BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22465_g2_i1 len=812 path=[3:0-207 211:208-236 596:237-358
2800:359-366 2809:367-369 729:370-462 822:463-517 877:518-625
985:626-811]

Length=812
                                                                      Score     E

gb|AFR60863.1|  sporamin B                                              146   8e-39   
gb|AFR60864.1|  sporamin B                                              145   1e-38   
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     145   2e-38   Ipomoea batatas [batate]
gb|AFR60860.1|  sporamin B                                              145   2e-38   
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    145   2e-38   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              145   2e-38   
gb|ABB90968.1|  sporamin B precursor                                    145   3e-38   Ipomoea batatas [batate]
gb|AAA33390.1|  sporamin B                                              144   3e-38   Ipomoea batatas [batate]
gb|AFR60859.1|  sporamin B                                              144   3e-38   
gb|AFR60867.1|  sporamin B                                              144   5e-38   
gb|AFR60865.1|  sporamin B                                              144   5e-38   
gb|AFR60862.1|  sporamin B                                              144   6e-38   
gb|ABB97547.1|  sporamin A precursor                                    134   3e-34   Ipomoea batatas [batate]
gb|ABG26236.1|  sporamin A                                              134   4e-34   Ipomoea trifida
gb|ABG26232.1|  sporamin A                                              133   7e-34   Ipomoea trifida
gb|AFR60855.1|  sporamin A                                              132   1e-33   
gb|AAB52547.1|  sporamin precursor                                      132   1e-33   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              132   2e-33   Ipomoea trifida
gb|AAA33391.1|  sporamin A precursor                                    132   3e-33   Ipomoea batatas [batate]
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    131   3e-33   Ipomoea batatas [batate]
gb|ABB97543.1|  sporamin A precursor                                    130   3e-33   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    131   4e-33   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    130   5e-33   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                      130   5e-33   Ipomoea batatas [batate]
gb|AAL55800.1|AF289060_1  sporamin                                      130   6e-33   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                              130   7e-33   Ipomoea leucantha
gb|ABB97549.1|  sporamin A precursor                                    130   8e-33   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                    130   9e-33   Ipomoea batatas [batate]
gb|ABG26238.1|  sporamin A                                              129   2e-32   Ipomoea trifida
gb|ABG26235.1|  sporamin A                                              129   3e-32   Ipomoea trifida
gb|ABG26222.1|  sporamin A                                              129   3e-32   Ipomoea leucantha
gb|ABG26231.1|  sporamin A                                              127   1e-31   Ipomoea trifida
gb|ABG26227.1|  sporamin A                                              126   2e-31   Ipomoea leucantha
gb|AFR60856.1|  sporamin A                                              126   3e-31   
gb|ABG26229.1|  sporamin A                                              125   6e-31   Ipomoea trifida
gb|AAA86670.1|  preprosporamin                                          125   1e-30   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                124   1e-30   
gb|ABB97542.1|  sporamin A precursor                                    124   2e-30   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     121   3e-29   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                              120   7e-29   Ipomoea batatas [batate]
gb|AAD40288.1|  sporamin A precursor                                    118   2e-28   Ipomoea batatas [batate]
gb|AAB52549.1|  sporamin                                              86.7    1e-17   Ipomoea batatas [batate]
emb|CDP19138.1|  unnamed protein product                              86.3    1e-16   
gb|AFR60853.1|  truncated sporamin                                    83.2    4e-16   
ref|XP_002265965.1|  PREDICTED: miraculin                             82.8    1e-15   Vitis vinifera
emb|CDP21779.1|  unnamed protein product                              80.9    7e-15   
gb|ABK01288.1|  miraculin-like protein                                80.5    8e-15   Coffea arabica [arabica coffee]
emb|CDP19136.1|  unnamed protein product                              80.1    1e-14   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     78.6    4e-14   Theobroma microcarpum
emb|CDP18338.1|  unnamed protein product                              78.2    5e-14   
emb|CBI35464.3|  unnamed protein product                              78.2    6e-14   
emb|CAN75396.1|  hypothetical protein VITISV_028636                   77.4    1e-13   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             77.0    1e-13   Vitis vinifera
emb|CAN81015.1|  hypothetical protein VITISV_025776                   77.0    1e-13   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                             76.6    2e-13   Vitis vinifera
emb|CDP21726.1|  unnamed protein product                              76.6    2e-13   
gb|ADD51186.1|  tumor-related protein                                 76.3    2e-13   Vitis cinerea var. helleri x Vitis riparia
gb|AAB52550.1|  sporamin                                              75.5    2e-13   Ipomoea batatas [batate]
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     75.9    4e-13   Theobroma bicolor
emb|CAI77768.1|  kunitz trypsin inhibitor                             74.7    9e-13   Populus tremula [European aspen]
emb|CAI77782.1|  kunitz trypsin inhibitor                             73.6    2e-12   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                             73.6    2e-12   Populus tremula [European aspen]
emb|CAI77774.1|  kunitz trypsin inhibitor                             73.6    2e-12   Populus tremula [European aspen]
emb|CAI77777.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77783.1|  kunitz trypsin inhibitor                             73.2    3e-12   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                             72.8    4e-12   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             72.8    5e-12   Populus tremula [European aspen]
ref|XP_009777240.1|  PREDICTED: miraculin-like                        72.4    5e-12   
emb|CAN65022.1|  hypothetical protein VITISV_027379                   72.0    6e-12   Vitis vinifera
emb|CAI77766.1|  kunitz trypsin inhibitor                             72.0    8e-12   Populus tremula [European aspen]
emb|CAI77772.1|  kunitz trypsin inhibitor                             72.0    8e-12   Populus tremula [European aspen]
prf||1802409A  albumin                                                71.2    1e-11
ref|XP_011072079.1|  PREDICTED: miraculin                             71.2    1e-11   
gb|ADK62529.1|  miraculin-like protein                                70.9    2e-11   
ref|XP_007036743.1|  21 kDa seed protein                              71.2    2e-11   
ref|XP_004234331.1|  PREDICTED: miraculin                             70.5    3e-11   
emb|CAI77785.1|  kunitz trypsin inhibitor                             70.5    3e-11   Populus tremula [European aspen]
ref|XP_007036748.1|  21 kDa seed protein, putative                    70.5    3e-11   
emb|CAI77769.1|  kunitz trypsin inhibitor                             70.1    3e-11   Populus tremula [European aspen]
ref|XP_007036750.1|  21 kDa seed protein                              70.1    4e-11   
ref|XP_007036746.1|  21 kDa seed protein                              69.7    6e-11   
emb|CAI77773.1|  kunitz trypsin inhibitor                             69.3    6e-11   Populus tremula [European aspen]
emb|CAI77786.1|  kunitz trypsin inhibitor                             69.3    6e-11   Populus tremula [European aspen]
emb|CAI77800.1|  kunitz trypsin inhibitor                             69.3    6e-11   Populus tremula [European aspen]
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              69.3    7e-11   
emb|CAI77795.1|  kunitz trypsin inhibitor                             68.9    1e-10   Populus tremula [European aspen]
ref|XP_009792285.1|  PREDICTED: miraculin                             68.6    1e-10   
emb|CDY11118.1|  BnaC06g23700D                                        68.2    1e-10   
emb|CAI77790.1|  kunitz trypsin inhibitor                             68.2    2e-10   Populus tremula [European aspen]
gb|ABG47463.1|  vegetative storage protein                            68.2    2e-10   Litchi chinensis [litchi]
gb|AAQ96377.1|  miraculin-like protein                                67.8    2e-10   Solanum palustre
ref|XP_002266302.2|  PREDICTED: miraculin-like                        67.0    3e-10   Vitis vinifera
gb|AAC49969.1|  tumor-related protein                                 67.4    3e-10   Nicotiana tabacum [American tobacco]
ref|XP_009627067.1|  PREDICTED: miraculin                             67.4    3e-10   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     67.4    4e-10   Theobroma cacao [chocolate]
ref|XP_006351546.1|  PREDICTED: miraculin-like                        66.6    5e-10   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        66.6    6e-10   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        65.9    7e-10   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        65.9    8e-10   
ref|XP_009127987.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  66.2    8e-10   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        65.5    1e-09   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        65.5    1e-09   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        65.5    2e-09   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           65.1    2e-09   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        65.1    2e-09   
gb|ABX76297.1|  stigma expressed protein                              65.5    3e-09   Nicotiana alata [flowering tobacco]
emb|CBI35471.3|  unnamed protein product                              67.0    4e-09   
ref|XP_010663911.1|  PREDICTED: miraculin-like                        64.3    4e-09   
ref|XP_007041757.1|  21 kDa seed protein, putative                    64.7    4e-09   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        63.9    5e-09   
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297     63.9    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565061.1|  kunitz trypsin inhibitor 1                          63.9    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAL85644.1|  trypsin inhibitor                                     62.8    7e-09   Theobroma subincanum
gb|AFL91232.1|  Kunitz-like protease inhibitor                        62.8    8e-09   
gb|AAN15685.1|  putative trypsin inhibitor                            63.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAL85637.1|  trypsin inhibitor                                     62.4    9e-09   Herrania mariae
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           63.2    9e-09   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           63.2    1e-08   
emb|CDY68006.1|  BnaA02g35870D                                        63.2    1e-08   
gb|AAL85651.1|  trypsin inhibitor                                     62.4    1e-08   Theobroma mammosum
gb|AAL85643.1|  trypsin inhibitor                                     62.0    1e-08   Theobroma angustifolium
gb|AAL85648.1|  trypsin inhibitor                                     62.0    1e-08   Theobroma obovatum
gb|AAL85650.1|  trypsin inhibitor                                     62.0    1e-08   Theobroma mammosum
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            62.4    1e-08   Populus balsamifera [balsam poplar]
emb|CAN63617.1|  hypothetical protein VITISV_041430                   63.2    1e-08   Vitis vinifera
ref|XP_003534079.1|  PREDICTED: miraculin-like                        62.8    1e-08   
ref|XP_008238584.1|  PREDICTED: miraculin-like                        62.4    2e-08   
ref|XP_009615974.1|  PREDICTED: miraculin-like                        62.4    2e-08   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           62.4    2e-08   
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            62.0    2e-08   Populus balsamifera [balsam poplar]
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1   62.4    2e-08   
gb|AEK26924.1|  Kunitz-type trypsin inhibitor C4                      61.6    2e-08   
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           62.4    2e-08   
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              62.4    2e-08   
ref|XP_010428237.1|  PREDICTED: miraculin-like                        62.0    3e-08   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           62.0    3e-08   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           62.0    3e-08   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           62.0    3e-08   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        62.0    3e-08   
gb|AAK96757.1|  putative trypsin inhibitor                            61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               61.6    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006302823.1|  hypothetical protein CARUB_v10020954mg           61.6    4e-08   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           61.6    4e-08   
ref|XP_002305032.2|  trypsin protein inhibitor 3                      61.6    4e-08   Populus trichocarpa [western balsam poplar]
emb|CDP16462.1|  unnamed protein product                              61.6    4e-08   
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              61.6    4e-08   
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458           61.6    4e-08   
gb|AAL85652.1|  trypsin inhibitor                                     60.5    4e-08   Theobroma mammosum
gb|AAL85640.1|  trypsin inhibitor                                     60.5    5e-08   Herrania albiflora
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  61.6    5e-08   Synsepalum dulcificum [miracle fruit]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           61.2    5e-08   
ref|XP_009133369.1|  PREDICTED: trypsin inhibitor DE-3-like           61.2    6e-08   
emb|CDY69418.1|  BnaAnng30440D                                        60.8    7e-08   
ref|XP_004301214.1|  PREDICTED: miraculin-like                        61.2    7e-08   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        60.1    8e-08   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      60.8    8e-08   
emb|CAI77767.1|  kunitz trypsin inhibitor                             60.8    9e-08   Populus tremula [European aspen]
emb|CAI77771.1|  kunitz trypsin inhibitor                             60.8    9e-08   Populus tremula [European aspen]
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   60.5    1e-07   
gb|ABK96521.1|  unknown                                               60.5    1e-07   Populus trichocarpa x Populus deltoides
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            60.5    1e-07   Populus trichocarpa x Populus deltoides
emb|CAC19831.1|  hypothetical protein                                 60.1    1e-07   Avicennia marina
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           60.5    1e-07   
gb|KHM99741.1|  Miraculin                                             60.1    1e-07   
ref|XP_009105980.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  60.1    1e-07   
gb|AFL91230.1|  Kunitz-like protease inhibitor                        59.3    1e-07   
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            59.3    2e-07   Populus balsamifera [balsam poplar]
gb|AFL91229.1|  Kunitz-like protease inhibitor                        59.3    2e-07   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               60.5    2e-07   Nicotiana glutinosa
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            59.3    2e-07   Populus balsamifera [balsam poplar]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        59.7    2e-07   
ref|XP_011035401.1|  PREDICTED: miraculin-like                        59.7    2e-07   
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            58.9    2e-07   Populus balsamifera [balsam poplar]
ref|XP_006495063.1|  PREDICTED: miraculin-like                        59.3    2e-07   
gb|KFK33833.1|  hypothetical protein AALP_AA5G065900                  59.3    2e-07   
gb|AAL85653.1|  trypsin inhibitor                                     58.5    2e-07   Theobroma simiarum
ref|XP_009803614.1|  PREDICTED: miraculin-like                        59.3    2e-07   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           60.1    2e-07   
ref|XP_002305033.1|  trypsin protein inhibitor 3                      59.3    3e-07   Populus trichocarpa [western balsam poplar]
gb|AAL85645.1|  trypsin inhibitor                                     58.2    3e-07   Theobroma grandiflorum
ref|XP_010918417.1|  PREDICTED: miraculin-like                        58.9    3e-07   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           58.9    3e-07   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            58.5    4e-07   Populus balsamifera [balsam poplar]
ref|XP_009793041.1|  PREDICTED: miraculin-like                        58.9    4e-07   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  58.5    4e-07   
gb|AFK36436.1|  unknown                                               58.9    4e-07   
emb|CDP20533.1|  unnamed protein product                              58.9    4e-07   
gb|KHN24493.1|  Miraculin                                             58.5    4e-07   
gb|AEK31202.1|  miraculin-like protein 2                              58.2    4e-07   
sp|P68171.1|IDE3_ERYLA  RecName: Full=Trypsin inhibitor DE-3          57.8    5e-07   Erythrina latissima
gb|ABR17296.1|  unknown                                               58.5    5e-07   Picea sitchensis
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            58.2    5e-07   Populus balsamifera [balsam poplar]
gb|KHM99738.1|  Miraculin                                             58.2    5e-07   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      58.5    5e-07   
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            58.2    5e-07   Populus balsamifera [balsam poplar]
emb|CDX72973.1|  BnaC06g34210D                                        58.5    5e-07   
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            57.8    6e-07   Populus balsamifera [balsam poplar]
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            57.8    6e-07   Populus balsamifera [balsam poplar]
ref|XP_003548288.1|  PREDICTED: miraculin-like                        58.2    6e-07   
ref|XP_003534078.1|  PREDICTED: miraculin-like                        58.2    6e-07   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        58.2    6e-07   
gb|KHM99743.1|  Miraculin                                             58.2    7e-07   
gb|AAB68964.1|  trypsin inhibitor propeptide                          58.2    7e-07   Brassica oleracea
gb|AFL91228.1|  Kunitz-like protease inhibitor                        57.4    8e-07   
gb|AAL85655.1|  trypsin inhibitor                                     57.0    8e-07   Theobroma bicolor
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 58.2    8e-07   Populus trichocarpa x Populus nigra
ref|XP_007041756.1|  21 kDa seed protein                              58.2    8e-07   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            57.4    8e-07   Populus balsamifera [balsam poplar]
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            57.4    9e-07   Populus balsamifera [balsam poplar]
ref|XP_004299457.1|  PREDICTED: miraculin-like                        57.8    1e-06   
ref|XP_010101167.1|  hypothetical protein L484_005403                 57.4    1e-06   
ref|XP_010428238.1|  PREDICTED: trypsin inhibitor BvTI-like           57.4    1e-06   
gb|AAL85661.1|  trypsin inhibitor                                     56.6    1e-06   Theobroma bicolor
emb|CDY59714.1|  BnaC02g46470D                                        57.8    1e-06   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            56.6    1e-06   Populus balsamifera [balsam poplar]
ref|XP_010683390.1|  PREDICTED: miraculin-like                        57.4    2e-06   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor   57.0    2e-06   
gb|ACL12055.1|  Kunitz trypsin inhibitor                              57.0    2e-06   Nicotiana tabacum [American tobacco]
gb|AAL85660.1|  trypsin inhibitor                                     56.2    2e-06   Theobroma sylvestre
emb|CDP21543.1|  unnamed protein product                              57.0    2e-06   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            56.6    2e-06   Populus balsamifera [balsam poplar]
ref|XP_003638409.1|  Alpha-amylase/subtilisin inhibitor               56.6    2e-06   
ref|XP_002309883.1|  hypothetical protein POPTR_0007s03640g           56.6    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           57.0    2e-06   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  56.6    2e-06   
gb|KHM99744.1|  Miraculin                                             56.2    2e-06   
ref|XP_003534080.1|  PREDICTED: miraculin-like                        56.6    2e-06   
ref|XP_009105982.1|  PREDICTED: subtilisin inhibitor CLSI-II-like     56.6    2e-06   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      57.0    2e-06   
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            56.2    2e-06   Populus balsamifera [balsam poplar]
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           55.8    2e-06   
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     56.6    2e-06   Theobroma grandiflorum
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 56.6    2e-06   Populus trichocarpa x Populus nigra
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      57.0    2e-06   
sp|P81366.1|IDE3_ERYVA  RecName: Full=Trypsin inhibitor DE-3; Alt...  55.8    2e-06   Erythrina variegata [ci tong]
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            57.0    2e-06   
ref|XP_011012013.1|  PREDICTED: endogenous alpha-amylase/subtilis...  56.2    3e-06   
gb|KFK41765.1|  hypothetical protein AALP_AA2G169300                  56.6    3e-06   
ref|XP_009406658.1|  PREDICTED: miraculin-like                        56.2    3e-06   
ref|XP_008778295.1|  PREDICTED: miraculin                             55.8    3e-06   
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            55.8    3e-06   Populus balsamifera [balsam poplar]
gb|AIT42164.1|  Kunitz-type inhibitor A                               56.6    3e-06   
gb|KHM99742.1|  Miraculin                                             55.1    3e-06   
ref|XP_011046376.1|  PREDICTED: miraculin-like                        55.8    3e-06   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        57.4    3e-06   
dbj|BAA82843.1|  miraculin homologue                                  55.5    3e-06   Solanum melongena [aubergine]
gb|AIT42157.1|  Kunitz-type inhibitor A                               56.2    3e-06   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           55.8    4e-06   
ref|XP_010536414.1|  PREDICTED: miraculin-like                        56.2    4e-06   
gb|AIT42159.1|  Kunitz-type inhibitor A                               56.2    4e-06   
gb|AEO27900.1|  miraculin-like protein 2                              55.1    5e-06   
sp|P09943.1|IDE3_ERYCA  RecName: Full=Trypsin inhibitor DE-3          55.1    5e-06   Erythrina caffra [lucky beantree]
ref|XP_004241480.1|  PREDICTED: miraculin-like                        55.8    5e-06   
gb|AAL85657.1|  trypsin inhibitor                                     54.7    5e-06   Theobroma sylvestre
ref|XP_007041755.1|  21 kDa seed protein, putative                    55.1    6e-06   
ref|XP_009105993.1|  PREDICTED: latex serine proteinase inhibitor...  55.8    6e-06   
ref|XP_002265535.2|  PREDICTED: alpha-amylase/subtilisin inhibito...  55.1    6e-06   Vitis vinifera
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                55.5    6e-06   Populus trichocarpa x Populus deltoides
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              55.8    6e-06   
emb|CDO98555.1|  unnamed protein product                              55.5    6e-06   
ref|XP_011023018.1|  PREDICTED: miraculin-like                        55.1    8e-06   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        55.1    8e-06   
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         55.1    9e-06   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           55.1    9e-06   Populus trichocarpa [western balsam poplar]
gb|AAL85659.1|  trypsin inhibitor                                     53.9    9e-06   Theobroma speciosum
gb|KHM99732.1|  Miraculin                                             55.1    9e-06   
gb|AIT42166.1|  Kunitz-type inhibitor A                               55.1    1e-05   
ref|XP_003548289.1|  PREDICTED: miraculin-like                        54.7    1e-05   
ref|XP_006442410.1|  hypothetical protein CICLE_v10022211mg           55.1    1e-05   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        55.1    1e-05   
ref|XP_002309882.2|  truncated Kunitz trypsin inhibitor family pr...  54.7    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007041758.1|  21 kDa seed protein, putative                    53.9    1e-05   
ref|XP_009128561.1|  PREDICTED: 21 kDa seed protein-like              54.7    1e-05   
dbj|BAA04148.1|  proteinase inhibitor                                 55.1    1e-05   
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  54.7    1e-05   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           54.3    1e-05   
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  54.7    1e-05   
gb|ACJ51124.1|  talisin                                               54.3    1e-05   
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like              54.3    1e-05   
ref|XP_006372631.1|  trypsin protein inhibitor 3                      54.3    2e-05   
gb|AAL85642.1|  trypsin inhibitor                                     53.1    2e-05   
sp|Q41480.2|API1_SOLTU  RecName: Full=Aspartic protease inhibitor...  54.3    2e-05   
sp|P24924.2|ITRY_ACACO  RecName: Full=Trypsin inhibitor; Contains...  53.5    2e-05   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         54.3    2e-05   
gb|AIT42162.1|  Kunitz-type inhibitor A                               54.3    2e-05   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           53.9    2e-05   
gb|AEK31201.1|  miraculin-like protein 2                              53.1    2e-05   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      53.9    2e-05   
ref|XP_009770904.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           53.5    3e-05   
gb|AEO27899.1|  miraculin-like protein                                53.1    3e-05   
emb|CAA44005.1|  aspartic proteinase inhibitor homologue              53.5    3e-05   
emb|CAC00536.1|  Cathepsin D Inhibitor                                53.9    3e-05   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         53.5    3e-05   
ref|XP_006477857.1|  PREDICTED: 21 kDa seed protein-like              53.5    3e-05   
sp|Q43645.2|API4_SOLTU  RecName: Full=Aspartic protease inhibitor...  53.5    3e-05   
emb|CDX72969.1|  BnaC06g34170D                                        53.1    4e-05   
gb|KHM99740.1|  Miraculin                                             52.0    4e-05   
ref|XP_011023017.1|  PREDICTED: miraculin-like                        53.1    4e-05   
gb|AEK26930.1|  Kunitz-type trypsin inhibitor C3                      52.8    4e-05   
emb|CDX72981.1|  BnaC06g34290D                                        53.1    4e-05   
ref|XP_010089350.1|  hypothetical protein L484_002886                 53.5    5e-05   
gb|AAL85656.1|  trypsin inhibitor                                     52.0    5e-05   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        53.1    5e-05   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      52.8    5e-05   
pdb|3QYD|A  Chain A, Crystal Structure Of A Recombinant Chimeric ...  52.4    5e-05   
emb|CDO98558.1|  unnamed protein product                              52.8    5e-05   
emb|CDX72971.1|  BnaC06g34190D                                        52.8    6e-05   
ref|XP_006390572.1|  hypothetical protein EUTSA_v10019151mg           52.4    6e-05   
gb|AIT42158.1|  Kunitz-type inhibitor A                               52.8    6e-05   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        52.8    6e-05   
emb|CDX72972.1|  BnaC06g34200D                                        52.4    7e-05   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        52.4    7e-05   
gb|AAK84063.1|AF401200_1  trypsin inhibitor                           51.6    8e-05   
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           52.4    8e-05   
ref|XP_004515059.1|  PREDICTED: miraculin-like                        52.0    8e-05   
gb|AAZ94195.1|  Kunitz-type protease inhibitor precursor              52.4    9e-05   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   52.0    9e-05   
ref|NP_001274943.1|  Kunitz-type protease inhibitor precursor         52.4    9e-05   
pdb|4J2K|A  Chain A, Crystal Structure Of A Plant Trypsin Inhibit...  51.6    9e-05   
gb|AIT42155.1|  Kunitz-type inhibitor A                               52.0    1e-04   
gb|AEK31197.1|  miraculin-like protein 2                              51.2    1e-04   
ref|XP_009105981.1|  PREDICTED: 21 kDa seed protein-like              51.6    1e-04   
ref|NP_001237383.1|  uncharacterized protein LOC100305579 precursor   51.6    1e-04   
dbj|BAA05474.1|  tumor-related protein                                50.4    1e-04   
gb|KHN27872.1|  Kunitz-type trypsin inhibitor-like 2 protein          51.6    1e-04   
ref|NP_001237786.1|  Kunitz trypsin protease inhibitor precursor      51.6    1e-04   
dbj|BAA82840.1|  miraculin homologue                                  50.4    1e-04   
gb|KFK41767.1|  hypothetical protein AALP_AA2G169600                  51.6    1e-04   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        52.0    1e-04   
gb|AEK31200.1|  miraculin-like protein 2                              50.8    2e-04   
gb|AIT42216.1|  Kunitz-type inhibitor D                               51.2    2e-04   
ref|XP_006360287.1|  PREDICTED: 21 kDa seed protein-like              51.6    2e-04   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           51.6    2e-04   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   51.2    2e-04   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        51.6    2e-04   
pdb|3I2X|A  Chain A, Crystal Structure Of A Chimeric Trypsin Inhi...  50.8    2e-04   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        51.2    2e-04   
emb|CDP20822.1|  unnamed protein product                              50.8    2e-04   
ref|NP_001237705.1|  uncharacterized protein LOC100305855 precursor   50.8    2e-04   
pdb|3I29|B  Chain B, Crystal Structure Of A Binary Complex Betwee...  50.4    2e-04   
pdb|2QYI|B  Chain B, Crystal Structure Of A Binary Complex Betwee...  50.4    2e-04   
pdb|1FMZ|A  Chain A, Crystal Structure Of A Mutant Winged Bean Ch...  50.4    2e-04   
gb|AIT42175.1|  Kunitz-type inhibitor B                               51.2    2e-04   
pdb|1XG6|A  Chain A, The Crystal Structure Of The P1 Mutant (Leu ...  50.4    2e-04   
gb|AAL85654.1|  trypsin inhibitor                                     50.1    2e-04   
gb|AEK31196.1|  miraculin-like protein 2                              50.1    2e-04   
gb|AIT42214.1|  Kunitz-type inhibitor D                               50.8    3e-04   
pdb|2ET2|A  Chain A, Crystal Structure Of An Asn To Ala Mutant Of...  50.4    3e-04   
sp|P83594.1|IFXA_BAUUN  RecName: Full=Factor Xa inhibitor BuXI        50.1    3e-04   
gb|ACR54294.1|  Kunitz-type proteinase inhibitor group A1             50.4    3e-04   
gb|AGX93227.1|  Kunitz proteinase inhibitor 1                         50.8    3e-04   
pdb|2ESU|A  Chain A, Crystal Structure Of Asn To Gln Mutant Of Wi...  50.4    3e-04   
emb|CDO98560.1|  unnamed protein product                              50.8    3e-04   
sp|P81726.1|ICI2_CANLI  RecName: Full=Subtilisin inhibitor CLSI-I...  50.4    3e-04   
ref|NP_565062.1|  Kunitz family trypsin and protease inhibitor pr...  50.8    3e-04   
ref|XP_011046090.1|  PREDICTED: miraculin-like                        50.4    3e-04   
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    50.8    3e-04   
sp|P86451.1|ITRY_ENTCO  RecName: Full=Trypsin inhibitor; Short=Ec...  50.1    3e-04   
pdb|2BEB|A  Chain A, X-Ray Structure Of Asn To Thr Mutant Of Wing...  50.1    4e-04   
gb|AFR54471.1|  miraculin-like protein 2                              50.4    4e-04   
pdb|1FN0|A  Chain A, Structure Of A Mutant Winged Bean Chymotryps...  50.1    4e-04   
pdb|1EYL|A  Chain A, Structure Of A Recombinant Winged Bean Chymo...  49.7    4e-04   
pdb|2BEA|A  Chain A, Crystal Structure Of Asn14 To Gly Mutant Of Wci  49.7    4e-04   
sp|Q41015.2|PIP21_PEA  RecName: Full=Kunitz-type trypsin inhibito...  50.4    4e-04   
gb|AAZ94192.1|  Kunitz-type protease inhibitor precursor              50.4    4e-04   
gb|ACR54296.1|  Kunitz-type proteinase inhibitor group A3             49.7    4e-04   
gb|ACR54295.1|  Kunitz-type proteinase inhibitor group A2             49.7    5e-04   
gb|AAC60536.1|  Kunitz chymotrypsin inhibitor 2                       50.1    5e-04   
gb|AEK31191.1|  miraculin-like protein 1                              49.3    5e-04   
gb|ACS12825.1|  Kunitz-type proteinase inhibitor A1                   49.7    5e-04   
gb|AEK26929.1|  Kunitz-type trypsin inhibitor C2                      49.3    5e-04   
gb|ABX76298.1|  sexual organ expressed protein                        50.4    5e-04   
sp|P10822.2|ICW3_PSOTE  RecName: Full=Chymotrypsin inhibitor 3; A...  49.7    6e-04   
ref|XP_003532236.1|  PREDICTED: trypsin inhibitor A-like              49.7    6e-04   
ref|XP_010098222.1|  hypothetical protein L484_010984                 49.3    7e-04   
gb|AEK26922.1|  Kunitz-type trypsin inhibitor C1                      49.3    7e-04   
emb|CDX96460.1|  BnaA07g30710D                                        49.3    7e-04   
gb|KHM99735.1|  Miraculin                                             48.5    7e-04   
ref|XP_007152431.1|  hypothetical protein PHAVU_004G129800g           49.7    7e-04   
pdb|3I2A|A  Chain A, Crystal Structure Of A Chimeric Trypsin Inhi...  49.3    7e-04   
dbj|BAE79511.1|  miraculin-like protein 2                             49.7    7e-04   
emb|CDO98557.1|  unnamed protein product                              49.3    7e-04   
pdb|4WBC|A  Chain A, 2.13 A Structure Of A Kunitz-Type Winged Bea...  48.9    7e-04   
gb|KHM99737.1|  Miraculin                                             49.7    8e-04   
gb|AFC88888.1|  Kunitz-type proteinase inhibitor group A1             49.3    8e-04   
ref|NP_001275465.1|  Kunitz-type protease inhibitor precursor         49.7    8e-04   
ref|XP_008437082.1|  PREDICTED: miraculin                             49.3    9e-04   
ref|XP_003638395.1|  Alpha-amylase/subtilisin inhibitor               49.7    9e-04   
ref|XP_009104823.1|  PREDICTED: trypsin inhibitor BvTI-like           49.3    0.001   
ref|XP_003534081.1|  PREDICTED: miraculin-like                        49.3    0.001   
ref|XP_003619578.1|  Kunitz-type trypsin inhibitor-like 2 protein     49.3    0.001   
sp|P83595.1|ITRY_BAUVA  RecName: Full=Trypsin inhibitor BvTI          48.5    0.001   
ref|XP_011045717.1|  PREDICTED: miraculin-like                        48.9    0.001   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        48.9    0.001   
gb|KEH38529.1|  Kunitz type trypsin inhibitor                         48.9    0.001   
gb|AAM88404.1|AF526372_1  proteinase inhibitor 20                     49.3    0.001   



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 111/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+   PADP +TVV  ST    +F+  P  +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITIRPADPESTVVMPSTFQTFRFS-IPTNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P   TPADP ATVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI +V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP ATVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A E   S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP ATVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP ATVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            V++  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            VI+  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VIVSRSDFDNGDPITITPADPESTVVMPSTYQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRL  A   A S+TPV+D  GD +  G  Y + S  W    GGLRLV LD S+ +C SD
Sbjct  25   PIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASD  84

Query  166  VIIG-SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG  342
            V++  S+ + G P+  TPADP +TVV  ST    +F      +LCVNNV+W +++D   G
Sbjct  85   VMVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFN-IATNKLCVNNVNWGIKHDSESG  143

Query  343  ERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
            + FVKAG+  S   +QFKI  V   L+AY I+YC  GT+ C+NVG +YD     TRLALS
Sbjct  144  QYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRLALS  203

Query  511  T  513
             
Sbjct  204  N  204



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GG RL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAIWGVGGGGPRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNVNWRIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS DS +  VI+
Sbjct  205  LS-DSPFVFVIK  215



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS DS +  VI+
Sbjct  205  LS-DSPFVFVIK  215



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDHMSRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC +D
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCATD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  7    PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  65

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  66   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  124

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  125  SGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  184

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  185  LS-NSPFVFVIK  195



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VII  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQQDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTR+A
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHMLRTTRIA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPLMRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT  E   S TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQQDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTR+A
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHMLRTTRIA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L++G P+  TPA  DP +TVV   T    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT  E   S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP ++V+  ST    +F      +LCVNNV+W +++D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFN-IATNKLCVNNVNWGIRHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDD-QHTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDPMMRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT  E   S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTP--ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TP  ADP ++V+  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI      L+ Y +TYC  G+D C+NVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 114/192 (59%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT  E   S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTP--ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            V +  ++L+ G P+  TP  ADP ++V+  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQQDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG   D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLA  204

Query  505  LS  510
            LS
Sbjct  205  LS  206



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 113/192 (59%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  + L+ G P+  TPA  DP +TVV  ST    +F      +L VNNV+W +Q+D  
Sbjct  86   VIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLRVNNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG  +D    TTRLA
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFAFVIR  215



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 113/192 (59%), Gaps = 15/192 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCV NV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IANNKLCVKNVNWGIQHDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+ F+K G+  S   +QFKI  V   L+ Y +TYC  G+D CYN G  +D    TTRLA
Sbjct  145  SGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHDPMLRTTRLA  204

Query  505  LSTDSTYEIVIQ  540
            LS +S +  VI+
Sbjct  205  LS-NSPFVFVIK  215



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 106/182 (58%), Gaps = 14/182 (8%)
 Frame = +1

Query  1    PIRLPTAAE---SDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT  E   S+TPV+D  GD +  G  Y + S  W    GGLRL  LD   +KC SD
Sbjct  27   PIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-MMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TPA  DP ATVV  ST    +F      +LCVNNV+W +QYD  
Sbjct  86   VIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFN-IATNKLCVNNVNWGIQYDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
              +  +KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG   D    TTRLA
Sbjct  145  SVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPMLRTTRLA  204

Query  505  LS  510
            LS
Sbjct  205  LS  206



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 111/191 (58%), Gaps = 13/191 (7%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGST-TKCPSDV  168
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W  GG  L        +KC SDV
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLGHLDMMSKCASDV  86

Query  169  IIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF  339
            I+  ++L+ G P+  TPA  DP +TVV  ST    +F      +LCVNNV+W +Q+D   
Sbjct  87   IVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQHDSAS  145

Query  340  GERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLAL  507
            G+ F+KAG+  S   +QFKI  V   L++Y +TYC  G D CYNVG  +D    TTRLAL
Sbjct  146  GQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHDHMLRTTRLAL  205

Query  508  STDSTYEIVIQ  540
            S +S +  VI+
Sbjct  206  S-NSPFVFVIK  215



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 102/182 (56%), Gaps = 14/182 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLL--RSWKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y +         GGLRL  LD     C SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVYAILGACGGGLRLAHLD-LMNNCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G  +  TPA  DP ATVV  ST    +F      +LCVNNV+W +QYD  
Sbjct  86   VIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFN-IATNKLCVNNVNWGIQYDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
             G+  +KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG   D    TTRLA
Sbjct  145  SGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLA  204

Query  505  LS  510
            LS
Sbjct  205  LS  206



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 102/182 (56%), Gaps = 14/182 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y L S       GGLRL  LD     C SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVSAILGACGGGLRLAHLD-LMNNCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G  +  TPA  DP ATVV  ST    +F      +LCVNNV+W +QYD  
Sbjct  86   VIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFN-IATNKLCVNNVNWGIQYDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
              +  +KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG   D    TTRLA
Sbjct  145  SVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPMLRTTRLA  204

Query  505  LS  510
            LS
Sbjct  205  LS  206



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 102/182 (56%), Gaps = 14/182 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S       GGLRL  LD     C SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAILGACGGGLRLAHLD-LMNNCASD  85

Query  166  VIIG-SELEEGYPVVFTPA--DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G  +  TPA  DP ATVV  ST    +F      +LCVNNV+W +QYD  
Sbjct  86   VIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFN-IATNKLCVNNVNWGIQYDSA  144

Query  337  FGERFVKAGDVFS---HQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLA  504
              +  +KAG+  S   +QFKI  V   L+ Y +TYC  G+D CYNVG   D    TTRLA
Sbjct  145  SVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPMLRTTRLA  204

Query  505  LS  510
            +S
Sbjct  205  IS  206



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +1

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFS---HQFK  387
            ADP +TVV  ST    +F      +LCVNNV+W +Q+D   G+ F+KAG+  S   +QFK
Sbjct  8    ADPESTVVMASTYQTFRF-NIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFK  66

Query  388  IVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLALSTDSTYEIVIQ  540
            I  V   L+ Y +TYC  G+D CYNVG  +D    TTRLALS +S +  VI+
Sbjct  67   IELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALS-NSPFVFVIK  117



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 94/191 (49%), Gaps = 17/191 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTK-CPSDVIIG-SELEE  192
            AAE   PV+D  G+ + PG  Y + S  W  GG  +    G   + CP  V+   S+   
Sbjct  20   AAEEPNPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGNEICPLAVVQEPSDRNR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFV------  354
            G+PV FTP +P   VV  ST LNIKFA  P++  C  +  W+V ++    + FV      
Sbjct  80   GHPVTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALEQHFVLTDGVE  139

Query  355  --KAGDVFSHQFKIVSVAPILHAYIITYCDSGTDN-----CYNVGSHYDDQHTTRLALST  513
                 +  ++ FKI ++  +   Y + YC +  D+     C +VG +YDD  T RLALS 
Sbjct  140  GNSGCETEANWFKIEAIGSL--GYKLVYCPAVCDSSSEAICKDVGIYYDDDRTRRLALSD  197

Query  514  DSTYEIVIQKA  546
                 + I+K+
Sbjct  198  QPFLVVFIKKS  208



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 72/122 (59%), Gaps = 10/122 (8%)
 Frame = +1

Query  1    PIRLPTA---AESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSD  165
            PIRLPT    A S+TPV+D  GD +  G  Y + S  W    GGLRL  LD + +KC SD
Sbjct  27   PIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD-TMSKCASD  85

Query  166  VIIG-SELEEGYPVVFTP--ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR  336
            VI+  ++L+ G P+  TP  ADP +TVV  ST    +F      +LCVNNV+W +Q+D  
Sbjct  86   VIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFN-IATNKLCVNNVNWGIQHDSA  144

Query  337  FG  342
             G
Sbjct  145  SG  146



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 18/191 (9%)
 Frame = +1

Query  10   LPTAAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            LP AAE+   PV+D EG  L  G  Y +L   +   GGL + S+   T  CP DV+    
Sbjct  21   LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVRNKT--CPLDVVQDKL  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKA  360
            E+  G P+ FTP +P   V+  ST  NIKF+      +C  +  W+++YD   G+RF+  
Sbjct  79   EVSHGLPLTFTPVNPKQDVIRVSTDHNIKFS---AATICAQSTVWKLEYDESTGQRFITT  135

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V         S+ FKI          +  T C+     C +VG  Y  +   RLAL+T
Sbjct  136  GGVEGNPGRGTLSNWFKIEKYGDDYKLVFCPTVCNFCKVICRDVGV-YIQKGYRRLALTT  194

Query  514  DSTYEIVIQKA  546
            D+ + ++ +KA
Sbjct  195  DAPFRVMFKKA  205



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 92/186 (49%), Gaps = 14/186 (8%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEGY  198
            AAE   PV+D  G+ + PG  Y + +     GG+      G+   CP   ++ + L+ G 
Sbjct  20   AAEEPNPVLDTNGEEIRPGVEYYMGTIFRPGGGVTYGKGPGNEI-CPL-AVVQAWLQRGD  77

Query  199  PVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFV--------  354
            PV FTP +P   VV  ST LNIKFA  P++  C  +  W+V ++    + FV        
Sbjct  78   PVTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALKQHFVLTDGVEGN  137

Query  355  KAGDVFSHQFKIVSVAPILHAYII--TYCDSGTDN-CYNVGSHYDDQHTTRLALSTDSTY  525
               +  ++ FKI +V+   + ++   T CDS ++  C +VG + DD  T RLAL      
Sbjct  138  SGCETTANWFKIEAVSDRDYKFVFCPTVCDSSSEAICKDVGIYMDD-GTRRLALGGQPYA  196

Query  526  EIVIQK  543
             + I+K
Sbjct  197  VVFIKK  202



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 86/175 (49%), Gaps = 13/175 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEGY  198
            AAE   PV+D  G+ + PG  Y + +     GG+      G+   CP   +  + L+ G 
Sbjct  20   AAEELYPVLDINGEEIRPGVEYYIGTTFRPGGGVTYGKGPGNEI-CPL-AVAQAWLQRGL  77

Query  199  PVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFSH  378
            PV FTP +P   VV  ST LNIKFA  P+ R+C  +  W+V ++  F + FV    V  +
Sbjct  78   PVTFTPVNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFNDLFEKHFVLTDGVEGN  137

Query  379  Q--------FKIVSVAPILHAYII--TYCDSGTDN-CYNVGSHYDDQHTTRLALS  510
                     FKI +V    +  +   T CDS ++  C  VG ++DD  T RLAL 
Sbjct  138  SGCGTTANWFKIEAVGDRGYKLVFCPTVCDSSSEAICKYVGIYHDDDGTRRLALG  192



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 86/188 (46%), Gaps = 13/188 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTK-CPSDVIIGS-ELEE  192
            A E   PVVD  G+ + PG  Y + S      G  +    G   + CP  V+    +   
Sbjct  20   ATEKPNPVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGNEICPLAVVQARPDFNR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVF  372
            G+PV FTP +P  +VV  ST LNIKF+  P +  C  +  W+V ++    + FV    V 
Sbjct  80   GHPVTFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVLTDGVE  139

Query  373  SHQ--------FKIVSVAPILHAYII--TYCDSGTDN-CYNVGSHYDDQHTTRLALSTDS  519
             +         FKI     + + ++     CDS ++  C +VG +YDD  T RLALS   
Sbjct  140  GNSGCETEANWFKIELTGNVGYKFVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDQP  199

Query  520  TYEIVIQK  543
                 I+K
Sbjct  200  FVVFFIKK  207



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 94/192 (49%), Gaps = 16/192 (8%)
 Frame = +1

Query  7    RLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SE  183
            R+  AA S  PV+D +GD L  G  Y + S  W  GG  L     +   CP  V+   S+
Sbjct  22   RVANAANS--PVLDIDGDELRTGVQYYVVSALWGAGGGGLALGRATGQSCPEIVVQRRSD  79

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKA  360
            L++G PV+F+ AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V  
Sbjct  80   LDDGTPVIFSNADSKDGVVRVSTDINIEFVPI-RDRLCTTSTVWKLDNYDNSAGKWWVTT  138

Query  361  GDV--------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALS  510
              V         S  FKI     I + +    + CDS T  C ++G H DD    RLALS
Sbjct  139  DGVKGDPGASTMSSWFKIEPAGGIGYKFRFCPSVCDSCTKLCSDIGKHSDDDGQIRLALS  198

Query  511  TDSTYEIVIQKA  546
             DS +  + +KA
Sbjct  199  -DSGWPWIFKKA  209



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 86/176 (49%), Gaps = 14/176 (8%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTK-CPSDVIIG-SELEE  192
            AAE   PV+D  G+ + PG  Y + S  +  GG  +    G   + CP  V+   S+L  
Sbjct  20   AAEEPNPVLDINGEEIRPGVEYHIVSAIFGGGGGGVTYGKGPGNQICPLAVVQALSDLNR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVF  372
            G+PV FTP +P   VV  ST LNIKF+PF  +  C  +  W+V ++    + FV    V 
Sbjct  80   GHPVSFTPVNPEEGVVRVSTDLNIKFSPF--INFCRGSNVWKVHFNEALEQHFVLTDGVE  137

Query  373  SHQ--------FKIVSVAPILH-AYIITYCDSGTDN-CYNVGSHYDDQHTTRLALS  510
             +         FKI    P     +    CDS ++  C +VG +YDD  T RLALS
Sbjct  138  GNSGCETEANWFKIEGNYPFYKLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALS  193



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 93/188 (49%), Gaps = 19/188 (10%)
 Frame = +1

Query  19   AAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELE  189
            AAES   PV+D EG  L  G  Y +L  ++   GGL L S    T  CP DV+    E+ 
Sbjct  45   AAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVS  102

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV  369
             G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  G V
Sbjct  103  NGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGV  159

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                      + FKI          +  T CD     C ++G +  +++  RLALS D  
Sbjct  160  EGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEY-RRLALS-DVP  217

Query  523  YEIVIQKA  546
            ++++ +KA
Sbjct  218  FKVMFKKA  225



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 92/188 (49%), Gaps = 19/188 (10%)
 Frame = +1

Query  19   AAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELE  189
            AAES   PV+D EG  L  G  Y +L  ++   GGL L S    T  CP DV+    E+ 
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVS  80

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV  369
             G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  G V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                      + FKI          +  T CD     C ++G +  + +  RLALS D  
Sbjct  138  EGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNXY-RRLALS-DVP  195

Query  523  YEIVIQKA  546
            ++++ +KA
Sbjct  196  FKVMFKKA  203



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 92/188 (49%), Gaps = 19/188 (10%)
 Frame = +1

Query  19   AAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELE  189
            AAES   PV+D EG  L  G  Y +L  ++   GGL L S    T  CP DV+    E+ 
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVS  80

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV  369
             G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  G V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                      + FKI          +  T CD     C ++G +  +++  RLALS D  
Sbjct  138  EGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEY-RRLALS-DVP  195

Query  523  YEIVIQKA  546
            +++  +KA
Sbjct  196  FKVKFKKA  203



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 91/191 (48%), Gaps = 19/191 (10%)
 Frame = +1

Query  10   LPTAAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
             P AAES   PV+D EG  L  G  Y +L   +   GGL L S       CP DV+    
Sbjct  20   FPVAAESSPDPVLDTEGKQLRSGVDYYILPVIRGRGGGLTLAST--GNENCPLDVVQEQH  77

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKA  360
            E+  G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  
Sbjct  78   EVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTT  134

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V          + FKI          +  T CD     C ++G +  + +  RLALS 
Sbjct  135  GGVEGNPGXETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-  192

Query  514  DSTYEIVIQKA  546
            D  ++++ +KA
Sbjct  193  DVPFKVMFKKA  203



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 91/191 (48%), Gaps = 19/191 (10%)
 Frame = +1

Query  10   LPTAAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
             P AAES   PV+D EG  L  G  Y +L   +   GGL L S       CP DV+    
Sbjct  20   FPVAAESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGGLTLAST--GNENCPLDVVQEQH  77

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKA  360
            E+  G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  
Sbjct  78   EVSNGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTT  134

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V          + FKI          +  T CD     C ++G +  + +  RLALS 
Sbjct  135  GGVEGNPGHETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-  192

Query  514  DSTYEIVIQKA  546
            D  ++++ +KA
Sbjct  193  DVPFKVMFKKA  203



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 85/176 (48%), Gaps = 14/176 (8%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTK-CPSDVIIG-SELEE  192
            A E   PV+D  G+ + PG  Y + S  +  GG  +    G   + CP  V+   S++  
Sbjct  20   ATEEPNPVLDINGEEIRPGVEYHIESAIFGGGGGGVTYGKGPGNEICPLAVVQALSDVNR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVF  372
            G+PV FTP +P   V+  ST LNIKF+PF  +  C  +  W+V ++    + FV    V 
Sbjct  80   GHPVTFTPVNPEEGVIRVSTDLNIKFSPF--INFCRGSNVWKVHFNEALEQHFVLTDGVE  137

Query  373  SHQ--------FKIVSVAPILH-AYIITYCDSGTDN-CYNVGSHYDDQHTTRLALS  510
             +         FKI    P     +    CDS ++  C +VG +YDD  T RLALS
Sbjct  138  GNSGCETEANWFKIEGNYPFYRLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALS  193



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 92/188 (49%), Gaps = 19/188 (10%)
 Frame = +1

Query  19   AAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELE  189
            AAES   PV+D EG  L  G  Y +L  ++   GGL L S    T  CP DV+    E+ 
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVS  80

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV  369
             G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+RFV  G V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                      + FKI          +  T CD     C ++G +  + +  RLALS D  
Sbjct  138  EGNPGRETLDNWFKIEKYDDDYKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-DVP  195

Query  523  YEIVIQKA  546
            ++++ +KA
Sbjct  196  FKVMFKKA  203



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +1

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFS---HQFK  387
              P +TVV  ST    +F      +LCVNNV+W +QYD    +  +KAG+  S   +QFK
Sbjct  58   GRPESTVVMASTYQTFRFN-IATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFK  116

Query  388  IVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ-HTTRLALST  513
            I  V   L+ Y +TYC  G+D CYNVG   D    TTRLALS+
Sbjct  117  IEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSS  159



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 91/188 (48%), Gaps = 14/188 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGSELEEG  195
            A  +++PV+D +GD L  G  Y + S  W  GG  L     +   CP  V+   S+L+ G
Sbjct  24   ANAANSPVLDTDGDELRTGVRYYVVSSIWGAGGGGLALGRATGQSCPEIVVQRRSDLDNG  83

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PV+F+ AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V 
Sbjct  84   TPVIFSNADSKDGVVRLSTDINIEFVPI-RDRLCSTSTVWKLDNYDNSAGKWWVTTDGVR  142

Query  370  -------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                    +  FKI     + + +    + CDS    C ++G H DD    RLALS D+ 
Sbjct  143  GQPGPNTLTSWFKIERAGVLGYKFRFCPSVCDSCKTLCSDIGRHSDDDGQIRLALS-DNG  201

Query  523  YEIVIQKA  546
            +  + +KA
Sbjct  202  WPWMFKKA  209



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 88/183 (48%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +L +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       +R V 
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQRLVT  131

Query  358  AG--------DVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
             G        D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 92/195 (47%), Gaps = 22/195 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  191  SLSDKLSPFLVVFKK  205



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 86/183 (47%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFETNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 91/195 (47%), Gaps = 22/195 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   +  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  191  SLSDKLSPFLVVFKK  205



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 90/195 (46%), Gaps = 22/195 (11%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS  180
            P  L +A  S +PV+D  GD +  G+ Y +       GG  L S       CP D+I  S
Sbjct  21   PSELVSAGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRGGGLLPSNVKQNNSCPRDIIQNS  80

Query  181  -ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
             E++EG PVVFTP DP   V+  ST LN++F       +C     W++  YD +  + F+
Sbjct  81   NEVQEGLPVVFTPVDPKKGVIRLSTDLNVRFF---TPTICARETIWKLGTYDEKLKQYFI  137

Query  355  KAGDV--------FSHQFKIVSVAP----ILHAYIITYCDSGTDNCYNVGSHYDDQHTTR  498
              G V         S+ FKI  +      +    + T+C      C +VG  Y+      
Sbjct  138  VTGGVEGNPGPLTVSNWFKIEKLGTDYKFVFCPSVCTFCKV---ICKDVG-IYNKDGVRF  193

Query  499  LALSTDSTYEIVIQK  543
            LALS D+ + ++ ++
Sbjct  194  LALS-DTPFRVMFKR  207



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = +1

Query  19   AAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELE  189
            AAES   PV+D EG  L  G  Y +L  ++   GGL L S    +  CP DV+    E+ 
Sbjct  23   AAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNES--CPLDVVQEQQEVS  80

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV  369
             G P+ FTP +P   V+  ST  NIKF+      +CV +  W+++YD   G+ FV  G V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFS---ASTICVQSTLWKLEYDESSGQWFVTTGGV  137

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                      + FKI          +  T CD     C ++G +  + +  RLALS D  
Sbjct  138  EGNPGRETLDNWFKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-DVP  195

Query  523  YEIVIQKA  546
            ++++ +KA
Sbjct  196  FKVMFKKA  203



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 91/195 (47%), Gaps = 22/195 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F + FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFINWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFETNRGRIL  190

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  191  SLSDKLSPFLVVFKK  205



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 85/183 (46%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   +  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>prf||1802409A albumin
Length=221

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 89/188 (47%), Gaps = 14/188 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEG  195
            A  +++PV+D +GD L  G  Y + S     GG  L     +   CP  V+   S+L+ G
Sbjct  24   ANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNG  83

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PV+F+ AD    VV  ST +NI+F P    RLC  +  W +  YD   G+ +V    V 
Sbjct  84   TPVIFSNADSKDDVVRVSTDVNIEFVPI-RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVK  142

Query  370  -------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                       FKI     + + +    + CDS T  C ++G H DD    RLALS D+ 
Sbjct  143  GEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALS-DNE  201

Query  523  YEIVIQKA  546
            +  + +KA
Sbjct  202  WAWMFKKA  209



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 89/191 (47%), Gaps = 18/191 (9%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-E  183
            L  AAE   PV+D + + +  G  Y +L   +   GGL L S    T  CP DV+    E
Sbjct  22   LSAAAEEPAPVLDTDRNLVRAGVDYYILPVIRGRGGGLTLASTGNET--CPLDVVQEQLE  79

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKA  360
            +  G P+ F P +P   VV  ST  NIKF+      +CV +  W++  YD   G+ F+  
Sbjct  80   VRNGLPLTFRPVNPKKGVVRVSTDQNIKFSG---ATICVQSTVWKLDNYDASTGKYFITT  136

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V         S+ FKI +        +  T C+     C +VG    D    RLAL+ 
Sbjct  137  GGVEGKPGRETISNWFKIETYGDDYKLVFCPTVCNYCKVICKDVGIFMQDGK-RRLALTE  195

Query  514  DSTYEIVIQKA  546
            D+ + ++++KA
Sbjct  196  DAPFRVMLKKA  206



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 91/192 (47%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--S  180
            L +AAE+   VVD  G  L  G  Y +L   +   GGL L S    +  CP D ++    
Sbjct  21   LSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQK  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E+  G+P+ FTP +P   V+ +ST LNIKF+      +CV    W++  +D   G+ F+ 
Sbjct  79   EINNGFPLTFTPVNPKKGVIRESTDLNIKFS---AASICVQTTLWKLDDFDETTGKYFIT  135

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T C+     C ++G    D  T RLALS
Sbjct  136  IGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDIGIFIQD-GTRRLALS  194

Query  511  TDSTYEIVIQKA  546
             D  ++++ +KA
Sbjct  195  -DVPFKVMFKKA  205



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 89/188 (47%), Gaps = 14/188 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEG  195
            A  +++PV+D +GD L  G  Y + S     GG  L     +   CP  V+   S+L+ G
Sbjct  24   ANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNG  83

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PV+F+ AD    VV  ST +NI+F P    RLC  +  W +  YD   G+ +V    V 
Sbjct  84   TPVIFSNADSKDDVVRVSTDVNIEFVPI-RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVK  142

Query  370  -------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                       FKI     + + +    + CDS T  C ++G H DD    RLALS D+ 
Sbjct  143  GEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALS-DNE  201

Query  523  YEIVIQKA  546
            +  + +KA
Sbjct  202  WAWMFKKA  209



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 92/192 (48%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--S  180
            L +AAES   VVD +G  L  G  Y +L   +   GGL + S+      CP D ++   +
Sbjct  21   LSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSI--GDKMCPLDAVVQEHN  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E+++G P+ FTP DP   V+ +ST LNI F+      +CV    W++  +D   G+ F+ 
Sbjct  79   EIDQGLPLTFTPVDPKKGVIRESTDLNIIFSA---NSICVQTTQWKLDDFDETTGQYFIT  135

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T CD     C ++G    D    RLALS
Sbjct  136  LGGDQGNPGVETISNWFKIEKYDRDYKLLYCPTVCDFCKVICRDIGIFIQD-GVRRLALS  194

Query  511  TDSTYEIVIQKA  546
             D  ++++ +KA
Sbjct  195  -DVPFKVMFKKA  205



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 85/183 (46%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S   V+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTESVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 89/190 (47%), Gaps = 19/190 (10%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--SELEE  192
            A  ++ PV+D +G+ L  G  Y + S  W  GG  L         CP D+++   SEL+ 
Sbjct  24   ANATNKPVLDTDGEELRTGVEYYVVSALWAAGGGGLALGRSRNQSCP-DIVVQRRSELDY  82

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV  369
            G PV+F+P  PN   +  ST L I+F P     LC+    W++  YD   G+ +V AG V
Sbjct  83   GIPVIFSPVKPNDVFIRVSTDLIIEFVPL-RDSLCLTTAVWKLDDYDQSTGKWWVIAGRV  141

Query  370  --------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGS---HYDDQHTTRLALSTD  516
                    F + FKI      +  Y  TYC S  D+C  + S    Y+D    RL LS D
Sbjct  142  AGDAGPHTFPNWFKIEKNG--VFGYKFTYCPSVCDSCTTLCSDIGRYEDNGQIRLGLS-D  198

Query  517  STYEIVIQKA  546
              +  V  KA
Sbjct  199  QGWPFVFTKA  208



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 90/195 (46%), Gaps = 23/195 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI     +   Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKAGVL--GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  189

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  190  SLSDKLSPFLVVFKK  204



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 90/187 (48%), Gaps = 14/187 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEGY  198
            A   ++PV+D++GD L  G  Y + S  W  GG  L     +   CP  V+     ++G 
Sbjct  24   ARADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRVTGQSCPEIVVQRGSDDDGL  83

Query  199  PVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--  369
            PV+F+ AD    VV  ST +NI+F P    RLC+ +  W++  YDP  G+ +V    V  
Sbjct  84   PVIFSNADGKDGVVRLSTDVNIEFVPI-RDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKG  142

Query  370  ------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTY  525
                   +  FKI +   + + +    + CDS    C + G H  D    RLALS ++ +
Sbjct  143  DPGHNTLTSWFKIENAGALGYKFRFCPSVCDSCIHLCNDFGRHGHDGQ-VRLALS-ENGW  200

Query  526  EIVIQKA  546
              + +KA
Sbjct  201  PWIFKKA  207



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 89/187 (48%), Gaps = 14/187 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEGY  198
            A   ++PV+D++GD L  G  Y + S  W  GG  L     +   CP  V+     ++G 
Sbjct  24   ARADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRVTGQSCPEIVVQRGSDDDGL  83

Query  199  PVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--  369
            PV+F+ AD    VV  ST +NI+F P    RLC+ +  W++  YDP  G+ +V    V  
Sbjct  84   PVIFSNADGKDGVVRLSTDVNIEFVPI-RDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKG  142

Query  370  ------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTY  525
                   +  FKI     + + +    + CDS    C + G H  D    RLALS ++ +
Sbjct  143  DPGHNTLTSWFKIEDAGALGYKFRFCPSVCDSCIHLCNDFGRHGHDGQ-VRLALS-ENGW  200

Query  526  EIVIQKA  546
              + +KA
Sbjct  201  PWIFKKA  207



>emb|CAI77773.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI     +   Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKAGVL--GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>emb|CAI77786.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI     +   Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKAGVL--GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 85/183 (46%), Gaps = 21/183 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   S  PV+D +G+ L  GT Y++ S  W  GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +  PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQVLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI   A IL  Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGIL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  190

Query  502  ALS  510
            +LS
Sbjct  191  SLS  193



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 90/193 (47%), Gaps = 19/193 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSE  183
            L +AAE+  PV+D  G  L  G  Y +L   +   GGL L S   +T  CP  V+   SE
Sbjct  23   LSSAAEAPPPVLDISGKELRAGVNYYILPVIRGRGGGLSLASTGNNT--CPLSVVQEQSE  80

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG  363
            L++G P+ F P DP   VV  ST  NIKF+      +CV +  W +  D   G+ FV  G
Sbjct  81   LKKGLPLTFHPVDPKKGVVRLSTDHNIKFS---ASTICVQSTVWRLDNDESTGKYFVNTG  137

Query  364  DV--------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDD-QHTTRLALS  510
             V         S+ FKI +     +  +   T C+     C +VG    D +    L L+
Sbjct  138  GVEGNPGSGSISNWFKIEAYGSSDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLT  197

Query  511  TDST-YEIVIQKA  546
             D T + I+ +KA
Sbjct  198  DDVTPFPIMFKKA  210



>emb|CAI77795.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 89/195 (46%), Gaps = 23/195 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   +  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI     +   Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKAGVL--GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  189

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  190  SLSDKLSPFLVVFKK  204



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 90/192 (47%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--S  180
            L +AAE+   VVD  G  L  G  Y +L   +   GGL L S    +  CP D ++    
Sbjct  21   LSSAAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQQ  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E++ G P+ FTP +P   V+ +ST LNIKF+      +CV    W++  +D   G+ F+ 
Sbjct  79   EIKNGLPLTFTPVNPKKGVIRESTDLNIKFSA---ASICVQTTLWKLDDFDETTGKYFIT  135

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T C+     C +VG    D    RLALS
Sbjct  136  IGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQD-GIRRLALS  194

Query  511  TDSTYEIVIQKA  546
             D  ++++ +KA
Sbjct  195  -DVPFKVMFKKA  205



>emb|CDY11118.1| BnaC06g23700D [Brassica napus]
Length=201

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 86/174 (49%), Gaps = 10/174 (6%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTP  216
            V+D +GD +  G+ Y+L   +   GG+ L    G    CP D++   SE++EG PV F+ 
Sbjct  23   VLDIDGDIIFRGSYYVLPVIRGRGGGVTLQGRGGEL--CPYDIVQESSEVDEGIPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDVFS-HQFKI  390
              P    V +S  LNI+      V +C+ +  W V ++D    E FV AG   S   F  
Sbjct  81   WRPRVAFVPESQDLNIEMDV--EVTICIQSTYWRVGEFDEERKEYFVVAGRQDSPKSFFQ  138

Query  391  VSVAPILHAYIIT--YCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            +  +   + ++     CDSG   C NVG   D+    RLALS++  + ++ +KA
Sbjct  139  IEKSGDDYKFVFCPPACDSGRPRCRNVGIFVDEIGVRRLALSSEP-FLVMFKKA  191



>emb|CAI77790.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 83/183 (45%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+   +  PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEANTEPVLDIQGEELKAGTEYIISSIFWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            +L +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDS----GTDNCYNVGSHYDDQHTTRL  501
              GE      D F++ FKI     +   Y + YC          C +VG +++      L
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKAGVL--GYKLVYCPEDICPSVGLCRDVGIYFESNRGRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>gb|ABG47463.1| vegetative storage protein [Litchi chinensis]
Length=225

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 93/199 (47%), Gaps = 25/199 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-G  177
            P  L  A+E   P+ D  GD ++ GT Y + S     GG  L    G   +CP DV    
Sbjct  19   PNSLLGASE---PLYDINGDEVITGTEYYIVSAIRGGGGGGLNLFSGRNERCPMDVFQHR  75

Query  178  SELEEGYPVVFTPADPN---ATVVFQSTLLNIKFAPFPMVRLCVNNVS-WEV-QYDPRFG  342
            S+L+ G P++F P + N     VV  ST +NI+F   P    C  + + W+V  YD + G
Sbjct  76   SDLQRGSPMMFFPVNYNGEKGAVVRASTDMNIQFNVQP--DACSQHSTVWKVDNYDEKGG  133

Query  343  ERFVKAGDVFS--------HQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQ  486
              F+    V          + FK   V   L+AY I +C S  D+C     +VG +Y  Q
Sbjct  134  AWFITTNGVIGNPGSKTIHNWFKFEKVGTDLNAYKIVHCPSVCDSCVTLCSDVGINYGTQ  193

Query  487  HTTRLALSTDSTYEIVIQK  543
               RLALS+DS    ++ K
Sbjct  194  R--RLALSSDSQKPFMLMK  210



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 90/192 (47%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--S  180
            L +AAES   VVD +G  L  G  Y +L   +   GGL + S+      CP D ++    
Sbjct  25   LSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKI--CPLDAVVQEHQ  82

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E+++G P+ FTP +P   V+ +ST LNI F+      +CV    W++  +D   G+ F+ 
Sbjct  83   EIDQGLPLTFTPVNPKKGVIRESTDLNIIFSA---NSICVQTTQWKLDDFDETTGQYFIT  139

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T CD     C  +G    D    RLALS
Sbjct  140  LGGNQGNPGRETISNWFKIEKFDRDYKLLYCPTVCDFCKVICKEIGIFIQD-GVRRLALS  198

Query  511  TDSTYEIVIQKA  546
             D  ++++ +KA
Sbjct  199  -DVPFKVMFKKA  209



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 17/165 (10%)
 Frame = +1

Query  82   YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTPADPNATVVFQSTLL  258
            Y+L  ++   GGL L S    T  CP DV+    E+  G P+ FTP +P   V+  ST  
Sbjct  5    YILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDH  62

Query  259  NIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV--------FSHQFKIVSVAPILH  414
            NIKF+      +CV +  W+++YD   G+RFV  G V          + FKI        
Sbjct  63   NIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  119

Query  415  -AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
              +  T CD     C ++G +  + +  RLALS D  ++++ +KA
Sbjct  120  LVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-DVPFKVMFKKA  162



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 90/192 (47%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--S  180
            L ++AE+   VVD  G  L  G  Y +L   +   GGL L S    +  CP D ++    
Sbjct  21   LSSSAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQQ  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E++ G P+ FTP +P   V+ +ST LNIKF+      +CV    W++  +D   G+ F+ 
Sbjct  79   EIKNGLPLTFTPVNPKKGVIRESTDLNIKFSA---ASICVQTTLWKLDDFDETTGKYFIT  135

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T C+     C +VG    D    RLALS
Sbjct  136  IGGNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQD-GIRRLALS  194

Query  511  TDSTYEIVIQKA  546
             D  ++++ +KA
Sbjct  195  -DVPFKVMFKKA  205



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 90/192 (47%), Gaps = 20/192 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS--  180
            L +AAE+   V+D  G  L  G  Y +L   +   GGL L S    +  CP D ++    
Sbjct  21   LSSAAEAPPAVIDIAGKKLRTGVDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEHH  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E++ G P+ FTP +P   V+ +ST LNIKF+      +CV    W++  +D   G+ F+ 
Sbjct  79   EIKNGLPLTFTPVNPKKGVIRESTDLNIKFSA---ASICVQTTLWKLDDFDEATGKYFIT  135

Query  358  AG--------DVFSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             G        +  S+ FKI          Y  T C+     C +VG    D  T RLALS
Sbjct  136  IGGNEGNPGRETISNWFKIDKFERDYKLVYCPTVCNFCKVICKDVGIFIQD-GTRRLALS  194

Query  511  TDSTYEIVIQKA  546
             D  ++++ + A
Sbjct  195  -DVPFKVMFKNA  205



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 87/188 (46%), Gaps = 14/188 (7%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEG  195
            A  +++P++D +GD L  G  Y + S     GG  L         CP  V+   SEL+ G
Sbjct  24   ANAANSPLLDTDGDELQTGVQYYVLSSISGAGGGGLALEGVQVQSCPEIVVQRRSELDNG  83

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PV+F+ AD    VV  ST +NI+F P    RLC  +  W +  YD   G+ ++    V 
Sbjct  84   TPVIFSNADSKDDVVRVSTDVNIEFVPIRD-RLCSTSTVWRLDNYDNSAGKWWLATDGVK  142

Query  370  -------FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                       FKI     + + +    + CDS T  C ++G H DD    RLA S D+ 
Sbjct  143  GETGPNTLCSWFKIEKSGVLGYKFRFCPSACDSCTTLCSDIGRHSDDDGQIRLAFS-DNG  201

Query  523  YEIVIQKA  546
            +  + +KA
Sbjct  202  WAWMFKKA  209



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 92/200 (46%), Gaps = 36/200 (18%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS--  180
            L +AAES   VVD +G  L  G  Y +L   +   GGL + S+      CP D ++    
Sbjct  21   LSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKI--CPLDAVVQEHH  78

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK  357
            E+++G P+ FTP +P   V+ +ST LNI F+      +CV    W++  +D   G+ F+ 
Sbjct  79   EIDQGLPLTFTPVNPKKGVIRESTDLNIIFSA---NSICVQTTQWKLDDFDETTGQYFIT  135

Query  358  AG-----------------DVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQ  486
             G                 + F   +K++        Y  T CD     C ++G    D 
Sbjct  136  LGGTQGNPGRETVSNWIKIEKFDRDYKLL--------YCPTVCDICKVICKDIGIFIQD-  186

Query  487  HTTRLALSTDSTYEIVIQKA  546
               RLALS D+ ++++ +KA
Sbjct  187  GVRRLALS-DAPFKVMFKKA  205



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 88/195 (45%), Gaps = 23/195 (12%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+ +   A+ D PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  20   PLPVKGNAQPD-PVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPVDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                + G+PV F+P +P   VV +ST LNIKF        C  +  W++  +D  FG+  
Sbjct  78   QHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DVPFKVVFKK  205



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 91/184 (49%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ L  GT Y +L  ++   GG+ L      +  CP DV+  G EL+ G P+ FT
Sbjct  4    VRDIDGNLLRSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDNGLPLTFT  61

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  62   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTSGNPGGE  115

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  + RLA+S D  ++I 
Sbjct  116  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIK  171

Query  535  IQKA  546
             +KA
Sbjct  172  FRKA  175



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 92/184 (50%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ +  GT Y +L  ++   GG+ L      +  CP DV+  G EL++G P+ FT
Sbjct  4    VRDXDGNLVXSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFT  61

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  62   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGE  115

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  + RLA+S D  ++I 
Sbjct  116  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIK  171

Query  535  IQKA  546
             +KA
Sbjct  172  FRKA  175



>ref|XP_009127987.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Brassica 
rapa]
Length=204

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 87/184 (47%), Gaps = 13/184 (7%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG---S  180
            L   A    PV+D  GD +  G+ Y+L       GGL L    G+   CP  + IG   S
Sbjct  15   LVVTASPGEPVLDINGDIIFDGSYYVLPRIFGPAGGLTLSPRGGN--NCP--LYIGQEYS  70

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQY-DPRFGERFVK  357
            E++ G PV F+        V +ST LNI+        +CV +  W V   D  FG  F+ 
Sbjct  71   EVKRGIPVRFSDWRTKVAFVPESTNLNIEMD--VKATICVQSTYWYVPAPDMVFGAAFIA  128

Query  358  AGDVFSHQ-FKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIV  534
            AG   S+  F+I  +   +  Y I +C +G D C +VG   D     RLAL++ + +E+V
Sbjct  129  AGPKPSNDFFQIKKIEDSIGGYKIVFCFNGED-CVDVGIFVDKHGVRRLALAS-TPFEVV  186

Query  535  IQKA  546
              +A
Sbjct  187  FVRA  190



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 92/184 (50%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ +  GT Y +L  ++   GG+ L      +  CP DV+  G EL++G P+ FT
Sbjct  4    VRDIDGNLVRSGTEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFT  61

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  62   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGE  115

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  + RLA+S D  ++I 
Sbjct  116  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIK  171

Query  535  IQKA  546
             +KA
Sbjct  172  FRKA  175



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 92/184 (50%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ +  GT Y +L  ++   GG+ L      +  CP DV+  G EL++G P+ FT
Sbjct  4    VRDIDGNLVXSGTEYYILPVFRGXGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFT  61

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  62   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGE  115

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  + RLA+S D  ++I 
Sbjct  116  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIK  171

Query  535  IQKA  546
             +KA
Sbjct  172  FRKA  175



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 84/193 (44%), Gaps = 18/193 (9%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS  180
            P  L +A  S +PV+D  GD +  G+ Y +       GG    S       CP D+I  S
Sbjct  21   PSELLSAGPSPSPVLDTNGDKIRTGSNYFVLPVIRGRGGGLFPSNVKQNNTCPRDIIQES  80

Query  181  -ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
             ++++G PVVFTP DP   V+  S+ LN++F       +C     W+V  +D +  + FV
Sbjct  81   LDVQQGLPVVFTPVDPKKGVIRLSSDLNVRFF---TPTICARETIWKVGDFDEKLKQYFV  137

Query  355  KAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYD--DQHTTRLA  504
              G V         S+ FKI  +      Y   +C S    C  +        ++  R  
Sbjct  138  VTGGVEGNPGPQTVSNWFKIEKLG---TDYKFVFCPSVCSFCKVICKDVGIFTKNGVRFL  194

Query  505  LSTDSTYEIVIQK  543
              +D+ + ++ +K
Sbjct  195  ALSDTPFRVMFKK  207



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 87/195 (45%), Gaps = 23/195 (12%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+ +   A+ D PV+D  G  L  G+ Y +L   K   GGL L    G+   CP DV+  
Sbjct  20   PLPVKGNAQPD-PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAG-RGNNKTCPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                + G PV F+P +P   VV +ST LNIKF        C  +  W++  +D  FG+  
Sbjct  78   QHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DIPFKVVFKK  205



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 84/181 (46%), Gaps = 17/181 (9%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFTP  216
            V+D +G+ +  G+ Y+L   +   GGL L    G    CP D++  S EL+EG PV F+ 
Sbjct  23   VLDIDGNIIFRGSYYVLPVIRGRGGGLTLSGRGGEL--CPLDIVQESQELDEGNPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG--------DV  369
              P    V +S  LNI+        +C  +  W V ++D    + F+ AG        D 
Sbjct  81   WRPRVAFVPESQDLNIQTDV--EATICFQSTYWRVGEFDEERKQYFIVAGLKPEGFGQDS  138

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
                FKI       + ++   + CDSG   C +VG   D+    RLALS D  + ++ +K
Sbjct  139  SKSFFKIEKSGDDAYKFVFCPSTCDSGCPKCSDVGIFEDELGVRRLALS-DEPFLVMFKK  197

Query  544  A  546
            A
Sbjct  198  A  198



>gb|ABX76297.1| stigma expressed protein [Nicotiana alata]
Length=243

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 79/167 (47%), Gaps = 26/167 (16%)
 Frame = +1

Query  1    PIRLPTAAESD------TPVVDAEGDALLPGTPYLLRSWKW-THGGLRLVSLDGSTTKCP  159
            PI LPT  + D      + V+D  G  L  G  Y + S  W T GG+ L +L  + TKCP
Sbjct  32   PIVLPTTTDDDNDLPVLSEVLDTNGKPLQIGEEYHIISASWRTGGGVYLTNL--TNTKCP  89

Query  160  SDVIIGSE-LEEGYPVVFTPADPN---ATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQY  327
            +DV+   E  ++G PV F   DP    ++VV ++  +NI F+  P  +LCVN   W+V  
Sbjct  90   NDVVQHWEGSKDGMPVKFFTMDPEVAPSSVVRETNDINIMFS-VPTTKLCVNETVWKVG-  147

Query  328  DP---RFGERFVKAGDVFSH--------QFKIVSVAPILHAYIITYC  435
            DP     G RFV  G    +         FKI  V      Y + YC
Sbjct  148  DPDSTEQGVRFVVTGGTLGYPGPITIKSWFKIEKVTKTAPFYKLRYC  194



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 17/165 (10%)
 Frame = +1

Query  82    YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTPADPNATVVFQSTLL  258
             Y+L  ++   GGL L S    T  CP DV+    E+  G P+ FTP +P   V+  ST  
Sbjct  1938  YILPVFRGRGGGLTLASTGNET--CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDH  1995

Query  259   NIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV--------FSHQFKIVSVAPILH  414
             NIKF+      +CV +  W+++YD   G+RFV  G V          + FKI        
Sbjct  1996  NIKFS---ASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  2052

Query  415   -AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
               +  T CD     C ++G +  + +  RLALS D  ++++ +KA
Sbjct  2053  LVFCPTVCDFCKPVCGDIGIYIQNGY-RRLALS-DVPFKVMFKKA  2095



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 92/191 (48%), Gaps = 18/191 (9%)
 Frame = +1

Query  10   LPTAAESD-TPVVDAEGDALLPGTP-YLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
             P AAE+   PV+D EG  L      Y+L   +   GG   ++  G  T CP DV+    
Sbjct  25   FPVAAEAAPDPVLDIEGKKLRSEVDCYILPVIRRRGGGGLTLASTGKET-CPLDVVQEQH  83

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKA  360
            E+  G P++F P +P   V+  ST  NI+F+      +C+ +  W+++YD   G++FV  
Sbjct  84   EVSNGLPLMFIPVNPKKGVIRVSTDHNIEFS---AATICIQSTVWKLEYDESSGQQFVTT  140

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V         S+ FKI       +  +  T CD     C ++  +  D +  RLALS 
Sbjct  141  GGVEGNPGRGTLSNWFKIEKYEDDNNLVFCPTVCDFCKPVCGDIVIYIQDGY-RRLALS-  198

Query  514  DSTYEIVIQKA  546
            D  ++++ +KA
Sbjct  199  DVPFKVMFKKA  209



>ref|XP_007041757.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOX97588.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 86/191 (45%), Gaps = 17/191 (9%)
 Frame = +1

Query  16   TAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEE  192
            +A + + PV D  GD + PG  Y + S  W  GG  L    G    CP DV    S+L  
Sbjct  20   SATDENVPVYDVNGDEVRPGVQYYVVSAIWGAGGGGLYLGQGRNKTCPYDVAQERSDLVR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGDV  369
            G PV F+  D    V+ +ST LNIKF   P    C  +  W+V  YD   GE FV  G +
Sbjct  80   GIPVTFSTVDTEGDVIHESTDLNIKFIR-PQPTACSPSTVWKVDCYDESGGEWFVTTGGL  138

Query  370  ------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTT------RLALST  513
                   S  F+I + AP   +Y +  C S  ++C         +H++      RL LS 
Sbjct  139  EGDAQALSSLFRI-TAAPGGISYKLALCPSVCESCTKYLCSEIGRHSSGFDSLIRLVLS-  196

Query  514  DSTYEIVIQKA  546
            D+ +  V  KA
Sbjct  197  DNGWPFVFIKA  207



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 23/195 (12%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+ +   A+ D PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  20   PLPVKGNAQPD-PVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPVDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST LNIKF        C  +  W++  +D  FG+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAAFGQWV  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DVPFKVVFKK  205



>gb|AAG52121.1|AC010556_3 putative trypsin inhibitor; 19671-20297 [Arabidopsis thaliana]
Length=208

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 86/188 (46%), Gaps = 17/188 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEG  195
            A+ +   VVD +G+A+   + Y+L   +   GGL L    G    CP D++   SE++EG
Sbjct  16   ASNAYGAVVDIDGNAMFHESYYVLPVIRGRGGGLTLAGRGGQP--CPYDIVQESSEVDEG  73

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG---  363
             PV F+        V +S  LNI+        +C+ +  W V ++D    + FV AG   
Sbjct  74   IPVKFSNWRLKVAFVPESQNLNIETDV--GATICIQSTYWRVGEFDHERKQYFVVAGPKP  131

Query  364  -----DVFSHQFKIVSVAPILHAYIIT--YCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                 D     FKI       + ++     CDSG   C +VG   D+    RLALS D  
Sbjct  132  EGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALS-DKP  190

Query  523  YEIVIQKA  546
            + ++ +KA
Sbjct  191  FLVMFKKA  198



>ref|NP_565061.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
 gb|AAL91212.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AAO00908.1| putative trypsin inhibitor [Arabidopsis thaliana]
 dbj|BAF02103.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AEE35435.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
Length=215

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 86/188 (46%), Gaps = 17/188 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEG  195
            A+ +   VVD +G+A+   + Y+L   +   GGL L    G    CP D++   SE++EG
Sbjct  23   ASNAYGAVVDIDGNAMFHESYYVLPVIRGRGGGLTLAGRGGQP--CPYDIVQESSEVDEG  80

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG---  363
             PV F+        V +S  LNI+      +  C+ +  W V ++D    + FV AG   
Sbjct  81   IPVKFSNWRLKVAFVPESQNLNIETDVGATI--CIQSTYWRVGEFDHERKQYFVVAGPKP  138

Query  364  -----DVFSHQFKIVSVAPILHAYIIT--YCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                 D     FKI       + ++     CDSG   C +VG   D+    RLALS D  
Sbjct  139  EGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALS-DKP  197

Query  523  YEIVIQKA  546
            + ++ +KA
Sbjct  198  FLVMFKKA  205



>gb|AAL85644.1| trypsin inhibitor [Theobroma subincanum]
Length=154

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVMSAIWGAGGGGLALGRATDQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V  G V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGPNT  119

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH  474
             S+ FKI       + Y   +C S  D+C  + S 
Sbjct  120  LSNWFKIEEAGG--NVYKFRFCPSVCDSCATLCSD  152



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 91/184 (49%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ +  G  Y +L  ++   GG+ L      +  CP DV+  G EL++G P+ FT
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFT  58

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  59   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGE  112

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  + RLA+S D  ++I 
Sbjct  113  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIK  168

Query  535  IQKA  546
             +KA
Sbjct  169  FRKA  172



>gb|AAN15685.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=215

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 86/188 (46%), Gaps = 17/188 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEG  195
            A+ +   VVD +G+A+   + Y+L   +   GGL L    G    CP D++   SE++EG
Sbjct  23   ASNAYGAVVDIDGNAMFHESYYVLPVIRGRGGGLTLAGRGGQP--CPYDIVQESSEVDEG  80

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG---  363
             PV F+        V +S  LNI+      +  C+ +  W V ++D    + FV AG   
Sbjct  81   IPVKFSNWRLKVAFVPESQNLNIETDVGATI--CIQSTYWRVGEFDHERRQYFVVAGPKP  138

Query  364  -----DVFSHQFKIVSVAPILHAYIIT--YCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                 D     FKI       + ++     CDSG   C +VG   D+    RLALS D  
Sbjct  139  EGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALS-DKP  197

Query  523  YEIVIQKA  546
            + ++ +KA
Sbjct  198  FLVMFKKA  205



>gb|AAL85637.1| trypsin inhibitor [Herrania mariae]
 gb|AAL85638.1| trypsin inhibitor [Herrania mariae]
 gb|AAL85639.1| trypsin inhibitor [Herrania mariae]
Length=154

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 72/155 (46%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  +     S   CP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYIVSSIWGAGGGGVALGRTSGQSCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST LNI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDGVVRVSTDLNIEFVPI-RDRLCTTSTVWKLDNYDHSAGKWWVTTDGVRGDPGAST  119

Query  370  FSHQFKIVSVAPILHA--YIITYCDSGTDNCYNVG  468
             +  FKI     I H   +  + CDS T  C ++G
Sbjct  120  LTSWFKIEHAGAIGHTLKFCPSVCDSCTTLCSDIG  154



>ref|XP_010416122.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=207

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 83/179 (46%), Gaps = 18/179 (10%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            PV+D +GD +  G+ Y+L   +   GGL L         CP D++   SE++EG PV F+
Sbjct  24   PVLDIDGDIIFDGSYYVLPVIRGQGGGLTLAGR--GDQPCPLDIVQESSEVDEGIPVKFS  81

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG-----DVFSH  378
                    V +S  LNI+        +CV +  W V    +F    V AG     +    
Sbjct  82   NWRSRVGFVPESENLNIETDV--AATICVQSTYWWVDTKAKFR---VTAGPKPEEESLLS  136

Query  379  QFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLAL---STDSTYEIVIQKA  546
             F+I +V    H Y   +C SG   CY+VG   D+    RLAL   S ++ + ++ +KA
Sbjct  137  FFQIQNVYD--HYYQFAFCPSGPKGCYDVGIFVDENGVRRLALTKRSDNTPFLVMFKKA  193



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 92/192 (48%), Gaps = 18/192 (9%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-G  177
            +R   A  + +PV+D  G+ L  G  Y +L   +   GGL L S    T+ CP DV+   
Sbjct  22   LRSVAADAAPSPVLDITGNKLQTGVDYYILPVIRGRGGGLTLASTSNKTS-CPLDVVQEQ  80

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
            +E+  G P+ F+P +    VV  ST LNIKF+      +CV +  W++ ++D + G+ FV
Sbjct  81   NEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFSA---TTICVQSTVWKLGKFDEQTGQWFV  137

Query  355  KAGDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLAL  507
             +G V         S+ FKI          +  T C+     C +VG  + D    RLAL
Sbjct  138  TSGGVEGNPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICGDVGIFFQDGK-RRLAL  196

Query  508  STDSTYEIVIQK  543
            S D  +  + +K
Sbjct  197  S-DVPFRAMFKK  207



>emb|CDY68006.1| BnaA02g35870D [Brassica napus]
Length=205

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 88/185 (48%), Gaps = 14/185 (8%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLL-RSWKWTHGGLRLVSLDGSTTKCPSDVIIG---  177
            L   A    PV+D  GD +  G+ Y+L R +    GGL L    G+   CP  + IG   
Sbjct  15   LVVTASPGEPVLDINGDIIFDGSYYVLPRIFGPAGGGLTLSPRGGN--NCP--LYIGQEY  70

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQY-DPRFGERFV  354
            SE++ G PV F+        V +ST LNI+        +CV +  W V   D  F   F+
Sbjct  71   SEVKRGIPVRFSDWRTKVAFVPESTNLNIEMD--VKATICVQSTYWYVPAPDMVFEAAFI  128

Query  355  KAGDVFSHQ-FKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEI  531
             AG   S+  F+I  +   +  Y I +C +G D C +VG   D     RLAL++ + +E+
Sbjct  129  AAGPKPSNDFFQIKKIEDSIGGYKIVFCFNGED-CVDVGIFVDKHGVRRLALAS-TPFEV  186

Query  532  VIQKA  546
            V  +A
Sbjct  187  VFVRA  191



>gb|AAL85651.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 74/155 (48%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYIVSAIWGAGGGGLDLGRATNQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGVPGPNT  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             S+ FKI      ++ +    + CDS T  C ++G
Sbjct  120  LSNWFKIEEAGGNIYKFRFCPSVCDSCTTLCSDIG  154



>gb|AAL85643.1| trypsin inhibitor [Theobroma angustifolium]
Length=154

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVVSTIWGAGGGGLDLGRATNQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGEPGPNT  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             S+ FKI      L+ +    + CDS    C ++G
Sbjct  120  LSNWFKIEEAGGTLYKFRFCPSVCDSCATLCSDIG  154



>gb|AAL85648.1| trypsin inhibitor [Theobroma obovatum]
 gb|AAL85649.1| trypsin inhibitor [Theobroma obovatum]
Length=154

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVVSVIWGAGGGGLALGRATDQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V  G V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGPNT  119

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH  474
             S+ FKI       + Y   +C S  D+C  + S 
Sbjct  120  LSNWFKIEEAGG--NVYKFRFCPSVCDSCATLCSD  152



>gb|AAL85650.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 74/155 (48%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVVSAIWGAGGGGLDLGRATNQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGVPGPNT  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             S+ FKI      ++ +    + CDS T  C ++G
Sbjct  120  LSNWFKIEEAGGNIYKFRFCPSVCDSCTTLCSDIG  154



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 88/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA  +  V+  ST LNIKF+   + + CV++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSDDDVIRVSTDLNIKFS---IKKACVHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 80/178 (45%), Gaps = 15/178 (8%)
 Frame = +1

Query  10   LPTAAESD-TPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSE  183
             P AAE+   PV+D EG  L     Y + S     GG  L         CP DV+   +E
Sbjct  20   FPVAAEAAPDPVLDTEGKKLQSEVDYYILSVIRRRGGGGLTLASTGNKTCPLDVVQEQNE  79

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG  363
            +  G  ++F+P +P   V+  ST  NI+F+      +CV +  W+++YD   G+ F   G
Sbjct  80   VSNGLTLMFSPVNPKKGVIRVSTDHNIEFSA---ATICVQSTVWKLEYDESSGQWFFTTG  136

Query  364  DV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
             V         S+QFKI       +  +  T CD     C ++G +  D +   LALS
Sbjct  137  WVEGNLGRGTLSNQFKIEKYEDDNNLVFCPTVCDFCKPVCGDIGIYIQDGY-RHLALS  193



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 90/191 (47%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + +   +   CP DV++  +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAT---TGADCPLDVVV-VDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C     W+++ YD    +RFV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVATSCPQTTVWKLKDYDYSTSQRFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNC-YNVG--SHYDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C Y  G    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCGDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 90/188 (48%), Gaps = 18/188 (10%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEE  192
            A  + +PV+D  G+ L  G  Y +L   +   GGL L S    T+ CP DV+   +E+  
Sbjct  27   ADAAPSPVLDITGNKLQTGVNYYILPVIRGRGGGLTLASTSNKTS-CPLDVVQEQNEVSN  85

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV  369
            G  + F+P +    VV  ST LNIKF+      +CV +  W++ ++D + G+ FV +G V
Sbjct  86   GLSLKFSPVNVTKGVVLVSTDLNIKFSA---TTICVQSTVWKLGKFDEQTGQWFVTSGGV  142

Query  370  --------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                     S+ FKI          +  T C+     C +VG  + D    RLALS D  
Sbjct  143  EGNPGRQTTSNWFKIEKFGDDYKLVFCPTVCNFCKVICRDVGIFFQDGK-RRLALS-DVP  200

Query  523  YEIVIQKA  546
            +  + +KA
Sbjct  201  FRAMFKKA  208



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 82/189 (43%), Gaps = 22/189 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEG  195
            A  S +PV+D  GD +  G+ Y +       GG  L S       CP D+I  S E+++G
Sbjct  27   AGSSPSPVLDINGDKVRVGSNYFVLPVIRGRGGGLLPSNVKQINTCPRDIIQNSDEVQQG  86

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PVVFTP D    VV  ST LN++F       +C     W++  YD +  + F+  G V 
Sbjct  87   LPVVFTPFDAKKGVVRLSTDLNVRFY---TPTICARETIWKLGTYDDKLKQYFIVTGGVE  143

Query  370  -------FSHQFKIVSVAPILHAYIITYCDSGTD----NCYNVGSHYDDQHTTRLALSTD  516
                    S  FKI  +      Y   +C S        C +VG +  D    R    +D
Sbjct  144  GNPGPQTVSSWFKIEKLG---TDYKFLFCPSVCKICKVICKDVGIYTKDG--VRFLALSD  198

Query  517  STYEIVIQK  543
            + + ++ +K
Sbjct  199  TPFRVMFKK  207



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 85/195 (44%), Gaps = 25/195 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDIAGKQLRAGSKYYILPVTKGQGGGLTLAGRSNNKT-CPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
               L  G+PV F+P +P   VV +ST LNIK   F     C  +  W++  +D   G+  
Sbjct  78   QHSLRNGFPVTFSPVNPKKGVVRESTDLNIK---FDAATSCAQSTVWKLDNFDAALGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + +C S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DVPFKVVFKK  205



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + CV++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACVHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_006477858.1| PREDICTED: 21 kDa seed protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477859.1| PREDICTED: 21 kDa seed protein-like isoform X2 [Citrus sinensis]
Length=213

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 83/189 (44%), Gaps = 21/189 (11%)
 Frame = +1

Query  13   PTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGSELE  189
            P  A  D P+VD  G+ +     Y + S     GG  L    G    CP DVI + S+L 
Sbjct  20   PLVAHPD-PLVDVNGNEVEASRDYYVVSLISGAGGGGLTLFRGRNELCPLDVIQLSSDLR  78

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGD  366
             G  + F   + N  ++ ++  LN++F+       C     W+V  YDP  G+ F+  G 
Sbjct  79   RGTRLRFATYN-NTRIIHENVDLNVRFS---TATRCNEPTVWKVDNYDPSRGKWFITTGG  134

Query  367  V--------FSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALS  510
            +          + FK   +     AY I +C S  ++C     +VG  YDD    RLAL+
Sbjct  135  IEGNPGAQTLKNWFKFERIGRDRDAYKIVHCPSVCESCVSLCNDVGVSYDDNR--RLALT  192

Query  511  TDSTYEIVI  537
             +  + +V+
Sbjct  193  KERAFAVVL  201



>gb|AEK26924.1| Kunitz-type trypsin inhibitor C4 [Populus nigra]
Length=178

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 73/157 (46%), Gaps = 22/157 (14%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEE----GYP  201
            PV+DA G+ L  G  YL   +     G L LV+ +GS   CP    +G E       G P
Sbjct  6    PVLDAGGEPLRSGVEYLADPAVADVAGSLTLVARNGS---CP--FYVGQESARSGRLGIP  60

Query  202  VVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDVFSH  378
            V+FTP +P  T++ +ST +N+ F+    V  CV N +W +   DP+   RFV  G   S+
Sbjct  61   VIFTPRNPQETIITESTEVNVTFS---GVSTCVRNTAWTIGGEDPQTRRRFVATGAEPSY  117

Query  379  QFKIVSVAPILHAYIITYC-------DSGTDNCYNVG  468
             F+I S   +  +Y    C       D G   C   G
Sbjct  118  -FQIKSRNQLGGSYTFQGCPQCVDEPDCGRPTCGTAG  153



>ref|XP_010428249.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
 ref|XP_010428250.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 18/179 (10%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            PV+D +GD +  G+ Y+L       GGL L         CP D++   SE++EG PV F+
Sbjct  25   PVLDIDGDIIFRGSYYVLPVISGQGGGLTLAGR--GDQPCPLDIVQESSEVDEGIPVKFS  82

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG-----DVFSH  378
                    V +S  LNI+        +CV +  W V    +F    V AG     +    
Sbjct  83   NWRSRVGFVPESENLNIETDV--KATICVQSTYWWVDTKAKFR---VTAGPKPEEESLLS  137

Query  379  QFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALST---DSTYEIVIQKA  546
             F+I  V    H Y   +C SG   CY+VG   D+    RLAL+    D+ + ++ +KA
Sbjct  138  FFQIQHVYD--HFYQFAFCPSGPKGCYDVGIFVDENGVRRLALTKRTDDTPFLVMFKKA  194



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 93/195 (48%), Gaps = 23/195 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  G  Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEAYTEPVLDIQGEELKAGAEYIISSAIWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +L  G PV F+PA+    V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DLLRGLPVTFSPANYGDDVIRISTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AG--------DVFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G        D  ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  132  TGGEEGNPGVDTLTNWFKI-EKAGIL-GYKLVFCPKDICHCGVLCRDIGIYFENNRGRIL  189

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  190  SLSDQLSPFVVVFKK  204



>ref|XP_010428237.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 83/181 (46%), Gaps = 17/181 (9%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFTP  216
            V+D +G+ +  G+ Y+L   +   GGL L    G    CP D++  S E++EG PV F+ 
Sbjct  23   VLDIDGNIIFRGSYYVLPVIRGRGGGLTLSGRGGEL--CPLDIVQESQEVDEGNPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG--------DV  369
              P    V +S  LNIK        +C  +  W V ++D    + F+ AG        D 
Sbjct  81   WRPRVAFVPESQDLNIKTDV--EATICFQSTYWRVGEFDEERKQYFIVAGLKPEGFGQDS  138

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
                FKI       + ++   + CDS    C +VG   D+    RLALS D  + ++ +K
Sbjct  139  SKSFFKIEKSGDDAYKFVFCPSTCDSDCPKCSDVGIFVDELGVRRLALS-DDPFLVMFKK  197

Query  544  A  546
            A
Sbjct  198  A  198



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 83/195 (43%), Gaps = 25/195 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPVDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST LNIKF        C  +  W++  +D   G+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAALGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGNYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DVPFKVVFKK  205



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = +1

Query  34   TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVV  207
            +PV+D  G  L  GT Y +L   +   GGL L S   +TT CP DV+    E+  G P+ 
Sbjct  28   SPVLDITGKKLRTGTDYYILPVIRGRGGGLTLASTS-NTTSCPLDVVQEQHEVSNGLPLT  86

Query  208  FTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV  369
            F+P +P   VV  ST  NIKF+      +CV +  W++ ++D + G+ FV +G V
Sbjct  87   FSPVNPKKGVVRVSTDHNIKFS---AATICVQSTMWKLDKFDEQTGQWFVTSGGV  138



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 86/195 (44%), Gaps = 23/195 (12%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+ +   A+ D PV+D  G  L  G+ Y +L   K   GGL L    G+   CP DV+  
Sbjct  20   PLPVKGNAQPD-PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAG-RGNNKTCPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                + G PV F+P +P   VV +ST +NIK         C  +  W++  +D  FG+  
Sbjct  78   QHSFKNGLPVTFSPVNPKKGVVRESTDINIKLD---AATSCAQSTVWKLDNFDAAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DIPFKVVFKK  205



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 23/195 (12%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+ +   A+ D PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  20   PLPVKGNAQPD-PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRRNNKT-CPLDVVQE  77

Query  178  SE-LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                + G PV F+P +P   VV +ST LNIK   F     C  +  W++  +D  FG+  
Sbjct  78   QHSFKNGLPVTFSPVNPKKGVVRESTDLNIK---FDAATSCAQSTVWKLDNFDAAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V  K
Sbjct  192  LALS-DVPFKVVSSK  205



>gb|AAK96757.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=205

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 85/188 (45%), Gaps = 17/188 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEG  195
            A+ +   VVD +G+A+   + Y+L   +   GGL L    G    CP D++   SE++EG
Sbjct  23   ASNAYGAVVDIDGNAMFHESYYVLPVIRGRGGGLTLAGRGGQP--CPYDIVQESSEVDEG  80

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG---  363
             PV F+        V +S  LNI+      +  C+ +  W V ++D    + FV AG   
Sbjct  81   IPVKFSNWRLKVAFVPESQNLNIETDVGATI--CIQSTYWRVGEFDHERRQYFVVAGPKP  138

Query  364  -----DVFSHQFKIVSVAPILHAYIIT--YCDSGTDNCYNVGSHYDDQHTTRLALSTDST  522
                 D     FKI       + ++     CDSG   C +VG   D+    RLALS D  
Sbjct  139  EGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALS-DKP  197

Query  523  YEIVIQKA  546
            +   +QK+
Sbjct  198  FLGYVQKS  205



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 79/169 (47%), Gaps = 18/169 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFT  213
            V+D +G+ L  GT Y +L  ++   GGL + S    T  CP DV+    E+ +G P+ FT
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET--CPLDVVQDPLEISKGLPLTFT  90

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVKAGDV-------  369
            P +P   V+  ST LNIKF+      +CV +  W++Q       + FV  G V       
Sbjct  91   PVNPKKGVIRVSTDLNIKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  370  -FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
              ++ FKI          +  T CD G   C +VG +  D     L+LS
Sbjct  148  TITNWFKIEKAGDDYKLVFCPTVCDCGA-LCRDVGIYIHDNGVRTLSLS  195



>ref|XP_006302823.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
 gb|EOA35721.1| hypothetical protein CARUB_v10020954mg [Capsella rubella]
Length=208

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 83/183 (45%), Gaps = 21/183 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTP  216
            V+D +G+ +  G+ Y+L   +   GGL L    G    CP D++   SE++EG PV F+ 
Sbjct  23   VLDIDGNIIFRGSYYVLPLIRGRGGGLTLAGRGGEL--CPLDIVQESSEVDEGIPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG--------DV  369
              P    V +S  LNI+        +CV +  W V ++D    + FV AG        D 
Sbjct  81   WRPRVGFVPESEDLNIETD--VGATICVQSTYWRVGEFDEERKQYFVVAGPKPEGFGQDS  138

Query  370  FSHQFKIVSVAPILHAYIITYC----DSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVI  537
                FKI        AY   +C    DS    C +VG   D+    RLALS D  + ++ 
Sbjct  139  LKSFFKIEKSGD--DAYKFVFCPRTWDSSCPKCSDVGVFVDELGVWRLALS-DEPFLVMF  195

Query  538  QKA  546
            +KA
Sbjct  196  KKA  198



>ref|XP_010471385.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 83/181 (46%), Gaps = 17/181 (9%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFTP  216
            V+D +G+ +  G+ Y+L   +   GGL L    G    CP D++  S E++EG PV F+ 
Sbjct  23   VLDIDGNIIFRGSYYVLPVIRGRGGGLTLSGRGGEL--CPLDIVQESQEVDEGNPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG--------DV  369
              P    V +S  LNI+        +C  +  W V ++D    + F+ AG        D 
Sbjct  81   WRPRVAFVPESQDLNIQTDV--EATICFQSTYWRVGEFDEERKQYFIVAGLKPEGFRQDS  138

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
                FKI       + ++   + CDSG   C ++G   D+    RLAL  D  + ++ +K
Sbjct  139  SKSFFKIEKSGDDAYKFVFCPSTCDSGCPKCSDIGIFEDELGVRRLALR-DEPFLVMFKK  197

Query  544  A  546
            A
Sbjct  198  A  198



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 79/169 (47%), Gaps = 18/169 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFT  213
            V+D +G+ L  GT Y +L  ++   GGL + S    T  CP DV+    E+ +G P+ FT
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET--CPLDVVQDPLEISKGLPLTFT  90

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVKAGDV-------  369
            P +P   V+  ST LNIKF+      +CV +  W++Q       + FV  G V       
Sbjct  91   PVNPKKGVIRVSTDLNIKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  370  -FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
              ++ FKI          +  T CD G   C +VG +  D     L+LS
Sbjct  148  TITNWFKIEKAGDDYKLVFCPTVCDCGA-LCRDVGIYIHDNGVRTLSLS  195



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 81/186 (44%), Gaps = 14/186 (8%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEE  192
            AAE   PV+D +GD +  G  Y ++ S +   GG            CP  V+    +L  
Sbjct  20   AAEKPNPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNESCPLPVVQEKLDLLR  79

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV-  369
            G+PV FTP +    VV  ST LNIKF+    V  C  +  W++ +D   G+ F+    V 
Sbjct  80   GHPVTFTPVNSKEGVVRVSTDLNIKFSKAAPV--CNESNVWKLDFDEELGQHFILTNGVE  137

Query  370  -------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYE  528
                     + FKI    P   +Y + +C +  + C  +          RLAL    ++ 
Sbjct  138  GNPGCGTIHNWFKI--EGPYHKSYRLVFCPTVCNICNVICKDVGVFSDRRLALGGTRSFT  195

Query  529  IVIQKA  546
            + IQKA
Sbjct  196  VFIQKA  201



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 92/195 (47%), Gaps = 23/195 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  G  Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEAYTEPVLDIQGEELKAGAEYIISSAIWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +L  G PV F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DLLRGLPVTFSPASSDDDVIRVSTDLNIKFS---IEKACDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AG--------DVFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G        D   + FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  132  TGGAEGNPGVDTLFNWFKI-EKAGIL-GYKLVFCPKDICHCGVLCRDIGIYFENNRGRIL  189

Query  502  ALSTD-STYEIVIQK  543
            +LS   S + +V +K
Sbjct  190  SLSDQLSPFVVVFKK  204



>ref|XP_002888920.1| hypothetical protein ARALYDRAFT_476458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65179.1| hypothetical protein ARALYDRAFT_476458 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 83/183 (45%), Gaps = 20/183 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTP  216
            V+D +G+ +   + Y+L   +   GGL L    G    CP D++   SELEEG PV F+ 
Sbjct  23   VLDIDGNTIFHESYYVLPVIRGRGGGLTLAGRGGEL--CPLDIVQESSELEEGIPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG--------DV  369
                   V +S  LNI+        +CV +  W V  +D    + FV AG        D 
Sbjct  81   WRLKVAFVPESENLNIETDI--GATICVQSTYWWVGDFDHERKQYFVVAGPKPEGFGQDS  138

Query  370  FSHQFKIVSVAPILHAYIITYC----DSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVI  537
                FKI      L AY   +C    DSG+  C +VG   D+    RLALS D  + ++ 
Sbjct  139  LKSFFKIEKSGD-LGAYKFVFCPRTCDSGSPKCSDVGIFVDELGVRRLALS-DEPFLVMF  196

Query  538  QKA  546
            +KA
Sbjct  197  KKA  199



>gb|AAL85652.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYIVSAIWGAGGGGLDLGRATNQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGVPGPNT  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             S+ FKI      ++ +    + CDS    C ++G
Sbjct  120  LSNWFKIEEAGGNIYKFRFCPSVCDSCATLCSDIG  154



>gb|AAL85640.1| trypsin inhibitor [Herrania albiflora]
 gb|AAL85641.1| trypsin inhibitor [Herrania sp. 'Columbia']
Length=154

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (47%), Gaps = 13/149 (9%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     S   CP  V+   S+L++G PV+F+ 
Sbjct  1    VLDTDGDELQTGVEYYVVSAIWGAGGGGLALGRASDQSCPEIVVQRRSDLDDGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST LNI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDLNIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGEPGART  119

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNC  456
             +  FKI S   +   Y   +C S  D+C
Sbjct  120  LTSWFKIESAGAL--GYKFRFCPSVCDSC  146



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 74/172 (43%), Gaps = 14/172 (8%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLD--GSTTKCPSDVI-IGSELEEGYPVV  207
            PV+D +G+ L  GT Y +      HGG   VS      T  CP  V+    E++   P+ 
Sbjct  35   PVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLA  94

Query  208  FTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV------  369
            F P +P   VV  ST LNI F+ F   R   + V    +YD   G+ FV  G V      
Sbjct  95   FFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGP  154

Query  370  --FSHQFKIVSVAPILHAYII---TYCDSGTDNCYNVGSHYDDQHTTRLALS  510
               S  FKI          ++   T C S    C +VG + D +   RLALS
Sbjct  155  ETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALS  206



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 85/195 (44%), Gaps = 25/195 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R   +A+   PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVRGNASAD---PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPVDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST +NIK   F     C  +  W++  +D   G+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDINIK---FDAATSCAQSTVWKLDNFDAAIGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D  +++V +K
Sbjct  192  LALS-DVPFKVVFKK  205



>ref|XP_009133369.1| PREDICTED: trypsin inhibitor DE-3-like [Brassica rapa]
Length=215

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 82/185 (44%), Gaps = 15/185 (8%)
 Frame = +1

Query  25   ESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDV-IIGSELEEGYP  201
            ++  P+ D +GD +   T Y +    W  GG  L  + G   +CP  V   GS+L+ G P
Sbjct  20   QAGGPIFDTDGDVIFGSTSYYVLPIFWGAGGGGLTLVPGHGNQCPLFVGQYGSDLKRGIP  79

Query  202  VVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV--QYDPRFGERFVKAG----  363
            V F+      T V +S  LNIK    P +  C +++ W V       F   F+ AG    
Sbjct  80   VRFSNWRSRVTNVPESENLNIKMDTEPTI--CPDSLYWWVTPAVMSDFRTFFITAGPKPE  137

Query  364  ----DVFSHQFKIV-SVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYE  528
                D     F+I+      L AY I +C+   D C +VG + D     RL + + + + 
Sbjct  138  AGEEDSSRSFFQIIKKTVGQLDAYNIVFCNDHND-CVDVGVNTDQGGVRRLDVGSTTPFN  196

Query  529  IVIQK  543
            +V +K
Sbjct  197  VVFEK  201



>emb|CDY69418.1| BnaAnng30440D [Brassica napus]
Length=205

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 85/185 (46%), Gaps = 14/185 (8%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLL-RSWKWTHGGLRLVSLDGSTTKCPSDVIIGSEL  186
            L   A +  PV+D  GD +  G+ Y+L R +    GGL L    G+   CP  + IG E 
Sbjct  15   LAATANAGGPVLDINGDIIFDGSYYVLPRIFGPGGGGLTLAPRGGN--HCP--LYIGQEY  70

Query  187  EE---GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQY-DPRFGERFV  354
             E   G PV F+        V +S  LNIK        +C  +  W V   D    E ++
Sbjct  71   SEVNMGIPVRFSDWRIKVAFVPESANLNIKMD--VAATICAQSTYWNVAGPDIVMKEVYL  128

Query  355  KAGDVFSHQ-FKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEI  531
             AG   S+  F+I  +   L  Y I YC +G+    ++G   D Q   RLALS+ S +E+
Sbjct  129  PAGPKPSNGLFQIKKIKDALAGYKIVYCPNGSYYS-DIGIFVDKQGVRRLALSSTS-FEV  186

Query  532  VIQKA  546
            V  KA
Sbjct  187  VFVKA  191



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 80/186 (43%), Gaps = 20/186 (11%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-  174
            P+ +   A    PV D +GD L  G  Y +L   +   GGL L S    T  CP DV+  
Sbjct  32   PLLVAVHAADPAPVRDIKGDNLQTGVEYWILPVIRGKGGGLTLASNRNKTIGCPLDVVQE  91

Query  175  GSELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVS-WEV-QYDPRFGER  348
             SE+  G P+ F+P +    VV  ST LNIKF+    V LC      W++ + D   G+R
Sbjct  92   QSEVSNGLPLTFSPVNLTKGVVRLSTDLNIKFSTSAAVTLCPQTSKVWKLDEVDESTGQR  151

Query  349  FVKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHT  492
             V  G V          + FKI         Y + +C      C     +VG H  +   
Sbjct  152  SVTTGGVEGNPSPKTLMNWFKIEKYD---DDYKLVFCPKVCRFCRVICGDVGVHL-ESGV  207

Query  493  TRLALS  510
             RLALS
Sbjct  208  RRLALS  213



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 80/166 (48%), Gaps = 20/166 (12%)
 Frame = +1

Query  82   YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTPADPNATVVFQSTLL  258
            Y+L  ++   GG+ L      +  CP DV+  G EL+ G P+ FTP DP   V+ +ST L
Sbjct  5    YILPVFRGRGGGVTLAPTRNES--CPLDVVQEGFELDNGLPLTFTPVDPKKGVIRESTDL  62

Query  259  NIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGDVFSHQFKIVSVAPIL  411
            NI F+      +C+ +  W + +Y+   G+R +          G+  S+ FKI       
Sbjct  63   NIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTSGNPGGETISNWFKIEKYENDY  116

Query  412  H-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
               Y  T CD     C ++G  + +  + RLA+S D  ++I  +KA
Sbjct  117  KLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIKFRKA  161



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 79/169 (47%), Gaps = 18/169 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFT  213
            V+D +G+ L  GT Y +L  ++   GGL + S    T  CP DV+    E+ +G P+ FT
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET--CPLDVVQDPLEISKGLPLTFT  90

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVKAGDV-------  369
            P +P   V+  ST LNIKF+      +CV +  W++Q       + FV  G V       
Sbjct  91   PVNPKKGVIRVSTDLNIKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  370  -FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
              ++ FKI          +  T CD G   C +VG +  D     L+LS
Sbjct  148  TITNWFKIEKADDDYKLVFCPTVCDCGA-LCRDVGIYIHDNGVRTLSLS  195



>emb|CAI77767.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77778.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77779.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 89/196 (45%), Gaps = 22/196 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S     GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEADTEPVLDIQGEELKAGTEYIITSIFRGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            ++ +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DVFQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPIL-HAYIITYCDS----GTDNCYNVGSHYDDQHTTR  498
              GE      D F++ FKI   A    + Y + +C          C +VG +++      
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGIYFESNRGRI  191

Query  499  LALSTD-STYEIVIQK  543
            L+LS   S + +V +K
Sbjct  192  LSLSDKLSPFLVVFRK  207



>emb|CAI77771.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 89/196 (45%), Gaps = 22/196 (11%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S     GG  + +   +   CP DVI  S 
Sbjct  18   LSVPSIEADTEPVLDIQGEELKAGTEYIITSIFRGAGGGDVAA---TNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF-------  339
            ++ +G PV F+PA     V+  ST LNIKF+   + + C  +  W++Q            
Sbjct  75   DVFQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDRSSVWKIQKSSNSEVQWLVT  131

Query  340  --GERFVKAGDVFSHQFKIVSVAPIL-HAYIITYCDS----GTDNCYNVGSHYDDQHTTR  498
              GE      D F++ FKI   A    + Y + +C          C +VG +++      
Sbjct  132  TGGEEGNPGCDTFTNWFKIEKGAGTFGYNYKLVFCPEDICPSVGLCRDVGIYFESNRGRI  191

Query  499  LALSTD-STYEIVIQK  543
            L+LS   S + +V +K
Sbjct  192  LSLSDKLSPFLVVFRK  207



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 92/205 (45%), Gaps = 32/205 (16%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDAL--------LPGTPYLLRSWK--WTHGGLRLVSLDGSTT  150
            P+ L  A  +  PV+D  G  L        +P  P+ +  +   +T GGL L S+D S  
Sbjct  18   PLLLGAAGAAPEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSIDES--  75

Query  151  KCPSDVIIGSELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QY  327
             CP DVII  +  EG P+ F+P +    V+  ST LNI F+     R   ++  W + Q+
Sbjct  76   -CPLDVII-EKANEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDE-RCPHHSTVWMLDQF  132

Query  328  DPRFGERFVKAGDVFSHQ--------FKIVSVAPILHAYIITYCDSGTDNCY----NVGS  471
            D   G+ +V  G V  +         FKI        AY + YC     +C+    ++G 
Sbjct  133  DASIGQTYVTTGGVVGNPGEHTILNWFKIQKYE---DAYKLVYCPRVCPSCHHLCKDIGM  189

Query  472  HYDDQHTTRLALSTDSTYEIVIQKA  546
              D      LALS D  ++I  ++A
Sbjct  190  FVDANRRMHLALS-DDPFKIKFKEA  213



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEAYTEPVLDIQGEQLKAGTEYIISSAIWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +L +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DLLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKDCDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  132  TGGEEGNPGVHTITNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>gb|ACO40153.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSKVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 88/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGS  180
            + +P+      PV+D +G+ L  GT Y++ S  +  GG     +  +   CP DVI   S
Sbjct  18   LSVPSIEAYTEPVLDIQGEELKAGTEYIIGSIFFGAGG---GDVSATNKTCPDDVIQYSS  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +L +G PV F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DLLQGLPVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AG--------DVFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G        D  ++ FKI   A IL  Y +  C  G  +    C ++G + ++     L
Sbjct  132  TGGEEGNPGIDTLTNWFKI-EKAGIL-GYKLVSCPEGICHCGVLCRDIGIYRENDGRRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>emb|CAC19831.1| hypothetical protein [Avicennia marina]
Length=202

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 84/182 (46%), Gaps = 21/182 (12%)
 Frame = +1

Query  22   AESDTPVVDAEGDALLPGTPYLLRSWKWTHGG----LRLVSLDGSTTKCPSDV-IIGSEL  186
            A ++  V+D EG+ L  G+ Y + S  W  GG    LRL   D    +CP  V   GS+L
Sbjct  26   AAAEEAVLDIEGNELQAGSKYYMVSAIWGAGGGGVTLRLTGND----RCPVTVGQEGSDL  81

Query  187  EEGYPVVFTPADPNATVVFQSTLLNIKF-APFPMVRLCVNNVSWEV-QYDPRFGERFVK-  357
              G PV F PA+   TVV  ST LNIKF    P    C N+  W V + D      F++ 
Sbjct  82   RNGLPVSFQPANSEETVVRVSTQLNIKFEVSVP----CANSTVWRVGRLDAWTRTSFIQI  137

Query  358  AGDVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVI  537
             G+     F+I  V+ + + Y +      +    N+   ++      L LS  +++ +V 
Sbjct  138  EGEPGFDWFEIEKVSELANIYKVV-----SRGGQNIAVIFNMVGQRILGLSPANSFLVVF  192

Query  538  QK  543
            +K
Sbjct  193  RK  194



>ref|XP_010428240.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=210

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 85/182 (47%), Gaps = 21/182 (12%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            PV+D +GD +  G+ Y+L   +   GGL L         CP D++   SE++EG PV F+
Sbjct  25   PVLDTDGDIIFGGSYYVLPVIRGQGGGLTLAGR--GDQPCPLDIVQESSEVDEGIPVKFS  82

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG--------DV  369
                    V +S  LNI+        +CV +  W V  + +F    V AG        + 
Sbjct  83   NWRSKVGFVPESANLNIETEV--AATICVQSAYWWVDENAKFR---VTAGPKPDELVKES  137

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALST---DSTYEIVIQ  540
            +   F+I +V    H Y   +C +G  +C +VG   D+    RLAL+    ++ + ++ +
Sbjct  138  YLSFFQIQNVYD--HFYQFAFCPTGPKSCSDVGVFVDENGVRRLALTKRADNTPFLVMFK  195

Query  541  KA  546
            KA
Sbjct  196  KA  197



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 89/191 (47%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV++  +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVVV-VDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C     W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVATSCPQTTVWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNC-YNVG--SHYDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C Y  G    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCGDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>ref|XP_009105980.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Brassica 
rapa]
 emb|CDX96461.1| BnaA07g30720D [Brassica napus]
Length=209

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 81/180 (45%), Gaps = 17/180 (9%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPY--LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVV  207
            P+ D +GD +  G+ Y  L   W  T GGL L SLD    +CP  +    SE+E G PV 
Sbjct  24   PIFDTDGDVIFGGSSYYVLPAIWGPTGGGLTLSSLD--DKQCPLYIQKEDSEVERGIPVK  81

Query  208  FTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV--QYDPRFGERFVKAG-----D  366
            F+   P    V +S  LNI+        +CV +  W V   + P     F+ AG     D
Sbjct  82   FSNWKPRVGFVPESENLNIEMD--VAATICVQSTYWWVAPSHLPIM-TFFIAAGPKPGED  138

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
                 F+I       + Y IT+C SG   C +VG   D     RLA+ ++  +  V +KA
Sbjct  139  SSRSFFQIKKTGGFHNGYKITFC-SGDGGCDDVGIARDANGVGRLAVGSEP-FPFVFRKA  196



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 26/169 (15%)
 Frame = +1

Query  82   YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTPADPNATVVFQSTLL  258
            Y L  +    GG+ L      +  CP DV+  G EL++G P+ FTP DP   V+ +ST L
Sbjct  3    YXLPVFXGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDL  60

Query  259  NIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGDVFSHQFKIVSVAPIL  411
            NI F+      +C+ +  W + +Y+   G+R +          G+  S+ FKI       
Sbjct  61   NIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYE---  111

Query  412  HAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            + Y + YC +  D C     ++G  + +  + RLA+S D  ++I  +KA
Sbjct  112  NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIKFRKA  159



>gb|ACO40077.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 83/181 (46%), Gaps = 19/181 (10%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGS  180
            + +P+      PV+D +G+ L  GT Y++ S  W   G R   +  +   CP DVI   S
Sbjct  3    LSVPSTEAYTEPVLDIQGEELKAGTEYIITSIFW---GARGGDVSATNKTCPDDVIKYSS  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DRLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNLEVQWFVT  116

Query  358  AG--------DVFSHQFKI--VSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLAL  507
             G        D  ++ FKI    +   L +     C  G   C ++G + ++     L+L
Sbjct  117  TGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPEDICHCGV-LCRDIGIYRENNGRKILSL  175

Query  508  S  510
            S
Sbjct  176  S  176



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 26/169 (15%)
 Frame = +1

Query  82   YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTPADPNATVVFQSTLL  258
            Y L  +    GG+ L      +  CP DV+  G EL++G P+ FTP DP   V+ +ST L
Sbjct  8    YXLPVFXGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDL  65

Query  259  NIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGDVFSHQFKIVSVAPIL  411
            NI F+      +C+ +  W + +Y+   G+R +          G+  S+ FKI       
Sbjct  66   NIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYE---  116

Query  412  HAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            + Y + YC +  D C     ++G  + +  + RLA+S D  ++I  +KA
Sbjct  117  NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAIS-DVPFKIKFRKA  164



>gb|AAF15901.1|AF208020_1 putative proteinase inhibitor [Nicotiana glutinosa]
Length=241

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 89/211 (42%), Gaps = 37/211 (18%)
 Frame = +1

Query  1    PIRLPTAAESDT--------PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKC  156
            PI LPT  + D          V+D  G+ L  G  Y + S  W  GG  +       T+C
Sbjct  32   PIVLPTTTDDDKGFPVPVLPEVLDINGEPLQIGEKYHIVSAIWGAGGGGVYLTYVRNTRC  91

Query  157  PSDVII-GSELEEGYPV---VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ  324
            P+DV+  G   ++  P+      P  P   VV ++  +NI F+  P  RLCVN   W+V 
Sbjct  92   PNDVVQHGRTPKKACPLNSLPLAPGPPPFNVVRETNNINIMFS-VPTSRLCVNETVWKVG  150

Query  325  YDPRF---GERFVKAG--------DVFSHQFKIVSVAPILHAYIITYC-------DSGTD  450
             DP     G RFV  G        +  +  FKI  V      Y + YC       +   D
Sbjct  151  -DPDLTARGTRFVVTGGTLGNPRPETINSWFKIEKVTKTAPFYKLRYCPDNFLCPECHPD  209

Query  451  NCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
             C +VG      H  RLAL T+  + ++ +K
Sbjct  210  VCLDVGL----THERRLAL-TNQPFMVLFRK  235



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI     +   Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 77/184 (42%), Gaps = 24/184 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST LNIK   F     C  +  W++  +D  FG+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDLNIK---FDAATSCAQSTVWKLDNFDAAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + YC S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALS  510
            LALS
Sbjct  192  LALS  195



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 78/169 (46%), Gaps = 18/169 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVFT  213
            V+D +G+ L  GT Y +L  ++   GGL + S       CP DV+    E+ +G P+ FT
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMAST--GDEACPLDVVQDPLEISKGLPLTFT  90

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVKAGDV-------  369
            P +P   V+  ST LNIKF+      +CV +  W++Q       + FV  G V       
Sbjct  91   PVNPKKGVIRVSTDLNIKFSA---SSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIE  147

Query  370  -FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
              ++ FKI          +  T CD G   C ++G +  D     L+LS
Sbjct  148  TITNWFKIEKAGDDYKLVFCPTVCDCGA-LCRDIGIYIHDNGVRTLSLS  195



>gb|ACO40073.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 86/183 (47%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 83/195 (43%), Gaps = 25/195 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST LNIK   F     C  +  W++  +D  FG+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDLNIK---FDAATSCAQSTVWKLDNFDTAFGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + +C S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D   ++V +K
Sbjct  192  LALS-DVPLKVVFKK  205



>gb|KFK33833.1| hypothetical protein AALP_AA5G065900 [Arabis alpina]
Length=205

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 84/186 (45%), Gaps = 16/186 (9%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSEL  186
            L   A++  PVVDA GD +  G+ Y+        GG+ L  L      CP +++   S  
Sbjct  15   LTATADNAIPVVDANGDNIFNGSYYIF-PIDAEGGGVTLSGL--GDKPCPLELVQDSSNA  71

Query  187  EEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGE-RFVKAG  363
            E G+PV F+    N   V +S  LNI+        +C  +  W V    + G+ RFV AG
Sbjct  72   ELGFPVKFSNWKSNVGFVPESESLNIEMD--ITATICDQSTYWWVDKRHKEGQMRFVTAG  129

Query  364  ---DVFSHQFKIVSVAPILHAYIITYCDSGT---DNCYNVGSHYDDQHTTRLALSTDSTY  525
               +VF  Q   +  +   ++Y    C + T   D C +VG   D+    R AL T+ ++
Sbjct  130  PKPEVFHFQ---IEKSEDFYSYKFVVCPNWTQSRDECKDVGIFVDENGVRRFALGTNLSF  186

Query  526  EIVIQK  543
              ++ K
Sbjct  187  SFLLMK  192



>gb|AAL85653.1| trypsin inhibitor [Theobroma simiarum]
Length=154

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 72/155 (46%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  V+   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVVSSIWGAGGGGLALGRATDQKCPEIVVQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V    V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGEPGPNA  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             +  FKI      ++ +    + CDS    C ++G
Sbjct  120  LTSWFKIEEAGGTVYKFRFCPSVCDSCATLCSDIG  154



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 80/194 (41%), Gaps = 20/194 (10%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-  177
            P RL  A  S +PV+D  GD +  G  Y +       GG    S       CP D+I   
Sbjct  22   PSRL-LAGSSPSPVLDINGDKVQVGLNYFVLPVIRGRGGGLYPSNVKQNNTCPRDIIQEV  80

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
             E+++G PVVFTP D    VV  ST LN++F       +C     W++  YD +  + F+
Sbjct  81   DEVQQGLPVVFTPFDAKKGVVRLSTDLNVRFF---TPTICARETIWKLGTYDDKLKQYFM  137

Query  355  KAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRL  501
              G V         S  FKI  +      Y   +C S    C  +      Y  +   R 
Sbjct  138  VTGGVEGNPGPQTLSSWFKIEKLG---TDYKFVFCPSVCKICKVICKDVGIYSTKDGVRF  194

Query  502  ALSTDSTYEIVIQK  543
               +D+ + ++ +K
Sbjct  195  MALSDTPFRVMFKK  208



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 22/183 (12%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVVF  210
            PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+      + G PV F
Sbjct  74   PVLDIAGKQLRTGSKYYILPVTKGRGGGLTLAGRSNNKT-CPLDVVQEQHSFKNGLPVTF  132

Query  211  TPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV------  369
            +P +P   VV +ST LNIKF        C  +  W++  +D   G+  +  G V      
Sbjct  133  SPVNPKKGVVRESTDLNIKFD---AATSCAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGP  189

Query  370  --FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALSTDSTYEIV  534
                + FKI         Y + YC S  + C  +      + +    RLALS D  ++IV
Sbjct  190  RTMRNWFKI---EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALS-DVPFKIV  245

Query  535  IQK  543
             +K
Sbjct  246  FKK  248



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  18   LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI     +   Y + +C     +    C ++G ++++     L
Sbjct  132  TGGEEGNPGVHTLTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  189

Query  502  ALS  510
            +LS
Sbjct  190  SLS  192



>gb|AAL85645.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85646.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85647.1| trypsin inhibitor [Theobroma grandiflorum]
Length=154

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +  KCP  VI   S+L+ G PV+F+ 
Sbjct  1    VLDTDGDELRTGVQYYVLSALWGAGGGGLDLGRATDQKCPEIVIQRRSDLDNGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V  G V        
Sbjct  61   ADSEDDVVRVSTDINIEFVPI-RDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKGEPGPNT  119

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH  474
             S+ FKI       + Y   +C S  D+C  + S 
Sbjct  120  LSNWFKIEEAGG--NVYKFRFCPSVCDSCATLCSD  152



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 83/183 (45%), Gaps = 22/183 (12%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFT  213
            V+D +G+ L  G  Y +        GGL L S + S   CP DV +  S    G PV F 
Sbjct  25   VLDTDGNELRRGVEYYIYPGITDVAGGLTLASRNHS---CPLDVTLAISPTNNGLPVTFL  81

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV--------  369
            PADP    +  ST LNI F+ F    +C+ + +W++ +D      +V  G V        
Sbjct  82   PADPEEDTINTSTDLNIVFSAFT---ICLQSTAWKLDFDNTTRRFYVTTGGVTGNPGRET  138

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIVI  537
              + FKI S A     Y + +C S  + C     ++G   +D    RL +S+D+   +  
Sbjct  139  LDNWFKIQS-ASGRSGYNLVFCPSVCNICRPVCGSLGVVREDGR-LRLGISSDAPLPVEF  196

Query  538  QKA  546
            ++A
Sbjct  197  RRA  199



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 86/197 (44%), Gaps = 27/197 (14%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKT-CPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST +NIKF        C  +  W++  +D   G+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDINIKFD---AATSCAQSTVWKLDNFDAALGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTD----NCYNVGSHYDDQHTT  495
            V  G V          + FKI         Y + +C S  +     C +VG  + +    
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFYGDYKLVFCPSVCNIFRGLCRDVG-IFINGGVR  190

Query  496  RLALSTDSTYEIVIQKA  546
            RLALS D  +++V +KA
Sbjct  191  RLALS-DVPFKVVFKKA  206



>gb|ACO40078.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGS  180
            + +P+      PV+D +G+ L  GT Y++ S  W   G R   +  +   CP DVI   S
Sbjct  3    LSVPSTEAYTEPVLDIQGEELKAGTEYIITSIFW---GARGGDVSATNKTCPDDVIKYSS  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ  324
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q
Sbjct  60   DRLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQ  104



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 79/190 (42%), Gaps = 22/190 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEG  195
            A  S +PV+D  GD +  G  Y +       GG  L S       CP D+I  S E++EG
Sbjct  27   AGSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNNTCPRDIIQNSDEVQEG  86

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PVVFTP +    VV  S  LN++F       +C     W++  YD +  + F+  G V 
Sbjct  87   LPVVFTPFNTKKGVVRLSIDLNVRFF---TPTICARETIWKLGTYDDKLKQYFIVTGGVE  143

Query  370  -------FSHQFKIVSVAPILHAYIITYCDSGTD----NCYNVGSHYDDQHTTRLALSTD  516
                    S  FKI  +      Y   +C S        C +VG +  D    R    +D
Sbjct  144  GNPGPQTLSSWFKIEKLG---TDYKFVFCPSVCKICKVICKDVGIYTKDG--VRFLALSD  198

Query  517  STYEIVIQKA  546
            +   ++ +K 
Sbjct  199  TPLRVMFKKT  208



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 22/189 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEE  192
            A +   PV+D  G+ L  GT Y +L   +   GGL L S    T  CP DV+    E+  
Sbjct  19   ATDGLDPVLDISGEELRTGTDYYILPVIRGGGGGLTLASTGNET--CPLDVVQEQLEVSN  76

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV-  369
            G P+ F+P +    VV  ST LNIKF+      +CV +  W++  D    +  V  G V 
Sbjct  77   GLPLTFSPVNITKGVVRVSTDLNIKFSA---ATICVQSTVWKLDNDEATQKMVVTTGGVE  133

Query  370  -------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALSTDS  519
                    S+ FKI         Y + +C    D C  V      + D    RLALS D 
Sbjct  134  GNPGIETLSNWFKIERYE---DDYKLVFCPGVCDFCRPVCGDLGVFIDAGIRRLALS-DV  189

Query  520  TYEIVIQKA  546
              +++ ++A
Sbjct  190  PLKVMFKRA  198



>gb|AFK36436.1| unknown [Lotus japonicus]
Length=218

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 84/190 (44%), Gaps = 20/190 (11%)
 Frame = +1

Query  7    RLPTAAESD--TPVVDAEGDALLPGTPYLLRSWKWT--HGGLRLVSLDGSTTKCPSDVII  174
            +LPTA   +    V+D  GD++ PG  Y +R        GG+RL     S   CP   + 
Sbjct  19   KLPTAFSPNDVEQVLDVNGDSIFPGGRYYIRPAIRGPPGGGVRLGKTGDS--DCPVTALQ  76

Query  175  G-SELEEGYPVVF-TPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGER  348
              SE++ G PV F   A+ +  ++F  T L+I+F   P    CV +  W V  D   G+ 
Sbjct  77   EYSEVKNGIPVRFRIAAEVSTGIIFTGTELDIEFTVKPH---CVESPKWIVFVDNEIGKA  133

Query  349  FVKAG--------DVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLA  504
             V  G          FS  F I   +     Y + +C  G+  C ++G + + +   RL 
Sbjct  134  CVGIGGAKDHPGKQTFSGTFNIQKNSAGF-GYKLVFCIKGSPTCLDIGRYDNGEGGKRLN  192

Query  505  LSTDSTYEIV  534
            L+    +++V
Sbjct  193  LTEHEAFDLV  202



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 84/196 (43%), Gaps = 27/196 (14%)
 Frame = +1

Query  16   TAAESDTPVVDAEGDALLPGTPYLLRSW-----KWTHGGLRLVSLDGSTTKCPSDVII-G  177
            +AAE+  PV D  G  L     Y +        K+  GGL L  +  +T  CP+ V    
Sbjct  27   SAAEAPEPVRDVAGKMLRTDRHYYILPAANVFDKFRGGGLTLSGIGKNT--CPAAVFQET  84

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
            SE + G P+ F P +P   VV  ST LNIKFA +P    C  +  W +  Y    G+ FV
Sbjct  85   SEQKNGIPLAFLPVNPKKGVVRVSTDLNIKFA-YP--ETCGQSPVWSIDNYVYPSGDSFV  141

Query  355  KAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTR  498
              G V         S  FKI         Y + YC +        C +VG  Y +    R
Sbjct  142  NIGGVVGNPGPKTLSSWFKIEKFG--YQDYKLVYCPAVCSYCKVICKDVGIEYQNGK-RR  198

Query  499  LALSTDSTYEIVIQKA  546
            L L+TD    +V +KA
Sbjct  199  LHLTTDYPLRVVFKKA  214



>gb|KHN24493.1| Miraculin [Glycine soja]
Length=200

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 86/191 (45%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   T Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKMVRARTSYYIVPASPDVGGLAMAS---TGEDCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C    +W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNVNKGVIRVSTDLNIY---FPIDTSCPLTKAWKLKDYDNSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S   +C    S    Y DQ+  RLALS+
Sbjct  133  DFGNPGSQTLANWFKIEKYE---DAYKLVYCPSVCKDCSYPCSDIGIYQDQYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y +  Q+A
Sbjct  190  EP-YRVKFQRA  199



>gb|AEK31202.1| miraculin-like protein 2 [Murraya koenigii]
Length=173

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 72/151 (48%), Gaps = 12/151 (8%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGSELEEGYPVVFT  213
            P+VD  G+ +     Y + S  W  GG  +    G    CP DVI + S++E G  +  T
Sbjct  3    PLVDVYGNKVESTLEYYIVSAIWGAGGGGVSLHGGRNGYCPLDVIQLSSDMENGIRLTLT  62

Query  214  PADPNATVVFQSTLLNIKFAPFPMVR-LCVNNVSWEV-QYDPRFGERFVKAGDVFSH---  378
            P D N+T+V +ST LN++F+     R  C     W+V  YD   G+ F+  G +  H   
Sbjct  63   PYD-NSTIVRESTDLNLRFSVLLSGREYCNEQPLWKVDNYDASSGKWFITTGGLDGHPGA  121

Query  379  -----QFKIVSVAPILHAYIITYCDSGTDNC  456
                  FK   +  +L AY I +C S  ++C
Sbjct  122  ETLLNWFKFEKLGTLLSAYKIVHCPSVCESC  152



>sp|P68171.1|IDE3_ERYLA RecName: Full=Trypsin inhibitor DE-3 [Erythrina latissima]
Length=172

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 78/172 (45%), Gaps = 9/172 (5%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFTP  216
            ++D  G+ +  G  Y L    W  GG   ++  G  T CP  V+   +EL +G P+    
Sbjct  2    LLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEET-CPLTVVQSPNELSDGKPIRIE-  59

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGD---VFSHQFK  387
            +   +T +     + I FA  P    C  +  W V  D + G     + D    F + FK
Sbjct  60   SRLRSTFIPDDDEVRIGFAYAPK---CAPSPWWTVVEDEQEGLSVKLSEDESTQFDYPFK  116

Query  388  IVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
               V+  LH+Y + YC+   + C ++G + D +   RL ++ D+   +V++K
Sbjct  117  FEQVSDKLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDNPLTVVLKK  168



>gb|ABR17296.1| unknown [Picea sitchensis]
Length=211

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 83/179 (46%), Gaps = 17/179 (9%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGD-ALLPGTPYLLRSWKWTHGGLRL-VSLDGSTTKCPSDVII-  174
            I LP   +    VVDAEG+  L+ G  Y+L +   + GGL L + ++ S   CP  V   
Sbjct  28   INLPLQVQGAADVVDAEGNPVLVGGEYYVLPAVAGSGGGLTLKMRVNNS---CPLYVAQE  84

Query  175  GSELEEGYPVVFTPA-----DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRF  339
             SE   G PVV  PA     + ++ +V +   LN+  A    V  CV + +W VQ D   
Sbjct  85   NSEKSRGLPVVLRPAKGQRGNYSSVIVQEHVNLNVNMAA---VTACVQSTAWSVQNDANT  141

Query  340  GERFVKAGDVFSHQFKIVSVAPILHAYIITYCDSGTD-NCYNVGSHYDDQHTTRLALST  513
             +RF+KA D  S  F+IV  A     Y++ +C       C  VG + D      L ++ 
Sbjct  142  TKRFIKASD-SSSLFQIVK-AIDGDGYVLYFCPCNCRLVCTKVGIYVDGDEKRWLVINN  198



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 83/183 (45%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF    + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFY---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI     +   Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|KHM99738.1| Miraculin [Glycine soja]
Length=199

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 88/191 (46%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C    +W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVGTSCPQTTAWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C    S    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCSDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 22/181 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-EL  186
            +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S + 
Sbjct  20   VPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSLDQ  76

Query  187  EEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVKAG  363
             +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV  G
Sbjct  77   LQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVTTG  133

Query  364  D--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRLAL  507
                       ++ FKI   A IL  Y + +C     +    C ++G ++++     L+L
Sbjct  134  GEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSL  191

Query  508  S  510
            S
Sbjct  192  S  192



>gb|ACO40084.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV++ +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLEIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>emb|CDX72973.1| BnaC06g34210D [Brassica napus]
Length=214

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 84/190 (44%), Gaps = 19/190 (10%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLL-RSWKWTHGGLRLVSLDGSTTKCPSDV-IIGSELEE  192
            A  +  PV+D +GD +  G+ Y+L   W  T GGL LVS  G+  +CP  +   GSE+  
Sbjct  17   ATANAGPVLDTDGDIIFDGSYYVLPLIWGPTGGGLTLVSRLGN--QCPLFIGQEGSEVNR  74

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR-FGERFVKAG--  363
            G PV F+        V +   LNIK    P +  C  +  W V   P  +   F+ AG  
Sbjct  75   GIPVKFSNWKSRVGFVPEEENLNIKMDVEPTI--CAQSAYWWVTPAPSPWRSLFIAAGPK  132

Query  364  ------DVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALST---D  516
                  D     F+I      L+AY   YC  G D C +VG++ +      +  ST    
Sbjct  133  PEAGGEDSSRSFFQIKKTQAKLNAYKFVYCSDGND-CIDVGTNVEGGVRGLVIGSTPPFG  191

Query  517  STYEIVIQKA  546
              +E+V  KA
Sbjct  192  YPFEVVFVKA  201



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 85/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF    + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFY---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|ACO40145.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA  +  V+  S  LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSDDDVIRVSADLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_003548288.1| PREDICTED: miraculin-like [Glycine max]
Length=200

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 86/191 (45%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   T Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKMVRARTSYYIVPASPDVGGLAMAS---TGEDCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C    +W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNVNKGVIRVSTDLNIY---FPIDTSCPLTKAWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S   +C    S    Y DQ+  RLALS+
Sbjct  133  DFGNPGSQTLANWFKIEKYE---DAYKLVYCPSVCKDCSYPCSDIGIYQDQYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y +  Q+A
Sbjct  190  EP-YRVKFQRA  199



>ref|XP_003534078.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 88/191 (46%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C    +W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVGTSCPQTTAWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C    S    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCSDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 84/190 (44%), Gaps = 22/190 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLD-GSTTKCPSDVII-GSELEE  192
            ++ S +PV+D  GD +  G  Y +       GG  L   +  +   CP D+I    E +E
Sbjct  16   SSSSLSPVLDVNGDEVQAGPNYFILPVIRGRGGGGLSPFNVKNNNTCPRDIIQWDDEEQE  75

Query  193  GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV  369
            G PVVFT  D   +VV  ST +N++F   P +  C     W++  YD +  + FV  G V
Sbjct  76   GLPVVFTRIDAKKSVVRVSTDVNVRFYT-PTI--CARETIWKLGDYDDKLKKYFVVTGGV  132

Query  370  --------FSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRLALST  513
                      + FKI         Y + YC S        C +VG    +     LALS 
Sbjct  133  EGNPGLKTVGNWFKIERFG---SGYKLVYCPSVCKFCKVICKDVGIFITNDGVRLLALS-  188

Query  514  DSTYEIVIQK  543
            D+ Y+++ +K
Sbjct  189  DTPYKVMFKK  198



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 87/191 (46%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C     W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVATSCPQTTVWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C    S    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCSDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>gb|AAB68964.1| trypsin inhibitor propeptide [Brassica oleracea]
Length=214

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 85/192 (44%), Gaps = 23/192 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLL-RSWKWTHGGLRLVSLDGSTTKCPSDVIIG---SEL  186
            A  +  PV+D +GD +  G+ Y+L   W  T GGL LVS  G+  +CP  + IG   SE+
Sbjct  17   ATANAGPVLDTDGDIIFDGSYYVLPLIWGPTGGGLTLVSRRGN--QCP--LFIGQERSEV  72

Query  187  EEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR-FGERFVKAG  363
              G PV F+        V +   LNIK    P +  C  +  W V   P  +   F+ AG
Sbjct  73   NRGIPVKFSNWRSRVGFVPEEENLNIKMDVEPTI--CAQSAYWWVTPAPSPWRSLFIAAG  130

Query  364  --------DVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALST--  513
                    D     F+I      L+AY   +C  G D C +VG + +      +  ST  
Sbjct  131  PKPEAGGEDSSRSFFQIKKTEAKLNAYKFVFCSEGND-CIDVGKNEEGGVRGLVLGSTPP  189

Query  514  -DSTYEIVIQKA  546
              + +E+V  KA
Sbjct  190  FATPFEVVFVKA  201



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 88/184 (48%), Gaps = 27/184 (15%)
 Frame = +1

Query  40   VVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            V D +G+ +  G  Y +L  ++   GG+ L      +  CP DV+  G EL++G P+ FT
Sbjct  4    VRDIDGNLVXXGXEYYILPXFRGRGGGVTLAPTRNES--CPLDVVQEGFELDDGLPLTFT  61

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK--------AGD  366
            P DP   V+ +ST LNI F+      +C+ +  W + +Y+   G+R +          G+
Sbjct  62   PVDPKKGVIRESTDLNIIFS---ASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGE  115

Query  367  VFSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTRLALSTDSTYEIV  534
              S+ FKI       + Y + YC +  D C     ++G  + +  +  L +  D  ++I 
Sbjct  116  TISNWFKIEKYE---NGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRXLXI-XDVPFKIK  171

Query  535  IQKA  546
             +KA
Sbjct  172  FRKA  175



>gb|AAL85655.1| trypsin inhibitor [Theobroma bicolor]
Length=154

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 73/155 (47%), Gaps = 13/155 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTP  216
            V+D +GD L  G  Y + S  W  GG  L     +   CP  V+   S+ + G PV+F+ 
Sbjct  1    VLDTDGDELQTGVQYYVVSSIWGAGGGGLALGRATGQSCPEIVVQRQSDFDRGTPVIFSN  60

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKA-GDV-------  369
            AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V   GD        
Sbjct  61   ADSEDGVVRVSTDINIEFVPIGD-RLCTTSTVWKLDNYDNSAGQWWVTTDGDKGEPGPNN  119

Query  370  FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
             +  FKI     + + +    ++CDS T  C ++G
Sbjct  120  LTSWFKIKESGVMSYKFRFCPSFCDSCTTLCSDIG  154



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 83/181 (46%), Gaps = 19/181 (10%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVI-IGS  180
            + +P+      PV+D +G+ L  GT Y++ S  W   G R   +  +   CP DVI   S
Sbjct  18   LSVPSTEAYTEPVLDIQGEELKAGTEYIISSIFW---GARGGDVSATNKTCPDDVIKYSS  74

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  75   DRLQGLPVTFSPASSEDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  131

Query  358  AG--------DVFSHQFKI--VSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLAL  507
             G        D  ++ FKI    +   L +     C  G   C ++G + ++     L+L
Sbjct  132  TGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPEDICHCGV-LCRDIGIYRENNGRKILSL  190

Query  508  S  510
            S
Sbjct  191  S  191



>ref|XP_007041756.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOX97587.1| 21 kDa seed protein [Theobroma cacao]
Length=214

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 67/154 (44%), Gaps = 13/154 (8%)
 Frame = +1

Query  16   TAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEG  195
            +A + +  V    GD L PG  Y + S  W  GG  L    G    CP DV+   + +  
Sbjct  21   SATDENGSVYHLNGDELRPGVEYYVVSAIWGAGGGGLYLGKGRNQTCPYDVV---QEKPA  77

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PV F+P D    V+ + T LNI F P P    C  +  W+V  YD    E FV  G V 
Sbjct  78   LPVTFSPVDTKGGVIHEPTDLNISFIP-PGPTACSQSTVWKVDSYDESRREWFVATGGVE  136

Query  370  -----FSHQFKIVSVAPILHAYIITYCDSGTDNC  456
                  S  FKI     +L  Y + +C S  ++C
Sbjct  137  GDPQALSSLFKIKGAGGLL--YELAFCPSVCESC  168



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  S  LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSADLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI     +   Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|ACO40093.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40143.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 85/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  S  LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSADLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 86/187 (46%), Gaps = 20/187 (11%)
 Frame = +1

Query  1    PIRLPTAAESD-TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSL-DGSTTKCPSDVI  171
            P+ +   A+SD  PV+D +G  +  G  Y +L   +   GGL L +  + + + CP DV+
Sbjct  24   PLLVAVHADSDPAPVLDIKGHNIQTGVEYWILPVIRGRGGGLTLATTGNRNRSICPLDVV  83

Query  172  I-GSELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVS-WEV-QYDPRFG  342
                E+  G P+ F+P +    VV  ST LNIKF+    V +C+N    W++   D   G
Sbjct  84   QEQQEVSNGLPLTFSPVNLKIGVVRLSTDLNIKFSTSAAVTICLNTSKVWKLDNLDESTG  143

Query  343  ERFVKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQH  489
            +RFV  G V         S+ FKI         Y + +C +  + C  +      Y +  
Sbjct  144  QRFVTTGGVEGNPGPKTISNWFKIEKYD---KDYKLVFCPTVCNFCKVICGDVGIYLEGG  200

Query  490  TTRLALS  510
              RL LS
Sbjct  201  VRRLVLS  207



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 79/171 (46%), Gaps = 18/171 (11%)
 Frame = +1

Query  34   TPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPVV  207
            + V+D  G  L  G  Y +L   +   GGL+L +    T+  P DV+    E+  G+P+ 
Sbjct  22   SAVLDLSGKKLQKGVDYYILPVIRGRGGGLKLANARNKTS--PLDVVQDQFEVSSGFPLT  79

Query  208  FTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-----  369
            F+PA+ N + V  ST LNIKF+       C  +  W++  +D   G+ FV +G V     
Sbjct  80   FSPANQNQSFVCLSTDLNIKFSA---ATTCAQSTVWKLDSFDESLGQWFVTSGGVEGNPG  136

Query  370  ---FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALS  510
                S+ FKI          +  T C+     C +VG +  D    RLALS
Sbjct  137  RQTISNWFKIEKYNDDYKLVFCPTVCNFCKVLCRDVGIYIKD-GIRRLALS  186



>ref|XP_010428238.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=209

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFT  213
            PV+D +GD +  G+ Y+L   +   GGL L         CP D++   SE++EG PV F+
Sbjct  24   PVLDTDGDIIFDGSYYVLPVIRGQGGGLTLAGR--GDQPCPLDIVQESSEVDEGIPVKFS  81

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG--------DV  369
                    V +S  LNI+        +CV    W V  + +F    V AG        + 
Sbjct  82   NWRSKVGFVPESENLNIETEV--AATICVQLAYWWVDENAKFR---VTAGPKPDELVKES  136

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLAL---STDSTYEIVIQ  540
            +   F+I +V    H Y   +C +G  +C +VG   D+    RL L   S ++ + ++ +
Sbjct  137  YLSFFQIQNVYD--HFYQFAFCPTGPKSCSDVGVFVDENGVRRLVLTKRSDNTPFLVMFK  194

Query  541  KA  546
            KA
Sbjct  195  KA  196



>gb|AAL85661.1| trypsin inhibitor [Theobroma bicolor]
Length=154

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 75/156 (48%), Gaps = 15/156 (10%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG--SELEEGYPVVFT  213
            V+D +G+ L  G  Y + S  W  GG  L         CP D+++   S+L+ G PV+F+
Sbjct  1    VLDTDGEELRTGVEYYVVSALWGAGGGGLAPGRSRNQSCP-DIVVQRRSDLDYGIPVIFS  59

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-------  369
            P  PN   +  ST LNI+F P     LC+    W++  YD   G+ +V AG V       
Sbjct  60   PVKPNDIFIRVSTDLNIEFTPL-RDSLCLTTAVWKLDDYDQSTGKWWVIAGGVAGDAGPH  118

Query  370  -FSHQFKIVSVAPILHAYII--TYCDSGTDNCYNVG  468
               + FKI     + + +I   + CDS T  C ++G
Sbjct  119  TLPNWFKIEKNGVLGYKFIYCPSVCDSCTTLCSDIG  154



>emb|CDY59714.1| BnaC02g46470D [Brassica napus]
Length=232

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 84/190 (44%), Gaps = 23/190 (12%)
 Frame = +1

Query  13   PTAAESDTPVVDAEGDALLPGTPYLLRS-WKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            P AA+   PV+D +GD +  G+ Y+L + +    GGL L S    + +CP  + +G E+ 
Sbjct  40   PNAAK---PVLDTDGDFIFDGSYYVLPAIFGAAGGGLNLASR--GSNQCP--LFVGQEIS  92

Query  190  E---GYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPR-FGERFVK  357
            E   G PV F+        V +S  LNIK        +CV +  W V   P  F   F+ 
Sbjct  93   EVDRGIPVKFSNWRLKVGFVPESEKLNIKMD--VEATICVQSTYWWVTAAPSGFRTSFIT  150

Query  358  AG-------DVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTD  516
            AG       D     F+I         Y I +C +  D C NVG   D+    RLALS+ 
Sbjct  151  AGPNPEAGEDSSRSFFQIEKAKGFPDGYHIMFCPNDND-CINVGIVVDEYGVRRLALSS-  208

Query  517  STYEIVIQKA  546
              +  V  KA
Sbjct  209  MPFPFVFMKA  218



>gb|ACO40104.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40105.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40106.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40110.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40139.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40140.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40159.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40161.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40163.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G  V F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLTVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSKVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_010683390.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 80/190 (42%), Gaps = 21/190 (11%)
 Frame = +1

Query  28   SDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEGYPV  204
            +DT V+D EG  L   + Y +       GG   VS    TT CP  V   S E+  G  V
Sbjct  25   ADTSVLDTEGRPLRAKSRYYILPASQGQGGGITVSQKNQTTLCPLYVSQESQEIYLGLSV  84

Query  205  VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG-------  363
             F P+  N  +++ S+ +NI    F MV +C+ + +W++  D     ++V  G       
Sbjct  85   WFLPSKHNQRLIYISSDINI---LFNMVNICLQSAAWKLSIDHTTWRKYVATGGAIGNPG  141

Query  364  -DVFSHQFKIVSVAPILHAYIITY--------CDSGTDNCYNVGSHYDDQHTTRLALSTD  516
             +  S  FKI  V    + Y   Y        C      C +VG    D  T  L LS D
Sbjct  142  EETVSSWFKIEKVKSGSYEYDYNYKIMYCPNVCSFCMVMCGDVGVFVQDDGTRLLGLS-D  200

Query  517  STYEIVIQKA  546
              + ++ +KA
Sbjct  201  RPFYVMFKKA  210



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 87/191 (46%), Gaps = 23/191 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTAGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVV-AVDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C     W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVGTSCPQTTVWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C    S    Y D++  RLALS+
Sbjct  133  DFGNPGSQTVANWFKIEKYE---DAYKLVYCPSVCNDCSYPCSDIGIYQDEYGKRLALSS  189

Query  514  DSTYEIVIQKA  546
            +  Y++  Q+A
Sbjct  190  EP-YKVKFQRA  199



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 78/189 (41%), Gaps = 22/189 (12%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-ELEEG  195
            A  S +PV+D  GD +  G  Y +       GG  L S       CP D+I  S E++EG
Sbjct  27   AGSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNNTCPRDIIQNSDEVQEG  86

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV-  369
             PVVF P +    VV  S  LN++F       +C     W++  YD +  + F+  G V 
Sbjct  87   LPVVFAPFNTKKGVVRLSIDLNVRFF---TPTICARETIWKLGTYDDKLKQYFIVTGGVE  143

Query  370  -------FSHQFKIVSVAPILHAYIITYCDSGTD----NCYNVGSHYDDQHTTRLALSTD  516
                    S  FKI  +      Y   +C S        C +VG +  D    R    +D
Sbjct  144  GNPGPQTLSSWFKIEKLG---TDYKFVFCPSVCKICKVICKDVGIYTKDG--VRFLALSD  198

Query  517  STYEIVIQK  543
            +   ++ +K
Sbjct  199  TPLRVMFKK  207



>gb|AAL85660.1| trypsin inhibitor [Theobroma sylvestre]
Length=153

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 70/153 (46%), Gaps = 12/153 (8%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELEEGYPVVFTPA  219
            V+D +GD L  G  Y + S  W  GG  L     +   CP  V+     ++G PV+F+ A
Sbjct  1    VLDTDGDELRTGVEYYVLSAIWGAGGGGLDLGRATGQSCPEIVVQRGFNDDGIPVIFSNA  60

Query  220  DPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGDV--------F  372
            D    VV  ST +NI+F P    RLC+ +  W++  YD   G+ +V    V         
Sbjct  61   DGKDGVVRLSTDVNIEFVPI-RDRLCLTSTVWKLDNYDHSTGKWWVTTDGVKGNPGHTTL  119

Query  373  SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGS  471
            +  FKI +   +   Y   +C S  D+C  + S
Sbjct  120  TSWFKIENAGAL--GYKFRFCPSVCDSCATLCS  150



>emb|CDP21543.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 84/196 (43%), Gaps = 27/196 (14%)
 Frame = +1

Query  16   TAAESDTPVVDAEGDALLPGTPYLLRSW-----KWTHGGLRLVSLDGSTTKCPSDVII-G  177
            +AAE+  PV D  G  L     Y +        K+  GGL L  +  +T  CP+ V    
Sbjct  27   SAAEAPEPVRDVAGKILRTDRHYYILPAANVFDKFRGGGLTLSGIGKNT--CPAAVFQET  84

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFV  354
            SE + G P+ F P +P   VV  ST LNIKFA +P    C  +  W +  Y    G+ FV
Sbjct  85   SEQKNGIPLAFLPVNPKKGVVRVSTDLNIKFA-YP--ETCGQSPVWSIDNYVYPSGDSFV  141

Query  355  KAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCY----NVGSHYDDQHTTR  498
              G V         S  FKI         Y + YC +    C     +VG  Y +    R
Sbjct  142  NIGGVVGNPGPKTLSSWFKIEKFG--YQDYKLVYCPAVCSYCRVICKDVGIEYQNGK-RR  198

Query  499  LALSTDSTYEIVIQKA  546
            L L+TD    +V ++A
Sbjct  199  LHLTTDYPLRVVFKQA  214



>gb|ACO40154.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G  V F+PA  +  V+  ST LNIKF+   + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLTVTFSPASSDDDVIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_003638409.1| Alpha-amylase/subtilisin inhibitor [Medicago truncatula]
 gb|KEH38528.1| Kunitz type trypsin inhibitor [Medicago truncatula]
Length=199

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 90/189 (48%), Gaps = 20/189 (11%)
 Frame = +1

Query  10   LPTAAE-SDTPVVDAEGDALLPGTPYLLRSWKWTHGG-LRLVSLDGSTTKCPSDVIIGSE  183
            +PT+A+  +  V+D  G  L  G  Y +RS     GG + LV+ +GS   CP  + +G E
Sbjct  21   IPTSAQPENEEVLDLTGRPLESGRKYYIRSDVSDFGGRITLVNKNGS---CP--LYVGQE  75

Query  184  ---LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                 +G  V+ TP + + TVV  +    +KF+       C  +  W++   D R G R 
Sbjct  76   TTDFGQGLSVILTPLENDDTVVKVNRDFKVKFSSSSS---CGQSTEWKLGDRDNRSGRRL  132

Query  352  VKAGDVFSHQFKIVSVA----PILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDS  519
            + AG    + F+I+ ++     ++  Y I +C S T NC  VG+  ++     LAL   +
Sbjct  133  IIAGSD-GNSFRILKISFGIEGVIGNYNIRFCPSDTVNCGTVGNLRENGKIL-LALDDRN  190

Query  520  TYEIVIQKA  546
               +  ++A
Sbjct  191  VLRVGFERA  199



>ref|XP_002309883.1| hypothetical protein POPTR_0007s03640g [Populus trichocarpa]
 gb|EEE90333.1| hypothetical protein POPTR_0007s03640g [Populus trichocarpa]
 gb|ADW95383.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=196

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 61/115 (53%), Gaps = 11/115 (10%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPS---DVIIGSELEEGYPV  204
            PV+D +G+ +  G  Y +  +     GGL LV+ +GS   CPS    V IGS   +G PV
Sbjct  25   PVLDTDGNPVTRGVEYYVDPAVTDVAGGLTLVTRNGS---CPSYVGQVPIGSGNVQGLPV  81

Query  205  VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAGD  366
            +FTP D   TV+ ++T   + F+      +CV++ +W + + DP    R +  GD
Sbjct  82   IFTPRDSGETVITENTQFTVAFS---AASICVSDTTWGIGEEDPETTRRLIVIGD  133



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 81/195 (42%), Gaps = 25/195 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG  177
            P+R      S  PV+D  G  L  G+ Y +L   K   GGL L     + T CP DV+  
Sbjct  22   PVR---GNASPDPVLDVAGKKLRAGSKYYILPVTKGQGGGLTLAGRSNNKT-CPLDVVQE  77

Query  178  S-ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERF  351
                  G PV F+P +P   VV +ST  NIK   F     C  +  W++  +D   G+  
Sbjct  78   QHSFRNGLPVTFSPVNPKKGVVRESTDFNIK---FDAATSCAQSTVWKLDNFDAALGQWL  134

Query  352  VKAGDV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTR  498
            V  G V          + FKI         Y + +C S  + C  +      + +    R
Sbjct  135  VTTGGVEGNPGPRTMRNWFKI---EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVRR  191

Query  499  LALSTDSTYEIVIQK  543
            LALS D   ++V +K
Sbjct  192  LALS-DVPLKVVFKK  205



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 86/191 (45%), Gaps = 19/191 (10%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPY-LLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-E  183
            L  A  +  PV+D  G  L  GT Y +L  ++   GGL L S    +  CP DV+    E
Sbjct  12   LLCANAAPDPVLDISGKKLRTGTDYYILPVFRGRGGGLTLASTGNES--CPLDVVQEQLE  69

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKA  360
            + +G PV F+P +    VV  ST  NIKF+      +CV    W++  +D    + FV  
Sbjct  70   VSDGLPVTFSPVNIKKGVVRVSTDQNIKFSA---ATICVQPTLWKLDSFDDSTRQWFVTT  126

Query  361  GDV--------FSHQFKIVSVAPILH-AYIITYCDSGTDNCYNVGSHYDDQHTTRLALST  513
            G V          + FKI          +  T CD     C +VG  + D    RLALS 
Sbjct  127  GGVEGNPGRETIDNWFKIEKYEDDYKLVFCPTVCDFCKVMCRDVGV-FIDGGVRRLALS-  184

Query  514  DSTYEIVIQKA  546
            D  ++++ ++A
Sbjct  185  DVPFKVMFKRA  195



>gb|KHM99744.1| Miraculin [Glycine soja]
Length=174

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 77/157 (49%), Gaps = 23/157 (15%)
 Frame = +1

Query  112  GGLRLVSLDGSTTKCPSDVIIGSELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVR  291
            GGL + S   +   CP DV+   +  +G P++FTP + N  V+  ST LNI    FP+  
Sbjct  29   GGLDMAS---TGADCPLDVV-AVDGYQGQPLIFTPVNFNKGVIRVSTDLNIY---FPVGT  81

Query  292  LCVNNVSWEVQ-YDPRFGERFVKAGDVF--------SHQFKIVSVAPILHAYIITYCDSG  444
             C    +W+++ YD    + FV  G  F        ++ FKI        AY + YC S 
Sbjct  82   SCPQTTAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYE---DAYKLVYCPSV  138

Query  445  TDNCYNVGSH---YDDQHTTRLALSTDSTYEIVIQKA  546
             ++C    S    Y D++  RLALS++  Y++  Q+A
Sbjct  139  CNDCSYPCSDIGIYQDEYGKRLALSSEP-YKVKFQRA  174



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 81/181 (45%), Gaps = 22/181 (12%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGSELE  189
            L  A  +   V+D  G  +   + Y +       GGL + S   +   CP DV+   +  
Sbjct  20   LGAAGPAPEQVLDTSGKIVRARSSYYIVPASPDLGGLDMAS---TGADCPLDVV-AIDGY  75

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQ-YDPRFGERFVKAGD  366
            +G P++FTP + N  V+  ST LNI    FP+   C     W+++ YD    + FV  G 
Sbjct  76   QGQPLIFTPVNFNKGVIRVSTDLNIY---FPVATSCPQTTVWKLKDYDYSTSQWFVTTGG  132

Query  367  VF--------SHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALST  513
             F        ++ FKI        AY + YC S  ++C    S    Y DQ+  RLALS+
Sbjct  133  DFGNPGSQTMANWFKIEKYE---DAYKLVYCPSVCNDCSYPCSDIGIYQDQYGKRLALSS  189

Query  514  D  516
            +
Sbjct  190  E  190



>ref|XP_009105982.1| PREDICTED: subtilisin inhibitor CLSI-II-like [Brassica rapa]
Length=211

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 78/179 (44%), Gaps = 22/179 (12%)
 Frame = +1

Query  22   AESDTPVVDAEGDALLPGTPYLL-RSWKWTHGGLRLVSLDGSTTKCPSDVIIG---SELE  189
            A +  PV+DA+GD +  G+ Y+L   W    GGL L S  G   KCP  + IG   SE+ 
Sbjct  19   ANAGGPVLDADGDIIFNGSYYVLPLVWGPAGGGLTLTS--GDYKKCP--LYIGQDSSEVN  74

Query  190  EGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG--  363
             G P+ F+        V +S  L+I+        +C  +  W V         FV AG  
Sbjct  75   MGIPIKFSNWKSKVGFVPESESLSIEMD--TKATICGQSTYWWVAAPDMPKMLFVTAGPN  132

Query  364  ------DVFSHQFKIVSVAPILHAYIITYCDSGTDN-CYNVGSHYDDQH-TTRLALSTD  516
                  D     F+I         Y I +C    DN C +VG H DD H   RLALS++
Sbjct  133  PKEHVEDSRRSFFQIKKAEDFRIGYKIVFCPQ--DNYCMDVGIHEDDNHGIRRLALSSE  189



>ref|XP_010428253.1| PREDICTED: bark lectin isoform 2 isoform X2 [Camelina sativa]
Length=223

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 68/159 (43%), Gaps = 6/159 (4%)
 Frame = +1

Query  82   YLLRSWKWTHGGLRLVSLDGSTTKCPSDVII---GSELEEGYPVVFTPADPNATVVFQST  252
            Y++ +   T GGL   S D +T     ++ I    S    G PV F+P D    +V  ST
Sbjct  48   YIIPAKIGTGGGLIPSSRDLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLDTKTKLVQLST  107

Query  253  LLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFSHQFKIVSVAPILHAYIITY  432
             LN++F     V LC  +  W + +  +  + FV  G           +     AY + Y
Sbjct  108  SLNLEFDS--TVWLCPESKIWRIDHSVQLRKSFVSIGGEKGKGNSWFQIQEDGDAYKLMY  165

Query  433  C-DSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            C  S T  C NV    DD    RL LS D ++ +  QKA
Sbjct  166  CPSSSTVACINVSLEIDDLGARRLVLSNDQSFTVEFQKA  204



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  GT Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGTEYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  S  LNIKF    + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSADLNIKFY---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 70/157 (45%), Gaps = 21/157 (13%)
 Frame = +1

Query  112  GGLRLVSLDGSTTKCPSDVIIGSE-LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMV  288
            GGL L     + T CP DV+      + G+PV F+P +P   VV +ST LNIK   F   
Sbjct  4    GGLTLAGRSNNKT-CPLDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIK---FDAA  59

Query  289  RLCVNNVSWEV-QYDPRFGERFVKAGDV--------FSHQFKIVSVAPILHAYIITYCDS  441
              C  +  W++  +D  FG+  V  G V          + FKI         Y + YC S
Sbjct  60   TSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKI---EKFFGDYKLVYCPS  116

Query  442  GTDNCYNVGSH---YDDQHTTRLALSTDSTYEIVIQK  543
              + C  +      + +    RLALS D  +++V +K
Sbjct  117  VCNFCRGLCRDVGIFINGGVRRLALS-DVPFKVVFKK  152



>gb|AAV41232.1| putative 21 kDa trypsin inhibitor [Theobroma grandiflorum]
Length=206

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 80/179 (45%), Gaps = 16/179 (9%)
 Frame = +1

Query  19   AAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEG  195
            A  +++PV+D +GD L  G  Y + S  W  GG  L         CP  V+   S+L  G
Sbjct  24   ANAANSPVLDTDGDDLQVGVQYYVVSSIWGAGGGGLDLGRAIGQSCPEIVVQRQSDLVLG  83

Query  196  YPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVK-----  357
             PV+F+ AD    VV  ST +NI+F P    RLC  +  W++  YD   G+ +V      
Sbjct  84   TPVIFSNADSKDGVVRVSTDINIEFVPIRD-RLCSTSTVWKLDNYDNSAGKWWVTTDGGE  142

Query  358  ---AGDVFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGS---HYDDQHTTRLALSTD  516
                    + +FKI  V  I   Y +  C S  ++C  + S      D   T +A+  D
Sbjct  143  GGCGRSRLTSRFKIEKVGRI--GYKLRLCPSVCESCITLSSDIGKSGDSGQTHMAVCYD  199



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 84/182 (46%), Gaps = 21/182 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKW-THGGLRLVSLDGSTTKCPSDVI-IG  177
            + +P+      PV+D +G+ L  GT Y++ S  W   GG     +  +   CP DVI   
Sbjct  18   LSVPSIEAYTEPVLDIQGEELKAGTEYIITSIFWGALGG----DVSATNKTCPDDVIQYS  73

Query  178  SELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFV  354
            S+L +G PV F+PA     ++  ST LNIKF+   + + C ++  W++Q       + FV
Sbjct  74   SDLLQGLPVTFSPASSEDDIIRVSTDLNIKFS---IKKACDHSSVWKIQKSSNSEVQWFV  130

Query  355  KAG--------DVFSHQFKI--VSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLA  504
              G        D  ++ FKI    +   L +     C  G   C ++G + ++     L+
Sbjct  131  TTGGEEGNPGIDTLTNWFKIEKAGIGYKLVSCPENICHCGV-LCRDIGIYRENNGRRILS  189

Query  505  LS  510
            LS
Sbjct  190  LS  191



>ref|XP_010428252.1| PREDICTED: bark lectin isoform 2 isoform X1 [Camelina sativa]
Length=231

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 64/151 (42%), Gaps = 6/151 (4%)
 Frame = +1

Query  106  THGGLRLVSLDGSTTKCPSDVII---GSELEEGYPVVFTPADPNATVVFQSTLLNIKFAP  276
            T GGL   S D +T     ++ I    S    G PV F+P D    +V  ST LN++F  
Sbjct  56   TGGGLIPSSRDLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLDTKTKLVQLSTSLNLEFDS  115

Query  277  FPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFSHQFKIVSVAPILHAYIITYC-DSGTDN  453
               V LC  +  W + +  +  + FV  G           +     AY + YC  S T  
Sbjct  116  --TVWLCPESKIWRIDHSVQLRKSFVSIGGEKGKGNSWFQIQEDGDAYKLMYCPSSSTVA  173

Query  454  CYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            C NV    DD    RL LS D ++ +  QKA
Sbjct  174  CINVSLEIDDLGARRLVLSNDQSFTVEFQKA  204



>sp|P81366.1|IDE3_ERYVA RecName: Full=Trypsin inhibitor DE-3; AltName: Full=ETIA [Erythrina 
variegata]
 gb|AAB24756.1| ETIa=Kunitz-type trypsin inhibitor [Erythrina variegata, var. 
Orientalis, seeds, Peptide, 172 aa]
 prf||1903155A trypsin inhibitor ET1a
Length=172

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 76/180 (42%), Gaps = 25/180 (14%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPV----  204
            ++D  G+ +  G  Y L    W  GG   ++  G  T CP  V+   +EL  G P+    
Sbjct  2    LLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEET-CPLTVVQSPNELSNGKPIRIES  60

Query  205  ----VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGD--  366
                 F P D    + F        +AP      C  +  W V  D + G     + D  
Sbjct  61   RLRSAFIPDDDKVRIGF-------AYAP-----KCAPSPWWTVLEDEQEGLSVKLSEDES  108

Query  367  -VFSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVIQK  543
              F + FK   V+  LH+Y + YC+   + C ++G + D +   RL ++ D+   +V++K
Sbjct  109  TQFDYPFKFEQVSDKLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDNPLTVVLKK  168



>ref|XP_010471390.1| PREDICTED: bark lectin isoform 2-like [Camelina sativa]
Length=223

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 64/151 (42%), Gaps = 6/151 (4%)
 Frame = +1

Query  106  THGGLRLVSLDGSTTKCPSDVII---GSELEEGYPVVFTPADPNATVVFQSTLLNIKFAP  276
            T GGL   S D +T     ++ I    S    G PV F+P D    +V  ST LN++F  
Sbjct  56   TGGGLIPSSRDLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLDTKTKLVQLSTSLNLEFDS  115

Query  277  FPMVRLCVNNVSWEVQYDPRFGERFVKAGDVFSHQFKIVSVAPILHAYIITYC-DSGTDN  453
               V LC  +  W + +  +  + FV  G   S       +     AY + YC  S    
Sbjct  116  --TVWLCPESKIWRIDHSVQLRKSFVSIGGEKSKGNSWFQIQEDGDAYKLMYCPSSSIVA  173

Query  454  CYNVGSHYDDQHTTRLALSTDSTYEIVIQKA  546
            C NV    DD    RL LS D ++ +  QKA
Sbjct  174  CINVSLEIDDLGARRLVLSNDQSFAVKFQKA  204



>ref|XP_011012013.1| PREDICTED: endogenous alpha-amylase/subtilisin inhibitor-like 
[Populus euphratica]
Length=186

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 11/114 (10%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPS---DVIIGSELEEGYPV  204
            PV+D +G+ L  G  Y +  +     GGL LV+ +GS   CPS    V IG    +G PV
Sbjct  25   PVLDTDGNPLTRGVEYYVDPAITDVAGGLTLVARNGS---CPSYVGQVPIGPGSVQGLPV  81

Query  205  VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG  363
            +FTP++P  T++ ++T   + F+       CV N +W + + DP    RF+  G
Sbjct  82   IFTPSNPGDTIITETTDFTVAFS---ASSTCVQNTTWGIGEEDPETRRRFLVIG  132



>gb|KFK41765.1| hypothetical protein AALP_AA2G169300 [Arabis alpina]
Length=208

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 81/183 (44%), Gaps = 21/183 (11%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVII-GSELEEGYPVVFTP  216
            V+D  G+ +   + Y+L   +   GGL L         CP D++   SE++EG PV F+ 
Sbjct  23   VLDINGEPIFGDSYYVLPVIRGRGGGLTLAGR--GDQPCPYDIVQESSEVDEGIPVKFSN  80

Query  217  ADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKA--------GDV  369
                   V +S  LNI+    P +  C+ +  W V ++D    + FV A        GD 
Sbjct  81   WRIRVAFVPESQNLNIETIVGPTI--CIQSTYWRVGEFDHERKQYFVVAGPKPEGFGGDS  138

Query  370  FSHQFKIVSVAPILHAYIITY----CDSGTDNCYNVGSHYDDQHTTRLALSTDSTYEIVI  537
                FKI        AY  T+    C S    C +VG   D++   RLAL TD  + +V 
Sbjct  139  VKSFFKIEKSGD--DAYRFTFCPRTCRSNGPKCNDVGIFVDEKGVRRLAL-TDEPFLVVF  195

Query  538  QKA  546
            +KA
Sbjct  196  KKA  198



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 84/192 (44%), Gaps = 22/192 (11%)
 Frame = +1

Query  10   LPTAAESDTPVVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPSDVIIGS-E  183
            L   A +D PV D +G+ L  G  Y +R +     GGL L + +GS   CP  V + S  
Sbjct  18   LALPASADEPVRDTDGNVLQRGVDYYIRPTVTDIGGGLTLEARNGS---CPLSVALASLP  74

Query  184  LEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAG  363
             + G P+ F+P D +   V  ST  N+ F+ F     C+ +  W+++ D   G  +V  G
Sbjct  75   ADNGLPLQFSPEDDDDDTVELSTDTNVIFSAFTT---CLQSTVWKLELDEGEGRYYVVIG  131

Query  364  DV--------FSHQFKIVSVAPILHAYIITYCDSGTDNCYNVGSH---YDDQHTTRLALS  510
             V         S+ FKI S   +   Y + +C +  D C  V      Y+      L + 
Sbjct  132  GVAGNPGKETLSNWFKIESYQGV---YKLVFCPTVCDYCRPVCGSLGVYEQGGRQWLGIR  188

Query  511  TDSTYEIVIQKA  546
             D+ +    ++A
Sbjct  189  DDTPFPFEFKRA  200



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 68/149 (46%), Gaps = 19/149 (13%)
 Frame = +1

Query  40   VVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPSDVIIG-SELEEGYPVVFT  213
            V+D +G+ L  G  Y +        GGL L S + S   CP DV +  S    G P+ F 
Sbjct  33   VLDRDGNELRRGVEYYIYPGITDVAGGLTLASRNHS---CPLDVTLAISPTSNGLPLTFL  89

Query  214  PADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFGERFVKAGDV--------  369
            PADP    +  ST LNI F+    V +CV +  W++ +D   G  +V  G V        
Sbjct  90   PADPEEDTINTSTDLNIVFS---AVTICVQSTVWKLDFDDAAGRFYVTTGGVAGNPGRET  146

Query  370  FSHQFKIVSVAPILHAYIITYCDSGTDNC  456
             ++ FKI +      AY + +C +  D C
Sbjct  147  LANWFKIENDR---GAYKLVFCPTVCDIC  172



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 84/183 (46%), Gaps = 22/183 (12%)
 Frame = +1

Query  4    IRLPTAAESDTPVVDAEGDALLPGTPYLLRSWKWTHGGLRLVSLDGSTTKCPSDVIIGS-  180
            + +P+      PV+D +G+ L  G  Y++ S  W  GG     +  +   CP DVI  S 
Sbjct  3    LSVPSIEAYTEPVLDIQGEELKAGREYIITSAIWGAGG---GDVSATNKTCPDDVIQYSL  59

Query  181  ELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEVQYDPRFG-ERFVK  357
            +  +G PV F+PA     V+  ST LNIKF    + + C ++  W++Q       + FV 
Sbjct  60   DQLQGLPVTFSPASSEDDVIRVSTDLNIKFY---IKKACDHSSVWKIQKSSNSEVQWFVT  116

Query  358  AGD--------VFSHQFKIVSVAPILHAYIITYCDSGTDN----CYNVGSHYDDQHTTRL  501
             G           ++ FKI   A IL  Y + +C     +    C ++G ++++     L
Sbjct  117  TGGEEGNPGVHTLTNWFKI-EKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRIL  174

Query  502  ALS  510
            +LS
Sbjct  175  SLS  177



>gb|AIT42164.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 86/201 (43%), Gaps = 26/201 (13%)
 Frame = +1

Query  1    PIRLPTAAESDTPVVDAEGDALLPGTPYLLRS--WKWTHGGLRLVSLDGSTTKCPSDVI-  171
            PI LP+ +    PV+D  G  L P + Y + S  W    G + L     S   CP  V  
Sbjct  27   PINLPSESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPCPDGVFR  86

Query  172  IGSEL-EEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGE  345
              S++   G PV F P   N   +F+  LLNI+F   P V+LCV+   W+V   +     
Sbjct  87   YNSDVGPNGTPVRFIPLSTN---IFEDQLLNIQFN-IPTVKLCVSYTIWKVGNLNAHLRT  142

Query  346  RFVKAGDVF----SHQFKIVSVA---------PILHAYIITYCDSGTDN-CYNVGSHYDD  483
              ++ G       S  FKIV  +         PI   ++  +C    DN C  VG    +
Sbjct  143  MLLETGGTIGQADSSYFKIVKSSKLGYNLLYCPISRHFLCPFCRD--DNFCAEVGVVIQN  200

Query  484  QHTTRLALSTDSTYEIVIQKA  546
                RLAL  ++  +++ Q+ 
Sbjct  201  GK-RRLALVNENPLDVLFQEV  220



>gb|KHM99742.1| Miraculin, partial [Glycine soja]
Length=146

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 76/157 (48%), Gaps = 23/157 (15%)
 Frame = +1

Query  112  GGLRLVSLDGSTTKCPSDVIIGSELEEGYPVVFTPADPNATVVFQSTLLNIKFAPFPMVR  291
            GGL + S   +   CP DV+   +  +G P++FTP + N  V+  ST LNI    FP+  
Sbjct  1    GGLDMAS---TGADCPLDVV-AVDGYQGQPLIFTPVNFNKGVIRVSTDLNIY---FPVGT  53

Query  292  LCVNNVSWEVQ-YDPRFGERFVKAGDVF--------SHQFKIVSVAPILHAYIITYCDSG  444
             C     W+++ YD    + FV  G  F        ++ FKI        AY + YC S 
Sbjct  54   SCPQTTVWKLKDYDYSASQWFVTTGGDFGNPGSQTMANWFKIEKYE---DAYKLVYCPSV  110

Query  445  TDNCYNVGSH---YDDQHTTRLALSTDSTYEIVIQKA  546
             ++C    S    Y D++  RLALS++  Y++  Q+A
Sbjct  111  CNDCSYPCSDIGIYQDEYGKRLALSSEP-YKVKFQRA  146



>ref|XP_011046376.1| PREDICTED: miraculin-like [Populus euphratica]
Length=196

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 11/114 (10%)
 Frame = +1

Query  37   PVVDAEGDALLPGTPYLLR-SWKWTHGGLRLVSLDGSTTKCPS---DVIIGSELEEGYPV  204
            PV+D +G+ L  G  Y +  +     GGL LV+ +GS   CPS    V IG    +G PV
Sbjct  25   PVLDTDGNPLTRGVEYYVDPAITDVAGGLTLVARNGS---CPSYVGQVPIGPGSVQGLPV  81

Query  205  VFTPADPNATVVFQSTLLNIKFAPFPMVRLCVNNVSWEV-QYDPRFGERFVKAG  363
            +FTP++P  T++ ++T   + F+       CV N +W + + DP    RF+  G
Sbjct  82   IFTPSNPGDTIITETTDFTVAFS---ASSTCVQNTTWGIGEEDPETRRRFLVIG  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524425518816