87.8    5e-17   
ref|XP_010057208.1|  PREDICTED: protein SRG1-like                     62.8    5e-17   
ref|XP_009799618.1|  PREDICTED: protein SRG1-like isoform X1          58.5    5e-17   
gb|KDO54061.1|  hypothetical protein CISIN_1g018035mg                 62.4    5e-17   
ref|XP_006428590.1|  hypothetical protein CICLE_v10012028mg           62.4    5e-17   
emb|CDY21770.1|  BnaA09g45210D                                        59.7    5e-17   
ref|XP_009125612.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  58.2    6e-17   
emb|CBI22799.3|  unnamed protein product                              62.4    6e-17   
ref|XP_004307670.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  64.7    6e-17   
ref|XP_010487452.1|  PREDICTED: protein SRG1-like                     62.4    6e-17   
ref|XP_002264807.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  62.4    6e-17   
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                     67.8    6e-17   
ref|XP_003608048.1|  Gibberellin 20 oxidase                           61.6    7e-17   
emb|CDP10992.1|  unnamed protein product                              57.8    7e-17   
ref|XP_004146011.1|  PREDICTED: protein SRG1-like                     57.8    7e-17   
gb|KCW79673.1|  hypothetical protein EUGRSUZ_C01027                   67.8    7e-17   
ref|XP_008805332.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  62.0    7e-17   
ref|XP_011091186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...  61.2    7e-17   
ref|XP_010540139.1|  PREDICTED: protein SRG1-like                     58.2    7e-17   
ref|XP_010028523.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...  57.4    7e-17   
dbj|BAB17075.1|  GA 3beta-hydroxylase                                 67.4    8e-17   
dbj|BAB62072.1|  GA 3beta-hydroxylase                                 67.4    8e-17   



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   115 bits (288),  Expect(4) = 6e-44, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGL-PEDDVDWLK----SKSTSAFLHFNSYPKCP  242
            F + +D YQE++ GLA KI +L+FK+LGL P +DV+W +    S ST A+L  N YPKCP
Sbjct  147  FCSVIDDYQEKMRGLAEKIAALMFKSLGLSPGEDVEWFEPNGLSNSTQAYLQMNWYPKCP  206

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPF  374
             PT+A+G+  HTD+SL+TLLYQ++ I GLQV+GPN N +   P 
Sbjct  207  DPTRAMGLAQHTDTSLVTLLYQTSNIRGLQVYGPNLNWVDVKPI  250


 Score = 84.7 bits (208),  Expect(4) = 6e-44, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            VDVKPI DA+VVN+ D+MQI SNG+FKSV H AIV +A +RIS+ +FFG   N++IS  L
Sbjct  245  VDVKPISDAIVVNLGDLMQIISNGRFKSVLHRAIVSEAHNRISVGYFFGSSKNVEISPSL  304

Query  536  KLVKDRD-SMYPP  571
            KL+K  +  MY P
Sbjct  305  KLIKGSEFPMYKP  317


 Score = 25.0 bits (53),  Expect(4) = 6e-44, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PISW EY  IK  +F+K
Sbjct  317  PISWNEYLDIKNKYFNK  333


 Score = 21.2 bits (43),  Expect(4) = 6e-44, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 9/15 (60%), Gaps = 0/15 (0%)
 Frame = +3

Query  636  TSDDEAPLGGRVYAF  680
             S DEAPLG  V A 
Sbjct  351  ASGDEAPLGSEVEAI  365



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score = 94.7 bits (234),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTS---AFLHFNSYPKCPYP  248
            F   ++ YQ+++ GLA+K+  L+  +LGL  +DV WLK K+ S   A L  NSYP CP P
Sbjct  176  FCGAMEEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKNRSGPRALLQLNSYPVCPDP  235

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            T+A+G+ PHTDSSL+TLL QS +ISGLQV 
Sbjct  236  TRAIGLAPHTDSSLLTLLNQS-SISGLQVL  264


 Score = 71.6 bits (174),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D+M I SNGQFKS  H A+V +  HRIS+ +F+G  +++KIS   
Sbjct  271  VPVHPIPGALVVNVGDLMHILSNGQFKSAVHRAVVNEVHHRISMAYFYGPPMDVKIS---  327

Query  536  KLVKDRDSMYPPYRGKS  586
             L+     +Y P   K 
Sbjct  328  PLIDHNHPLYRPVTWKE  344


 Score = 28.9 bits (63),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY   K  HFDK
Sbjct  339  PVTWKEYLEYKATHFDK  355



>ref|XP_008337346.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Malus domestica]
Length=205

 Score = 90.9 bits (224),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +3

Query  90   VDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTS---AFLHFNSYPKCPYPTQAL  260
            ++ YQ+++ GLA+K+  L+  +LGL  +DV WLK K++S     L  NSYP CP PT+A+
Sbjct  1    MEEYQKEMKGLALKLIGLMLGSLGLNYEDVKWLKPKNSSRPQTVLQLNSYPVCPDPTRAM  60

Query  261  GIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            G+ PHTDSSL+TLL QS +ISGLQV       + + P P
Sbjct  61   GLAPHTDSSLLTLLNQS-SISGLQVLVDGIRWVPAHPIP  98


 Score = 71.6 bits (174),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V   PIP ALVVNV D+M I SNGQFKS  H A+V +  HRIS+ +F+G  +++KIS   
Sbjct  92   VPAHPIPGALVVNVGDLMHILSNGQFKSAAHRAVVNEVHHRISMAYFYGPPMDVKISP--  149

Query  536  KLVKDRDSMYPPYRGKS  586
             L+     +Y P   K 
Sbjct  150  -LIDHNHPLYQPVTWKE  165


 Score = 25.4 bits (54),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY   K  HF K
Sbjct  160  PVTWKEYLDYKATHFXK  176



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score = 88.2 bits (217),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF----LHFNSYPKCPY  245
            F   ++  Q+++ GL+ +I  ++FK+LGL E+DV +L  K  S +    L  NSYPKCP 
Sbjct  157  FCNVMEACQKEMKGLSERIIGIMFKSLGLNEEDVKFLGLKDGSQYPQGALQLNSYPKCPD  216

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+ PHTDSSLIT+L+Q   +SGLQVF
Sbjct  217  PDRAMGLAPHTDSSLITVLHQGG-VSGLQVF  246


 Score = 68.2 bits (165),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+ DALVVN+ D+M I SNG+FK  +H A+V +  HRIS+ +F+G   ++KIS  +
Sbjct  253  VPVSPVDDALVVNIGDLMHIISNGRFKCAQHQAVVNKTRHRISVAYFYGPPGDVKISPLM  312

Query  536  KLVK-DRDSMYPPYRGKS  586
            +LV  D   +Y P   K 
Sbjct  313  QLVDFDHPVLYCPVTWKE  330


 Score = 26.9 bits (58),  Expect(3) = 3e-31, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY   K ++FDK
Sbjct  325  PVTWKEYLDAKAIYFDK  341



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score = 91.7 bits (226),  Expect(3) = 6e-31, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF----LHFNSYPKCPY  245
            F   V  YQ+++ GL+ +I  L+FK+LGL E+DV +L  K  S +    L  NSYPKCP 
Sbjct  157  FCDAVKAYQKEMKGLSERIIGLMFKSLGLIEEDVKFLGLKDESQYPQGALQLNSYPKCPD  216

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+ PHTDSSLIT+L+Q + +SGLQVF
Sbjct  217  PDRAMGLAPHTDSSLITVLHQ-DGVSGLQVF  246


 Score = 64.3 bits (155),  Expect(3) = 6e-31, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P+  ALVVN+ D+M I SNG+FK  +H A+V +  HRIS+ +F+G   ++KIS  ++L
Sbjct  255  VCPVDGALVVNIGDLMHIISNGRFKCAQHQAVVNKTHHRISVAYFYGPPGDVKISPLMQL  314

Query  542  VK-DRDSMYPPYRGKS  586
            V  D   +Y P   K 
Sbjct  315  VDFDHPVLYRPVTWKE  330


 Score = 26.2 bits (56),  Expect(3) = 6e-31, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY   K ++FDK
Sbjct  325  PVTWKEYLDAKTIYFDK  341



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score = 91.3 bits (225),  Expect(3) = 9e-31, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTS-----AFLHFNSYP  233
            +  F   V+ YQ+++ GL+ ++  L+FK+LGL ++DV W  +KS +     + L  NSYP
Sbjct  143  YTTFCDVVEEYQKEMKGLSERLIGLMFKSLGLAQEDVKWFTTKSETQHQPQSVLQLNSYP  202

Query  234  KCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
             CP   QA+G+ PHTDS+L+TL++Q+N  SGLQVF
Sbjct  203  ICPEAGQAMGLAPHTDSTLLTLVHQNNA-SGLQVF  236


 Score = 63.5 bits (153),  Expect(3) = 9e-31, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVN+ D+MQI SNG+FKSV H A+V +  HR S+  F+G  ++ ++S  +
Sbjct  243  VPVHPVDGALVVNIGDLMQILSNGRFKSVLHRAVVNETYHRTSVVHFYGPPMDAEVSPLM  302

Query  536  KLV  544
             L+
Sbjct  303  HLI  305


 Score = 26.6 bits (57),  Expect(3) = 9e-31, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            +SWKEY   K +HFDK
Sbjct  316  VSWKEYLDAKKIHFDK  331



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score = 81.6 bits (200),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS--KSTSAF---LHFNSYPKCP  242
            F   ++ YQ+++ GL+ K+  L+  +LGL ++DV WL    +S++ F   L  N YP CP
Sbjct  153  FCDVMEEYQKKMKGLSGKLIRLMLGSLGLDKEDVKWLNRPKRSSTNFPQVLQLNYYPVCP  212

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             PT+A+G+ PHTD+S+ T+L Q + ISGLQVF      +   P P
Sbjct  213  DPTRAMGLAPHTDTSVFTVLNQCD-ISGLQVFQEGIGWMSVQPIP  256


 Score = 79.3 bits (194),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PIP ALVVNV D+M I SNG+FK+  H A+V +  HRISI +F+G   ++KIS  +
Sbjct  250  MSVQPIPGALVVNVGDLMHILSNGRFKTTIHRAVVNELHHRISIAYFYGPPYDVKISPLM  309

Query  536  KLV-KDRDSMYPPYRGKSTRGLRGC  607
            KL+ +D   +Y P   K   G++G 
Sbjct  310  KLIGQDHPPLYRPVTWKEYLGIKGT  334



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score = 94.4 bits (233),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 5/96 (5%)
 Frame = +3

Query  72   VCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK----SKSTSAFLHFNSYPKC  239
            + F   +  YQ++L GLA KI  L+F++LGL ++D+ W K     KS    L  NSYP C
Sbjct  157  INFCQVMVEYQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVC  216

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPN  347
            P P +A+G+ PHTDSSL+T LYQ NT SGLQV+  N
Sbjct  217  PDPNRAMGLAPHTDSSLLTSLYQGNT-SGLQVYRDN  251


 Score = 60.8 bits (146),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVV V D+MQI  NG+FKS  H A+V    HRIS  +F+G   ++KIS  +
Sbjct  255  VPVHPVSGALVVIVGDLMQITCNGRFKSALHRALVNNTRHRISTAYFYGPPQDVKISPSV  314

Query  536  KLV-KDRDSMYPP  571
            KL   D   +Y P
Sbjct  315  KLTDHDHPILYRP  327


 Score = 25.8 bits (55),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W+EY   K  HF+K
Sbjct  327  PVTWREYLDAKATHFNK  343



>gb|KDO80406.1| hypothetical protein CISIN_1g043986mg, partial [Citrus sinensis]
Length=195

 Score = 93.2 bits (230),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = +3

Query  99   YQEQLMGLAIKITSLIFKALGLPEDDVDWLK----SKSTSAFLHFNSYPKCPYPTQALGI  266
            YQ++L GLA KI  L+F++LGL ++D+ W K     KS    L  NSYP CP P +A+G+
Sbjct  6    YQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMGL  65

Query  267  VPHTDSSLITLLYQSNTISGLQVFGPN  347
             PHTDSSL+T LYQ NT SGLQV+  N
Sbjct  66   APHTDSSLLTSLYQGNT-SGLQVYRDN  91


 Score = 60.8 bits (146),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVV V D+MQI  NG+FKS  H A+V    HRIS  +F+G   ++KIS  +
Sbjct  95   VPVHPVSGALVVIVGDLMQITCNGRFKSALHRALVNNTRHRISTAYFYGPPQDVKISPSV  154

Query  536  KLV-KDRDSMYPP  571
            KL   D   +Y P
Sbjct  155  KLTDHDHPILYRP  167


 Score = 26.2 bits (56),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W+EY   K  HF+K
Sbjct  167  PVTWREYLDAKATHFNK  183



>ref|XP_006451038.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
 gb|ESR64278.1| hypothetical protein CICLE_v10010731mg [Citrus clementina]
Length=193

 Score = 93.2 bits (230),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = +3

Query  99   YQEQLMGLAIKITSLIFKALGLPEDDVDWLK----SKSTSAFLHFNSYPKCPYPTQALGI  266
            YQ++L GLA KI  L+F++LGL ++D+ W K     KS    L  NSYP CP P +A+G+
Sbjct  4    YQKELKGLAEKILGLMFRSLGLTQEDIAWFKPKYGCKSPQGVLQLNSYPVCPDPNRAMGL  63

Query  267  VPHTDSSLITLLYQSNTISGLQVFGPN  347
             PHTDSSL+T LYQ NT SGLQV+  N
Sbjct  64   APHTDSSLLTSLYQGNT-SGLQVYRDN  89


 Score = 60.8 bits (146),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVV V D+MQI  NG+FKS  H A+V    HRIS  +F+G   ++KIS  +
Sbjct  93   VPVHPVSGALVVIVGDLMQITCNGRFKSALHRALVNNTRHRISTAYFYGPPQDVKISPSV  152

Query  536  KLV-KDRDSMYPP  571
            KL   D   +Y P
Sbjct  153  KLTDHDHPILYRP  165


 Score = 26.2 bits (56),  Expect(3) = 3e-30, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W+EY   K  HF+K
Sbjct  165  PVTWREYLDAKATHFNK  181



>dbj|BAD06943.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=372

 Score = 86.7 bits (213),  Expect(3) = 9e-30, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW-LKSKSTSAFLHFNSYPKCPY  245
            F  F   V+ Y++++  LA ++  LI ++LG+ E+D  W ++SK   + L  NSYP CP 
Sbjct  159  FNSFCEVVEEYEKEMKKLAGRMMKLILESLGVAEEDAKWGVESKGRCSALQLNSYPACPD  218

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  219  PGRAMGLAEHTDSTVLTILHQNNT-SGLQVF  248


 Score = 63.2 bits (152),  Expect(3) = 9e-30, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALV+N  D++ I SNG + SV H A+V ++SHR+S+ + +G    +KIS   
Sbjct  257  VTVPPIPGALVINAGDLLHILSNGLYHSVLHRAVVNRSSHRLSVAYLYGPPPGIKISPLP  316

Query  536  KLVKD  550
            KLV +
Sbjct  317  KLVAE  321


 Score = 28.5 bits (62),  Expect(3) = 9e-30, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 2/26 (8%)
 Frame = +1

Query  541  GQGP*FHVSPISWKEYQRIKGVHFDK  618
            GQ P F    I+W EY R K  HFDK
Sbjct  322  GQPPLFRA--ITWSEYLRTKAKHFDK  345



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score = 85.1 bits (209),  Expect(3) = 2e-28, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 6/90 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK----STSAFLHFNSYPKCPY  245
            F + ++ YQ+++ GL+ K+  LI ++LG+  +D+ W   K    S  A L  NSYP CP 
Sbjct  162  FCSVMEMYQKEMKGLSEKLLELILRSLGVNYEDIKWANPKNGLSSYQALLQLNSYPVCPD  221

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            PT+A+G+ PHTDSSL+T+LYQS    GLQV
Sbjct  222  PTRAMGLAPHTDSSLLTVLYQS--CMGLQV  249


 Score = 60.8 bits (146),  Expect(3) = 2e-28, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +  AL+VN+ D+M I SNG+FKS  H A+V +  HR+S+ +F G     KISS +
Sbjct  258  VPVHTVDGALIVNLGDLMHIMSNGRFKSAMHRAVVNKTHHRVSVAYFCGPPKEEKISSLI  317

Query  536  KLV-KDRDSMY  565
            +++  DR  MY
Sbjct  318  QMIDDDRPRMY  328


 Score = 27.3 bits (59),  Expect(3) = 2e-28, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WKEY  I+  HFDK
Sbjct  331  VTWKEYLEIRAAHFDK  346



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score = 86.3 bits (212),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 12/117 (10%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK----STSAFL  215
            Y  +CC         + ++ ++  LA ++  L+  +LG+ +DDV+W   K    + SA  
Sbjct  159  YTKFCC-------ITEEFEREIKRLASRLVWLMLASLGISKDDVEWDGPKGDDQNASAVF  211

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHL  386
             FNSYP CP P + LG+VPHTDSSL+++++QSN I GLQVF          P P  L
Sbjct  212  QFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQSN-IDGLQVFREGTGWFTIQPVPGAL  267


 Score = 66.6 bits (161),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            ++P+P ALV+NV D+M I SNG + SV H  +V +A HRIS+ + +G    +KI+   KL
Sbjct  260  IQPVPGALVINVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLAKL  319

Query  542  VKDRDS-MYPPYRGK----STRG-LRGCILTSVR  625
            V   +S +YPP        ST+  L+G  L S+R
Sbjct  320  VGPSNSPLYPPVTNWNEYISTKAKLKGKALPSLR  353



>ref|XP_007013295.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
 gb|EOY30914.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
Length=355

 Score = 80.5 bits (197),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLP-EDDVDWLK-----SKSTSAFLHFNSYPKC  239
            F   ++ +QE++  L+ K+ +++  +LGL  E+DV W +        ++  L  NSYP C
Sbjct  161  FCEVMEQFQEEMKALSEKMVAIMLSSLGLTHEEDVKWFEPMKEGCDQSTCVLQLNSYPVC  220

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            P P +A+G+ PHTDSS++TLLYQ N ISGLQV
Sbjct  221  PDPGRAMGLAPHTDSSVLTLLYQGN-ISGLQV  251


 Score = 68.6 bits (166),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+P+  ALVVNV D+M I SNG+FKSV H A+V    HR+S  +F+G   + K+ SPL+ 
Sbjct  262  VEPVEGALVVNVGDLMHIVSNGRFKSVLHRALVNNEHHRVSTAYFYGPPRDAKV-SPLRK  320

Query  542  VKDRDSMYPP-YR  577
            + DRD  +PP YR
Sbjct  321  LIDRD--HPPLYR  331


 Score = 23.9 bits (50),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WK+Y   K  HF K
Sbjct  332  PVTWKDYLEAKSKHFSK  348



>dbj|BAG48320.1| gibberellin 3-oxidase1 [Chrysanthemum x morifolium]
Length=356

 Score = 82.0 bits (201),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYP  248
            +  F   ++ Y+E++  LA  + SL+  +LG+  +DV W  S+ +   L  NSYP CP P
Sbjct  147  YTRFCDVIEEYKEEMNKLAQTLMSLMLGSLGVTMEDVKWAGSQGSCPALQLNSYPACPDP  206

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             +A+G+  HTDS+L+T+L+Q+NT SGLQ        +   P P
Sbjct  207  DRAMGLAAHTDSTLLTILHQNNT-SGLQAHRDGAGWVTVPPIP  248


 Score = 64.7 bits (156),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G   N++IS   
Sbjct  242  VTVPPIPGALVINVGDLLHILSNGLYPSVLHRAMVNRTKHRLSVAYLYGPPSNVQIS---  298

Query  536  KLVKDRDSMYPP-YR  577
             L K  D ++PP YR
Sbjct  299  PLSKLTDQVHPPLYR  313


 Score = 24.3 bits (51),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  314  PVTWSEYLGTKAKHFNK  330



>ref|XP_009343425.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score = 83.2 bits (204),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +LG+  +D+ W  SK      SA L  NSYP CP 
Sbjct  161  FCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQSNT SGLQV       +   P P
Sbjct  221  PDRAMGLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMP  263


 Score = 62.0 bits (149),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALV+NV D+  I SNG + SV H A+V +  HR+SI + FG   +L+IS   
Sbjct  257  VTVPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSIAYLFGPPASLQISPLS  316

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  317  KLVGPS---HPPLYR  328


 Score = 25.8 bits (55),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PISW EY   K  HF+K
Sbjct  329  PISWNEYLGTKAKHFNK  345



>dbj|BAA89316.1| gibberellin 3beta-hydroxylase [Nicotiana tabacum]
Length=371

 Score = 84.7 bits (208),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y+ ++  LA ++  L+  +LG+ +++V W      +SK  SA L  NSYP CP
Sbjct  160  FCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWAVCPKGESKGGSAALQLNSYPACP  219

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQVF      +   PFP
Sbjct  220  DPDRAMGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPFP  263


 Score = 63.2 bits (152),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G    +K+S   
Sbjct  257  VTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPLA  316

Query  536  KLVKDRDSMYPP-YR  577
            KLV  R   +PP YR
Sbjct  317  KLVDQR---HPPLYR  328


 Score = 23.1 bits (48),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HFDK
Sbjct  330  VTWSEYLGTKARHFDK  345



>ref|XP_009588350.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=371

 Score = 84.7 bits (208),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y+ ++  LA ++  L+  +LG+ +++V W      +SK  SA L  NSYP CP
Sbjct  160  FCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWAVCPKGESKGGSAALQLNSYPACP  219

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQVF      +   PFP
Sbjct  220  DPDRAMGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPFP  263


 Score = 63.2 bits (152),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G    +K+S   
Sbjct  257  VTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPLA  316

Query  536  KLVKDRDSMYPP-YR  577
            KLV  R   +PP YR
Sbjct  317  KLVDQR---HPPLYR  328


 Score = 22.7 bits (47),  Expect(3) = 1e-27, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HFDK
Sbjct  330  VTWSEYLGTKAKHFDK  345



>ref|XP_010254240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=352

 Score = 82.8 bits (203),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPK  236
            +  F   ++ YQ+++  L+ ++T L+  +LGL  DD++W+ +        + L  NSYP 
Sbjct  156  YTNFCDVIEEYQKEMSKLSGRLTVLLLNSLGLTTDDLEWVGATGEINGARSALRLNSYPP  215

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP PT+A+G+ PHTDSSL T++YQ+ T +GLQV
Sbjct  216  CPEPTRAMGLAPHTDSSLFTVIYQNGT-TGLQV  247


 Score = 63.9 bits (154),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+  ALVVNV D++ I SNG+F S  H A+V +A HR+SI  F+G  +N ++S   
Sbjct  255  VTVRPVTGALVVNVGDILHIISNGRFVSSVHRAVVDRAQHRLSIAHFYGPPVNAQLSPAK  314

Query  536  KLVKDRD  556
            KLV   D
Sbjct  315  KLVDPPD  321


 Score = 23.1 bits (48),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 5/28 (18%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDKR*R*SKLVMMRH  654
            ++ +EY  IK  HFDK      L ++RH
Sbjct  329  VTSQEYLAIKAKHFDK-----ALALIRH  351



>ref|XP_011081703.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like, partial [Sesamum 
indicum]
Length=369

 Score = 89.4 bits (220),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F  T++ YQ+++  LA ++  LI  +LG+ EDDV W++ K       A L  NSYP CP 
Sbjct  163  FCNTIEEYQKEMKNLASRLMGLILGSLGVTEDDVKWVEPKGELKERGAALQLNSYPPCPD  222

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+++ +L+QSNT SGLQVF
Sbjct  223  PDKAMGMAAHTDSTILNILHQSNT-SGLQVF  252


 Score = 54.3 bits (129),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V ++P P AL+V + D+M I SNG + +  H A+V Q  HR+S+ +  G   ++K+    
Sbjct  260  VTLQPHPGALIVVIGDLMHILSNGSYLNALHRAVVNQTQHRLSVVYLHGPPSSVKMGPLP  319

Query  536  KLVKDRDSMYPP-YR  577
            +LV   DS +PP YR
Sbjct  320  QLV---DSNHPPLYR  331


 Score = 26.2 bits (56),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY  IK  +FDK
Sbjct  332  PITWNEYLGIKAQYFDK  348



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score = 80.5 bits (197),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF----LHFNSYPKCPY  245
            +   V+ Y+EQ+  LA K+  L   +LG+ E+D+ W  + S S +    L  N YP CP 
Sbjct  164  YCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANSDSDWAQSALQLNHYPVCPE  223

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+L+Q+NT +GLQVF  +   +   P P
Sbjct  224  PDRAMGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVP  266


 Score = 62.0 bits (149),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P +LVVNV D+  I SNG FKSV H A V Q   R+S+ F +G + ++KIS   
Sbjct  260  VTVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVP  319

Query  536  KLVKDRDSMYPPYR  577
            KLV    S  P YR
Sbjct  320  KLVSPVGS--PLYR  331


 Score = 26.9 bits (58),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 5/29 (17%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDKR*R*SKLVMMRHH  657
            ++W EY R K  HF++      L M+R+H
Sbjct  333  VTWTEYLRTKATHFNE-----ALSMIRNH  356



>dbj|BAA37129.1| gibberelin 3beta-hydroxylase [Lactuca sativa]
Length=363

 Score = 80.1 bits (196),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ Y+ ++  LA ++  L+  +LG+  +DV W  S+ +   L  NSYP CP P +A
Sbjct  157  FCDVIEGYKHEMNNLAQRLMWLMLGSLGVTTEDVKWDGSQGSCPALQLNSYPACPDPDRA  216

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +G+  HTDS+L+T+LYQ+NT SGLQ        +   P P
Sbjct  217  MGLAAHTDSTLLTILYQNNT-SGLQAHREGAGWVTVPPIP  255


 Score = 65.5 bits (158),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G   N++IS   
Sbjct  249  VTVPPIPGALVVNVGDLLHILSNGLYPSVLHRAMVNRTQHRLSVAYLYGPPSNVQIS---  305

Query  536  KLVKDRDSMYPP-YR  577
             L K  D ++PP YR
Sbjct  306  PLSKLTDHVHPPLYR  320


 Score = 24.3 bits (51),  Expect(3) = 3e-27, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  321  PVTWSEYLGTKAKHFNK  337



>gb|ACT99991.1| gibberellin 3-oxidase [Malus domestica]
Length=369

 Score = 83.2 bits (204),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +LG+  +D+ W  SK      SA L  NSYP CP 
Sbjct  161  FCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQSNT SGLQV       +   P P
Sbjct  221  PDRAMGLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMP  263


 Score = 60.5 bits (145),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALV+NV D+  I SNG + SV H A+V +  HR+S+ + FG   +++IS   
Sbjct  257  VTVPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLS  316

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  317  KLVGPS---HPPLYR  328


 Score = 25.8 bits (55),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PISW EY   K  HF+K
Sbjct  329  PISWNEYLGTKAKHFNK  345



>ref|NP_001275412.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
 gb|AAK91506.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
Length=355

 Score = 83.2 bits (204),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW-LKSKSTSAFLHFNSYPKCPYPTQ  254
            F   ++ Y+ ++  LA ++  L+  +LG+ ++DV W +  +S S+ L  NSYP CP P +
Sbjct  148  FCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVGPRSGSSALQLNSYPACPDPDR  207

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+  HTDS+L+T+L+Q+NT SGLQVF
Sbjct  208  AMGLAAHTDSTLLTILHQNNT-SGLQVF  234


 Score = 60.1 bits (144),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H AIV +  HR+S+ + +G    +KIS   
Sbjct  241  VTVLPLRGALVLNVGDLVHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLS  300

Query  536  KLVKDRD-SMYPP  571
            KLV  R+  MY P
Sbjct  301  KLVDQRNPQMYRP  313


 Score = 25.8 bits (55),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HFDK
Sbjct  313  PVTWSEYLGTKAKHFDK  329



>ref|XP_008365721.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=371

 Score = 83.2 bits (204),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +LG+  +D+ W  SK      SA L  NSYP CP 
Sbjct  161  FCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKWAGSKGEFKGASAALQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQSNT SGLQV       +   P P
Sbjct  221  PDRAMGLAAHTDSTLLTILYQSNT-SGLQVLREGTGWVTVPPMP  263


 Score = 60.5 bits (145),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALV+NV D+  I SNG + SV H A+V +  HR+S+ + FG   +++IS   
Sbjct  257  VTVPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLS  316

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  317  KLVGPS---HPPLYR  328


 Score = 25.8 bits (55),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PISW EY   K  HF+K
Sbjct  329  PISWNEYLGTKAKHFNK  345



>ref|XP_009771250.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
 gb|AAM12873.1|AF494090_1 gibberellin 3-oxidase 2 [Nicotiana sylvestris]
Length=370

 Score = 84.7 bits (208),  Expect(3) = 5e-27, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (63%), Gaps = 6/104 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y+ ++  LA ++  L+  +LG+ ++DV+W      +SK  SA L  NSYP CP
Sbjct  159  FCDAIEEYEREMEKLAGRLMWLMLGSLGITKEDVNWAVGPKGESKGGSAALQLNSYPACP  218

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPF  374
             P +A+G+  HTDS+++T+L+Q+NT SGLQVF      +   PF
Sbjct  219  DPDRAMGLAAHTDSTILTILHQNNT-SGLQVFKEGSGWVTVPPF  261


 Score = 60.8 bits (146),  Expect(3) = 5e-27, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P   ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  256  VTVPPFLGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLA  315

Query  536  KLVKDRDSMYPP-YR  577
            KLV  R   +PP YR
Sbjct  316  KLVDQR---HPPLYR  327


 Score = 23.5 bits (49),  Expect(3) = 5e-27, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            I+W EY   K  HFDK
Sbjct  329  ITWSEYLGTKAKHFDK  344



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score = 85.9 bits (211),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 12/117 (10%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK----STSAFL  215
            Y  +CC         + +++++  LA ++  L+  +LG+ +DDV+W   K    + SA  
Sbjct  159  YTKFCC-------ITEEFEKEIKKLASRLMWLMLASLGISKDDVEWDGPKGDDQNASAVF  211

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHL  386
             FNSYP CP P + LG+VPHTDSSL+++++QSN I GLQVF          P P  L
Sbjct  212  QFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQSN-IDGLQVFREGTGWFTIQPVPGAL  267


 Score = 62.4 bits (150),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            ++P+P ALVVNV D+M I SNG + SV H  +V +A HRIS+ + +G    +KI+   KL
Sbjct  260  IQPVPGALVVNVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLEKL  319

Query  542  VK-DRDSMYPPYRGK----STRG-LRGCILTSVR  625
                   +YPP        ST+  L+G  L S+R
Sbjct  320  FGPSHPPLYPPVTNWNEYISTKAKLKGKALPSLR  353



>ref|XP_002299619.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE84424.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=372

 Score = 84.7 bits (208),  Expect(3) = 8e-27, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F   ++ Y++++  LA ++T L+  +LG+ + D+ W     +SK  SA L  N YP 
Sbjct  159  YTKFCDIIEEYKKEMQKLARRLTWLMLGSLGIAKKDLKWAGSTGESKKGSAALQLNYYPA  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            CP P QA+G+  HTDS+L+T+LYQSNT SGLQV       +   P P
Sbjct  219  CPDPDQAMGLAAHTDSTLLTILYQSNT-SGLQVLKEGIGWITVPPIP  264


 Score = 61.6 bits (148),  Expect(3) = 8e-27, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V PIP  LVVNV D++ I SNG + SV H A+V +  HR+SI F +G   +++IS   
Sbjct  258  ITVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQ  317

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  318  KLVGPN---HPPLYR  329


 Score = 21.9 bits (45),  Expect(3) = 8e-27, Method: Compositional matrix adjust.
 Identities = 7/17 (41%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  +F+K
Sbjct  330  PVTWNEYLGTKAKYFNK  346



>ref|XP_011045367.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=372

 Score = 85.1 bits (209),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F   ++ Y++++  LA ++T L+  +LG+ + D+ W     +SK  SA L  N YP 
Sbjct  159  YTKFCDIIEEYKKEMQKLARRLTRLMLGSLGITKKDLKWAGSTGESKKGSAALQLNYYPA  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            CP P QA+G+  HTDS+L+T+LYQSNT SGLQV       +   P P
Sbjct  219  CPDPDQAMGLAAHTDSTLLTILYQSNT-SGLQVLKEGIGWVTVPPIP  264


 Score = 62.4 bits (150),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP  LVVNV D++ I SNG + SV H A+V +  HR+SI F +G   +++IS   
Sbjct  258  VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQ  317

Query  536  KLVK-DRDSMYPPYRGKSTRGLRGC----ILTSVR  625
            KLV  +   +Y P       G +       L+SVR
Sbjct  318  KLVGPNHPPLYRPVTWNEYLGTKATYFNKALSSVR  352



>ref|XP_006356177.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=372

 Score = 83.2 bits (204),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y++++  LA ++  LI  +LG+ +DDV W      ++K   A L  NSYP CP
Sbjct  161  FCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACP  220

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQV+      +   P P
Sbjct  221  DPGRAMGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWVTVPPIP  264


 Score = 63.9 bits (154),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G    +++S   
Sbjct  258  VTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPLS  317

Query  536  KLVKDRDSMYPP-YR  577
            KL+  R   +PP YR
Sbjct  318  KLLDHR---HPPLYR  329


 Score = 20.4 bits (41),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  +FDK
Sbjct  331  VTWSEYLGTKAKYFDK  346



>ref|XP_006427125.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|ESR40365.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|KDO58202.1| hypothetical protein CISIN_1g036286mg [Citrus sinensis]
Length=352

 Score = 79.3 bits (194),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            F      ++ Y++++  LA ++  L+  +LG+   DV W   K      SA L  N YP 
Sbjct  155  FCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKWAGPKGHFTDASAALQLNYYPA  214

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            CP P +A+G+  HTDS+L+T+LYQ+NT SGLQV       +M  P P
Sbjct  215  CPDPDRAMGLAEHTDSTLLTILYQNNT-SGLQVLKEGTGWVMVPPIP  260


 Score = 63.2 bits (152),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D++ I SNG + SV H A+V +A HR+SI + +G   +++IS   
Sbjct  254  VMVPPIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQ  313

Query  536  KLV  544
            KLV
Sbjct  314  KLV  316


 Score = 25.0 bits (53),  Expect(3) = 1e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  326  PITWSEYLDTKAKHFNK  342



>ref|NP_001233855.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34125.1| 3b-hydroxylase [Solanum lycopersicum]
Length=355

 Score = 83.2 bits (204),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW-LKSKSTSAFLHFNSYPKCPYPTQ  254
            F   ++ Y+ ++  LA ++  L+  +LG+ ++DV W +  +S S+ L  NSYP CP P +
Sbjct  148  FCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVGPRSGSSALQLNSYPACPDPDR  207

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+  HTDS+L+T+L+Q+NT SGLQVF
Sbjct  208  AMGLAAHTDSTLLTILHQNNT-SGLQVF  234


 Score = 57.8 bits (138),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +  ALV+NV D++ I SNG + SV H AIV +  HR+S+ + +G    +KIS   
Sbjct  241  VTVPLLRGALVINVGDLLHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLS  300

Query  536  KLVKDRD-SMYPP  571
            KLV  R+  MY P
Sbjct  301  KLVDQRNPQMYRP  313


 Score = 25.8 bits (55),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HFDK
Sbjct  313  PVTWSEYLGTKAKHFDK  329



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score = 77.4 bits (189),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPY  245
            F   ++ Y +++  L+ ++  LI  +LG+ + D+ W       K   A L  NSYP CP 
Sbjct  149  FCDVIEEYNKEMNKLSNRVMWLILGSLGIKKGDIKWANQEGEIKEACAALQLNSYPSCPD  208

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            P +A+G+  HTDS+L+T+L+QSNT SGLQV
Sbjct  209  PDRAMGLAAHTDSTLLTILHQSNT-SGLQV  237


 Score = 65.1 bits (157),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V VKPI  ALVVN+ D++QI SNG + SV H A+V +  HR+S+ + +G   N++I+   
Sbjct  244  VTVKPIAGALVVNIGDLIQILSNGLYSSVLHRAMVNRTQHRLSVAYLYGPPSNVRIAPLS  303

Query  536  KLVKDRDSMYPP-YR  577
            KL    D+++PP YR
Sbjct  304  KLT---DNVHPPLYR  315


 Score = 24.3 bits (51),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  316  PVTWSEYLGTKAKHFNK  332



>ref|XP_010254241.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=370

 Score = 79.0 bits (193),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y + +  LA K+  L+  +LG+ +DD++W      +S +  A L  NSYP CP
Sbjct  159  FCDVMEEYGKCMKQLARKLFWLMLGSLGINKDDINWASPQGGESGAMCAALQLNSYPACP  218

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             PT+A+G+  HTDS+L+T+LYQ N+ SGLQV       +   P P
Sbjct  219  DPTRAMGLAAHTDSTLLTVLYQ-NSTSGLQVLRDGAGWVTVPPLP  262


 Score = 63.5 bits (153),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVVNV D++ I SNG F SV H A+V +  HR+S+ + +G   N +IS   
Sbjct  256  VTVPPLPGALVVNVGDLLHILSNGIFPSVLHRAVVNRTRHRLSVAYLYGPPTNAQISPLS  315

Query  536  KLVKDRDSMYPP-YR  577
             LV   D  +PP YR
Sbjct  316  SLV---DPNHPPLYR  327


 Score = 23.9 bits (50),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  328  PVTWAEYLGTKAKHFNK  344



>ref|XP_006341659.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=356

 Score = 80.5 bits (197),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW-LKSKSTSAFLHFNSYPKCPYPTQ  254
            F   ++ Y+ ++  LA ++  L+  +LG+ ++DV W +  +S  + L  NSYP CP P +
Sbjct  149  FCDVIEEYENEMEKLAGRLMGLMLGSLGITKEDVKWAVGPRSGCSALQLNSYPACPDPDR  208

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  209  AMGLAAHTDSTILTILHQNNT-SGLQVF  235


 Score = 60.1 bits (144),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  242  VTVPPLCGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLS  301

Query  536  KLVKDRD-SMYPP  571
            KLV  R+  MY P
Sbjct  302  KLVDQRNPPMYRP  314


 Score = 25.8 bits (55),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HFDK
Sbjct  314  PVTWSEYLGTKAKHFDK  330



>gb|ACN89835.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=372

 Score = 81.6 bits (200),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y++++  LA ++  LI  +LG+ +D+V W      ++K   A L  NSYP CP
Sbjct  161  FCEVIEEYEKEMEKLAGRLMWLILGSLGITKDEVKWAVGPKGETKEGCAALQLNSYPACP  220

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQV+      +   P P
Sbjct  221  DPGRAMGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWVTVPPIP  264


 Score = 64.3 bits (155),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D++ I SNG + SV H A+V +  HR+S+ + +G    +++S   
Sbjct  258  VTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPLS  317

Query  536  KLVKDRDSMYPP-YR  577
            KL+  R   +PP YR
Sbjct  318  KLLDHR---HPPLYR  329


 Score = 20.4 bits (41),  Expect(3) = 3e-26, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  +FDK
Sbjct  331  VTWSEYLGTKAKYFDK  346



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 80.5 bits (197),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            Y  +CC        V+ Y+ ++  LA ++  LIF +LG+ ++DV W   K      S  L
Sbjct  156  YNKFCC-------MVEEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGGFEDASNAL  208

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
              NSYP CP P++A+G+  HTDS+L+T+++QSN ISGLQV       L   P
Sbjct  209  QLNSYPACPDPSRAMGLAEHTDSTLLTIIHQSN-ISGLQVLREGAGWLTVPP  259


 Score = 65.5 bits (158),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+  ALV+N+ D++ I SNG++++V H AIV ++  R+S+ + +G  IN++IS   
Sbjct  255  LTVPPVAGALVINIGDLIHILSNGEYQNVLHRAIVNRSQQRLSVAYLYGPPINVQISPHS  314

Query  536  KLVK-DRDSMYPPYRGKSTRGLRG  604
            KLV     S+Y P   K   G++G
Sbjct  315  KLVTPSHPSLYRPVTWKEYLGIKG  338



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score = 77.0 bits (188),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   V+ Y+EQ+  LA K+  L   +LG+ E+D+ W  +        + L  N YP CP 
Sbjct  164  YCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKWASANPDLNWAQSALQLNHYPVCPE  223

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+L+Q+NT +GLQVF  +   +   P P
Sbjct  224  PDRAMGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVP  266


 Score = 64.3 bits (155),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+PD+LVVNV D+  I SNG FKSV H A V Q   R+S+ F +G + ++KIS   
Sbjct  260  VTVPPVPDSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVP  319

Query  536  KLVKDRDSMYPPYR  577
            KLV    S  P YR
Sbjct  320  KLVSPVGS--PLYR  331


 Score = 24.3 bits (51),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY R K  HF++
Sbjct  333  VTWTEYLRTKATHFNE  348



>ref|XP_002303276.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE78255.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=373

 Score = 80.5 bits (197),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F   ++ +++++  LA ++T L+  +LG+ + D++W     +SK   A L  NSYP 
Sbjct  160  YTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPA  219

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            CP P  A+G+  HTDS+L+T+LYQ+NT SGLQV       +   P P
Sbjct  220  CPDPDLAMGLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIP  265


 Score = 60.8 bits (146),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP  LVVNV D++ I SNG + SV H A+V +  HR+SI + +G   +++IS   
Sbjct  259  VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQ  318

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  319  KLVGPN---HPPLYR  330


 Score = 24.3 bits (51),  Expect(3) = 4e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  331  PITWNEYLVAKAKHFNK  347



>gb|AAR12160.1| gibberellin 3-oxidase [Populus tremula x Populus tremuloides]
Length=373

 Score = 80.5 bits (197),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F   ++ +++++  LA ++T L+  +LG+ + D++W     +SK   A L  NSYP 
Sbjct  160  YTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPA  219

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            CP P  A+G+  HTDS+L+T+LYQ+NT SGLQV       +   P P
Sbjct  220  CPDPDLAMGLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIP  265


 Score = 60.8 bits (146),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP  LVVNV D++ I SNG + SV H A+V +  HR+SI + +G   +++IS   
Sbjct  259  VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQ  318

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  319  KLVGPN---HPPLYR  330


 Score = 24.3 bits (51),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  331  PITWNEYLVAKAKHFNK  347



>ref|XP_011072274.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=378

 Score = 75.5 bits (184),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLP-EDDVDWLK----SKSTSAFLHFNSYPKCP  242
            F  T++ YQ+ +  LA ++  L+  +LG+  EDD+ W      +   +A +  NSYP CP
Sbjct  166  FCDTIEDYQKSMKKLAGRLMWLMLGSLGITNEDDIKWASPAGEAGGGNAAIQLNSYPACP  225

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
             P +A+G+  HTDS+L+T+L+QSNT SGLQVF       ++ P
Sbjct  226  DPDRAMGLAAHTDSTLLTILHQSNT-SGLQVFQEGSKRWITVP  267


 Score = 61.2 bits (147),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P P ALV++V D+M I SNG + SV H A+V +  HR+SI + +G   ++KIS   
Sbjct  264  ITVPPHPGALVIHVGDLMHILSNGLYPSVLHRAVVNRTRHRLSIAYLYGPPSSVKISPLP  323

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  324  KLV---DHFHPPLYR  335


 Score = 28.5 bits (62),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (55%), Gaps = 0/33 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDKR*R*SKLVMMRHHWVE  666
            PI+W EY   K  HFDK     +L   R+ +V+
Sbjct  336  PITWSEYLGTKAKHFDKALTSVRLCAPRNGFVD  368



>ref|XP_009339604.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score = 82.0 bits (201),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +LG+  +DV W  SK      SA L  NSYP CP 
Sbjct  161  FCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKWAGSKGEFKGASAALQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+L+T+LYQ+NT SGLQV 
Sbjct  221  PDRAMGLAAHTDSTLLTILYQNNT-SGLQVL  250


 Score = 58.5 bits (140),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVNV D++ I SNG + SV H A+V +  HR+SI + FG   +++IS   
Sbjct  257  VTVPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLS  316

Query  536  KLV  544
            KLV
Sbjct  317  KLV  319


 Score = 24.6 bits (52),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  329  PITWNEYLGTKAKHFNK  345



>gb|ACN89834.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=356

 Score = 79.0 bits (193),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW-LKSKSTSAFLHFNSYPKCPYPTQ  254
            F   ++ Y+ ++  LA  +  L+  +LG+ ++DV W +  +S  + L  NSYP CP P +
Sbjct  149  FCDVIEEYENEMEKLAGTLMGLMLGSLGITKEDVKWAVGPRSGCSALQLNSYPACPDPDR  208

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  209  AMGLAAHTDSTILTILHQNNT-SGLQVF  235


 Score = 60.5 bits (145),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  242  VTVPPLRGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLS  301

Query  536  KLVKDRD-SMYPP  571
            KLV  R+  MY P
Sbjct  302  KLVDQRNPPMYRP  314


 Score = 25.8 bits (55),  Expect(3) = 5e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HFDK
Sbjct  314  PVTWSEYLGTKAKHFDK  330



>gb|AFS18537.1| gibberellin 3-oxidase [Pyrus communis]
Length=371

 Score = 82.0 bits (201),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +LG+  +DV W  SK      SA L  NSYP CP 
Sbjct  161  FCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKWAGSKGEFKGASAALQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+L+T+LYQ+NT SGLQV 
Sbjct  221  PDRAMGLAAHTDSTLLTILYQNNT-SGLQVL  250


 Score = 58.5 bits (140),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVNV D++ I SNG + SV H A+V +  HR+SI + FG   +++IS   
Sbjct  257  VTVPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLS  316

Query  536  KLV  544
            KLV
Sbjct  317  KLV  319


 Score = 24.6 bits (52),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  329  PITWNEYLGTKAKHFNK  345



>ref|XP_009596383.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=363

 Score = 83.6 bits (205),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 7/106 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW------LKSKSTSAFLHFNSYPKC  239
            F   ++ Y++++  LA ++  L+  +LG+ +DDV W      ++SK   + L  NSYP C
Sbjct  151  FCEIIEEYEKEMEKLAGRLMWLMLGSLGINKDDVKWAVGPRGVESKGGCSALQLNSYPAC  210

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P P +A+G+  HTDS+++T+L+Q+NT SGLQVF      +   P P
Sbjct  211  PDPDRAMGLAAHTDSTILTILHQNNT-SGLQVFKEGNGWVAVPPLP  255


 Score = 61.6 bits (148),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  249  VAVPPLPGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSMAYLYGPPSWVKISPLS  308

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  309  KLV---DQGHPPMYR  320



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score = 80.5 bits (197),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 12/112 (11%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            Y  +CC        V+ Y+ ++  LA ++  LIF +LG+ ++DV W   K      S  L
Sbjct  156  YNKFCC-------MVEEYETEMKKLAGRLMWLIFGSLGISKEDVSWAGPKGDFEDASNAL  208

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
              NSYP CP P++A+G+  HTDS+L+T+++QSN ISGLQV       L   P
Sbjct  209  QLNSYPACPDPSRAMGLAEHTDSTLLTIIHQSN-ISGLQVLREGAGWLTVPP  259


 Score = 64.3 bits (155),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+  ALV+N+ D++ I SNG++++V H AIV ++  R+S+ + +G  IN++IS   
Sbjct  255  LTVPPVAGALVINIGDLIHILSNGEYQNVFHRAIVNRSQQRLSVAYLYGPPINVQISPHS  314

Query  536  KLVK-DRDSMYPPYRGKSTRGLRG  604
            KLV     S+Y P   K   G+ G
Sbjct  315  KLVTPSHPSLYRPVTWKEYLGIEG  338



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score = 76.6 bits (187),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   V+ Y+EQ+  LA K+  L   +LG+ E+D+ W  +        + L  N YP CP 
Sbjct  164  YCDIVEEYEEQMQTLASKLMWLSLTSLGVSEEDIKWATANPDLNWAQSALQLNHYPVCPE  223

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+L+Q+NT +GLQVF  +   +   P P
Sbjct  224  PDRAMGLAAHTDSTLLTILHQNNT-AGLQVFRDDLGWVTVPPVP  266


 Score = 61.2 bits (147),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P +LVVNV D+  I SNG FKSV H A V Q   R S+ F +G + ++KIS   
Sbjct  260  VTVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRFSVAFLWGPQSDIKISPVP  319

Query  536  KLVKDRDSMYPPYR  577
            KLV   +S  P YR
Sbjct  320  KLVSLVES--PLYR  331


 Score = 26.9 bits (58),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 5/29 (17%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDKR*R*SKLVMMRHH  657
            ++W EY R K  HF++      L M+R+H
Sbjct  333  VTWTEYLRTKATHFNE-----ALSMIRNH  356



>ref|XP_008804067.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=359

 Score = 85.1 bits (209),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPY  245
            F   ++ Y+E +  LA ++  L+  +LGL E+D+ W      S   SA L  NSYP CP 
Sbjct  157  FCDVMEEYKEVMKELAGRLMHLMLLSLGLTEEDISWAGPVRDSGELSAVLQLNSYPACPE  216

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            P +A+G+  HTDSSL+T+LYQS+T SGLQV  P+    ++ P
Sbjct  217  PDRAMGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVTVP  257


 Score = 59.7 bits (143),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVVNV D+  I SNGQF++V H A+V +  HR+S  +  G   ++ +S   
Sbjct  254  VTVPPLPGALVVNVGDLSHILSNGQFRTVLHRAVVNRTRHRLSAAYICGPPAHVGVSPVD  313

Query  536  KLVKDRDSMYPPYR  577
            KLV       P YR
Sbjct  314  KLVGPGQG--PAYR  325



>ref|NP_001233848.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34124.1| 3b-hydroxylase [Solanum lycopersicum]
Length=373

 Score = 83.2 bits (204),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y++++  LA ++  LI  +LG+ +DDV W      ++K   A L  NSYP CP
Sbjct  162  FCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACP  221

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQV+      +   P P
Sbjct  222  DPGRAMGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWITVPPIP  265


 Score = 60.5 bits (145),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V PIP ALVVN+ D++ I SNG + SV H A+V +  +R+S+ + +G    +++S   
Sbjct  259  ITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSPLS  318

Query  536  KLVKDRDSMYPP-YR  577
            KLV  R   +PP YR
Sbjct  319  KLVDHR---HPPLYR  330


 Score = 20.4 bits (41),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  +FDK
Sbjct  332  VTWSEYLGTKAKYFDK  347



>ref|NP_001275108.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
 gb|AAK91507.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
Length=373

 Score = 83.2 bits (204),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-----KSKSTSAFLHFNSYPKCP  242
            F   ++ Y++++  LA ++  LI  +LG+ +DDV W      ++K   A L  NSYP CP
Sbjct  162  FCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKWAVGPKGETKEGCAALQLNSYPACP  221

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             P +A+G+  HTDS+++T+L+Q+NT SGLQV+      +   P P
Sbjct  222  DPGRAMGLAAHTDSTILTILHQNNT-SGLQVYQEGNGWITVPPIP  265


 Score = 60.5 bits (145),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V PIP ALVVN+ D++ I SNG + SV H A+V +  +R+S+ + +G    +++S   
Sbjct  259  ITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSPLS  318

Query  536  KLVKDRDSMYPP-YR  577
            KLV  R   +PP YR
Sbjct  319  KLVDHR---HPPLYR  330


 Score = 20.4 bits (41),  Expect(3) = 1e-25, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  +FDK
Sbjct  332  VTWSEYLGTKAKYFDK  347



>gb|AAO22518.1| GA4 [Brassica rapa subsp. pekinensis]
Length=166

 Score = 83.2 bits (204),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   VDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPYPTQA  257
            V+ Y+E +  LA K+  L   +LG+ E+D++W    S      A L  N YP CP P +A
Sbjct  1    VEEYEEHMKKLASKLMWLALNSLGVSEEDIEWASLSSDLNWAQAALQLNHYPVCPEPDRA  60

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +G+  HTDS+L+T+LYQ+NT +GLQVF  +   +   PFP
Sbjct  61   MGLAAHTDSTLLTILYQNNT-AGLQVFRDDLGWVTVPPFP  99


 Score = 60.5 bits (145),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P +LVVNV D+  I SNG FKSV H A V Q   R+S+ F +G + ++KIS   
Sbjct  93   VTVPPFPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVP  152

Query  536  KLVKDRDS  559
            KLV   +S
Sbjct  153  KLVSPVES  160



>dbj|BAJ65442.1| gibberellin 3-oxidase [Torenia fournieri]
 dbj|BAJ76663.1| gibberellin 3-oxidase [Torenia fournieri]
Length=382

 Score = 77.8 bits (190),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 7/104 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDD-VDWLKSKS-----TSAFLHFNSYPKC  239
            F  T++ YQ+ +  LA ++  L+  +LG+ EDD + W   K       SA L  NSYP C
Sbjct  164  FCDTIEEYQKAMKRLAGRLMWLMLGSLGITEDDDLKWAAQKEPDDQGGSAALQLNSYPSC  223

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            P P +A+G+  HTDS+++T+L+QSNT SGLQV    +   ++ P
Sbjct  224  PDPDRAMGLAAHTDSTILTILHQSNT-SGLQVAREGRAGWVTVP  266


 Score = 59.3 bits (142),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVV+V D++ I SNG + SV H A+V +  HR+S+ + +G   ++KIS   
Sbjct  263  VTVPPLAGALVVHVGDLLHILSNGLYPSVVHRAVVNRTRHRLSVAYLYGPPSSVKISPLR  322

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  323  KLV---DKYHPPLYR  334


 Score = 26.6 bits (57),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HFDK
Sbjct  335  PITWSEYLGTKAKHFDK  351



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score = 72.8 bits (177),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ YQ+++ GLA K+  L+ ++LGL  +DV WL    +   L  NSYP CP PT+A
Sbjct  147  FCNVMEEYQKEMKGLAAKLIELMLRSLGLNNEDVKWLTHPQS--LLQLNSYPVCPDPTRA  204

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            +G+ PHTDSSL+TLLYQ+ T  GLQV 
Sbjct  205  MGLAPHTDSSLLTLLYQT-TTGGLQVL  230


 Score = 70.5 bits (171),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P   ALVVNV D+M I SNG FKSV H AIV +  HRISI +F+G   ++KI SPL  
Sbjct  239  VYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWDVKI-SPLMK  297

Query  542  VKDRDSMYPPYRGKSTRGLRGC  607
            + D   +Y P   K   G +  
Sbjct  298  LTDHPPLYQPVTWKEYLGYKAT  319



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score = 79.3 bits (194),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 13/115 (11%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y  YC         ++ Y+E++  LA K+  LI  ++G+ E+D+ W         S S  
Sbjct  135  YDKYCG-------IIEEYEEEMQKLAGKLMGLILGSIGVTEEDIKWTGPNNSGLGSGSGA  187

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +  N YP CP P QA+G+  HTDS+++T+L+Q+N  +GLQ+F      ++  P P
Sbjct  188  IRLNHYPVCPEPDQAMGLAAHTDSTMVTILHQNNA-AGLQMFKEGTGWVLVKPVP  241


 Score = 55.5 bits (132),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            VKP+P  LVVNV D++ I SNG+ +S  H A+V +   R SI + +G   ++ IS   KL
Sbjct  237  VKPVPGLLVVNVGDLLHILSNGKLRSSLHQALVNKNKSRFSIAYLWGPSGDIDISPISKL  296

Query  542  VKDRD-SMYPPYRGKS  586
            V   + +MY P   K 
Sbjct  297  VSPIEPAMYRPVTWKE  312


 Score = 28.9 bits (63),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY  +K  HFDK
Sbjct  307  PVTWKEYLEMKARHFDK  323



>emb|CDP18939.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 77.0 bits (188),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST----SAFLHFNSYPKCPY  245
            F   +  Y++++  LA K+  LI  +LG+ E++V W   K      +A +  NSYP CP 
Sbjct  161  FCNVMKEYEKEMKKLAGKLMWLILGSLGVTEEEVKWASPKGAFEGGNAAIQLNSYPACPE  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+++T+L+Q+NT SGLQV 
Sbjct  221  PDRAMGLAAHTDSTILTILHQNNT-SGLQVL  250


 Score = 60.8 bits (146),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVVN+ D++ I SNG + SV H A+V +  HR S+ + +G    + IS   
Sbjct  258  VTVPPLPGALVVNIGDLLHILSNGLYPSVLHRAVVNRTRHRFSVAYLYGPPSGVTISPLQ  317

Query  536  KLV-KDRDSMYPP  571
            KLV + R  +Y P
Sbjct  318  KLVDQGRPPLYRP  330


 Score = 25.8 bits (55),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HFDK
Sbjct  330  PVTWTEYLGTKAKHFDK  346



>gb|ACF71491.1| gibberellin 3-beta hydroxylase [Chrysanthemum x morifolium]
Length=358

 Score = 79.7 bits (195),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK----SKSTSAFLHFNSYPKCPY  245
            F   VD Y +++  L  ++  L+  +LG+ E DV W +    +K     L  NSYP CP 
Sbjct  148  FCVVVDEYNKEMKKLTNRLMWLVLGSLGITEGDVKWARQTRDTKEACPALQLNSYPACPD  207

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            P +A+G+  HTDSSL+T+L+Q+NT SGLQV
Sbjct  208  PDRAMGLAAHTDSSLLTILHQNNT-SGLQV  236


 Score = 60.1 bits (144),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PI  ALVV+V D++ I SNG + SV H AIV +A HR+SI + +G   N++IS   
Sbjct  244  VTVPPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRAQHRLSIAYIYGPPSNVRISPLS  303

Query  536  KLVK-DRDSMYPP  571
            KL    R  +Y P
Sbjct  304  KLTSIVRPPLYQP  316


 Score = 23.9 bits (50),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY  IK  +F+K
Sbjct  316  PVTWSEYLAIKAKYFNK  332



>dbj|BAG32267.1| gibberellin 3-oxidase [Allium fistulosum]
Length=365

 Score = 84.0 bits (206),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPY  245
            F   ++ Y +++  +A ++  L+  +LGL E+ + W     + +  S+ L  NSYP CP 
Sbjct  157  FCEVIEEYNKEMKRVAERLMQLMLLSLGLTEETIKWAGPMNELQDISSVLQLNSYPACPN  216

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
            P +A+G+  HTDSSL+T+LYQSNT SGLQV  PNK
Sbjct  217  PDRAIGLAAHTDSSLLTILYQSNT-SGLQVLRPNK  250


 Score = 58.9 bits (141),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 3/83 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP ALVVNV D+  I SNG+F SV H A+V +  HR S  +  G   ++K+S   
Sbjct  258  VTVPPIPGALVVNVGDLCHILSNGRFHSVVHRAVVNRTEHRYSAAYICGPPAHVKVS---  314

Query  536  KLVKDRDSMYPPYRGKSTRGLRG  604
             +VK     Y P   +   G++ 
Sbjct  315  PIVKPVGPAYRPITWREYLGIKA  337



>ref|XP_010061961.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW69008.1| hypothetical protein EUGRSUZ_F02568 [Eucalyptus grandis]
Length=370

 Score = 77.8 bits (190),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA----FLHFNSYPKCPY  245
            F   ++ YQ+++  LA ++  L+  +LG+ + D+ W   K   A     L  NSYP CP 
Sbjct  161  FCDVIEEYQKEMRKLAGRLMWLMLGSLGICKGDIKWAGPKGDFAGACNALQLNSYPACPD  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+ PHTDS+L+T+L+Q N+ SGLQV       +   P P
Sbjct  221  PDRAMGLAPHTDSTLLTILFQ-NSTSGLQVLKEGSGWVTIPPIP  263


 Score = 61.2 bits (147),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V + PIP ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G   N++IS   
Sbjct  257  VTIPPIPGALVINVGDLLHILSNGLYPSVLHRAVVNRTWHRLSVAYLYGPPSNVQISPLS  316

Query  536  KLVKDRDSMYPP-YR  577
            +L+   +S  PP YR
Sbjct  317  QLI---NSSNPPLYR  328


 Score = 23.9 bits (50),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  329  PVTWSEYLGTKAKHFNK  345



>gb|AHC32022.1| gibberellin 3-oxidase 1 [Camellia sinensis]
Length=361

 Score = 74.3 bits (181),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 61/104 (59%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  L+  +L + ++DV W   K      +A +  NSYP CP 
Sbjct  163  FCDVIEEYEKEMKILARRLMWLMLGSLDISKEDVKWAGPKGDFKGANAAVQLNSYPACPE  222

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+NT SGL+V       +   P P
Sbjct  223  PDRAMGLAAHTDSTLLTILYQNNT-SGLEVHRDGYGWVTVPPIP  265


 Score = 65.1 bits (157),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIPD LVVN+ D++ I SNG + SV H A+V +  HR+S+ + +G   N++IS   
Sbjct  259  VTVPPIPDTLVVNIGDLLHILSNGLYPSVLHRAMVNRTRHRLSVAYLYGPPPNVQISPLS  318

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  319  KLV---DLTHPPLYR  330


 Score = 23.5 bits (49),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  +FDK
Sbjct  331  PVTWTEYLGTKAKYFDK  347



>gb|AHC32023.1| gibberellin 3-oxidase 2 [Camellia sinensis]
Length=373

 Score = 76.3 bits (186),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++ +  LA ++  L+  +LG+ ++D+ W   K+     SA +  NSYP CP 
Sbjct  153  FCHVIEEYEKVMQQLAGRLMWLMLGSLGITKEDIKWAGPKADFKGASAAIQLNSYPACPD  212

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+L+Q+NT SGLQV       +   P P
Sbjct  213  PDRAMGLAAHTDSTLLTILHQNNT-SGLQVLREGAGWVTVPPQP  255


 Score = 62.0 bits (149),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P  LVVN+ D++ I SNG + SV H A+V +  HR+SI + +G   N++IS   
Sbjct  249  VTVPPQPGTLVVNIGDLLHILSNGLYPSVLHRAMVNRTQHRLSIAYLYGPPTNVQISPLS  308

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  309  KLV---DPSHPPLYR  320


 Score = 23.9 bits (50),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  321  PVTWTEYLGTKAKHFNK  337



>ref|XP_010249916.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=378

 Score = 77.0 bits (188),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 7/93 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTS------AFLHFNSYPKC  239
            F   ++ Y++++  LA ++  L+  +LG+ +DD+ W  + S        A L  NSYP C
Sbjct  165  FCDVMEEYEKEMKQLAGRLMWLMLGSLGISKDDIKWAAAASKGESGGVCAALQLNSYPAC  224

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P P++A+G+  HTDS+L+T+LYQ N+ SGLQV 
Sbjct  225  PDPSRAMGLAAHTDSTLLTVLYQ-NSTSGLQVL  256


 Score = 61.2 bits (147),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVNV D++ I SNG++ SV H AIV +  HR+S+ + +G   N +IS   
Sbjct  264  VTVPPLRGALVVNVGDLLHILSNGKYPSVLHRAIVNRTHHRLSVAYLYGPPTNAQISPIS  323

Query  536  KLVKDRDSMYPP-YR  577
             LV   D  +PP YR
Sbjct  324  SLV---DPNHPPLYR  335


 Score = 23.9 bits (50),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  336  PVTWAEYLGTKAKHFNK  352



>ref|XP_011039983.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=465

 Score = 79.7 bits (195),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPY  245
            F   ++ +++++  LA ++T L+  +LG+ + D++W     +SK   A L  NSYP CP 
Sbjct  255  FCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNWAGPKGESKEGGAALQLNSYPACPD  314

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P  A+G+  HTDS+L+T+LYQ+NT SGLQV       +   P P
Sbjct  315  PDLAMGLAAHTDSTLLTILYQNNT-SGLQVLKEGIGWVTVPPIP  357


 Score = 58.2 bits (139),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP  LVVNV D++ I SNG + SV H A+V +  HR+SI + +G    + IS   
Sbjct  351  VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRNKHRLSIAYLYGPPSTVLISPIQ  410

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  411  KLVGPN---HPPLYR  422


 Score = 23.9 bits (50),  Expect(3) = 5e-25, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  423  PVTWNEYLVAKAKHFNK  439



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score = 73.6 bits (179),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ YQ ++ GLA K+  L+ ++LGL  +DV WL+   +   L  NSYP CP PT+A
Sbjct  148  FCNVMEEYQMEMKGLAAKLIELMLRSLGLNNEDVKWLRHPRS--LLQLNSYPVCPDPTRA  205

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            +G+ PHTDSSL+TLLYQ+ T  GLQV 
Sbjct  206  MGLAPHTDSSLLTLLYQT-TTGGLQVL  231


 Score = 68.2 bits (165),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P   ALVVNV D+M I SNG FKSV H AIV +  HRISI +F+G   ++KIS  +KL
Sbjct  240  VYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWDVKISPLMKL  299

Query  542  V-KDRDSMYPPYRGKSTRGLRGC  607
            +  +   +Y P   K   G +  
Sbjct  300  IDHNHPPLYQPVTWKEYLGYKAT  322



>gb|AEK70423.1| GA3ox1 [Gossypium hirsutum]
Length=364

 Score = 72.4 bits (176),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 6/102 (6%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGL-PEDDVDWLKSKS----TSAFLHFNSYPKCPYPT  251
             +  Y++++  LA ++  L+  +LG+  + D+ W   KS     SA L  N YP CP P 
Sbjct  155  VIKEYKQEMKKLAGRLMCLMLGSLGITAKQDIKWAGPKSEFKEASAALQLNYYPACPDPD  214

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +A+G+  HTDS+L+T+LYQ N+ SGLQV       +  SP P
Sbjct  215  RAMGLAAHTDSTLLTILYQ-NSTSGLQVLKEGVGWIKVSPVP  255


 Score = 65.1 bits (157),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+PD LV+NV D+M I SNG + SV H A+V +  HR+SI + +G   ++KIS   
Sbjct  249  IKVSPVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHP  308

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  309  KLV---GPTHPPLYR  320


 Score = 24.3 bits (51),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 22/52 (42%), Gaps = 11/52 (21%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDKR*R*SKLVMMRHHWVEGCMRL-*CTRINPHNISSK  720
            PI+W EY   K  +F+K             WV  C+ L     +N HN S K
Sbjct  321  PITWNEYLDTKAKYFNK----------ALSWVRVCVPLNGLVDVNEHNNSVK  362



>ref|XP_009400517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score = 72.0 bits (175),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 11/99 (11%)
 Frame = +3

Query  72   VCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV------DWL----KSKSTSAFLHF  221
            + F   ++ Y+E++  LA K+  ++  +LGL E +        W+    ++   SA L  
Sbjct  155  LAFCDVIEEYKEEMKQLARKLMRMMLMSLGLTEAEAEAETETGWIGPGDEAGGMSAVLQL  214

Query  222  NSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            NSYP CP P +A+G+  HTDS+L+TLL+QSNT SGLQV 
Sbjct  215  NSYPVCPDPDRAMGMAAHTDSTLLTLLFQSNT-SGLQVL  252


 Score = 62.4 bits (150),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P AL+VNV D+ QI SNG+++SV H A+V + SHR+S+ +  G     K+   +
Sbjct  267  VTVPPMPGALIVNVGDLFQILSNGRYRSVIHRAVVNRTSHRVSVAYMCGPPAASKVEPIV  326

Query  536  KLV  544
            KLV
Sbjct  327  KLV  329


 Score = 27.3 bits (59),  Expect(3) = 7e-25, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 2/26 (8%)
 Frame = +1

Query  541  GQGP*FHVSPISWKEYQRIKGVHFDK  618
            G GP +   P++W EY  +KG  FDK
Sbjct  332  GSGPVYR--PVTWPEYLSVKGKLFDK  355



>ref|XP_009788819.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
Length=360

 Score = 78.2 bits (191),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ Y++++  LA ++  L+  +LG+ +DD+ W  +  +   + L  NSYP CP P 
Sbjct  152  FCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWAVVGPRGGCSALQLNSYPACPDPD  211

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  212  RAMGLAAHTDSTILTILHQNNT-SGLQVF  239


 Score = 60.1 bits (144),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  246  VTVPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLS  305

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  306  KLV---DQGHPPLYR  317


 Score = 22.7 bits (47),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HFDK
Sbjct  319  VTWSEYLGTKAKHFDK  334



>ref|XP_010532143.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like isoform X1 [Tarenaya 
hassleriana]
Length=362

 Score = 80.9 bits (198),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 61/114 (54%), Gaps = 7/114 (6%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            Y  Y  PF   S  +  Y+E +  LA K+  L+  +LG+ E D+ W    S      A +
Sbjct  159  YCIYSYPF--NSDVIKEYEEHMQKLATKLMWLVLSSLGVTEADIKWAGPNSDFNGAQAAI  216

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
              N YP CP P +A+G+  HTDS+L+T+LYQ N  +GLQVF      L  SP P
Sbjct  217  QLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ-NITAGLQVFKDGVGWLTVSPIP  269


 Score = 51.6 bits (122),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V PIP +LVVN+ D++ I SNG+  SV H   V +   R S+ + +G + +++IS   
Sbjct  263  LTVSPIPGSLVVNIGDLLHILSNGRLPSVLHRVRVNKNRSRFSVAYLWGPQSDVQISPIW  322

Query  536  KLV  544
            KLV
Sbjct  323  KLV  325


 Score = 28.5 bits (62),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY R K  HF+ 
Sbjct  335  PVTWKEYLRTKATHFNN  351



>dbj|BAJ65443.1| gibberellin 3-oxidase [Torenia fournieri]
Length=184

 Score = 80.5 bits (197),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ Y++++  LA ++  L+  +LG+ +DDV W K+  ++  L  NSYP CP P +A
Sbjct  20   FCDVIEEYEKEMEKLAGRLMWLMLGSLGITKDDVKWAKAGCSA--LQLNSYPACPDPDRA  77

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            +G+  HTDS++ T+L+Q+NT SGLQVF
Sbjct  78   MGLAAHTDSTIFTILHQNNT-SGLQVF  103


 Score = 60.5 bits (145),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG ++SV H A+V +  HR+S  + +G    +KIS   
Sbjct  110  VTVPPLTGALVINVGDLLHILSNGLYQSVLHRAVVNRTRHRLSAAYLYGPPSGVKISPLS  169

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  170  KLV---DQGHPPMYR  181



>gb|ABO70984.1| gibberellin 3-oxidase 2 [Nicotiana tabacum]
Length=360

 Score = 78.2 bits (191),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ Y++++  LA ++  L+  +LG+ +DD+ W     +   + L  NSYP CP P 
Sbjct  152  FCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCGPRGECSALQLNSYPACPDPD  211

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  212  RAMGLAAHTDSTILTILHQNNT-SGLQVF  239


 Score = 59.7 bits (143),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  246  VTVPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLS  305

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  306  KLV---DQGHPPLYR  317


 Score = 22.7 bits (47),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HFDK
Sbjct  319  VTWSEYLGTKAKHFDK  334



>gb|AAM12872.1|AF494089_1 gibberellin 3-oxidase 1 [Nicotiana sylvestris]
Length=360

 Score = 77.8 bits (190),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ Y++++  LA ++  L+  +LG+ +DD+ W     +   + L  NSYP CP P 
Sbjct  152  FCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCGPRXECSALQLNSYPACPDPD  211

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDS+++T+L+Q+NT SGLQVF
Sbjct  212  RAMGLAAHTDSTILTILHQNNT-SGLQVF  239


 Score = 59.7 bits (143),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALV+NV D++ I SNG + SV H A+V +  HR+S+ + +G    +KIS   
Sbjct  246  VTVPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLS  305

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  306  KLV---DQGHPPLYR  317


 Score = 22.7 bits (47),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HFDK
Sbjct  319  VTWSEYLGTKAKHFDK  334



>ref|XP_008347459.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score = 84.0 bits (206),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 15/118 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            Y  +CC         + Y+ +++ LA  +  L+  +LG+ ++D+ W   +      SA L
Sbjct  159  YTKFCC-------IAEEYEREMIRLAAXLMWLMLGSLGISKEDIKWAGPRGEFEDASAVL  211

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNE----LMSSPFP  377
             FNSYP CP P + +G+  HTDSSLI++++QS+  SGLQVF   + E    LM  P P
Sbjct  212  QFNSYPACPDPDRTIGLAQHTDSSLISIVHQSSNASGLQVFRQGEEEGRGWLMVPPVP  269


 Score = 55.8 bits (133),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P+P A V+NV D M + SNG +++V H A+V ++ HR+S+   +G   N ++S   KL
Sbjct  265  VPPVPGAFVINVGDFMHMLSNGLYQNVFHRAVVNRSQHRVSVACLYGPPENAQVSPLSKL  324

Query  542  VKDR-DSMYPPYRGKSTRGLRG  604
            +      +YPP       G + 
Sbjct  325  LGPSCPPLYPPLTWNEYLGTKA  346



>ref|XP_010532144.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=354

 Score = 79.7 bits (195),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   +  Y+E +  LA K+  L+  +LG+ E D+ W    S      A +  N YP CP 
Sbjct  159  YCDVIKEYEEHMQKLATKLMWLVLSSLGVTEADIKWAGPNSDFNGAQAAIQLNHYPVCPE  218

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ N  +GLQVF      L  SP P
Sbjct  219  PDRAMGLAAHTDSTLLTVLYQ-NITAGLQVFKDGVGWLTVSPIP  261


 Score = 51.6 bits (122),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V PIP +LVVN+ D++ I SNG+  SV H   V +   R S+ + +G + +++IS   KL
Sbjct  257  VSPIPGSLVVNIGDLLHILSNGRLPSVLHRVRVNKNRSRFSVAYLWGPQSDVQISPIWKL  316

Query  542  V  544
            V
Sbjct  317  V  317


 Score = 28.5 bits (62),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++WKEY R K  HF+ 
Sbjct  327  PVTWKEYLRTKATHFNN  343



>ref|XP_009355033.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=362

 Score = 82.0 bits (201),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            Y  +CC         + Y+ ++  LA ++  L+  +LG+ ++D+ W   +      SA L
Sbjct  159  YTKFCC-------IAEEYEREMKRLAARLMWLMLGSLGISKEDIKWAGPRGEFEDASAVL  211

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFG---PNKNELMSSPFP  377
             FNSYP CP P + +G+  HTDS+LI++++QS+  SGLQVF      +  LM  P P
Sbjct  212  QFNSYPACPDPDRTMGLAQHTDSTLISIVHQSSNASGLQVFRQGEQGRGWLMVPPVP  268


 Score = 57.4 bits (137),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P+P A V+NV D + + SNG +++V H A+V ++ HR+S+ + +G   N+++S   KL
Sbjct  264  VPPVPGAFVINVGDFIHMLSNGLYQNVLHRAVVNRSQHRVSVAYLYGPSENVQVSPLSKL  323

Query  542  VKDR-DSMYPPYRGKSTRGLRG  604
            +      +YPP       G + 
Sbjct  324  LGPSCPPLYPPLTWNEYLGTKA  345



>gb|KDP37169.1| hypothetical protein JCGZ_06225 [Jatropha curcas]
Length=375

 Score = 78.6 bits (192),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 5/94 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  F  T++ YQ ++  LA K+  L+  +L + ++D+ W   K+     SA L  N YP 
Sbjct  158  YTKFCGTIEVYQVEMQKLAAKLMWLVLGSLDITKEDITWAGPKADFREASAALQLNYYPA  217

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            CP P QA+G+  HTDS+L+T+LYQ+NT SGLQV 
Sbjct  218  CPDPDQAMGLAAHTDSTLLTILYQNNT-SGLQVL  250


 Score = 56.6 bits (135),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PI   LVVNV D++ I SNG + SV H A+V +  HR+S+ + +G   +++IS   
Sbjct  257  VTVPPISGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSMAYLYGPPSSIQISPLS  316

Query  536  KLVKDRDSMYPPYR  577
            KLV    S  P YR
Sbjct  317  KLVG--PSQPPLYR  328


 Score = 24.6 bits (52),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            PI+W EY   K  HF+K
Sbjct  329  PITWNEYLGTKAKHFNK  345



>gb|KDO58203.1| hypothetical protein CISIN_1g043985mg [Citrus sinensis]
Length=350

 Score = 74.3 bits (181),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +3

Query  84   TTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPYPT  251
              V+ Y++++  LA ++  LI ++LG   +D+ W       K   + L+FN YP CP P 
Sbjct  162  NVVEEYKKEMKKLAERLMCLILRSLGTTREDIKWPGLNGDFKDHPSPLNFNYYPACPDPD  221

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDSSL T+LYQ N++SGLQV 
Sbjct  222  RAMGLAAHTDSSLFTILYQ-NSVSGLQVL  249


 Score = 58.5 bits (140),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+ DALVVNV DM+ I SNG + SV H A+  +  +R+SI +F+GL  +L+IS   
Sbjct  256  VTVPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATR-KNRLSIAYFYGLPSDLQISPLE  314

Query  536  KLVKDRDSMYPPYRGKS  586
             LV    S  P YR  S
Sbjct  315  NLVG--PSQPPLYRSIS  329


 Score = 26.6 bits (57),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ISW EY R+K  HF+K
Sbjct  328  ISWSEYLRMKAKHFNK  343



>ref|XP_009108486.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Brassica rapa]
Length=350

 Score = 81.3 bits (199),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+++  L+ ++ S++  +LGL   ++ WL       ++ S+ +FL  NSYP 
Sbjct  155  FCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLVPNITGSRTDSSQSFLQLNSYPV  214

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++
Sbjct  215  CPDPDLAMGLAPHTDSSLLTILYQGN-IPGLEI  246


 Score = 55.5 bits (132),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P+   LVV + D+  I SNG+FKS  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  257  IGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQI-GPL  315

Query  536  KLVKDRDSMY  565
                D   +Y
Sbjct  316  TADTDHPPLY  325


 Score = 22.7 bits (47),  Expect(3) = 3e-24, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W+EY   K  HF+K
Sbjct  328  LTWEEYLAAKATHFNK  343



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score = 87.0 bits (214),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ YQ+++  L+ ++ ++I K LG+ E DVDW  L+S + +A L  NSYP+CP P 
Sbjct  162  FCEVMEDYQDKMKALSERLLAMILKYLGMSEHDVDWPRLRSNACTA-LQLNSYPRCPDPR  220

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
            QA+G+ PHTD+ L+T+L+Q+++  GLQV
Sbjct  221  QAMGLAPHTDTFLLTILHQNHSAHGLQV  248


 Score = 52.4 bits (124),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVNV DM+ I SN  F SV H AI  + +HR+++ +F+G   +  +    
Sbjct  256  VPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRAIPSENTHRLTVGYFYGPPTDFHVGPIH  315

Query  536  KLVK  547
            +L +
Sbjct  316  RLTQ  319



>ref|XP_009372969.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score = 85.9 bits (211),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK---STSAFLHFNSYPKCPYP  248
            F  T+D YQ Q+  LA K+  + FK+L +  ++ DWL      S S  L  NSYP CP P
Sbjct  156  FCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSGLSSPSTALQLNSYPPCPDP  215

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHLS  389
            T+ALG+  HTD+SL+T++ QS T SGLQVF      ++  P P  L+
Sbjct  216  TRALGMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALT  261


 Score = 53.1 bits (126),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+PIP AL VN+ D + I SNG F SV+H  +V Q   R S+ +F+    +  +S  L  
Sbjct  253  VQPIPGALTVNLGDYLHILSNGMFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSR  312

Query  542  VKDRDSMYPPYRGKSTR  592
            V ++    P YR  + +
Sbjct  313  VLEK---VPKYRSLTVK  326



>emb|CAX46400.1| putative GA3OX protein [Rosa lucieae]
Length=240

 Score = 82.0 bits (201),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            FS  V+ Y++++  LA K+  LI  +LG+P++DV W   K      S  +  NSYP CP 
Sbjct  68   FSCMVEEYEKEMKRLAGKLMWLILGSLGIPKEDVIWAGPKGDFEDASNAVQLNSYPACPD  127

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+++++Q+N ISGLQV       L   P P
Sbjct  128  PNRAMGLAEHTDSTLLSIIHQTN-ISGLQVLHEGAGWLTVPPVP  170


 Score = 57.0 bits (136),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+P ALVVN+ D+  I SNG + +V H AIV ++  R+SI + +G   +++IS   
Sbjct  164  LTVPPVPGALVVNIGDLTHILSNGVYHNVLHRAIVNRSQQRLSIAYLYGPPASVQISPQS  223

Query  536  KLV  544
            KLV
Sbjct  224  KLV  226



>gb|KHG10231.1| Gibberellin 3-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=364

 Score = 70.5 bits (171),  Expect(3) = 4e-24, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 6/102 (6%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGL-PEDDVDWLKSKS----TSAFLHFNSYPKCPYPT  251
             +  Y++++  LA ++  L+  +LG+  + D+ W   KS     SA L  N YP CP P 
Sbjct  155  VIKEYKQEMKKLAGRLMCLMLGSLGITAKQDIKWAGPKSDFKEASAALQLNYYPACPDPD  214

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +A+G+  HTDS+L+T+LYQ N+ SGLQV       +   P P
Sbjct  215  RAMGLAAHTDSTLLTILYQ-NSTSGLQVLKEGVGWIKVPPVP  255


 Score = 64.7 bits (156),  Expect(3) = 4e-24, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+PD LV+NV D+M I SNG + SV H A+V +  HR+SI + +G   ++KIS   
Sbjct  249  IKVPPVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHP  308

Query  536  KLVKDRDSMYPP-YR  577
            KLV      +PP YR
Sbjct  309  KLV---GPTHPPLYR  320


 Score = 24.3 bits (51),  Expect(3) = 4e-24, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 22/52 (42%), Gaps = 11/52 (21%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDKR*R*SKLVMMRHHWVEGCMRL-*CTRINPHNISSK  720
            PI+W EY   K  +F+K             WV  C+ L     +N HN S K
Sbjct  321  PITWNEYLDTKAKYFNK----------ALSWVRVCVPLNGLVDVNEHNNSVK  362



>emb|CDY38660.1| BnaC02g23190D [Brassica napus]
Length=351

 Score = 77.8 bits (190),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = +3

Query  27   LYLLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-----  191
            L +  R Y  YC         ++ Y+ ++  LA ++ S I  +LG+  DD++W +     
Sbjct  142  LTIWPRDYTKYCG-------IIEEYKGEMENLANRLLSCILGSLGVTVDDIEWAQKTEKS  194

Query  192  -SKSTSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSS  368
             SK     +  N YP CP P +A+G+  HTDS L+T+L+QSN + GLQVF      +   
Sbjct  195  GSKMGRGVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQSN-MGGLQVFKEESGWVTVE  253

Query  369  PFP  377
            P P
Sbjct  254  PIP  256


 Score = 55.5 bits (132),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V+PIP  LVVN+ D+  I SNG+F SV H A V Q   RISI + +G
Sbjct  250  VTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNQTKSRISIAYLWG  298


 Score = 25.8 bits (55),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY RIK   FDK
Sbjct  323  PVTWSEYLRIKFEVFDK  339



>dbj|BAG48321.1| gibberellin 3-oxidase2 [Chrysanthemum x morifolium]
Length=358

 Score = 76.6 bits (187),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPY  245
            F   VD Y +++  L  ++  L+  +LG+ E DV W       K     L  NSYP CP 
Sbjct  148  FCEVVDEYNKEMKKLTNRLMWLVLGSLGITEGDVKWAGPAGDLKEACPALQLNSYPACPD  207

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            P +A+G+  HTDSSL+T+L+Q+NT SGLQV
Sbjct  208  PDRAMGLAAHTDSSLLTILHQNNT-SGLQV  236


 Score = 57.8 bits (138),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PI  ALVV+V D++ I SNG + SV H AIV +  HR SI + +G   N++IS   
Sbjct  244  VTVPPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRTQHRFSIAYLYGPPSNVRISPLS  303

Query  536  KLVK-DRDSMYPP  571
            KL    R  +Y P
Sbjct  304  KLTSIVRPPLYQP  316


 Score = 23.9 bits (50),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY  IK  +F+K
Sbjct  316  PVTWSEYLAIKAKYFNK  332



>emb|CDY31424.1| BnaC03g64000D [Brassica napus]
Length=350

 Score = 81.3 bits (199),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 8/93 (9%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+++  L+ ++ S++  +LGL   +  WL       ++ S+ +FL  NSYP 
Sbjct  155  FCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKEFRWLVPNITGSRTNSSQSFLQLNSYPV  214

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++
Sbjct  215  CPDPDLAMGLAPHTDSSLLTILYQGN-IPGLEI  246


 Score = 54.7 bits (130),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P+   LVV + D+  I SNG+FKS  H A+V +  HR+S  +F G   NL I  PL
Sbjct  257  IGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLHI-GPL  315

Query  536  KLVKDRDSMY  565
                D   +Y
Sbjct  316  TADTDHPPLY  325


 Score = 22.7 bits (47),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W+EY   K  HF+K
Sbjct  328  LTWEEYLAAKATHFNK  343



>emb|CDX76441.1| BnaA08g09590D [Brassica napus]
Length=350

 Score = 81.3 bits (199),  Expect(3) = 6e-24, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+++  L+ ++ S++  +LGL   ++ WL       ++ S+ +FL  NSYP 
Sbjct  155  FCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLVPNITGSRTDSSQSFLQLNSYPV  214

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++
Sbjct  215  CPDPDLAMGLAPHTDSSLLTILYQGN-IPGLEI  246


 Score = 55.1 bits (131),  Expect(3) = 6e-24, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P+   LVV + D+  I SNG+FKS  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  257  IGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQI-GPL  315

Query  536  KLVKDRDSMY  565
                D   +Y
Sbjct  316  TADTDHPPLY  325


 Score = 21.6 bits (44),  Expect(3) = 6e-24, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W+EY   K  HF++
Sbjct  328  LTWEEYLAAKATHFNE  343



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score = 73.2 bits (178),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV-DWLKS--KSTSAFLHFNSYPKC  239
            +  F+  +D YQ+++  LA +I  L+ K+L + E+D+  W  S   S +  L  NSYP C
Sbjct  154  YESFTDVIDVYQKKMKELAHQILLLLLKSLEISEEDITSWAASTHDSNNGALQLNSYPCC  213

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P P++A+G+ PHTDS L+T+L Q++  S LQ+F
Sbjct  214  PNPSRAIGLAPHTDSLLLTILSQTHDSSALQIF  246


 Score = 65.1 bits (157),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 6/83 (7%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+ DALVVNV D++ I SNG+F SV H  IV +  HRIS+ +F+G + + ++ +PL
Sbjct  253  IAVAPVRDALVVNVGDLLHILSNGRFPSVYHQVIVSEKEHRISVAYFYGPRTDAQV-APL  311

Query  536  KLVKDRDSMYPPYRGKSTRGLRG  604
              ++      P YR  S +   G
Sbjct  312  SRIE-----VPIYRSLSVKEFIG  329



>ref|XP_010537951.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Tarenaya hassleriana]
Length=367

 Score = 84.0 bits (206),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = +3

Query  33   LLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----  200
            L  R ++ YC         +  Y+EQ+  LA ++T L+  +LG+ E D+ W    S    
Sbjct  155  LWPRHHLRYC-------NIIKEYEEQMQKLARRLTWLVLGSLGVTEGDIKWAGPNSDFNG  207

Query  201  TSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPM  380
              A +  N YP CP P +A+G+  HTDS+L+T+LYQSNT +GLQVF      L   P P 
Sbjct  208  AQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQSNT-AGLQVFKDGFGWLTVPPIPG  266

Query  381  HL  386
             L
Sbjct  267  SL  268


 Score = 54.3 bits (129),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V PIP +LVVN+ D++ I SNG+  S  H   V Q   R S+ + +G + +++IS   KL
Sbjct  261  VPPIPGSLVVNIGDLLHILSNGRLSSALHRVRVNQDRPRFSVAYLWGPQADVQISPLPKL  320

Query  542  VKD-RDSMYPPYRGKSTRGLRGC----ILTSVRGDPN  637
            V   +  +Y P   K   G +       L+++R D N
Sbjct  321  VSPVKPPLYRPVTWKEYLGTKATHFNNALSAIRVDDN  357



>ref|XP_008350339.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=260

 Score = 86.3 bits (212),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK---SKSTSAFLHFNSYPKCPYP  248
            F  T+D YQ Q+  LA K+  + FK+L +  ++ DWL    S   S  L  NSYP CP P
Sbjct  71   FCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSGSSXPSTALQLNSYPPCPDP  130

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHLS  389
            T+ALG+  HTD+SL+T++ QS T SGLQVF      ++  P P  L+
Sbjct  131  TRALGMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALT  176


 Score = 52.0 bits (123),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 3/72 (4%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+PIP AL VN+ D + I SNG F SV+H  +V Q   R S+ +F+    +  +S  L  
Sbjct  168  VQPIPGALTVNLGDYLHIXSNGVFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSR  227

Query  542  VKDRDSMYPPYR  577
            V ++    P YR
Sbjct  228  VLEK---VPKYR  236



>ref|XP_008387508.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score = 86.3 bits (212),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK---SKSTSAFLHFNSYPKCPYP  248
            F  T+D YQ Q+  LA K+  + FK+L +  ++ DWL    S + S  L  NSYP CP P
Sbjct  156  FCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDWLNDSGSSNPSTALQLNSYPPCPDP  215

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHLS  389
            T+ALG+  HTD+SL+T++ QS T SGLQVF      ++  P P  L+
Sbjct  216  TRALGMATHTDTSLVTIVQQSKT-SGLQVFKDGAGWVLVQPIPGALT  261


 Score = 51.6 bits (122),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+PIP AL VN+ D + I SNG F SV+H  +V Q   R S+ +F+    +  +S  L  
Sbjct  253  VQPIPGALTVNLGDYLHIXSNGVFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPVLSR  312

Query  542  VKDRDSMYPPYRGKSTR  592
            V ++    P YR  + +
Sbjct  313  VLEK---VPKYRSLTVK  326



>ref|XP_009128435.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Brassica rapa]
Length=351

 Score = 79.3 bits (194),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 14/123 (11%)
 Frame = +3

Query  27   LYLLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-----  191
            L +  R Y  YC         ++ Y+ ++  LA ++ S I  +LG+  DD++W K     
Sbjct  142  LTIWPRDYTKYC-------GIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKS  194

Query  192  -SKSTSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSS  368
             SK   + +  N YP CP P +A+G+  HTDS L+T+L+QSN + GLQVF      +   
Sbjct  195  ESKMGQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQSN-MGGLQVFKEESGWVTVE  253

Query  369  PFP  377
            P P
Sbjct  254  PIP  256


 Score = 53.5 bits (127),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V+PIP  LVVN+ D+  I SNG+F SV H A V +   RISI + +G
Sbjct  250  VTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWG  298


 Score = 25.0 bits (53),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY RIK   FDK
Sbjct  323  PVTWSEYLRIKFEVFDK  339



>emb|CDY37588.1| BnaA02g19820D [Brassica napus]
Length=351

 Score = 79.0 bits (193),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 14/123 (11%)
 Frame = +3

Query  27   LYLLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-----  191
            L +  R Y  YC         ++ Y+ ++  LA ++ S I  +LG+  DD++W K     
Sbjct  142  LTIWPRDYTKYC-------GIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKS  194

Query  192  -SKSTSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSS  368
             SK   + +  N YP CP P +A+G+  HTDS L+T+L+QSN + GLQVF      +   
Sbjct  195  ESKMGQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQSN-MGGLQVFKEESGWVTVE  253

Query  369  PFP  377
            P P
Sbjct  254  PIP  256


 Score = 53.5 bits (127),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V+PIP  LVVN+ D+  I SNG+F SV H A V +   RISI + +G
Sbjct  250  VTVEPIPGVLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWG  298


 Score = 25.0 bits (53),  Expect(3) = 9e-24, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY RIK   FDK
Sbjct  323  PVTWSEYLRIKFEVFDK  339



>ref|XP_008785607.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=362

 Score = 81.6 bits (200),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 8/109 (7%)
 Frame = +3

Query  57   YCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFN  224
            YC  F      ++ Y +    LA ++  L+  +LGL E+D+ W      S   SA +  N
Sbjct  156  YCAEFC---NVIEEYNKVAKELAGRLMHLMLLSLGLTEEDISWAGPIRDSGDLSAVIQLN  212

Query  225  SYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            SYP CP P +ALG+  HTDSSL+T+LYQS T SGLQV  P+    ++ P
Sbjct  213  SYPACPEPDRALGLAAHTDSSLLTVLYQSGT-SGLQVLRPDPARWVTVP  260


 Score = 53.9 bits (128),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS  526
            V V P+P  L+V+V D+  I SNG F+SV H A+V +  HR+S  +  G   ++K+S
Sbjct  257  VTVPPLPGVLIVHVGDLSHILSNGHFRSVLHRAVVNRRHHRLSAAYICGPPAHVKVS  313


 Score = 21.9 bits (45),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%)
 Frame = +1

Query  544  QGP*FHVSPISWKEYQRIKGVHFDK  618
            QGP +    ++W EY  +KG  F+K
Sbjct  323  QGPAYRA--VTWPEYLALKGKLFNK  345



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score = 72.0 bits (175),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +3

Query  84   TTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPYPT  251
              V+ Y++++  LA ++  LI ++LG   +D+ W       K   + L+FN YP CP P 
Sbjct  162  NVVEEYKKEMKKLAERLMCLILRSLGTTREDIKWAGLNGDFKDHPSPLNFNYYPACPDPD  221

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDSSL T+L Q N++SGLQV 
Sbjct  222  RAMGLAAHTDSSLFTILCQ-NSVSGLQVL  249


 Score = 58.5 bits (140),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+ DALVVNV DM+ I SNG + SV H A+  +  +R+SI +F+GL  +L+IS   
Sbjct  256  VTVPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATR-KNRLSIAYFYGLPSDLQISPLE  314

Query  536  KLVKDRDSMYPPYRGKS  586
             LV    S  P YR  S
Sbjct  315  NLVG--PSQPPLYRSIS  329


 Score = 26.6 bits (57),  Expect(3) = 1e-23, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ISW EY R+K  HF+K
Sbjct  328  ISWSEYLRMKAKHFNK  343



>ref|XP_010925284.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=362

 Score = 80.1 bits (196),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F   ++ Y + +  LA ++  L+  +LGL E+D+ W      S   S  +  NSYP 
Sbjct  157  YAEFCNVIEEYSKVMKKLAGRLMHLMLLSLGLTEEDISWAGPTKDSGDLSTVMQLNSYPA  216

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            CP P +A+G+  HTDSSL+T+LYQS T SGLQV  P+    ++ P
Sbjct  217  CPEPDRAVGLAAHTDSSLLTVLYQSRT-SGLQVLRPDPPRWVTVP  260


 Score = 57.0 bits (136),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P  L+V+V D+  I SNG+F+SV H A+V +  HR+S  +  G   ++K+S   
Sbjct  257  VTVPPLPGVLIVHVGDLSHILSNGRFRSVLHRAVVNRTHHRLSAAYICGPPAHVKVSPVK  316

Query  536  KLVKDRDSMYPPYRG  580
            KL+    S  P YR 
Sbjct  317  KLLG--PSQGPAYRA  329



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score = 91.7 bits (226),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-SKSTSAFLHFNSYPKCPYPTQ  254
            F  T+ HY+ QL  L  ++  +IFK+L +  D+V WLK S+  S  L  N YP CP PT+
Sbjct  157  FCDTMVHYRSQLKALTEQLIRIIFKSLNINPDEVAWLKESQGLSIGLQLNCYPPCPDPTR  216

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            A+GI PHTD+SLIT+L QS  +SGLQVF      ++  P P
Sbjct  217  AMGIAPHTDTSLITVLQQSK-VSGLQVFKEGAGWVLVQPVP  256


 Score = 42.0 bits (97),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFF  499
            V+P+P A+ VN+ D   I SNG F +V+H  +V     R+S  +F+
Sbjct  252  VQPVPGAITVNLGDFFHILSNGVFTTVRH-RVVATRIRRLSFAYFY  296


 Score = 23.1 bits (48),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 18/31 (58%), Gaps = 2/31 (6%)
 Frame = +1

Query  526  ISTQIGQGP*FHVSPISWKEYQRIKGVHFDK  618
            +S   G+ P +    +S KEY  IKG HF+K
Sbjct  308  LSKDFGEVPRYQT--LSVKEYVGIKGKHFEK  336



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score = 86.7 bits (213),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ YQ+++  L+ ++ ++I K LG+ E DVDW  L+S + +A L  NSYP+CP P 
Sbjct  162  FCEVMEDYQDKMKALSERLLAMILKYLGISEHDVDWPRLRSNACTA-LQLNSYPRCPDPR  220

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
            QA+G+ PHTD+ L+T+L+Q+++  GLQV
Sbjct  221  QAMGLAPHTDTFLLTILHQNHSAHGLQV  248


 Score = 50.1 bits (118),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVNV DM+ I SN  F SV H  I  + +HR+++ +F+G   +  +    
Sbjct  256  VPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDFHVGPIH  315

Query  536  KLVK  547
            +L +
Sbjct  316  ELTQ  319



>ref|XP_006465424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
Length=350

 Score = 72.0 bits (175),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +3

Query  84   TTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPYPT  251
              V+ Y++++  LA ++  LI ++LG   +D+ W       K   + L+ N YP CP P 
Sbjct  162  NVVEEYKKEMKKLAERLMCLILRSLGTTREDIKWPGLNGDFKDHPSPLNLNYYPACPDPD  221

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDSSL T+LYQ N++SGLQV 
Sbjct  222  RAMGLAAHTDSSLFTILYQ-NSVSGLQVL  249


 Score = 58.2 bits (139),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+ DALVVNV DM+ I SNG + SV H A+  +  +R+SI +F+GL  +L+IS   
Sbjct  256  VTVPPVWDALVVNVGDMLHILSNGLYPSVLHRAVATR-KNRLSIAYFYGLPSDLQISPLE  314

Query  536  KLVKDRDSMYPPYRGKS  586
             LV    S  P YR  S
Sbjct  315  NLVG--PSQPPLYRSIS  329


 Score = 26.6 bits (57),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ISW EY R+K  HF+K
Sbjct  328  ISWSEYLRMKAKHFNK  343



>ref|XP_010110310.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC25830.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=372

 Score = 75.1 bits (183),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST----SAFLHFNSYPKCPY  245
            F   ++ Y+ ++  LA ++  L+  +LG+   D+ W   K      SA L  NSYP CP 
Sbjct  162  FCDVIEEYEAEVKRLAGRLMWLMLGSLGISRADIKWAGPKGNFKGASAALQLNSYPACPD  221

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+  HTDS+L+T+LYQ N+ SGLQV 
Sbjct  222  PDRAMGLAAHTDSTLLTILYQ-NSTSGLQVL  251


 Score = 56.6 bits (135),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PI  A VVNV D++ I SNG + SV H A+V +  HR+SI + +G   ++KIS   
Sbjct  258  VTVPPIHGAFVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSIAYLYGPPSSVKISPLP  317

Query  536  KLV  544
            +LV
Sbjct  318  RLV  320


 Score = 24.6 bits (52),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (58%), Gaps = 2/26 (8%)
 Frame = +1

Query  541  GQGP*FHVSPISWKEYQRIKGVHFDK  618
            GQ P +   PI+W EY   K  HF+K
Sbjct  323  GQPPLYR--PITWTEYLGTKAKHFNK  346



>ref|XP_004290878.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 79.3 bits (194),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +3

Query  72   VCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST---SAFLHFNSYPKCP  242
            VC   T+D YQ+Q+  LA ++  ++FK L + +++VDW    +    SAF   NSYP CP
Sbjct  152  VC--DTMDEYQKQVKALAEQLIRIVFKFLSISQEEVDWFDDPTNMCPSAF-QLNSYPPCP  208

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
             PTQALG+ PHTD SL T+L+  +   GLQVF      +   P P
Sbjct  209  DPTQALGLPPHTDGSLFTILH--SRTEGLQVFKEGVGWITVQPNP  251


 Score = 57.0 bits (136),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P P+A +VN+ D++ I SNG+F SV H A V Q  HRIS  +F+   ++  IS  L
Sbjct  245  ITVQPNPEAFIVNLGDVLHIMSNGRFVSVLHRAAVIQKDHRISAAYFYWPPMDFTISPIL  304

Query  536  KLVKDRDSMYPPYR  577
                      P YR
Sbjct  305  SKNSADSEQVPKYR  318



>ref|XP_007227245.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
 gb|EMJ28444.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
Length=344

 Score = 91.3 bits (225),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-SKSTSAFLHFNSYPKCPYPTQ  254
            F  T+  YQ QL  L  ++  +IFK+L +  ++VDWLK S+ +S  L  NSYP CP PT+
Sbjct  159  FCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDWLKDSQGSSTALQLNSYPACPDPTR  218

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            A+G+ PHTD+SLIT+L QS T SGLQVF      ++  P P
Sbjct  219  AMGLAPHTDTSLITIL-QSKT-SGLQVFKEGAGWILVQPIP  257


 Score = 45.1 bits (105),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+PIP AL+VNV D + I SNG F +V+H  +V     R S   F+    ++ I SP+ +
Sbjct  253  VQPIPGALIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDV-IVSPV-M  309

Query  542  VKDRDSMYPPYRGKSTRG  595
             KD   + P Y   S +G
Sbjct  310  SKDFGGV-PRYHSVSVKG  326



>ref|XP_010914990.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=360

 Score = 72.4 bits (176),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPY  245
            F   ++ Y+E +  LA ++  L+  +LGL E+D+ W     ++    A L  NSYP CP 
Sbjct  158  FCDVIEEYKEVMKELAGRLLHLMLLSLGLTEEDISWAGPVRETGDLPAVLQLNSYPACPE  217

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            P +A+G+  HTDSSL+T+LYQS+T SGLQV  P+    ++ P
Sbjct  218  PDRAIGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVTVP  258


 Score = 63.9 bits (154),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVVNV D+  I SNGQF+SV H A+V +  HR+S  +  G   ++K+S   
Sbjct  255  VTVPPLPGALVVNVGDLSHILSNGQFRSVLHRAVVNRTRHRLSAAYICGPPAHVKVSPVD  314

Query  536  KLVKDRDSMYPPYR  577
            KLV   +   P YR
Sbjct  315  KLVGPSEG--PAYR  326



>ref|XP_010049018.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81481.1| hypothetical protein EUGRSUZ_C02840 [Eucalyptus grandis]
Length=355

 Score = 86.3 bits (212),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHFNSYPKCPYPT  251
            F   ++ YQ+++  L+ ++ ++I K LG+ E DVDW  L+S + +A L  NSYP+CP P 
Sbjct  162  FCEVMEDYQDKMKALSERLLAMILKYLGISEHDVDWPRLRSNACTA-LQLNSYPRCPDPG  220

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
            QA+G+ PHTD+ L+T+L+Q+++  GLQV
Sbjct  221  QAMGLAPHTDTLLLTILHQNHSAHGLQV  248


 Score = 50.1 bits (118),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS  526
            V V P+  ALVVNV DM+ I SN  F SV H  I  + +HR+++ +F+G   +  + 
Sbjct  256  VPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDFHVG  312



>gb|AEK70424.1| GA3ox2 [Gossypium hirsutum]
Length=368

 Score = 76.6 bits (187),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 10/117 (9%)
 Frame = +3

Query  54   HYCC----PFVCFSTTVDHYQEQLMGLAIKITSLIFKALGL-PEDDVDWLKSKS----TS  206
            H+C      F      +  Y+E++  LA ++  L+  +LG+  ++D+ W   K+     S
Sbjct  144  HFCQLWPQDFSYHCDVIKEYKEEMKKLAGRLMWLMLGSLGIIAKEDIKWAGPKADFKGAS  203

Query  207  AFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            A L  N YP CP P +A+G+ PHTDS+L+T+LYQ N+ SGLQVF      +   P P
Sbjct  204  AALQLNYYPACPDPDRAMGLAPHTDSTLLTILYQ-NSTSGLQVFKEGAGWVAVPPVP  259


 Score = 59.3 bits (142),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P  LV+NV D+M I SNG ++SV H A+V ++ HR+S  + +G    ++IS   
Sbjct  253  VAVPPVPGGLVINVGDLMHILSNGSYQSVLHRAMVNRSHHRLSSAYLYGPPSTVEISPHP  312

Query  536  KLV  544
            KLV
Sbjct  313  KLV  315



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score = 87.8 bits (216),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTS-AFLHFNSYPKCPYPTQ  254
            F   ++ YQ+++  L+ ++ ++I K LG+ E D+DW + +S + A L  NSYP+CP P Q
Sbjct  162  FCEVMEDYQDKMKALSERLLAMILKYLGISEHDIDWPRLRSNACAALQLNSYPRCPDPRQ  221

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQV  335
            A+G+ PHTD+ L+T+L+Q+++  GLQV
Sbjct  222  AMGLAPHTDTFLLTILHQNHSAHGLQV  248


 Score = 48.1 bits (113),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V P+  ALVVN+ DM+ I SN  F SV H  I  +  HR+++ +F+G
Sbjct  256  VPVFPMNGALVVNLGDMLHIMSNAMFPSVVHRVIPSEKRHRLTVGYFYG  304



>gb|ABK28643.1| unknown [Arabidopsis thaliana]
Length=350

 Score = 79.0 bits (193),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+ +  L+ ++ S++  +LGL  +D+ WL        + S  +FL  NSYP 
Sbjct  154  FCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPV  213

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKN  353
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P + 
Sbjct  214  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIESPQEE  251


 Score = 55.8 bits (133),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LVV + D+  I SNGQF+S  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  256  IGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQI-GPL  314

Query  536  KLVKDRDSMY  565
               K+   +Y
Sbjct  315  TSDKNHPPIY  324


 Score = 21.2 bits (43),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF+K
Sbjct  329  WEEYLAAKATHFNK  342



>ref|NP_193900.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
 sp|Q9SVS8.1|G3OX3_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 3; AltName: Full=GA 
3-oxidase 3; Short=AtGA3ox3; Short=AtGA3ox4; AltName: Full=Gibberellin 
3 beta-hydroxylase 3 [Arabidopsis thaliana]
 emb|CAB36813.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB81276.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 gb|ABE66082.1| gibberellin 3 beta-hydroxylase family protein [Arabidopsis thaliana]
 gb|AEE84490.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
Length=349

 Score = 79.0 bits (193),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+ +  L+ ++ S++  +LGL  +D+ WL        + S  +FL  NSYP 
Sbjct  154  FCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPV  213

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKN  353
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P + 
Sbjct  214  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIESPQEE  251


 Score = 55.8 bits (133),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LVV + D+  I SNGQF+S  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  256  IGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQI-GPL  314

Query  536  KLVKDRDSMY  565
               K+   +Y
Sbjct  315  TSDKNHPPIY  324


 Score = 21.2 bits (43),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF+K
Sbjct  329  WEEYLAAKATHFNK  342



>ref|XP_010439443.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=353

 Score = 80.5 bits (197),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 10/100 (10%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL---------KSKSTSAFLHFNSY  230
            F   ++ YQ+ +  L++++ +++  +LGL  +D+ WL          S S  +FL  NSY
Sbjct  156  FCNVMEEYQKAMDDLSLRLITMLMGSLGLTHEDLGWLVPDKTGSGTDSNSIQSFLQLNSY  215

Query  231  PKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
            P CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P +
Sbjct  216  PVCPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQE  254


 Score = 54.7 bits (130),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LV+ + D+  I SNGQF++  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  260  IGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQI-GPL  318

Query  536  KLVKDRDSMY  565
               K+   +Y
Sbjct  319  ACDKNHPPIY  328


 Score = 20.4 bits (41),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 6/14 (43%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF++
Sbjct  333  WEEYLAAKATHFNR  346



>ref|XP_010449018.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=351

 Score = 79.7 bits (195),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (63%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA-------FLHFNSYPK  236
            F   ++ YQ+ +  L++++ +++  +LGL  +D+ WL  + T +       FL  NSYP 
Sbjct  156  FCNVMEEYQKAMDDLSLRLITMLMVSLGLTHEDLGWLVPEKTGSGTDSIQSFLQLNSYPV  215

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKN  353
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P ++
Sbjct  216  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQED  253


 Score = 54.3 bits (129),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISS  529
            K + V+PI  +LV+ + D+  I SNGQF++  H A+V +  HR S  FF G   NL+I  
Sbjct  256  KWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRFSAAFFAGPPKNLQI-G  314

Query  530  PLKLVKDRDSMY  565
            PL   K+   +Y
Sbjct  315  PLTGDKNHPPIY  326


 Score = 21.2 bits (43),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF+K
Sbjct  331  WEEYLAAKATHFNK  344



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score = 89.4 bits (220),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-SKSTSAFLHFNSYPKCPYPTQ  254
            F  T+ HY+ QL  L  ++  +IFK+L +  ++V WLK ++  S  L  N YP CP PT+
Sbjct  157  FCGTMVHYRSQLKALTEQLIRIIFKSLNINPEEVAWLKDTEGLSIGLQLNCYPPCPDPTR  216

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            A+GI PHTD+SLIT+L QS  +SGLQVF      ++  P P
Sbjct  217  AMGIAPHTDTSLITILQQSK-VSGLQVFKEGAGWVLVQPVP  256


 Score = 42.7 bits (99),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFF  499
            V+P+P A+ VN+ D+  I SNG F +V+H  +V     R+S  +F+
Sbjct  252  VQPVPGAITVNLGDIFHILSNGVFTTVRH-RVVATPIRRLSFAYFY  296


 Score = 23.1 bits (48),  Expect(3) = 5e-23, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 18/31 (58%), Gaps = 2/31 (6%)
 Frame = +1

Query  526  ISTQIGQGP*FHVSPISWKEYQRIKGVHFDK  618
            +S   G+ P +    +S KEY  IKG HF+K
Sbjct  308  LSKDFGEVPRYQT--LSVKEYVGIKGKHFEK  336



>ref|XP_010434144.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Camelina sativa]
Length=351

 Score = 80.1 bits (196),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+ +  L++++ +++  +LGL  +D+ WL        + S  +FL  NSYP 
Sbjct  156  FCNVMEEYQKAMDDLSLRLITMLMASLGLTHEDLGWLVPDKTGSGTDSIQSFLQLNSYPV  215

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKN  353
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P + 
Sbjct  216  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEE  253


 Score = 54.7 bits (130),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LV+ + D+  I SNGQF++  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  258  IGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQI-GPL  316

Query  536  KLVKDRDSMY  565
               K+   +Y
Sbjct  317  ACDKNHPPIY  326


 Score = 20.4 bits (41),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 6/14 (43%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF++
Sbjct  331  WEEYLAAKATHFNR  344



>ref|XP_008231797.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=356

 Score = 72.4 bits (176),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS---TSAFLHFNSYPKC  239
            +    +  + Y ++L  L+ ++  ++  +LG+ ++DV W   K     +  L  NSYP C
Sbjct  156  YTKICSITEEYDKELGRLSSRLMWIMLASLGISKEDVKWSGPKGDNHEAHVLQLNSYPAC  215

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P P + +G+VPHTDS+L+T+++QS  I GLQVF          P P
Sbjct  216  PDPDRVMGLVPHTDSTLVTIVHQSK-ICGLQVFQEGTGWFTVPPVP  260


 Score = 62.4 bits (150),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISS-PLK  538
            V P+P A+VVNV D+M I SNG + SV H  +V Q   R+S+ + +G   N+ IS  P  
Sbjct  256  VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQQRLSVVYTYGPPDNVPISPIPKL  315

Query  539  LVKDRDSMYPPYRGKST-----RGLRGCILTSVR  625
            L     ++YPP    S        L+G  L S+R
Sbjct  316  LSASHPALYPPVTNWSEYIDTKTKLKGKALASLR  349



>gb|AEW67998.1| gibberellin 3 oxidase 1 [Castanea mollissima]
Length=368

 Score = 79.0 bits (193),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F   ++ Y++++  LA ++  LI  +LG+  +D+ W   K      SA L  NSYP CP 
Sbjct  158  FCDIIEEYEKEMKKLAGRLMWLILGSLGICNEDIKWAGPKGEFQGASAALQLNSYPACPD  217

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P QA+G+  HTDS+L+T+L+Q+NT SGLQV 
Sbjct  218  PDQAMGLAAHTDSTLLTILHQNNT-SGLQVL  247


 Score = 51.6 bits (122),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVN+ D++ I SNG + SV H A+V +  +R+S+ + +G   +++IS   
Sbjct  254  VTVDPVQGALVVNIGDLLHILSNGLYPSVLHRAMVNRTRYRLSMAYLYGPPDSVQISPLS  313

Query  536  KLV  544
            KL+
Sbjct  314  KLL  316


 Score = 24.3 bits (51),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY   K  HF+K
Sbjct  326  PVTWNEYLGTKAKHFNK  342



>ref|XP_009377503.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score = 83.6 bits (205),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA---FLHFNSYPKCPYP  248
            F  T+D YQ Q+  LA K+  + FK+L +   +++WL     S+    L  NSYP CP P
Sbjct  156  FCDTIDDYQNQMKALAEKLIRIFFKSLNINFKELNWLNDSGLSSPGTALQLNSYPPCPDP  215

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHLS  389
            T+A+G+  HTD+SL+T++ QS T SGLQVF      ++  P P  L+
Sbjct  216  TRAMGMAAHTDTSLVTIVQQSKT-SGLQVFKDGVGWVLVQPVPGALT  261


 Score = 51.2 bits (121),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+P+P AL VN+ D + I SNG + SV H A+V Q   R S+ +F+    +  +S  L  
Sbjct  253  VQPVPGALTVNLGDYLHILSNGMYTSVLHRAVVNQQIQRFSMAYFYAPPRDFTVSPVLSR  312

Query  542  VKDRDSMYPPYRGKSTR  592
            V  +    P YR  + +
Sbjct  313  VMGQ---MPKYRSLTVK  326



>dbj|BAD30035.1| gibberellin 3beta-hydroxylase1 [Daucus carota]
Length=344

 Score = 82.8 bits (203),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 62/98 (63%), Gaps = 3/98 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   V+ Y +++  LA ++  L+ K+LG+ E+D++W  S    A +  NSYP CP P +A
Sbjct  151  FCDLVEEYGKEMKNLAERLMWLMLKSLGITEEDINW--SSLGGAAIQLNSYPVCPDPDRA  208

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            +G+  HTDSSL+T+LYQ+NT +GLQ+F      L   P
Sbjct  209  MGLAEHTDSSLLTILYQNNT-TGLQIFREGTGWLTVQP  245


 Score = 47.8 bits (112),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P    LVVN+ D+M I SNG + SV H A+V +   RIS+ + +    N+ IS   
Sbjct  241  LTVQPHTGVLVVNIGDLMHILSNGLYPSVLHRALVNRKQQRISVAYIYRPPANVLISPLP  300

Query  536  KLV  544
            KLV
Sbjct  301  KLV  303


 Score = 23.9 bits (50),  Expect(3) = 8e-23, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHF  612
            PI+W EY  +K  HF
Sbjct  313  PITWTEYLELKSKHF  327



>ref|XP_010520599.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Tarenaya hassleriana]
Length=391

 Score = 77.8 bits (190),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA------FLHFNSYPKC  239
            FS  ++ YQ+ +  L  ++  ++  +LGL ++DV W     T +      FL  NSYP C
Sbjct  195  FSDVMEEYQKAMETLGRRLICMLMDSLGLAQEDVGWTVPDRTGSRPEIQPFLQLNSYPVC  254

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            P P  A+G+ PHTDSSL T+L+Q+N I GLQ+
Sbjct  255  PEPDLAMGLAPHTDSSLFTILHQAN-IPGLQI  285


 Score = 53.9 bits (128),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V PIP  LVV + D+  + SNG+F +V H  +V    HR+S  +F+G   ++ +    KL
Sbjct  297  VDPIPGGLVVIMGDVFHMLSNGRFNNVMHRVVVNSTRHRVSAAYFYGPPRSVTVGPSSKL  356

Query  542  V-KDRDSMY  565
            + +DR  MY
Sbjct  357  IDEDRPRMY  365


 Score = 23.1 bits (48),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            +SW EY   K  +FDK
Sbjct  368  VSWGEYLETKATYFDK  383



>ref|XP_003543662.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=352

 Score = 79.7 bits (195),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   V  Y E +  L  K+  L+  +LG+ ++D+ W  SK     T A L  NSYP CP 
Sbjct  157  YCDIVKRYDEAMKKLVGKLMWLMLDSLGITKEDLKWAGSKGQFKKTCAALQLNSYPTCPD  216

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+N ISGLQV       +  +P P
Sbjct  217  PDRAMGLAAHTDSTLLTILYQNN-ISGLQVHRKGGGWVTVAPVP  259


 Score = 52.8 bits (125),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P+ LV+NV D++ I SNG + SV H  +V +   R+S+ +  G   N++I    
Sbjct  253  VTVAPVPEGLVINVGDLLHILSNGLYPSVLHRVLVNRIQQRLSVAYLCGPPPNVEICPHA  312

Query  536  KLV  544
            KLV
Sbjct  313  KLV  315


 Score = 21.2 bits (43),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  326  VTWNEYLGTKAKHFNK  341



>ref|XP_007150692.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
 gb|ESW22686.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
Length=365

 Score = 81.3 bits (199),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK----STSAFLHFNSYPKCPY  245
            +  TV  Y E +  LA K+  L+ ++LG+ ++D+ W  +K    +T A L  NSYP CP 
Sbjct  160  YCDTVMQYDETMKKLAEKLMWLMLESLGITKEDLKWAGAKGQFKNTCAALQLNSYPTCPD  219

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+N ISGLQV       +   P P
Sbjct  220  PDRAMGLAAHTDSTLLTILYQNN-ISGLQVHRKGTGWVTVPPVP  262


 Score = 50.8 bits (120),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P  LV+NV D++ I SNG + SV H  +V +   R+S+ +  G   N+ I    
Sbjct  256  VTVPPVPGGLVINVGDLLHILSNGLYPSVLHRVLVNRVQQRLSVAYLCGPPPNVSICPHE  315

Query  536  KLV  544
            KLV
Sbjct  316  KLV  318


 Score = 21.6 bits (44),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  329  VTWNEYLGTKAKHFNK  344



>ref|XP_002869872.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46131.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score = 76.3 bits (186),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+ +  L+ ++ S++  +L L  +D+ WL        + S  +FL  NSYP 
Sbjct  153  FCNVMEEYQKAMDDLSHRLISMLMGSLRLTREDLGWLVPDKTGSGTDSIQSFLQLNSYPV  212

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P +
Sbjct  213  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIESPQE  249


 Score = 55.8 bits (133),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LVV + D+  I SNGQF+S  H A+V +  HR+S  +F G   NL+I  PL
Sbjct  255  IGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNLQI-GPL  313

Query  536  KLVKDRDSMY  565
               K+   +Y
Sbjct  314  TSDKNHPPIY  323


 Score = 21.2 bits (43),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 9/14 (64%), Gaps = 0/14 (0%)
 Frame = +1

Query  577  WKEYQRIKGVHFDK  618
            W+EY   K  HF+K
Sbjct  328  WEEYLAAKATHFNK  341



>ref|XP_008352044.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score = 85.5 bits (210),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA---FLHFNSYPKCPYP  248
            F  T+D YQ Q+  LA KI  + FK+L +  ++++WL     S+    L  NSYP CP P
Sbjct  156  FCDTIDDYQNQMKALAEKIIRIFFKSLNINFEELNWLNDSGLSSPGTALQLNSYPPCPDP  215

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPMHLS  389
            T+A+G+  HTD+SL+T++ QS T SGLQVF      ++  P P  L+
Sbjct  216  TRAMGMAAHTDTSLVTIVQQSKT-SGLQVFKDGVGWVLVQPVPGALT  261


 Score = 47.8 bits (112),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+P+P AL V + D + I SNG + +V H A+V Q   R S+ +F+    +  +S  L  
Sbjct  253  VQPVPGALTVXLGDYLHILSNGMYTNVLHRAVVNQQIQRFSMAYFYAPPRDFTVSPVLSR  312

Query  542  VKDRDSMYPPYRGKSTR  592
            V  +    P YR  + +
Sbjct  313  VTGQ---MPKYRSLTVK  326



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 67.8 bits (164),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL------KSKSTSAFLHFNSYPKC  239
            F   ++ Y   +  L  ++  L+  +LGL E ++DW         ++ +  +  NSYP C
Sbjct  149  FCGAIEEYTSWMKPLGCRLMLLMLASLGLSEGEIDWAVPSNDTTHEAPAPVIQLNSYPAC  208

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPN  347
            P P +A+G+  HTDSSL T+LYQ  ++ GLQ+   N
Sbjct  209  PDPDRAMGLAEHTDSSLFTVLYQ-GSVRGLQLLHGN  243


 Score = 65.1 bits (157),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVVNV D+  I SNG+F+SV H AIV +   RIS+ +F+G   + KI+   
Sbjct  252  VTVPPLPGALVVNVGDLSHILSNGRFQSVTHRAIVNRTQTRISVAYFYGPPAHFKIAPIE  311

Query  536  KLVKDRDSMYPPYR  577
            KL+  +    P YR
Sbjct  312  KLMGPQQG--PAYR  323



>ref|XP_006389782.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
 gb|ESQ27068.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
Length=358

 Score = 77.0 bits (188),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   +  Y+E +  LA ++  L   +LG+ E D++W    S      A +  N YP CP 
Sbjct  158  YCEIITEYEEHMQKLAARLMWLALGSLGVDEKDINWAGLSSDFQGAQAAIQLNHYPICPE  217

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+NTI GLQVF  +   +   P P
Sbjct  218  PDRAMGLAAHTDSTLMTILYQNNTI-GLQVFRDDVGWVTVPPVP  260


 Score = 53.5 bits (127),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P +LVVNV D++ I +NG F SV H A V     R SI + +G   +L IS   
Sbjct  254  VTVPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSIAYLWGPPSDLMISPLP  313

Query  536  KLVKDRDS-MYPPYRGK  583
            KLV    S +YP    K
Sbjct  314  KLVNPLHSPLYPSLTWK  330


 Score = 21.9 bits (45),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  327  LTWKQYLATKATHFNQ  342



>ref|XP_006285095.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
 gb|EOA17993.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
Length=353

 Score = 79.7 bits (195),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 62/99 (63%), Gaps = 8/99 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL-------KSKSTSAFLHFNSYPK  236
            F   ++ YQ+ +  L++++ +++  +LG+  +D+ WL       ++ S  +FL  NSYP 
Sbjct  158  FCNVMEEYQKAMDDLSLRLITMLMGSLGITHEDLGWLVPDKTGSETNSIQSFLQLNSYPV  217

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKN  353
            CP P  A+G+ PHTDSSL+T+LYQ N I GL++  P + 
Sbjct  218  CPDPHLAMGLAPHTDSSLLTILYQGN-IPGLEIQSPQEE  255


 Score = 51.6 bits (122),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PI  +LV+ + D+  I SNG F++  H A+V +  HR+S  +F G   NL+I    
Sbjct  260  IGVEPIEGSLVIIMGDLSHIISNGLFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQIG---  316

Query  536  KLVKDRDSMYPP-YR  577
             L+ D++  +PP YR
Sbjct  317  PLIGDKN--HPPIYR  329


 Score = 21.2 bits (43),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            + W+EY   K  HF+K
Sbjct  331  LVWEEYLAAKATHFNK  346



>dbj|BAD30036.1| gibberellin 3beta-hydroxylase2 [Daucus carota]
Length=353

 Score = 77.8 bits (190),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPK  236
            +  F    + YQ+++  LA KI  ++ +ALG+ ++D+ W     + +++ A L  NSYP 
Sbjct  159  YSVFCDVTEEYQKEMKKLAGKIMWIMLEALGITKEDIIWAGPNGEFEASGAALQLNSYPV  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            CP P +A+G+  HTDS+L+++L+QSN  SGLQVF
Sbjct  219  CPDPDRAMGLADHTDSTLLSILHQSNQ-SGLQVF  251


 Score = 54.3 bits (129),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  ALVVN+ D++ I +NG + SV H   V +  HR S+ + +G   + +IS   
Sbjct  258  VTVPPVEGALVVNIGDLLHILTNGSYPSVLHRVTVNRERHRYSMAYLYGPPHSAEISPLS  317

Query  536  KLVKDRDSMYPP-YR  577
            KLV   D  +PP YR
Sbjct  318  KLV---DHQHPPLYR  329


 Score = 20.4 bits (41),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 6/15 (40%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHF  612
            P++W EY  +K + F
Sbjct  330  PVTWSEYLGMKAILF  344



>ref|XP_007221040.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
 gb|EMJ22239.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
Length=356

 Score = 70.9 bits (172),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS---TSAFLHFNSYPKC  239
            +    +  + Y ++L  L  ++  ++  +LG+ ++DV W   K     +  L  NSYP C
Sbjct  156  YTKICSITEEYDKELGRLCSRLMWIMLASLGISKEDVKWSGPKGDNQEAHVLQLNSYPAC  215

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P P +A+G+V HTDS+L+T+++QS  I GLQVF          P P
Sbjct  216  PDPDRAMGLVAHTDSTLVTIVHQSK-ICGLQVFQEGTGWFTVPPVP  260


 Score = 61.2 bits (147),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISS-PLK  538
            V P+P A+VVNV D+M I SNG + SV H  +V Q   R+S+ + +G   N+ IS  P  
Sbjct  256  VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQPRLSVVYTYGPPDNVPISPIPKL  315

Query  539  LVKDRDSMYPPYRGKST-----RGLRGCILTSVR  625
            L     ++YPP    S        L+G  L S+R
Sbjct  316  LSASHPALYPPVTNWSEYIDTKTKLKGKALASLR  349



>ref|XP_006301281.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
 gb|EOA34179.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
Length=355

 Score = 78.2 bits (191),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 64/114 (56%), Gaps = 12/114 (11%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFL  215
            ++ YC         ++ Y+E +  LA K+  L   +LG+ E+D+ W    S    T A +
Sbjct  153  HLEYC-------EIIEAYKEHMQKLAAKLMWLALGSLGVEENDIKWAGPNSDFQGTQAAI  205

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
              N YP CP P +++G+  HTDS+L+T+LYQ+NT +GLQVF  +   +   P P
Sbjct  206  QLNHYPICPEPERSMGLAAHTDSTLLTILYQNNT-AGLQVFRDDVGWVTVPPIP  258


 Score = 52.4 bits (124),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP +LVVNV D++ I +NG F SV H A V     R S+ + +G   ++ IS   
Sbjct  252  VTVPPIPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPSSDVMISPLP  311

Query  536  KLVKDRDS-MYPPYRGK  583
            KLV    S +YP    K
Sbjct  312  KLVDPLQSPLYPSLTWK  328


 Score = 21.6 bits (44),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 6/15 (40%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFD  615
            ++WK+Y   K  HF+
Sbjct  325  LTWKQYLATKATHFN  339



>gb|ABI64150.1| gibberellin 3-oxidase [Pisum sativum]
Length=349

 Score = 84.7 bits (208),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ YQ+Q+  LA KIT++IF  LG+ ++   W+ S +    L  N YP CP P +A
Sbjct  159  FCDIMEDYQKQMKTLAEKITNIIFNILGISKEQNKWVGSNNHCEALQLNFYPCCPDPKKA  218

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +G+ PHTD+SL T+L+QS T SGLQ+F      +   P P
Sbjct  219  MGLAPHTDTSLFTILHQSQT-SGLQIFKEGVGYVTVDPHP  257


 Score = 47.4 bits (111),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 5/83 (6%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P+ LVVN  D++ I SN +F+   H A+V     R S+ +F+G  ++  + SPL
Sbjct  251  VTVDPHPNTLVVNTGDILHILSNSRFRCSLHRAVVNDVKDRYSVAYFYGPPVDYLV-SPL  309

Query  536  KLVKDRDSMYPPYRGKSTRGLRG  604
             +    D   P +R  S +   G
Sbjct  310  VV----DGSLPRFRSLSVKDYIG  328



>ref|XP_008356836.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score = 77.8 bits (190),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            F    + Y++++  LA ++  L+  +L + ++D+ W   +      SA L  NSYP CP 
Sbjct  162  FCCVTEEYEKEMKRLAARLMWLMLGSLXISKEDIKWAGPRGEFEDASAALQLNSYPACPD  221

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNE----LMSSPFP  377
            P + +G+  HTDS+L+++++QS   SGLQVF   K+E    LM  P P
Sbjct  222  PDRTMGLAQHTDSNLLSIIHQSAKASGLQVFQEGKDEGRGWLMVPPVP  269


 Score = 53.5 bits (127),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P+P A V+NV D + I SNG +++  H A+V ++ HR+S+ + +G   N ++S   KL
Sbjct  265  VPPVPGAFVINVGDFIHILSNGLYQTPLHRAVVNRSQHRVSVAYLYGPPENAQVSPLSKL  324

Query  542  V  544
            +
Sbjct  325  L  325



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score = 76.3 bits (186),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST-----SAFLHFNSYPKCP  242
            F   ++ Y  ++  LA ++  L+  +LGL +++V+W           +  L  NSYP CP
Sbjct  148  FCDAIERYDREMKALAGRLIRLMLLSLGLSDEEVEWAGQGGELPPDLAGVLRLNSYPACP  207

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
             P +A+G+  H DSSL+T+LYQS+T SGLQV    + E  +SP
Sbjct  208  DPDRAMGMAAHADSSLVTILYQSST-SGLQVL---RAEDQNSP  246


 Score = 54.7 bits (130),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVV V D+  I SNG+FKSV H  +V ++  R+S  +F G    + +S   
Sbjct  250  VTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSAAYFCGPPAGVTVSPIE  309

Query  536  KLVKDRDSMYPPYR  577
            KLV    +  P YR
Sbjct  310  KLVGPGRA--PAYR  321



>ref|XP_006338004.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 65.5 bits (158),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +++YQ+++  L+ ++   I   L  P  D   + S   +  L  NSYP CP P  A
Sbjct  160  FCDVMENYQKKMKVLSFQLCLFILNYLQ-PSQDQHSINSFEFAGALQLNSYPCCPNPNHA  218

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            LG+ PHTDS  +T+L+Q+N   GLQ+ 
Sbjct  219  LGLAPHTDSLFLTILHQTNNTKGLQIL  245


 Score = 65.1 bits (157),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG +++  I SPL   KD D
Sbjct  260  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMI-SPLVSSKDND  318

Query  557  SMYPPYRG---KSTRGLRGCILTSV  622
             +   YR    K   GL+   L  V
Sbjct  319  GVVLKYRNVKVKEYLGLKAKHLEKV  343



>ref|XP_008219863.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=344

 Score = 87.8 bits (216),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLK-SKSTSAFLHFNSYPKCPYPTQ  254
            F  T+  YQ QL  L  ++  +IFK+L +  ++VDWLK S+ +S  L  NSYP CP PT+
Sbjct  159  FCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDWLKDSQGSSTALQLNSYPACPDPTR  218

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+ PHTD+SLIT+L QS T SGLQVF
Sbjct  219  AMGLAPHTDTSLITIL-QSKT-SGLQVF  244


 Score = 42.7 bits (99),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+ IP A++VNV D + I SNG F +V+H  +V     R S   F+    ++ I SP+ +
Sbjct  253  VQSIPGAVIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDV-IVSPV-M  309

Query  542  VKDRDSMYPPYRGKSTRG  595
             KD   + P YR  S +G
Sbjct  310  SKDFGEV-PRYRSVSVKG  326



>ref|XP_002517539.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF44703.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=240

 Score = 71.2 bits (173),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 6/100 (6%)
 Frame = +3

Query  93   DHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAFLHFNSYPKCPYPTQA  257
            + YQ ++  LA+++  L+  +LG+  +DV W   +     +++A L  N YP CP P +A
Sbjct  23   EEYQIEMQKLAVRLMWLMLGSLGITSEDVTWAGPEGDFEGASAAALQLNYYPACPDPDKA  82

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +G+  HTDS+L+T+L+Q N+ SGLQV       +   P P
Sbjct  83   MGLAAHTDSTLLTILHQ-NSTSGLQVQKEGTGWVTVPPIP  121


 Score = 58.9 bits (141),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PIP  LVV+V D++ I SNG + SV H A+V +  HR+S+ + +G   +++IS   
Sbjct  115  VTVPPIPGGLVVHVGDLLHILSNGLYPSVIHRAVVNRTKHRLSVAYLYGPPSSIQISPLS  174

Query  536  KLV  544
            KLV
Sbjct  175  KLV  177



>gb|AAN87570.1| gibberellin 3-oxidase [Spinacia oleracea]
Length=382

 Score = 68.9 bits (167),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV-DWLKS-KSTSAFLHFNSYPKCPYPT  251
            F   ++ YQ+++  LA K+  L+  +LG+   D+ +W    +  +  +  NSYP  P P 
Sbjct  160  FCDIIEKYQKEMNQLAKKLMQLVVGSLGISNQDIMNWADLLEGANGAMQLNSYPIRPDPN  219

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVF  338
            +A+G+  HTDS+L+T+L+QSNT +GLQVF
Sbjct  220  RAMGLAAHTDSTLLTILHQSNT-TGLQVF  247


 Score = 58.2 bits (139),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V PI   LV+N+ D++ I SNG++ SV H A+V +  HR+S+ + +G    +++    
Sbjct  254  VTVPPISGGLVINIGDLLHILSNGRYPSVYHRAMVNRVQHRLSVAYLYGPASGVRVQPLP  313

Query  536  KLVKDRDSMYPP-YR  577
            KL+   D+ +PP YR
Sbjct  314  KLI---DATHPPLYR  325


 Score = 22.7 bits (47),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 10/17 (59%), Gaps = 0/17 (0%)
 Frame = +1

Query  568  PISWKEYQRIKGVHFDK  618
            P++W EY  IK  H  K
Sbjct  326  PVTWSEYLGIKSEHLTK  342



>ref|XP_002887835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64094.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score = 76.6 bits (187),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPY  245
            +   ++ Y E +  LA K+  L   +LG+ E D+ W    S    T A    N YP CP 
Sbjct  156  YCEIIEEYGEHMQKLAAKLMWLALGSLGVEEKDIKWAGPNSDFQGTQAATQLNHYPICPE  215

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+NT +GLQVF  +   +   P P
Sbjct  216  PDRAMGLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWVTVPPVP  258


 Score = 50.8 bits (120),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P +LVVNV D++ I +NG F SV H A V     R S+ + +G   ++ IS   
Sbjct  252  VTVPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDIMISPLP  311

Query  536  KLVKDRDS-MYPPYRGK  583
            +LV    S +YP    K
Sbjct  312  RLVDPLQSPLYPSLTWK  328


 Score = 21.9 bits (45),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  325  LTWKQYLATKATHFNQ  340



>ref|NP_001267625.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28484.1| GA 3-oxidase [Cucumis sativus]
 gb|KGN45325.1| hypothetical protein Csa_7G435500 [Cucumis sativus]
Length=374

 Score = 74.7 bits (182),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 61/112 (54%), Gaps = 12/112 (11%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFL  215
            Y  YC          + Y  ++  L  ++  L    LG+  +DV+W ++    K+++A +
Sbjct  162  YSKYC-------DITEEYSREMKSLCGRVIWLALGELGITREDVNWAEANGDFKTSNAVI  214

Query  216  HFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
              NSYP CP P +A+G+  HTD+SL+T+LYQ+NT  GLQV       +M  P
Sbjct  215  QLNSYPVCPDPDRAMGLGAHTDTSLLTILYQNNT-RGLQVLREGNRWVMVEP  265


 Score = 54.7 bits (130),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+  ALVV V D++ I +NG + S  H A+V Q   RISI +FFG   + +IS   
Sbjct  261  VMVEPVTGALVVQVGDLLHILTNGLYPSSAHQAVVNQNRKRISIAYFFGPSESAEISPLN  320

Query  536  KLV  544
            KLV
Sbjct  321  KLV  323



>emb|CDY38661.1| BnaC02g23180D [Brassica napus]
Length=358

 Score = 76.6 bits (187),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPY  245
            +   +  Y+E +  LA K+  L   +LG+ E D++W       +   A +  N YP CP 
Sbjct  159  YCKIIQEYEEHMQKLAAKLMWLALGSLGVEEKDIEWAGPISDFQGAQAAIQLNHYPICPE  218

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P +A+G+  HTDS+L+T+LYQ+NT +GLQVF  +   +   P P
Sbjct  219  PDRAMGLAAHTDSTLMTILYQNNT-AGLQVFRDDVGWITVPPVP  261


 Score = 50.4 bits (119),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+P +LVVN+ D++ I +NG F SV H A V     R S+ + +G   +L IS   
Sbjct  255  ITVPPVPGSLVVNLGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLP  314

Query  536  KLVKDRDS-MYPPYRGK  583
            KLV    S +YP    K
Sbjct  315  KLVDPLHSPLYPSLTWK  331


 Score = 21.9 bits (45),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  328  LTWKQYLATKATHFNQ  343



>gb|ADK71017.1| gibberellin 3-beta-hydroxylase [Trigonella gladiata]
Length=301

 Score = 77.8 bits (190),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +3

Query  96   HYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPTQAL  260
             Y E +  LA K+ SL+  +LG+ ++D+ W  SK+      SA L  NSYP CP P  A+
Sbjct  137  QYDETMKKLAGKLMSLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSCPDPDHAM  196

Query  261  GIVPHTDSSLITLLYQSNTISGLQV  335
            G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  197  GLAPHTDSTFLTILSQ-NDISGLQV  220


 Score = 51.2 bits (121),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H A+V +   R S+ + +G   N++I    
Sbjct  228  VTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHA  287

Query  536  KLV  544
            KLV
Sbjct  288  KLV  290



>gb|KFK42430.1| hypothetical protein AALP_AA2G255300 [Arabis alpina]
Length=354

 Score = 75.5 bits (184),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 5/106 (5%)
 Frame = +3

Query  72   VCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKC  239
            V +   +  Y+E +  LA K+  L   +LG+ E D+ W    S      A +  N YP C
Sbjct  158  VKYCEIIKEYEEHMQKLAAKLMWLALGSLGVEEKDIKWAWPSSDFQGAQAAIQLNHYPIC  217

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P P +A+G+  HTDS+L+T+LYQ++T +GLQVF  +   +   P P
Sbjct  218  PEPDRAMGLAAHTDSTLLTILYQNDT-AGLQVFRDDVGWVTVPPVP  262


 Score = 51.6 bits (122),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P +LVVNV D++ I +NG F SV H A V     R S+ + +G   +L IS   
Sbjct  256  VTVPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDLMISPLP  315

Query  536  KLVKDRDS-MYP  568
            +LV    S +YP
Sbjct  316  QLVDPLQSPLYP  327


 Score = 21.9 bits (45),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  329  LTWKQYLATKATHFNQ  344



>ref|XP_008461055.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
2-like [Cucumis melo]
Length=375

 Score = 73.2 bits (178),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 13/113 (12%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y  YC          + Y  ++  L  ++  L    LG+ ++DV+W  S      ST+A 
Sbjct  161  YSKYC-------DLTEEYSREMGSLCGRLIWLALGELGITQEDVNWAGSNGDFKTSTNAV  213

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            +  NSYP CP P +A+G+  HTDSSL+T+LYQ+N+  GLQV       +M  P
Sbjct  214  IQLNSYPICPDPDRAMGLGAHTDSSLLTILYQNNS-RGLQVLREGNRWVMVEP  265


 Score = 55.5 bits (132),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V+P+  ALVV V D++ I +NG + S  H A+V Q   RISI +FFG    ++IS   KL
Sbjct  263  VEPVNGALVVQVGDLLHILTNGLYLSSVHQAVVNQTQKRISIAYFFGPSEGVEISPINKL  322

Query  542  VK-DRDSMYP  568
            V   R  +YP
Sbjct  323  VTPTRPLLYP  332



>ref|XP_002324270.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEF02835.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=341

 Score = 79.0 bits (193),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS-KSTSAFLHFNSYPKCPYPTQ  254
            F   ++ YQ+++  LAI +  LI K+L L E+++  + S    S  L  NSYP CP P++
Sbjct  155  FCDVMEDYQKKMKELAITLMHLILKSLDLSEEEISKVVSPGGASTALQLNSYPFCPDPSR  214

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
             +G+ PHTD+SL+T+LYQS TI+GL++F      ++ SP
Sbjct  215  VMGLAPHTDTSLLTILYQS-TINGLEIFKDGVGWVLVSP  252


 Score = 49.7 bits (117),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P   +LVVNV D++ I SN QF SV H  ++ +   R+S+ +F+    +  + SPL L
Sbjct  250  VSPTNGSLVVNVGDLLHILSNAQFPSVLHRVVLKEKQQRLSLAYFYSPPTDFDV-SPLAL  308

Query  542  VKDRDSMYPPYRGKSTR  592
                 +  P YR  S R
Sbjct  309  ---NPAQIPLYRSVSVR  322



>ref|XP_006361220.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 65.5 bits (158),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +++YQ+++  L+ ++  LI   L   ++    +KS  +   L  NSYP CP P  A
Sbjct  161  FCDVMENYQKKIKALSFQLWLLILNYLQPSQEHS--IKSFESRRALQLNSYPCCPNPNHA  218

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
            LG+ PHTDS  +T+L+Q+N   GLQ+   ++
Sbjct  219  LGLAPHTDSLFLTILHQTNNTKGLQILKKDQ  249


 Score = 62.8 bits (151),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG +++  I  PL   KD  
Sbjct  260  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMI-VPLVSSKDNV  318

Query  557  SMYPPYR  577
             + P YR
Sbjct  319  GVVPKYR  325



>ref|XP_008445137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=369

 Score = 77.4 bits (189),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF----LHFNSYPKCPY  245
            F   ++ YQ ++  LA +IT+LIF  L +  D  +WL S   +A     L  N YP+CP 
Sbjct  182  FCDVMEEYQRKMKALAEQITNLIFNYLKI-SDCANWLHSTGAAAACSTALQLNCYPRCPD  240

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            PT+ +G+ PHTD+ L+T+L+Q+ T  GLQ+F      +  +P P
Sbjct  241  PTRVMGLAPHTDTFLLTILHQTRT-CGLQIFRDGSGWVPVAPLP  283


 Score = 50.4 bits (119),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V P+P ALV+NV D+  I SNG+F +V H  +V     R+S+ +F+G
Sbjct  277  VPVAPLPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTQRRLSMAYFYG  325



>ref|XP_004291423.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 87.8 bits (216),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 6/91 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSA----FLHFNSYPKCPY  245
            FS T+D YQ Q+  LA K+T ++F+AL +P +D++W    +  +     L  NSYP CP 
Sbjct  149  FSDTIDEYQSQMKALAEKVTGILFRALSIPVEDLNWFDDPTNRSGCNLALQLNSYPPCPE  208

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            PT+ LG+ PHTD+S++T+L Q+ T SGLQVF
Sbjct  209  PTRTLGLAPHTDTSIVTIL-QAKT-SGLQVF  237


 Score = 40.0 bits (92),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFF  499
            + V+P P+A++VN+ D   + SNG+F SV H  +V +   R S+ +F+
Sbjct  244  IPVEPEPEAIIVNLGDFTHLLSNGRFISVLH-RVVVKPIQRYSMGYFY  290



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score = 70.5 bits (171),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST-----SAFLHFNSYPKCP  242
            F   ++ Y + +  LA ++ +L+  +LGL  ++++W           +  L  NSYP CP
Sbjct  149  FCDVIERYDQVMKALAGRLITLMLLSLGLRHEELEWAGQTGKLLPDLAGVLRLNSYPACP  208

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
             P +A+G+  H DSSL+T+LYQS+T SGLQ+ 
Sbjct  209  DPDRAMGMAAHADSSLLTILYQSST-SGLQLL  239


 Score = 57.4 bits (137),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+P ALVV V D+  I SNG+FKSV H  +V ++  R+S+ +F G    +++S   
Sbjct  251  VTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSVAYFSGPPAGVRVSPIG  310

Query  536  KLVKDRDSMYPPYR  577
            KLV    +  P YR
Sbjct  311  KLVGPGRA--PAYR  322



>ref|XP_006366661.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 66.6 bits (161),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQALGI  266
             +++YQ+++  L+ ++  LI   L   ++    +KS  ++  L  NSYP CP P  ALG+
Sbjct  164  VMENYQKKMKALSFQLWLLILNYLQPSQEHS--IKSFESTGALQLNSYPCCPNPNHALGL  221

Query  267  VPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPM  380
             PHTDS  +T+L+Q+N   GLQ+    KN++ +S  P+
Sbjct  222  APHTDSLFLTILHQTNNTKGLQIL--KKNQVWTSIAPV  257


 Score = 60.8 bits (146),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG +++  I  PL   +D  
Sbjct  260  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMI-VPLVSSEDNV  318

Query  557  SMYPPYR  577
               P YR
Sbjct  319  GAIPKYR  325



>ref|XP_008461418.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=353

 Score = 67.0 bits (162),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 6/97 (6%)
 Frame = +3

Query  93   DHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPYPTQAL  260
            + Y +++  L  K+  L    LG+  +D++W  S    K+++  L  NSYP CP P +++
Sbjct  149  EEYLKEMKNLCGKVMWLTLGELGITPEDINWAGSDGEFKTSNQALRMNSYPVCPEPDESI  208

Query  261  GIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            G+ PH+DSS++T+LYQ  T  GLQV    K  +   P
Sbjct  209  GLPPHSDSSVLTVLYQ--TTKGLQVLIEGKGWVTVEP  243


 Score = 60.8 bits (146),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+ DALVV V DM+ I +NG +    H A+V Q   R+S  FFFG   N ++S   
Sbjct  239  VTVEPVKDALVVQVGDMLHILTNGLYSPSVHQAVVNQTHDRMSTAFFFGTPKNTEVSPLK  298

Query  536  KLVK-DRDSMYP  568
            KLV   R  MYP
Sbjct  299  KLVTPTRPLMYP  310



>ref|XP_004253252.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score = 64.7 bits (156),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +  YQ+++  L+ ++  LI   L   ++    +KS  ++  L  NSYP CP P  A
Sbjct  161  FCDVMGDYQKKMKALSFQLWMLILNYLQPSQEHS--IKSFESTGALQLNSYPCCPNPNHA  218

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            LG+ PHTDS  +T+L+Q+N   GLQ+ 
Sbjct  219  LGLAPHTDSLFLTILHQTNNTKGLQIL  245


 Score = 62.8 bits (151),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG +++  +  PL   KD  
Sbjct  260  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVD-SVIVPLVSSKDNV  318

Query  557  SMYPPYR  577
             + P YR
Sbjct  319  GVVPKYR  325



>ref|NP_178150.1| gibberellin 3-beta-dioxygenase 2 [Arabidopsis thaliana]
 sp|Q9ZT84.2|G3OX2_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 2; AltName: Full=GA 
3-oxidase 2; Short=AtGA3ox2; AltName: Full=Gibberellin 3 
beta-hydroxylase 2 [Arabidopsis thaliana]
 gb|AAG52442.1|AC018848_13 gibberellin 3 beta-hydroxylase; 29683-28215 [Arabidopsis thaliana]
 gb|AEE36389.1| gibberellin 3-beta-dioxygenase 2 [Arabidopsis thaliana]
Length=347

 Score = 74.7 bits (182),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +3

Query  108  QLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPYPTQALGIVPH  275
             +  LA K+      +LG+ E D+ W    S    T A +  N YPKCP P +A+G+  H
Sbjct  166  HMQKLAAKLMWFALGSLGVEEKDIQWAGPNSDFQGTQAVIQLNHYPKCPEPDRAMGLAAH  225

Query  276  TDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            TDS+L+T+LYQ+NT +GLQVF  +   + + P P
Sbjct  226  TDSTLMTILYQNNT-AGLQVFRDDVGWVTAPPVP  258


 Score = 50.4 bits (119),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V   P+P +LVVNV D++ I +NG F SV H A V     R S+ + +G   ++ IS   
Sbjct  252  VTAPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDIMISPLP  311

Query  536  KLVKDRDS-MYP  568
            KLV    S +YP
Sbjct  312  KLVDPLQSPLYP  323


 Score = 21.9 bits (45),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  325  LTWKQYLATKATHFNQ  340



>sp|Q3I409.1|G3O23_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-3; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-3; AltName: Full=Gibberellin 
3-oxidase 2-3 [Triticum aestivum]
 gb|AAZ94379.1| gibberellin 3-oxidase 2-3 [Triticum aestivum]
Length=369

 Score = 68.6 bits (166),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 58.5 bits (140),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV D+ QI +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRESDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>emb|CDM81908.1| unnamed protein product [Triticum aestivum]
Length=369

 Score = 68.2 bits (165),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 58.5 bits (140),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV D+ QI +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRESDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>gb|KDP21184.1| hypothetical protein JCGZ_21655 [Jatropha curcas]
Length=369

 Score = 72.4 bits (176),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  75   CFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF--LHFNSYPKCPYP  248
             F  T++ Y E+L G+A KI  L+ KALG+ E  VD+++      +  +  N YP CP P
Sbjct  170  SFRDTIEAYSEELQGVANKIFKLVIKALGIME--VDYIRELFEEGWQAMRMNYYPSCPQP  227

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQV  335
               +G+ PH+D++ +T+L+Q N I GLQ+
Sbjct  228  DLVIGLKPHSDATGLTILFQLNDIVGLQI  256


 Score = 54.3 bits (129),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 52/98 (53%), Gaps = 12/98 (12%)
 Frame = +2

Query  332  SLWAQ*K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKI  511
             LW     + VKPIP+A ++N+ DM++I +NG ++S++H A +     R+SI  F   K 
Sbjct  260  GLW-----IPVKPIPNAFIINIGDMLEIVTNGIYRSIEHRATISSNKERLSIATFHNPKF  314

Query  512  NLKISSPLKLVK-------DRDSMYPPYRGKSTRGLRG  604
            + ++ +   LV         R S+   ++G  +R L G
Sbjct  315  DAELVAASSLVTPQTPQAFKRMSVSDYFKGYLSRELDG  352



>gb|ADK71022.1| gibberellin 3-beta-hydroxylase [Trigonella spruneriana]
Length=301

 Score = 75.1 bits (183),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC         V  Y E +  LA K+  L+  +LG+ ++D+ W  SK+      SA 
Sbjct  132  YAKYC-------DIVLQYDETMKKLAGKLMLLMLDSLGISKEDIKWASSKAQFDENASAA  184

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  185  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  224


 Score = 51.6 bits (122),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H A+V +   R S+ + +G   N++I   +
Sbjct  232  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHV  291

Query  536  KLV  544
            KLV
Sbjct  292  KLV  294



>gb|ADK71010.1| gibberellin 3-beta-hydroxylase [Trigonella calliceras]
Length=299

 Score = 75.5 bits (184),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCP  242
            +   V  Y E +  LA K+  L+  +LG+ +DD+ W  SK+     + A +  NSYP CP
Sbjct  133  YCDIVLQYDEPMKKLAGKLMWLMLDSLGITKDDIKWASSKAQFEEKSCAAMQLNSYPSCP  192

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
             P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  193  DPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  222


 Score = 51.2 bits (121),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H A+V +   R S+ + +G   N++I    
Sbjct  230  VTVPPLXGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHA  289

Query  536  KLV  544
            KLV
Sbjct  290  KLV  292



>gb|KDP32294.1| hypothetical protein JCGZ_13219 [Jatropha curcas]
Length=350

 Score = 80.1 bits (196),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS-KSTSAFLHFNSYPKCPYPTQ  254
            F   ++ YQ+++  LA  +  LI + + + E++  WL S   +S  L  NSYP CP P +
Sbjct  157  FCDVMEDYQKKMEELATTLIHLILQNISMSEEETKWLGSPGGSSTALQLNSYPNCPDPHR  216

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
            A+G+ PHTD+SL+T+L+QS TISGLQ+F
Sbjct  217  AMGLAPHTDTSLLTILHQS-TISGLQIF  243


 Score = 46.2 bits (108),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 40/79 (51%), Gaps = 5/79 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P   ALVVN+ D++ I SNG+F SV H  I+ +   R S+ FF+  + +  +  PL L
Sbjct  252  VYPTNGALVVNIGDLLHILSNGRFISVLHRVIMKEPKQRFSVAFFYCPRTDFHV-FPLGL  310

Query  542  VK----DRDSMYPPYRGKS  586
                  D     P YR  S
Sbjct  311  SSGDEDDDHGQVPLYRSVS  329



>gb|AAC83647.1| gibberellin 3 beta-hydroxylase [Arabidopsis thaliana]
Length=347

 Score = 74.3 bits (181),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +3

Query  108  QLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPYPTQALGIVPH  275
             +  LA K+      +LG+ E D+ W    S    T A +  N YPKCP P +A+G+  H
Sbjct  166  HMQKLAAKLMWFALGSLGVEEKDIQWAGPNSDFQGTQAAIQLNHYPKCPEPDRAMGLAAH  225

Query  276  TDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            TDS+L+T+LYQ+NT +GLQVF  +   + + P P
Sbjct  226  TDSTLMTILYQNNT-AGLQVFRDDVGWVTAPPVP  258


 Score = 50.1 bits (118),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V   P+P +LVVNV D++ I +NG F SV H A V     R S+ + +G   ++ IS   
Sbjct  252  VTAPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDVMISPLP  311

Query  536  KLVKDRDS-MYP  568
            KLV    S +YP
Sbjct  312  KLVDPLQSPLYP  323


 Score = 21.9 bits (45),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  325  LTWKQYLATKATHFNQ  340



>ref|XP_003588693.1| Gibberellin 3-beta-dioxygenase [Medicago truncatula]
 gb|AES58944.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=359

 Score = 81.3 bits (199),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F  T+++YQ+Q+  LA K+T++I   LG+ ++   W+ S +    +  N YP CP P +A
Sbjct  169  FCDTMENYQKQMKTLAEKLTNMILNILGISQEQNKWIGSNNHVGAMQLNFYPCCPDPKKA  228

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            +G+ PHTD+SL T+L+QS T +GLQ+F      +   P P
Sbjct  229  MGLAPHTDTSLFTILHQSQT-NGLQLFKEGVGYVPVDPHP  267


 Score = 45.1 bits (105),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS  526
            V V P P+ LVVN  D++ I SN +F+   H  +V   S R S+ +F+G  ++  +S
Sbjct  261  VPVDPHPNTLVVNTGDILHILSNSRFRCSLHRVVVNDISDRYSVAYFYGPPVDYLVS  317



>ref|XP_006355575.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=358

 Score = 72.8 bits (177),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 4/103 (4%)
 Frame = +3

Query  72   VCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPT  251
            +    T++ Y E+   L+IK+  ++ KALG+ E++V  L  +   + +  N YP CP P 
Sbjct  166  LSLRETIEEYSEEAKELSIKVLKMLGKALGIDEEEVKSLFEEGMQS-MRMNYYPPCPQPE  224

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFPM  380
            + +G+ PH+D++ +T+L Q N I GLQ+    K+E+  S  P+
Sbjct  225  KVMGLAPHSDATGLTILLQVNDIQGLQI---KKDEIWISILPL  264


 Score = 53.5 bits (127),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + + P+P A +VNV D+ +IFSNG +KS++H ++V     RIS+  F   +++ ++    
Sbjct  259  ISILPLPRAFIVNVGDVFEIFSNGIYKSIEHRSVVSSEKERISVATFHNSRLDGELGPAN  318

Query  536  KLVKDRDSMYPP----------YRGKSTRGLRG  604
             L+   ++  PP          Y+G  TR L G
Sbjct  319  SLI---NAHNPPKFKKIEATEFYKGYLTRELVG  348



>ref|XP_003529820.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN01362.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=378

 Score = 72.4 bits (176),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 12/108 (11%)
 Frame = +3

Query  27   LYLLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS--  200
            L L  + Y  YC         V  Y+  +  LA K+  L+  +LG+ ++D  W   K   
Sbjct  151  LKLWPQDYAKYC-------DIVVEYEAAMKKLAAKLMCLMLASLGITKEDTKWAGPKGEF  203

Query  201  --TSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
                A LH NSYP CP P +A+G+  HTDS+L+T+L+Q+N ++GLQV 
Sbjct  204  NGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQNN-VNGLQVL  250


 Score = 53.5 bits (127),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LV+NV D++ I SNG + SV H   V +   R S+ + +G   N++IS  +
Sbjct  257  VAVPPLHGGLVINVGDLLHILSNGLYPSVLHRVRVNRTQQRFSVAYLYGPPANVQISPHV  316

Query  536  KLVK-DRDSMYPPYRGKSTRGLRGCI----LTSVR  625
            KLV   R ++Y P       G +  +    L++VR
Sbjct  317  KLVGPTRPALYRPVTWNEYLGTKANLFNKALSAVR  351



>sp|Q3I411.1|G3O21_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-1; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-1; AltName: Full=Gibberellin 
3-oxidase 2-1 [Triticum aestivum]
 gb|AAZ94377.1| gibberellin 3-oxidase 2-1 [Triticum aestivum]
Length=370

 Score = 68.2 bits (165),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEHKIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 57.8 bits (138),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV D+ QI +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>sp|Q3I410.1|G3O22_WHEAT RecName: Full=Gibberellin 3-beta-dioxygenase 2-2; AltName: Full=Gibberellin 
3 beta-hydroxylase 2-2; AltName: Full=Gibberellin 
3-oxidase 2-2 [Triticum aestivum]
 gb|AAZ94378.1| gibberellin 3-oxidase 2-2 [Triticum aestivum]
Length=370

 Score = 68.2 bits (165),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRALADKLLELFLVALGLTGEQVAAVESEQKIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 57.8 bits (138),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV D+ QI +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>ref|XP_004291424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score = 66.6 bits (161),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-TSAFLHFNSYPKCPYPTQ  254
            F   +D YQ+Q  GLA ++   IF  L +    V+W    +   A L  NS+P CP PT+
Sbjct  151  FCDIMDDYQKQARGLAEQLIRTIFIFLTI---KVNWFDDPTMCQAALQLNSFPPCPDPTR  207

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVF  338
             LG+ PHTDSSL+T+L+  +   GLQVF
Sbjct  208  VLGLPPHTDSSLLTILH--SRTEGLQVF  233


 Score = 58.9 bits (141),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+P P++L+VNV D++ I SNG+F SV H A V Q  HRIS+ +F+   ++  +S  L
Sbjct  239  ITVQPNPESLIVNVGDLLHILSNGRFVSVFHRAAVVQKKHRISVAYFYWSPLDCTVSPLL  298

Query  536  KLVKDRDSMYPPYRGKSTR  592
                      P YR  +++
Sbjct  299  SKNFADSKQVPKYRSVTSK  317



>ref|XP_010691237.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score = 72.0 bits (175),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV-DW--LKSKSTSAFLHFNSYPKCPYP  248
            F   ++ YQ+++  LA ++  LI  +LG+   D+  W  L  K  +  +  NSYP CP P
Sbjct  224  FCDIIEEYQKEMNHLAKRLMQLILGSLGISNQDIMKWADLLLKGANGAIQLNSYPVCPDP  283

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVF  338
             +A+G+  HTDS+L+T+L+QS+T +GLQVF
Sbjct  284  NRAMGLAAHTDSTLLTILHQSST-TGLQVF  312


 Score = 53.5 bits (127),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+   LV+N+ D++ I SNGQ+ SV H A+V +  HR+S+ + +G    ++I  PL
Sbjct  319  ITVPPLSGGLVINIGDLLHILSNGQYPSVYHRAMVNRVQHRLSVAYLYGPAPGVRI-QPL  377

Query  536  KLVKDRDSMYPPYRGKSTRGLRG  604
                    +Y P       G++G
Sbjct  378  PNTT-HPPIYRPVTWSEYLGIKG  399



>ref|XP_011026517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=341

 Score = 77.0 bits (188),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-TSAFLHFNSYPKCPYPTQ  254
            F   ++ YQ+++  LAI +  LI K+L L E+++  + S    S  L  NSYP CP P++
Sbjct  155  FCDVMEDYQKKMKELAITLMHLILKSLDLSEEEISKVVSPGCASTALQLNSYPFCPDPSR  214

Query  255  ALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
             +G+ PHTD+SL+T+L+QS TI+GL++F      ++ SP
Sbjct  215  VMGLAPHTDTSLLTILHQS-TINGLEIFKDGVGWVLVSP  252


 Score = 48.5 bits (114),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V P   +LVVNV D++ I SN QF S+ H  ++ +   R+S+ +F+    +  + SPL L
Sbjct  250  VSPTNGSLVVNVGDLLHILSNAQFPSILHRVVLKEKQQRLSLAYFYSPPTDFHV-SPLAL  308

Query  542  VKDRDSMYPPYRGKSTR  592
                 +  P YR  S R
Sbjct  309  ---NPAEIPLYRSVSVR  322



>gb|ADK71019.1| gibberellin 3-beta-hydroxylase [Trigonella kotschyi]
Length=297

 Score = 74.7 bits (182),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +3

Query  96   HYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPTQAL  260
             Y E +  LA K+  L+  +LG+ ++D+ W  SK+      SA +  NSYP CP P  A+
Sbjct  140  QYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDEKASAAMQLNSYPSCPDPDHAM  199

Query  261  GIVPHTDSSLITLLYQSNTISGLQV  335
            G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  200  GLAPHTDSTFLTILSQ-NDISGLQV  223


 Score = 50.8 bits (120),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H A+V +   R S+ + +G   N++I    
Sbjct  231  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHA  290

Query  536  KLV  544
            KLV
Sbjct  291  KLV  293



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 75.5 bits (184),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  167  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  226

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFG  341
             A+G+ PHTDS+ +T+L Q N ISGLQV G
Sbjct  227  HAMGLAPHTDSTFLTILSQ-NDISGLQVQG  255


 Score = 48.5 bits (114),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  261  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  320

Query  536  KLV  544
            KLV
Sbjct  321  KLV  323


 Score = 21.6 bits (44),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  334  VTWNEYLGTKAKHFNK  349



>ref|XP_003569638.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-2-like [Brachypodium 
distachyon]
Length=385

 Score = 69.3 bits (168),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 60/101 (59%), Gaps = 8/101 (8%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS-----KSTSAFLHFNSYP  233
            ++ F   ++ +  ++  LA K+  L  +ALGL  D+   +++     ++ +A  H N YP
Sbjct  161  YLLFCEVMEEFHREMRLLADKLLGLFLRALGLTADEALAVEATHRIAETMTATTHLNWYP  220

Query  234  KCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +CP P +ALG++PHTDS   T + QS  + GLQ+F  GP++
Sbjct  221  RCPDPKRALGLIPHTDSGYFTFVLQSQ-VPGLQLFRRGPDR  260


 Score = 56.2 bits (134),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A VVNV D+  I +NG+F SV H A+V + SHR+S+ +F G     ++  PL
Sbjct  262  VAVPAVPGAFVVNVGDLFSILTNGRFHSVFHRAVVNKESHRVSLGYFLGPPAQTRV-GPL  320

Query  536  K  538
            +
Sbjct  321  E  321



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score = 75.5 bits (184),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  167  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  226

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFG  341
             A+G+ PHTDS+ +T+L Q N ISGLQV G
Sbjct  227  HAMGLAPHTDSTFLTILSQ-NDISGLQVQG  255


 Score = 48.5 bits (114),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  261  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  320

Query  536  KLV  544
            KLV
Sbjct  321  KLV  323


 Score = 21.6 bits (44),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  334  VTWNEYLGTKAKHFNK  349



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score = 74.3 bits (181),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  +   V  Y+E +  LA K+  L+  +LG+ ++D+ W  SK+      A +  NSYP 
Sbjct  159  YAKYCDIVLQYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKACAAMQLNSYPS  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  219  CPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  250


 Score = 49.3 bits (116),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R SI + +G   N++I    
Sbjct  258  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSIAYLYGPPSNVEICPHT  317

Query  536  KLV  544
            KLV
Sbjct  318  KLV  320


 Score = 21.2 bits (43),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score = 76.6 bits (187),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  129  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  181

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            + FNSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  182  MQFNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.5 bits (114),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPSSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_008461419.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=378

 Score = 70.9 bits (172),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPY  245
            +   ++ +  +L  L  ++  L    LG+ ++DV W       +++S  ++ NSYP CP 
Sbjct  168  YCDIIEEFDRELKALCGRLVWLALGELGITKEDVHWAGPNGDFETSSGVMNLNSYPVCPD  227

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            P +A+GI  HTDS  +TLLYQ+NT SGLQV    K  +   P
Sbjct  228  PDRAMGIGVHTDSCFLTLLYQNNT-SGLQVLREGKRWVTVEP  268


 Score = 53.9 bits (128),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+  ALVV V D++QI +NG + S  H A+V +   R+S+ +FFG   N +IS   
Sbjct  264  VTVEPVTGALVVQVADLLQILTNGLYSSPFHQAVVNRDRKRLSVAYFFGPPENAEISPIK  323

Query  536  KLV  544
            KLV
Sbjct  324  KLV  326



>gb|ADK71001.1| gibberellin 3-beta-hydroxylase [Medicago suffruticosa]
Length=288

 Score = 75.5 bits (184),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCP  242
            +  TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP
Sbjct  126  YCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCP  185

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
             P  A+G+ PHTDS+L+T+L Q N ISGLQV
Sbjct  186  DPDHAMGLAPHTDSTLLTILSQ-NEISGLQV  215


 Score = 49.3 bits (116),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLHGGLVVNVGDLFHILSNGSYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK71014.1| gibberellin 3-beta-hydroxylase [Trigonella cretica]
Length=296

 Score = 75.9 bits (185),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  99   YQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPTQALG  263
            Y E +  LA K+  L+  +LG+ ++D+ W  SK+      SA L  NSYP CP P +A+G
Sbjct  137  YDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKASAVLQLNSYPSCPDPDRAMG  196

Query  264  IVPHTDSSLITLLYQSNTISGLQV  335
            + PHTDS+ +T+L Q N ISGLQV
Sbjct  197  LAPHTDSTFLTILSQ-NDISGLQV  219


 Score = 49.3 bits (116),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVN+ D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  227  VTVPPLHGGLVVNIGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEIGPHA  286

Query  536  KLV  544
            KLV
Sbjct  287  KLV  289



>ref|XP_006355748.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score = 63.5 bits (153),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +++YQ+++  L+ ++  LI   L   ++ +  + S   +  L  NSYP CP P  A
Sbjct  160  FCDVMENYQKKMKALSFQLWLLILNYLQPSQEHL--INSFEFTQALQLNSYPCCPNPNHA  217

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            LG+ PHTDS  +T+L+Q+N   GLQ+ 
Sbjct  218  LGLAPHTDSLFLTILHQTNNTKGLQIL  244


 Score = 61.2 bits (147),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG +++  I   +   K+  
Sbjct  259  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSTIVPLVSFEKNVG  318

Query  557  SMYPPYR  577
             + P YR
Sbjct  319  VVVPKYR  325



>ref|XP_007135716.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
 gb|ESW07710.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
Length=374

 Score = 75.9 bits (185),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 12/108 (11%)
 Frame = +3

Query  27   LYLLKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS--  200
            L L  + Y  YC         V  Y+  +  LA K+  L+  +LG+ ++D+ W   +   
Sbjct  152  LQLWPQEYAKYC-------EIVKEYEAAMKKLAAKLMCLVLASLGISKEDIKWAGPRGEF  204

Query  201  --TSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
                A LH NSYP CP P +A+G+  HTDS+L+T+L+Q+N +SGLQV 
Sbjct  205  NGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQNN-VSGLQVL  251


 Score = 48.5 bits (114),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 7/96 (7%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V + P+   LV+N+ D++ I SNG + SV H   V ++  R S+ + +G   N++IS   
Sbjct  258  VALPPLAGGLVINIGDLLHILSNGLYPSVLHRVRVNRSRQRFSVAYLYGPPTNVEISPNE  317

Query  536  KLVK-DRDSM-----YPPYRGKSTRGLRGCILTSVR  625
            KLV   R S+     +  Y GK  +      L++VR
Sbjct  318  KLVGPGRPSLFQSVTWNEYLGKKAKHFNKA-LSAVR  352



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score = 73.9 bits (180),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  130  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  182

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  183  MQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  222


 Score = 50.4 bits (119),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++IS   
Sbjct  230  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHE  289

Query  536  KLV  544
            KLV
Sbjct  290  KLV  292



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score = 74.3 bits (181),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  129  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  181

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  182  MQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 50.4 bits (119),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++IS   
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_006432906.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46146.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=356

 Score = 64.3 bits (155),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ Y  +L  L +KI  L+ KAL +  +D+  L      + L  N YP CP P Q 
Sbjct  165  FRDDLEVYLTELKNLTLKILDLMAKALRMDPNDMKELFENGMQS-LRMNYYPPCPQPEQV  223

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            LG  PH+D S++T+L Q N + GLQ+
Sbjct  224  LGFKPHSDGSVLTILLQINEMDGLQI  249


 Score = 60.1 bits (144),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            VKP+PDA +VNV D+++IFSNG ++S++H A V     R+S   F+  K++ ++   L L
Sbjct  258  VKPLPDAFIVNVGDVLEIFSNGTYRSIEHRATVNSMKERLSFGTFYSPKLDGELGPALSL  317

Query  542  V  544
            +
Sbjct  318  I  318



>gb|ADK71009.1| gibberellin 3-beta-hydroxylase [Trigonella bicolor]
Length=300

 Score = 75.5 bits (184),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC         V  Y E +  LA K+  L+  +LG+ ++D+ W  SK+      SA 
Sbjct  131  YAKYC-------DIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDENASAA  183

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            L  NSYP CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  184  LQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  223


 Score = 48.9 bits (115),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  231  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  290

Query  536  KLV  544
            KLV
Sbjct  291  KLV  293



>ref|XP_010670743.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score = 68.9 bits (167),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYP  248
            F  F   ++ YQ ++  L+ K+  L+ K+L +P   +  + +   +A L  NSYP CP P
Sbjct  161  FQGFCDVMEEYQTRMKDLSDKLMGLLLKSLNIPGPYMKEMDNDLCTA-LQLNSYPTCPNP  219

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQVF--GP  344
            T+ +G+  HTD+ L T+L+QS   SGLQVF  GP
Sbjct  220  TRTMGLAQHTDTFLFTILHQSANASGLQVFIDGP  253


 Score = 55.1 bits (131),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 8/82 (10%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P P ALVVNV D++ I SN +F S  H A+V  A+ R+S  +F+G  ++ +++  L
Sbjct  256  VSVDPHPGALVVNVGDLLHIISNARFPSAIHRAVVNNATQRLSFAYFYGPPLDFQVAPFL  315

Query  536  KLVKDRDSMYPPYRGKSTRGLR  601
                     YP   G + + L+
Sbjct  316  D--------YPGCEGPTFKSLK  329



>gb|AFN53718.1| putative flavonol synthase [Linum usitatissimum]
Length=234

 Score = 67.8 bits (164),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQALGI  266
            T++ Y E+L  LA++I S + KALG+   +++ + S    + +  N YP CP P +A+G 
Sbjct  38   TLETYSEELKRLALRILSYMSKALGMDVHEMEDMFSDGVQS-MRMNYYPPCPEPDKAIGF  96

Query  267  VPHTDSSLITLLYQSNTISGLQV  335
             PH+D+  +T+LYQ N   GLQ+
Sbjct  97   TPHSDADALTILYQLNDTEGLQI  119


 Score = 56.2 bits (134),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISS  529
            K V +KP+ +A VVN+ D+M+I SNG ++S++H A V   S R+S+  F+  K+N  +  
Sbjct  124  KWVPIKPLLNAFVVNIGDIMEIMSNGVYRSIEHRAAVNPTSERLSVATFYSCKLNCTLGP  183

Query  530  PLKLV  544
               LV
Sbjct  184  ATSLV  188



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score = 73.9 bits (180),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  167  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  226

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  227  HAMGLAPHTDSTFLTILSQ-NDISGLQV  253


 Score = 48.5 bits (114),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  261  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  320

Query  536  KLV  544
            KLV
Sbjct  321  KLV  323


 Score = 21.6 bits (44),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  334  VTWNEYLGTKAKHFNK  349



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score = 73.9 bits (180),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +3

Query  96   HYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST----SAFLHFNSYPKCPYPTQALG  263
             Y+E +  LA K+  L+  +LG+ ++D+ W  SK+      A +  NSYP CP P +A+G
Sbjct  168  QYEETMKKLAGKLMWLMLDSLGITKEDIKWAGSKAQFEKGCAAIQLNSYPSCPDPDRAMG  227

Query  264  IVPHTDSSLITLLYQSNTISGLQV  335
            + PHTDS+ +T+L Q N ISGLQV
Sbjct  228  LAPHTDSTFLTILSQ-NDISGLQV  250


 Score = 48.9 bits (115),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  258  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHT  317

Query  536  KLV  544
            KLV
Sbjct  318  KLV  320


 Score = 21.2 bits (43),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>ref|XP_004292966.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 80.9 bits (198),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWL----KSKSTSAFLHFNSYPKCPY  245
            F  T+D YQ+Q+  LA ++  ++FKAL +  ++++WL     S   S  L  NSYP CP 
Sbjct  151  FCDTIDDYQKQMKALAEQLMRILFKALSISVEELNWLDDPTNSSGCSLSLQLNSYPPCPE  210

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P++ LG+ PHTD+S++T+L Q+ T SGLQVF
Sbjct  211  PSRTLGLAPHTDTSIVTIL-QAKT-SGLQVF  239


 Score = 42.7 bits (99),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +2

Query  374  PDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKD  550
            PDAL VN+ D  +I SNGQF SV H  +V +   R S+ +FF    +  ++SPL L KD
Sbjct  252  PDALFVNLGDFSRILSNGQFISVLH-RVVVKPIQRYSMAYFFRPPTDF-VASPL-LSKD  307


 Score = 20.4 bits (41),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 15/32 (47%), Gaps = 0/32 (0%)
 Frame = +1

Query  523  FISTQIGQGP*FHVSPISWKEYQRIKGVHFDK  618
             +S  +G G       ++ KEY  +KG H + 
Sbjct  303  LLSKDLGPGEVPRYRSVTVKEYLDLKGKHLEN  334



>gb|ADK70954.1| gibberellin 3-beta-hydroxylase [Medicago arabica]
Length=297

 Score = 74.3 bits (181),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  134  TVLQYDEAMKKLAGKLMWLMLDSLGISMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  193

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+L+T+L Q N ISGLQV
Sbjct  194  HAMGLAPHTDSTLLTILSQ-NDISGLQV  220


 Score = 49.3 bits (116),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG F SV H  +V +   R S+ + +G   N++I    
Sbjct  228  VTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  287

Query  536  KLV  544
            KLV
Sbjct  288  KLV  290



>gb|ADK70993.1| gibberellin 3-beta-hydroxylase [Medicago sativa]
Length=298

 Score = 75.5 bits (184),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPF  374
             A+G+ PHTDS+ +T+L Q N ISGLQV G     +   P 
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSGWVTVPPL  234


 Score = 48.5 bits (114),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>gb|ADK70992.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=292

 Score = 73.6 bits (179),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  128  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  180

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  181  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  220


 Score = 50.4 bits (119),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++IS   
Sbjct  228  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHE  287

Query  536  KLV  544
            KLV
Sbjct  288  KLV  290



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score = 75.1 bits (183),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+      +A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+L+T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTLLTILSQ-NDISGLQV  221


 Score = 48.9 bits (115),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_004233005.2| PREDICTED: codeine O-demethylase-like [Solanum lycopersicum]
Length=361

 Score = 62.4 bits (150),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
               T++ + ++   LAI+I   + K LG+ E ++  L S      +  N YP CP P + 
Sbjct  165  LRETMEEHSKEFKNLAIRILCQLAKVLGMDEKEMRDL-SNDGMQLIRMNYYPPCPEPEKT  223

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +GI PH+D+  +T+L Q N   GLQV
Sbjct  224  IGISPHSDADALTILLQLNETEGLQV  249


 Score = 61.2 bits (147),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = +2

Query  332  SLWAQ*K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKI  511
            S+W     V VKP+PDAL+VNV DMM+I SNG ++S++H A+V     R+S+  F+   +
Sbjct  253  SVW-----VPVKPLPDALIVNVGDMMEILSNGVYRSIEHRAVVNSKEERLSLATFYLFNL  307

Query  512  NLKISSPLKLVKDRDSMYPPYRGK  583
            + ++     L+   +   PP  G+
Sbjct  308  DSELGPAHSLIGPNN---PPIFGR  328



>gb|EPS71653.1| gibberellin 3-oxidase, partial [Genlisea aurea]
Length=322

 Score = 69.3 bits (168),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F  T++ Y+  +  LA ++  L+   +G+   +  W       + L  N YP CP P +A
Sbjct  137  FCETIEKYERAMKNLAGELMRLMLGGMGV-RREAKWGSGSEPGSALQLNCYPPCPDPDRA  195

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            +G+  HTDS+L+T+L+QS    GLQV 
Sbjct  196  MGLAAHTDSTLLTILHQSGGACGLQVL  222


 Score = 48.5 bits (114),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V + PIP ALVV+V D+M I SNG + SV H A+V +   R+S+ + +G   N+KI    
Sbjct  228  VTMPPIPGALVVHVGDLMHILSNGLYPSVLHRAVVNRNRRRVSVAYLYGPPANVKIGPLD  287

Query  536  KLVKDR  553
            +L+ +R
Sbjct  288  ELIDER  293


 Score = 25.8 bits (55),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            +SWKEY   K  HFDK
Sbjct  301  VSWKEYLGTKAQHFDK  316



>gb|KDP22220.1| hypothetical protein JCGZ_26051 [Jatropha curcas]
Length=363

 Score = 71.6 bits (174),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +3

Query  75   CFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF--LHFNSYPKCPYP  248
             F   ++ Y E+L GLA KI +L+ KALG+ E  VD++       +  +  N YP CP P
Sbjct  164  SFRDAIEAYSEELQGLANKIFNLVIKALGILE--VDYITESFEKGWQAMRMNYYPPCPQP  221

Query  249  TQALGIVPHTDSSLITLLYQSNTISGLQV  335
               +G+ PH+D+S +T+L+Q N + GLQ+
Sbjct  222  ELVMGVNPHSDASGLTILFQLNDVVGLQI  250


 Score = 52.0 bits (123),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 7/101 (7%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + VKPIP+A ++N+ DM++I +NG + S++H A +  +  R+SI  F   K +  + +  
Sbjct  257  IPVKPIPNAFIINIGDMLEILTNGIYPSIEHRATINSSKERLSIATFHNPKFDGDLVAAS  316

Query  536  KLVK-------DRDSMYPPYRGKSTRGLRGCILTSVRGDPN  637
             L+         R S+    +G  TR L G     +   PN
Sbjct  317  SLITPKTPQVFKRTSVSDYLKGYLTRQLDGKSFIELLRIPN  357



>sp|O24648.1|G3OX_PEA RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; AltName: Full=Gibberellin 3 beta-hydroxylase 
1 [Pisum sativum]
 gb|AAB65829.1| 2-oxoglutarate-dependent dioxygenase [Pisum sativum]
 gb|AAC49792.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 73.9 bits (180),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  F   V  Y E +  LA  +  L+  +LG+ ++D+ W  SK+      A L  NSYP 
Sbjct  159  YTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPS  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  219  CPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  250


 Score = 48.1 bits (113),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  258  ITVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  317

Query  536  KLV  544
            KL+
Sbjct  318  KLI  320


 Score = 21.6 bits (44),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>ref|XP_009772021.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=358

 Score = 68.6 bits (166),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F  T++ Y E++  LA+K+  L+ KALG+  ++V+ L  K   + +  N YP CP P   
Sbjct  163  FRETIEAYSEEVKELAMKVLDLLGKALGIEAEEVNNLFGKGMQS-VRMNYYPPCPQPELV  221

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+D+  + +L Q N   GLQ+
Sbjct  222  MGLCPHSDACALAILLQVNETDGLQI  247


 Score = 55.1 bits (131),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 13/93 (14%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+P+A +VNV D ++IFSNG ++S++H ++V     RISI  F   K++ ++  P 
Sbjct  254  IPVLPLPNAFIVNVGDSLEIFSNGIYRSIEHRSVVSAVKERISIATFHSPKLDGEL-GPA  312

Query  536  KLVKDRDSMYPP----------YRGKSTRGLRG  604
            K +   DS  PP          +RG  TR L G
Sbjct  313  KSLITADS--PPIFKTINVHEYFRGFFTRKLDG  343



>emb|CAC83089.1| gibberellin 3-oxidase [Cucurbita maxima]
Length=377

 Score = 75.1 bits (183),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 5/98 (5%)
 Frame = +3

Query  90   VDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKS----KSTSAFLHFNSYPKCPYPTQA  257
            V+ Y  ++  L  ++  L    LG+  DD+ W       K++ A   FNSYP CP P +A
Sbjct  171  VEEYDREMRSLCGRLMWLGLGELGITRDDMKWAGPDGDFKTSPAATQFNSYPVCPDPDRA  230

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSP  371
            +G+ PHTD+SL+T++YQSNT  GLQV    K  +   P
Sbjct  231  MGLGPHTDTSLLTIVYQSNT-RGLQVLREGKRWVTVEP  267


 Score = 48.5 bits (114),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 9/97 (9%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+   LVV V D++ I +NG + S  H A+V +   R+S+ + FG   + +I SPL
Sbjct  263  VTVEPVAGGLVVQVGDLLHILTNGLYPSALHQAVVNRTRKRLSVAYVFGPPESAEI-SPL  321

Query  536  K--LVKDRDSMYPP-----YRGKSTRGLRGCILTSVR  625
            K  L   +  +Y P     Y GK         L++VR
Sbjct  322  KKLLGPTQPPLYRPVTWTEYLGKKAEHFNNA-LSTVR  357



>ref|XP_004229097.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=348

 Score = 64.7 bits (156),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  377  DALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKDRD  556
            DAL+VNV D++ I SNG+F SV H  +V Q  HR+S+ +FFG ++   I SPL   +D D
Sbjct  259  DALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVE-SIISPLVSSQDND  317

Query  557  SMYPPYRGKSTRGLRG  604
             +   YR  + +   G
Sbjct  318  GVVLKYRNVTVKEYLG  333


 Score = 58.9 bits (141),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +++YQ ++  L+ ++   I   L    +    + S      L  NSYP CP P  A
Sbjct  160  FCDVMENYQTKMKVLSFQLCMFILNYLQPSHEHS--INSFEFEGALQLNSYPCCPNPYHA  217

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVF  338
            LG+ PHTDS  +T+L+Q+N   GLQ+ 
Sbjct  218  LGLAPHTDSLFLTILHQTNNTKGLQIL  244



>gb|KCW74243.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=282

 Score = 64.7 bits (156),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +D Y  +L  LA+KI  LI KAL +   ++  L  +     +  N YP CP P  A
Sbjct  84   FRDVLDKYSTELQDLAMKILLLIAKALKMDTKEMIELFDEGLQ-MMRMNYYPPCPRPELA  142

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+D++ +T+L Q N + GLQV
Sbjct  143  IGLTPHSDAAGVTILLQVNEVEGLQV  168


 Score = 58.5 bits (140),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS-  526
            K V +KP+P+A VVNV D+++I +NG ++S++H A V   + R+S+  F+  K+  ++  
Sbjct  173  KWVPIKPLPNAFVVNVGDILEIVTNGNYRSIEHRATVNSTNERLSVATFYSPKLEGEMGP  232

Query  527  SPLKLVKDRDSMYPP------YRGKSTRGLRGC----ILTSVRGDPN  637
            +P  +  D+ +++        ++G  +R L+G     I+ +++G+ N
Sbjct  233  TPSLITPDKPALFRTIGVADYFKGFYSRELQGKSYLDIMRTIQGEEN  279



>gb|AAC86820.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
 gb|AAC49793.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 73.9 bits (180),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  F   V  Y E +  LA  +  L+  +LG+ ++D+ W  SK+      A L  NSYP 
Sbjct  159  YTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPS  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  219  CPDPDHAMGLTPHTDSTFLTILSQ-NDISGLQV  250


 Score = 47.8 bits (112),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  258  ITVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  317

Query  536  KLV  544
            KL+
Sbjct  318  KLI  320


 Score = 21.6 bits (44),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>gb|KGN62899.1| hypothetical protein Csa_2G379300 [Cucumis sativus]
Length=372

 Score = 72.8 bits (177),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK------STSAFLHFNSYPKC  239
            F   ++ YQ ++  LA +IT  IF  L +  D  +WL S       + S  L  N YP+C
Sbjct  183  FCDVMEEYQRKMKSLAEQITRSIFNYLKI-SDGANWLHSAGSTEAAACSTALQLNCYPRC  241

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P PT+ +G+ PHTD+ L+T+L+Q+ T  GLQVF      +  +P P
Sbjct  242  PDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDGFGWVPVAPVP  286


 Score = 50.4 bits (119),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V P+P ALV+NV D+  I SNG+F +V H  +V     R+S+ +F+G
Sbjct  280  VPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYG  328



>ref|XP_010429978.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Camelina sativa]
Length=358

 Score = 71.2 bits (173),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = +3

Query  105  EQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPYPTQALGIVP  272
              +  LA K+  L   +LG+ E+D++W    S    T A +  N YP CP P +++G+  
Sbjct  168  RHMQKLAAKLMWLALGSLGVEENDINWAGPNSDFQGTQAAIQLNHYPICPEPDRSMGLAA  227

Query  273  HTDSSLITLLYQSNTISGLQVF  338
            HTDS+L+T+LYQ+NT +GLQVF
Sbjct  228  HTDSTLLTILYQNNT-AGLQVF  248


 Score = 49.7 bits (117),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V  +PD+LVVNV D++ I +NG F SV H A V     R S+ + +G   +L IS   +L
Sbjct  257  VPTVPDSLVVNVGDLLHILTNGIFPSVLHRARVNHIRSRFSMAYLWGPPSDLMISPLSRL  316

Query  542  VKDRDS-MYPPYRGK  583
            V    S +YP    K
Sbjct  317  VDPLQSPLYPSLTWK  331


 Score = 22.3 bits (46),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++WK+Y   K  HF++
Sbjct  328  LTWKQYLATKATHFNQ  343



>gb|ADK70983.1| gibberellin 3-beta-hydroxylase [Medicago papillosa]
Length=298

 Score = 73.9 bits (180),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 49.3 bits (116),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V+V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VNVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_003546239.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHM98787.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=353

 Score = 74.3 bits (181),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  90   VDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPKCPYPTQA  257
            V  Y E +  L  K+  L+  +LG+ ++D+ W  SK     T A L  NSYP CP P +A
Sbjct  162  VMQYDEAMKKLVGKLMLLMLDSLGITKEDLKWAGSKGQFEKTCAALQLNSYPTCPDPDRA  221

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+  HTDS+L+T+LYQ+N ISGLQV
Sbjct  222  MGLAAHTDSTLLTILYQNN-ISGLQV  246


 Score = 47.4 bits (111),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LV+NV D++ I SNG + SV H  +V +   R+S+ +  G   N++I    
Sbjct  254  VTVPPLSGGLVINVGDLLHILSNGLYPSVLHRVLVNRIQRRLSVAYLCGPPPNVEICPHA  313

Query  536  KLV  544
            KLV
Sbjct  314  KLV  316


 Score = 21.6 bits (44),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  327  VTWNEYLGTKAKHFNK  342



>gb|ADK70975.1| gibberellin 3-beta-hydroxylase [Medicago marina]
Length=275

 Score = 76.3 bits (186),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SKS     T A +  NSYP CP P 
Sbjct  124  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKSQFDEKTCAAMQLNSYPSCPDPD  183

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPF  374
             A+G+ PHTDS+ +T+L Q N ISGLQV       +  SP 
Sbjct  184  HAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVSPL  223


 Score = 47.0 bits (110),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKI  523
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I
Sbjct  218  VTVSPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTHQRFSVAYLYGPPSNVEI  273



>ref|NP_001274405.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28483.1| GA 3-oxidase [Cucumis sativus]
Length=353

 Score = 72.4 bits (176),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK------STSAFLHFNSYPKC  239
            F   ++ YQ ++  LA +IT  IF  L +  D  +WL S       + S  L  N YP+C
Sbjct  164  FCDVMEEYQRKMKSLAEQITRSIFNYLKI-SDGANWLHSAGSTEAAACSTALQLNCYPRC  222

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVFGPNKNELMSSPFP  377
            P PT+ +G+ PHTD+ L+T+L+Q+ T  GLQVF      +  +P P
Sbjct  223  PDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDGFGWVPVAPVP  267


 Score = 50.8 bits (120),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V P+P ALV+NV D+  I SNG+F +V H  +V     R+S+ +F+G
Sbjct  261  VPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYG  309



>emb|CBL59327.1| Gibberellin 3-oxidase [Cucurbita maxima]
Length=350

 Score = 75.1 bits (183),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDD--VDWLKSKS----TSAFLHFNSYPKC  239
            F   ++ YQ+ +  LA KIT LI   L +P+D    +WL S       S  L  N YP+C
Sbjct  160  FCDVMEEYQKNMKSLAEKITHLILNFLKIPDDAEISNWLHSAGAAAACSTALQLNCYPRC  219

Query  240  PYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P PT+ +G+ PHTD+ L+T+L+QS+T  GLQ+F
Sbjct  220  PDPTRVMGLAPHTDTFLLTILHQSST-CGLQIF  251


 Score = 48.1 bits (113),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            + V P+  ALV+NV D+  I SNG+F +V H  +V     R+S+ +FFG
Sbjct  258  IPVTPVAGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFFG  306



>gb|ADE18861.1| putative 2-oxoglutarate dependent dioxygenase [Avena sativa]
Length=372

 Score = 63.2 bits (152),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAFLHFNSYP  233
            +  F   ++ +  ++  L+ ++  L   ALGL  +    ++++     + +A +H N YP
Sbjct  155  YRLFCDVMEEFHGEMRALSDRLMELFLAALGLTGEQAAAVEAEHRIAETMTATMHLNWYP  214

Query  234  KCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            KCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  215  KCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  254


 Score = 60.1 bits (144),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +2

Query  371  IPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKLVKD  550
            + DA VVNV D+ QI +NG+F SV H A+V + S RIS+ +F G   + K+ +PL+    
Sbjct  262  VQDAFVVNVGDLFQILTNGRFHSVYHRAVVNRDSDRISLGYFHGPPADTKV-APLREAVG  320

Query  551  RDSMYPPYR  577
            R    P YR
Sbjct  321  RTGGKPAYR  329



>ref|XP_010057202.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Eucalyptus grandis]
 gb|KCW74241.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=372

 Score = 64.7 bits (156),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +D Y  +L  LA+KI  LI KAL +   ++  L  +     +  N YP CP P  A
Sbjct  174  FRDVLDKYSTELQDLAMKILLLIAKALKMDTKEMIELFDEGLQ-MMRMNYYPPCPRPELA  232

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
            +G+ PH+D++ +T+L Q N + GLQV    K
Sbjct  233  IGLTPHSDAAGVTILLQVNEVEGLQVRKEGK  263


 Score = 58.5 bits (140),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 64/107 (60%), Gaps = 11/107 (10%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS-  526
            K V +KP+P+A VVNV D+++I +NG ++S++H A V   + R+S+  F+  K+  ++  
Sbjct  263  KWVPIKPLPNAFVVNVGDILEIVTNGNYRSIEHRATVNSTNERLSVATFYSPKLEGEMGP  322

Query  527  SPLKLVKDRDSMYPP------YRGKSTRGLRGC----ILTSVRGDPN  637
            +P  +  D+ +++        ++G  +R L+G     I+ +++G+ N
Sbjct  323  TPSLITPDKPALFRTIGVADYFKGFYSRELQGKSYLDIMRTIQGEEN  369



>ref|XP_010057209.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74253.1| hypothetical protein EUGRSUZ_E02897 [Eucalyptus grandis]
Length=371

 Score = 63.2 bits (152),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +D Y  +L  LA+KI  L+ KAL +   ++  L  +   + +  N YP CP P   
Sbjct  169  FRDVLDEYSSKLRDLAMKILLLMAKALKMDTKEMMELFDEGRQS-IRMNYYPPCPRPDLV  227

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+DS+ +T+L Q N + GLQV
Sbjct  228  IGLTPHSDSAGLTILLQVNEVEGLQV  253


 Score = 60.1 bits (144),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +2

Query  344  Q*K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKI  523
            Q K V VKP+P+A VVNV D+++I +NG ++S++H AIV     R+SI  F+  K+  +I
Sbjct  256  QGKWVLVKPLPEAFVVNVGDILEIVTNGTYRSIEHRAIVNSTKERLSIATFYSPKLEEEI  315

Query  524  S-SPLKLVKDRDSMYPPYRGKSTRGLRGCILTSVRG  628
              +P  +  D+ +++   R      LRG     + G
Sbjct  316  GPAPSLITPDKPALF--RRIGVANYLRGLFSRELEG  349



>ref|XP_009396646.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score = 70.1 bits (170),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKST----SAFLHFNSYPKCPY  245
            F   +  Y +++  +A ++  L+  ++GL  +++   +  +     SA L  NSYP CP 
Sbjct  156  FCDVMQEYSDEMKQVAGRVVRLMLLSMGLTPEEMKRAEEGTRVDQLSAVLQLNSYPPCPD  215

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVFGPN  347
            P +A+G+  HTDSSL+TLL+QS T SGLQ+  P 
Sbjct  216  PNRAMGLAAHTDSSLVTLLFQSGT-SGLQLLRPQ  248


 Score = 53.1 bits (126),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS  526
            V V P P AL+V   D++QI +NG++KSV H A+V +  HR+S+ +  G   + K+S
Sbjct  257  VTVPPRPGALIVLAGDLLQILTNGRYKSVAHRAVVNRNHHRVSVAYICGPPPHHKLS  313


 Score = 20.0 bits (40),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            +SW +Y  +K   FDK
Sbjct  330  VSWADYLGLKAELFDK  345



>gb|ABV64512.1| gibberellin 3-beta-hydroxylase [Dasypyrum villosum]
Length=368

 Score = 67.8 bits (164),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRALADKLLELFLVALGLTVEQVAAVESEQQIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 55.5 bits (132),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV  + QI +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGGLFQILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>ref|XP_010112080.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC32577.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=404

 Score = 63.2 bits (152),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 56/107 (52%), Gaps = 21/107 (20%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDD----VDWLK-----------------S  194
            F   ++ YQ+Q+  LA K+   I K+L +   +    ++WL                  S
Sbjct  159  FCEVMETYQKQMKTLAEKLLPTILKSLNIHNQEQQVLLNWLSTNTSSSSTSKSKENTITS  218

Query  195  KSTSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
             +    L  NSYP CP P +A+G+ PHTD+ L+T+L+Q+ T +GLQ+
Sbjct  219  TTPCTALQLNSYPSCPDPNRAMGLAPHTDTFLLTILHQTQTDAGLQI  265


 Score = 59.7 bits (143),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V+P+  ALVVNV D++ I SNG+F SV H A+V Q   R+S  +F+G   +  +S   
Sbjct  282  VPVRPVAGALVVNVGDLLHIMSNGRFPSVVHRAVVNQTRQRLSFAYFYGPPTDFTVS---  338

Query  536  KLVKDRDSM  562
             L+ D ++M
Sbjct  339  PLLSDHNNM  347



>gb|ADK70986.1| gibberellin 3-beta-hydroxylase [Medicago polyceratia]
Length=291

 Score = 74.3 bits (181),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+ ++LG+  +D+ W  SK+      +A +  NSYP CP P 
Sbjct  129  TVLQYDEAMKKLAGKLMWLMLESLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPD  188

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  189  HAMGLAPHTDSTFLTILSQ-NDISGLQV  215


 Score = 48.5 bits (114),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score = 73.9 bits (180),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.9 bits (115),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHX  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_002519764.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF42737.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=213

 Score = 67.0 bits (162),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query  54   HYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYP  233
            + C P       ++ Y E+L  LA KI  L+ KA+G+  D++  L  +   A +  N YP
Sbjct  10   YICSPLYHPEDAIETYSEELKSLAHKIFDLVAKAVGMKPDEMKELFEEGWQA-MRMNCYP  68

Query  234  KCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
             CP P   +G+ PH+D++ +T+L Q N + GLQ+
Sbjct  69   PCPQPDLVIGLKPHSDATGLTILLQVNDVVGLQI  102


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 51/90 (57%), Gaps = 7/90 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V+PIP+A ++N+ DM++I +NG ++S++H A +  A  R+SI  F+  K +  ++   
Sbjct  109  IPVQPIPNAFIINIGDMLEILTNGIYRSIEHRATISSAKERLSIATFYNPKFDGYLAPAP  168

Query  536  KLVK-------DRDSMYPPYRGKSTRGLRG  604
             L+        +R S    ++G  +R L G
Sbjct  169  SLITAKTPAAFERISFADYFQGYVSRELDG  198



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score = 74.3 bits (181),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  130  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  182

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  183  MQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  222


 Score = 48.5 bits (114),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   ++S+ + +G   N++I    
Sbjct  230  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRGLVNRTRQKVSVAYLYGPPSNVEICPHE  289

Query  536  KLV  544
            KLV
Sbjct  290  KLV  292



>ref|XP_009385827.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score = 73.9 bits (180),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 10/98 (10%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDW--LKSKSTSAFLHF  221
            Y  YCC        ++ Y   +  L+ ++   +  +LGL E+D+DW  L SK+    L  
Sbjct  142  YEEYCC-------VMEEYNRLIKALSGRLLRSMMLSLGLHEEDMDWAGLLSKA-DPVLQL  193

Query  222  NSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            N YP CP P +A+GI  HTDSS IT+LYQS+  SGLQ+
Sbjct  194  NYYPACPEPDRAIGIAHHTDSSFITILYQSSGESGLQL  231


 Score = 48.9 bits (115),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 41/77 (53%), Gaps = 2/77 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P   ALVVNV D+ +I  NG+ +SV H AIV +   R+S+ +F G      ++   
Sbjct  244  VTVPPRRGALVVNVGDLCEIVFNGRIRSVMHRAIVNRTQTRVSVAYFCGPPRQFNVAPIG  303

Query  536  KLVKDRDSMYPPYRGKS  586
            KLV   +   P YR  S
Sbjct  304  KLVGPNER--PAYRAMS  318



>gb|AAC96017.1| defective gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96015.1| gibberellin 3B-hydroxylase [Pisum sativum]
Length=374

 Score = 73.9 bits (180),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  F   V  Y E +  LA  +  L+  +LG+ ++D+ W  SK+      A L  NSYP 
Sbjct  159  YTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPS  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  219  CPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  250


 Score = 47.0 bits (110),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  258  ITVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  317

Query  536  KLV  544
            KL+
Sbjct  318  KLI  320


 Score = 21.6 bits (44),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>gb|ADK70962.1| gibberellin 3-beta-hydroxylase [Medicago daghestanica]
Length=290

 Score = 73.2 bits (178),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  131  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  190

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  191  HAMGLAPHTDSTFLTILSQ-NDISGLQV  217


 Score = 49.3 bits (116),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG F SV H  +V +   R S+ + +G   N++I    
Sbjct  225  VTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  284

Query  536  KLV  544
            KLV
Sbjct  285  KLV  287



>gb|AHW42464.1| GA3ox2 [Pinus tabuliformis]
Length=348

 Score = 75.5 bits (184),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F  T+D Y   +  LA K+ SLI ++LGL + D  W       A L  N YP CP P Q 
Sbjct  162  FCETIDEYDHAMKDLASKLMSLILESLGLRQRDYSW--GGDNCAALQMNHYPSCPRPAQT  219

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+  HTDS+ +T+LYQ  ++ GLQ+
Sbjct  220  MGMAEHTDSTFLTVLYQG-SVQGLQI  244


 Score = 45.4 bits (106),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 4/69 (6%)
 Frame = +2

Query  362  VKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPLKL  541
            V  IP+A VVN  D++Q+ SNG++KSV H A V     R+S  + +G  +   I    +L
Sbjct  254  VPAIPNAFVVNAGDLLQVLSNGRYKSVVHRA-VNSIKPRLSFAYLWGPPLTAVIEPAPQL  312

Query  542  VKDRDSMYP  568
            V   DS +P
Sbjct  313  V---DSKHP  318


 Score = 21.9 bits (45),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 6/16 (38%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY  ++  HFD+
Sbjct  324  LNWNEYLVVRAKHFDR  339



>gb|ADK70974.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=275

 Score = 74.3 bits (181),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  113  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  165

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q+N ISGLQV
Sbjct  166  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQNN-ISGLQV  205


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  213  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  272

Query  536  KLV  544
            KLV
Sbjct  273  KLV  275



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score = 73.2 bits (178),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 49.7 bits (117),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG F SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>gb|AAC49794.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score = 73.9 bits (180),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS----TSAFLHFNSYPK  236
            +  F   V  Y E +  LA  +  L+  +LG+ ++D+ W  SK+      A L  NSYP 
Sbjct  159  YTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKWAGSKAQFEKACAALQLNSYPS  218

Query  237  CPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  219  CPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  250


 Score = 47.0 bits (110),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  258  ITVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  317

Query  536  KLV  544
            KL+
Sbjct  318  KLI  320


 Score = 21.6 bits (44),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 7/16 (44%), Positives = 10/16 (63%), Gaps = 0/16 (0%)
 Frame = +1

Query  571  ISWKEYQRIKGVHFDK  618
            ++W EY   K  HF+K
Sbjct  331  VTWNEYLGTKAKHFNK  346



>gb|ADK70995.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=298

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>gb|ADK71011.1| gibberellin 3-beta-hydroxylase [Trigonella caerulea]
Length=294

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC         V  Y E +  LA K+  L+  +LG+ ++D+ W  SK+       A 
Sbjct  125  YAKYC-------DIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVENACAA  177

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            L  NSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  178  LQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQV  217


 Score = 48.9 bits (115),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  225  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGAPSNVEICPHE  284

Query  536  KLV  544
            KLV
Sbjct  285  KLV  287



>gb|AGH39958.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=293

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  124  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  176

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q+N ISGLQV
Sbjct  177  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQNN-ISGLQV  216


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  224  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  283

Query  536  KLV  544
            KLV
Sbjct  284  KLV  286



>gb|ADK70966.1| gibberellin 3-beta-hydroxylase [Medicago hybrida]
 gb|ADK70996.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=295

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  134  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  193

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  194  HAMGLAPHTDSTFLTILSQ-NDISGLQV  220


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  228  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  287

Query  536  KLV  544
            KLV
Sbjct  288  KLV  290



>gb|ADK70997.1| gibberellin 3-beta-hydroxylase [Medicago saxatilis]
Length=293

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>gb|ADK70973.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=292

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  123  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  175

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q+N ISGLQV
Sbjct  176  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQNN-ISGLQV  215


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK70994.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=295

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D++W  SK+       A +  NSYP CP P 
Sbjct  134  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQLNSYPSCPDPD  193

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  194  HAMGLAPHTDSTFLTILSQ-NDISGLQV  220


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  228  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  287

Query  536  KLV  544
            KLV
Sbjct  288  KLV  290



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score = 73.9 bits (180),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  118  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAA  170

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  171  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  210


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  218  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  277

Query  536  KLV  544
            KLV
Sbjct  278  KLV  280



>ref|XP_004968405.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-2-like [Setaria italica]
Length=382

 Score = 68.9 bits (167),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAFLHFNSYPKCP  242
            F   ++ + +++  LA ++  L  +ALGL  + V  ++++     + +A +H N YP+CP
Sbjct  160  FCDVMEEFHKEMRALADRLLELFLRALGLTGEQVGAVEAERRIGETMTATMHLNWYPRCP  219

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
             P +ALG++ HTDS   T + QS  + GLQ+F  GPN+
Sbjct  220  DPRRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPNR  256


 Score = 53.5 bits (127),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 47/90 (52%), Gaps = 7/90 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A VVNV D+  I +NG+F SV H A+V +   RIS+ +F G   + K+ +PL
Sbjct  258  VAVPAVPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDLDRISLGYFLGPPPHAKV-APL  316

Query  536  KLVKDRDSMYPPYRGKSTRGLRGCILTSVR  625
            + V       PP R  + R +       VR
Sbjct  317  REV------VPPGRAPAYRAVTWPEYMGVR  340



>gb|AAT49061.1| GA 3-oxidase 2 [Hordeum vulgare subsp. vulgare]
 dbj|BAD51997.1| gibberellin 3beta-hydroxylase [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 66.6 bits (161),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----STSAF  212
            Y H+C         ++ +  ++  LA K+  L   ALGL  + V  ++S+     + +A 
Sbjct  156  YRHFCA-------VMEEFHREMRVLADKLLELFLVALGLTGEQVAAVESEHKIAETMTAT  208

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
            +H N YPKCP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  209  MHLNWYPKCPDPKRALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  255


 Score = 55.8 bits (133),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V  +P A+VVNV D+  I +NG+F SV H A+V + S RIS+ +F G   ++K+ +PL
Sbjct  257  VTVPAVPGAMVVNVGDLFHILTNGRFHSVYHRAVVNRDSDRISLGYFLGPPAHVKV-APL  315

Query  536  K  538
            +
Sbjct  316  R  316



>gb|ADK70963.1| gibberellin 3-beta-hydroxylase [Medicago fischeriana]
Length=281

 Score = 73.6 bits (179),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+      +A +  NSYP CP P 
Sbjct  122  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPD  181

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  182  HAMGLAPHTDSTFLTILSQ-NDISGLQV  208


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  216  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  275

Query  536  KLV  544
            KLV
Sbjct  276  KLV  278



>ref|XP_011095018.1| PREDICTED: leucoanthocyanidin dioxygenase [Sesamum indicum]
Length=359

 Score = 65.1 bits (157),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISS  529
            K + V P+P+A +VN+ D +++ SNG +KSV+H  IV     R+SI  F+  + ++ I  
Sbjct  257  KWITVDPVPNAFIVNIGDQLEVLSNGNYKSVEHRVIVNSEKERVSIALFYNPRGDMLIKP  316

Query  530  PLKLV-KDRDSMYPP-----YR-GKSTRGLRG  604
              +LV +DR  +YPP     YR    TRG RG
Sbjct  317  ADELVTEDRPPLYPPTVYDEYRLYMRTRGPRG  348


 Score = 57.4 bits (137),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 2/91 (2%)
 Frame = +3

Query  66   PFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV-DWLKSKSTSAFLHFNSYPKCP  242
            P  C    V  Y  +++ L  ++  ++   LGL E+ + +    +   A +  N YPKCP
Sbjct  163  PLSC-REMVGEYCREVVELGGRLMKILSSNLGLEEEYLQEAFGGEEFGACMRVNYYPKCP  221

Query  243  YPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
             P   LG+ PH+D   +TLL+    +SGLQV
Sbjct  222  QPDLTLGLSPHSDPGGMTLLFPDENVSGLQV  252



>ref|XP_010057195.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74240.1| hypothetical protein EUGRSUZ_E02879 [Eucalyptus grandis]
Length=359

 Score = 66.2 bits (160),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +D Y  +L  LA+KI  L+ KAL +   D+  L  +   A L  N YP CP P   
Sbjct  169  FREVLDEYSSELRDLAMKILLLMAKALQMEPKDMIELFDEGRQA-LRMNYYPPCPRPELV  227

Query  258  LGIVPHTDSSLITLLYQSNTISGLQVFGPNK  350
             G+ PH+DS+ +T+L Q N + GLQV    K
Sbjct  228  TGLTPHSDSTGLTILLQVNEMEGLQVRKEGK  258


 Score = 55.8 bits (133),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V VKP+P+A VVNV D+++I +NG ++S++H A+V     R+SI  F   K+  K     
Sbjct  260  VSVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVNSVKERLSIAAFHSPKLEGKCGPAA  319

Query  536  KLVKD-------RDSMYPPYRGKSTRGLRG  604
             L+         R  M    RG  +R L+G
Sbjct  320  SLITQEKPALFRRIGMADYLRGLFSRELQG  349



>gb|ADK70999.1| gibberellin 3-beta-hydroxylase [Medicago shepardii]
Length=292

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+      +A +  NSYP CP P 
Sbjct  129  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSCPDPD  188

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  189  HAMGLAPHTDSTFLTILSQ-NDISGLQV  215


 Score = 48.5 bits (114),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK71005.1| gibberellin 3-beta-hydroxylase [Melilotus indicus]
Length=299

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC         +  Y E +  LA K+  L+  +LG+ ++D+ W  SK+       A 
Sbjct  131  YAKYC-------EIILQYDETMKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKACAA  183

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            L  NSYP CP P +A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  184  LQLNSYPSCPDPDRAMGLAPHTDSTFMTILSQ-NDISGLQV  223


 Score = 48.5 bits (114),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  231  VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHA  290

Query  536  KLV  544
            KLV
Sbjct  291  KLV  293



>gb|ADK70971.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=292

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  129  TVLQYDEAMKKLAGKLMCLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  188

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  189  HAMGLAPHTDSTFLTILSQ-NDISGLQV  215


 Score = 48.5 bits (114),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK71016.1| gibberellin 3-beta-hydroxylase [Trigonella foenum-graecum]
Length=292

 Score = 70.9 bits (172),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC         V  Y E +  LA K+  L+  +LG+ ++D+ W  SK+      SA 
Sbjct  123  YAKYC-------DIVLQYDETMKILAGKLMFLMLDSLGITKEDIKWASSKAQFVENASAA  175

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            L  NSYP CP P  A+G+  HTDS+ +T+L Q N ISGLQV
Sbjct  176  LQLNSYPSCPDPDHAMGLARHTDSTFLTILSQ-NDISGLQV  215


 Score = 51.2 bits (121),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H A+V +   R S+ + +G   N++I    
Sbjct  223  VTVPPLQGGLVVNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHA  282

Query  536  KLV  544
            KLV
Sbjct  283  KLV  285



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score = 73.2 bits (178),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.9 bits (115),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +  HR S+ + +G    ++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRHRFSVAYLYGPPSKVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score = 62.0 bits (149),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + V P+  ALVVNV D++ I SNG++ SV H A+V QA HRIS+ +F+G   +  IS   
Sbjct  257  ITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPPADSLISPLC  316

Query  536  KLVKDRDSMYPP-YRGKSTR  592
             LV     +  P YR  S +
Sbjct  317  NLVSSGQQVVAPRYRSVSVK  336


 Score = 59.7 bits (143),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVD----WLKSKSTSAFLHFNSYPKCPY  245
            F   ++ YQ+++  LA  +  +  ++L + +++          K+ +  L  NSYP CP 
Sbjct  161  FCDVMEDYQKKMKELAESLLHIFLESLDISKEEYRSTTIQRGHKACNTALQLNSYPPCPD  220

Query  246  PTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P +A+G+ PHTDS L T+++QS+T SGLQ+ 
Sbjct  221  PNRAMGLAPHTDSLLFTIVHQSHT-SGLQIL  250



>gb|ADK71000.1| gibberellin 3-beta-hydroxylase [Medicago soleirolii]
Length=281

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  120  TVLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  179

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  180  HAMGLAPHTDSTFLTILSQ-NDISGLQV  206


 Score = 48.5 bits (114),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  214  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  273

Query  536  KLV  544
            KLV
Sbjct  274  KLV  276



>gb|KDP21181.1| hypothetical protein JCGZ_21652 [Jatropha curcas]
Length=366

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAF--LHFNSYPKCPYPT  251
               T++ Y  ++  LAIKI   I KAL +   D + +K  +   +  +  N YP CP P 
Sbjct  170  LRETLETYATEMKKLAIKILGQIAKALKM---DTEEMKELTNDGYQSMRMNYYPPCPEPE  226

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
            +A+G+ PH+D+ ++T+L Q N I GLQV
Sbjct  227  KAIGLTPHSDADILTILLQLNEIEGLQV  254


 Score = 55.8 bits (133),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +2

Query  350  K*VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKIN  514
            K + VKP+P+A VVN+ DMM+I SNG ++S++H A V     RIS   F+  K++
Sbjct  259  KWIPVKPLPNAFVVNIGDMMEIVSNGVYRSIEHRATVNSTKERISAATFYTPKLD  313



>gb|ABY49032.1| GA3-oxidase [Ehrharta erecta]
Length=260

 Score = 70.9 bits (172),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 66/112 (59%), Gaps = 8/112 (7%)
 Frame = +3

Query  36   LKR*YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSK-----S  200
            L+R +      ++ F   ++ + +++ GLA K+  L  +ALGL  + +  ++++     +
Sbjct  99   LRRLWPKSGDDYLLFCDVMEEFHKEMRGLAGKLLELFLEALGLTGEQIGAVEAEQKLGET  158

Query  201  TSAFLHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF--GPNK  350
             +A +H N YP+CP P +ALG++ HTDS   T + QS  + GLQ+F  GP++
Sbjct  159  MTATMHLNWYPRCPDPARALGLIAHTDSGFFTFVLQS-LVPGLQLFRHGPDR  209


 Score = 50.8 bits (120),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFG  502
            V V   P A VVNV D+  I +NG+F SV H A+V + S RIS+ +F G
Sbjct  211  VAVPATPGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDSDRISLGYFLG  259



>ref|XP_010057211.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74256.1| hypothetical protein EUGRSUZ_E02902 [Eucalyptus grandis]
Length=363

 Score = 68.2 bits (165),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   +D Y +++  LAIK+  LI KALG+   D++ +  +     +  N YP CP P  A
Sbjct  166  FRDDLDAYSKEMQALAIKLLYLIVKALGIEAKDLEGMFEEGLQG-MRMNYYPPCPQPELA  224

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+  H+D+  IT+L Q N + GLQ+
Sbjct  225  IGLNSHSDADAITILLQVNEMEGLQI  250


 Score = 53.9 bits (128),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKIS  526
            V VKP+P A +VNV D+++I +NG ++S++H A V     R+SI  FF  +++ +I 
Sbjct  257  VPVKPLPGAFIVNVGDIVEIMTNGIYQSIEHRAAVNAVKERVSIATFFSPRMDAEIG  313



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +3

Query  48   YIHYCCPFVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAF  212
            Y  YC        TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A 
Sbjct  122  YAKYC-------DTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAA  174

Query  213  LHFNSYPKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQV  335
            +  NSYP CP P  A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  175  MQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQV  214


 Score = 48.5 bits (114),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  222  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  281

Query  536  KLV  544
            KLV
Sbjct  282  KLV  284



>ref|XP_010249910.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=376

 Score = 63.5 bits (153),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 60/96 (63%), Gaps = 7/96 (7%)
 Frame = +3

Query  69   FVCFSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDV-DWLK-----SKSTSAFLHFNSY  230
            +  F   +D YQ+++  L++++  LI  +LGL  +D+  W+      ++  +  L  NSY
Sbjct  165  YTRFCGVMDEYQKEMKQLSVRLLRLILSSLGLAREDLTKWVGPAGEFTQGATTALQLNSY  224

Query  231  PKCPYPTQALGIVPHTDSSLITLLYQSNTISGLQVF  338
            P CP P + +G+  HTD+S+ T+LYQSNT SGLQ+F
Sbjct  225  PACPDPNRTMGLAAHTDTSMFTILYQSNT-SGLQIF  259


 Score = 58.2 bits (139),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+  AL+VNV D++QI SN +F +V H A+V + + R+SI +F+G     +I    
Sbjct  266  VSVPPLAGALIVNVGDLLQILSNARFPAVLHRAVVNRTNQRLSIAYFYGPSTETRIMPLS  325

Query  536  KLVKDRDSMYPPYR  577
            KL+   D   P YR
Sbjct  326  KLIGPGDP--PLYR  337



>ref|XP_008373604.1| PREDICTED: S-norcoclaurine synthase 1-like [Malus domestica]
Length=357

 Score = 62.8 bits (151),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F  T+D Y E+L  + + I  LI K LGL  ++++ +    T   L  N YP C   ++ 
Sbjct  167  FRETLDKYSEELQQVTLYIWKLICKNLGLNSEEMESMFEDGTQG-LRMNYYPPCQQASRV  225

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+D+  +TLL Q N + GLQ+
Sbjct  226  MGLTPHSDAVGLTLLVQVNEVQGLQI  251


 Score = 59.3 bits (142),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V VKP+P A +VN+ D+++I SNG++KS++H A+V     R+SI  F    +   I    
Sbjct  258  VPVKPVPSAFIVNIGDIIEIMSNGEYKSIEHRAVVNTERERLSIAAFHSPNLRTAIGPLP  317

Query  536  KLVKDRDSMY  565
             LVKD  + Y
Sbjct  318  DLVKDNAANY  327



>ref|XP_006399020.1| hypothetical protein EUTSA_v10013861mg [Eutrema salsugineum]
 gb|ESQ40473.1| hypothetical protein EUTSA_v10013861mg [Eutrema salsugineum]
Length=371

 Score = 62.8 bits (151),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +3

Query  90   VDHYQEQLMGLAIKITSLIFKALGLPEDDV-DWLKSKSTSAFLHFNSYPKCPYPTQALGI  266
            +D Y ++L+ L+ +I  ++   LGL ED   D    ++  A L  N YPKCP P  ALG+
Sbjct  182  IDEYGKELVKLSGRIMRVLSSNLGLKEDKFQDAFGGENIGACLRVNYYPKCPRPELALGL  241

Query  267  VPHTDSSLITLLYQSNTISGLQV  335
             PH+D   +T+L   + + GLQV
Sbjct  242  SPHSDPGGMTILLPDDQVFGLQV  264


 Score = 58.9 bits (141),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            + VKP P A +VN+ D +QI SN  +KSV+H  IV     R+S+ FF+  K ++ I    
Sbjct  271  ITVKPHPHAFIVNIGDQIQILSNSTYKSVEHRVIVNSEKERVSLAFFYNPKSDIPIQPLQ  330

Query  536  KLVKDRD-SMYPP  571
            +LV + +  +YPP
Sbjct  331  ELVSNHNPPLYPP  343



>gb|ADK70965.1| gibberellin 3-beta-hydroxylase [Medicago heyniana]
Length=293

 Score = 73.2 bits (178),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  130  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPE  189

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  190  HAMGLAPHTDSTFLTILSQ-NDISGLQV  216


 Score = 48.5 bits (114),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  224  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  283

Query  536  KLV  544
            KLV
Sbjct  284  KLV  286



>ref|XP_010057206.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74250.1| hypothetical protein EUGRSUZ_E02891 [Eucalyptus grandis]
Length=370

 Score = 63.9 bits (154),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ Y  +L  LA+KI  L+ K L +   DV  L      A L  N YP CP P   
Sbjct  169  FRDVLEKYSSELRDLAMKILLLVAKPLKMDTKDVIELFDGGRQA-LRMNYYPPCPRPELV  227

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+D+S +T+L Q N + GLQ+
Sbjct  228  IGLTPHSDASALTILLQVNEMEGLQI  253


 Score = 57.4 bits (137),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V VKP+P+A VVNV D+++I +NG ++S++H A +     R+S   F+G K++ ++    
Sbjct  260  VPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATINSMKERLSFATFYGPKLDGEMGPAP  319

Query  536  KLV-KDRDSMY------PPYRGKSTRGLRG  604
             LV  D+ +++        ++G+ +R L+G
Sbjct  320  SLVSSDKPALFRRIGVADYFKGRFSRELQG  349



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score = 73.2 bits (178),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.5 bits (114),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



>ref|XP_010057207.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=363

 Score = 64.3 bits (155),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +3

Query  78   FSTTVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKSTSAFLHFNSYPKCPYPTQA  257
            F   ++ Y  +L  LA+KI  L+ K L +   DV  L      A L  N YP CP P   
Sbjct  162  FRDVLEKYSSELRDLAMKILLLVAKPLKMDTKDVIELFDGGRQA-LRMNYYPPCPRPELV  220

Query  258  LGIVPHTDSSLITLLYQSNTISGLQV  335
            +G+ PH+D+S +T+L Q N + GLQ+
Sbjct  221  IGLTPHSDASALTILLQVNEMEGLQI  246


 Score = 57.4 bits (137),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V VKP+P+A VVNV D+++I +NG ++S++H A +     R+S   F+G K++ ++    
Sbjct  253  VPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATINSMKERLSFATFYGPKLDGEMGPAP  312

Query  536  KLV-KDRDSMY------PPYRGKSTRGLRG  604
             LV  D+ +++        ++G+ +R L+G
Sbjct  313  SLVSSDKPALFRRIGVADYFKGRFSRELQG  342



>gb|ADK70981.1| gibberellin 3-beta-hydroxylase [Medicago noeana]
Length=297

 Score = 73.2 bits (178),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 6/88 (7%)
 Frame = +3

Query  87   TVDHYQEQLMGLAIKITSLIFKALGLPEDDVDWLKSKS-----TSAFLHFNSYPKCPYPT  251
            TV  Y E +  LA K+  L+  +LG+  +D+ W  SK+       A +  NSYP CP P 
Sbjct  135  TVLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCPDPD  194

Query  252  QALGIVPHTDSSLITLLYQSNTISGLQV  335
             A+G+ PHTDS+ +T+L Q N ISGLQV
Sbjct  195  HAMGLAPHTDSTFLTILSQ-NDISGLQV  221


 Score = 48.5 bits (114),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  356  VDVKPIPDALVVNVNDMMQIFSNGQFKSVKHCAIVCQASHRISITFFFGLKINLKISSPL  535
            V V P+   LVVNV D+  I SNG + SV H  +V +   R S+ + +G   N++I    
Sbjct  229  VTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHE  288

Query  536  KLV  544
            KLV
Sbjct  289  KLV  291



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1173402497230