BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22464_g3_i2 len=1595 path=[11561:0-225 11787:226-227 11538:228-245
15028:246-252 11813:253-274 4233:275-298 15058:299-309 14832:310-340
4299:341-346 4305:347-379 4338:380-420 4379:421-673 4632:674-1594]

Length=1595
                                                                      Score     E

gb|ADZ16122.1|  truncated cellulose synthase A3                         588   0.0      
gb|AEP33550.1|  truncated cellulose synthase catalytic subunit          588   0.0      
gb|AEP33542.1|  truncated cellulose synthase catalytic subunit          588   0.0      
gb|AEP33544.1|  truncated cellulose synthase catalytic subunit          586   0.0      
gb|ADZ16118.1|  truncated cellulose synthase A3                         585   0.0      
dbj|BAF01916.1|  cellulose synthase catalytic subunit                   575   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491045.1|  PREDICTED: cellulose synthase A catalytic su...    570   0.0      
ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    594   0.0      
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    594   0.0      
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    593   0.0      
gb|KDP26042.1|  hypothetical protein JCGZ_21075                         588   0.0      
ref|NP_001275292.1|  cellulose synthase                                 591   0.0      
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    591   0.0      
ref|XP_002278997.1|  PREDICTED: cellulose synthase A catalytic su...    591   0.0      Vitis vinifera
gb|KHG03009.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    590   0.0      
gb|AEP33552.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|AEP33538.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|AEP33547.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|AEP33557.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|AEP33543.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|AEP33537.1|  cellulose synthase catalytic subunit                    590   0.0      
gb|ADZ16121.1|  cellulose synthase A3                                   590   0.0      
gb|AEP33556.1|  cellulose synthase catalytic subunit                    589   0.0      
gb|AEP33551.1|  cellulose synthase catalytic subunit                    589   0.0      
gb|ADZ16123.1|  cellulose synthase A3                                   589   0.0      
gb|AEP33554.1|  cellulose synthase catalytic subunit                    589   0.0      
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             589   0.0      
ref|XP_003540527.1|  PREDICTED: cellulose synthase A catalytic su...    589   0.0      
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    589   0.0      
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715              572   0.0      
ref|XP_003542849.1|  PREDICTED: cellulose synthase A catalytic su...    588   0.0      
gb|ADZ16119.1|  cellulose synthase A3                                   588   0.0      
gb|KHN37622.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    588   0.0      
gb|AEP33540.1|  cellulose synthase catalytic subunit                    588   0.0      
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         588   0.0      
gb|AEP33539.1|  cellulose synthase catalytic subunit                    587   0.0      
gb|AEP33536.1|  cellulose synthase catalytic subunit                    587   0.0      
gb|AEP33545.1|  cellulose synthase catalytic subunit                    587   0.0      
gb|AEP33553.1|  cellulose synthase catalytic subunit                    587   0.0      
gb|AEP33559.1|  cellulose synthase catalytic subunit                    587   0.0      
gb|ADZ16120.1|  cellulose synthase A3                                   587   0.0      
gb|AFZ78564.1|  cellulose synthase                                      587   0.0      
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    586   0.0      
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    586   0.0      
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    586   0.0      
emb|CDP07782.1|  unnamed protein product                                587   0.0      
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...    586   0.0      
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    585   0.0      
gb|AEK31218.1|  cellulose synthase A                                    586   0.0      
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    586   0.0      
gb|AEP33541.1|  cellulose synthase catalytic subunit                    585   0.0      
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    585   0.0      
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    585   0.0      
ref|XP_002308955.1|  cellulose synthase family protein                  584   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011048033.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    584   0.0      
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...    584   0.0      
ref|XP_011020351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    585   0.0      
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2        584   0.0      
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    584   0.0      Ricinus communis
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    584   0.0      
gb|KEH19084.1|  cellulose synthase-like protein                         584   0.0      
ref|XP_004149389.1|  PREDICTED: cellulose synthase A catalytic su...    583   0.0      
ref|XP_007028786.1|  Cellulose synthase family protein                  583   0.0      
ref|XP_011033321.1|  PREDICTED: cellulose synthase A catalytic su...    583   0.0      
ref|XP_010534646.1|  PREDICTED: cellulose synthase A catalytic su...    575   0.0      
ref|XP_008460760.1|  PREDICTED: cellulose synthase A catalytic su...    582   0.0      
ref|XP_011033320.1|  PREDICTED: cellulose synthase A catalytic su...    583   0.0      
gb|AAD39534.2|  cellulose synthase catalytic subunit                    582   0.0      Gossypium hirsutum [American cotton]
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                582   0.0      
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    582   0.0      
ref|XP_004162186.1|  PREDICTED: cellulose synthase A catalytic su...    582   0.0      
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1         576   0.0      
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...    582   0.0      
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             582   0.0      
gb|AFB18638.1|  CESA10                                                  582   0.0      
ref|XP_008231249.1|  PREDICTED: cellulose synthase A catalytic su...    582   0.0      
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    582   0.0      
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...    582   0.0      
ref|XP_002322712.1|  cellulose synthase family protein                  582   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006373780.1|  hypothetical protein POPTR_0016s05520g             582   0.0      
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    581   0.0      
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    582   0.0      
gb|KDO83413.1|  hypothetical protein CISIN_1g001413mg                   577   0.0      
ref|XP_010937172.1|  PREDICTED: probable cellulose synthase A cat...    581   0.0      
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    581   0.0      
ref|XP_002298432.1|  hypothetical protein POPTR_0001s27320g             581   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    581   0.0      
gb|AEE60898.1|  cellulose synthase                                      581   0.0      
ref|XP_002314037.1|  cellulose synthase family protein                  581   0.0      Populus trichocarpa [western balsam poplar]
gb|ABY25277.1|  cellulose synthase                                      581   0.0      Eucalyptus grandis [rose gum]
ref|XP_004510986.1|  PREDICTED: cellulose synthase A catalytic su...    581   0.0      
gb|AFZ78557.1|  cellulose synthase                                      581   0.0      
ref|XP_008784835.1|  PREDICTED: probable cellulose synthase A cat...    580   0.0      
ref|XP_010032436.1|  PREDICTED: cellulose synthase A catalytic su...    580   0.0      
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    580   0.0      
ref|XP_010653789.1|  PREDICTED: cellulose synthase A catalytic su...    580   0.0      
gb|AIS86011.1|  cellulose synthase 3                                    580   0.0      
gb|AIS85996.1|  cellulose synthase 3                                    580   0.0      
gb|AIS85978.1|  cellulose synthase 3                                    580   0.0      
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    580   0.0      
gb|AIA10372.1|  cellulose synthase                                      580   0.0      
gb|AIS86009.1|  cellulose synthase 3                                    580   0.0      
gb|AIS85989.1|  cellulose synthase 3                                    580   0.0      
gb|AIS85977.1|  cellulose synthase 3                                    580   0.0      
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    580   0.0      
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    579   0.0      
gb|AIS86005.1|  cellulose synthase 3                                    580   0.0      
gb|AIS85991.1|  cellulose synthase 3                                    579   0.0      
gb|EAZ03185.1|  hypothetical protein OsI_25338                          579   0.0      Oryza sativa Indica Group [Indian rice]
gb|AIS85990.1|  cellulose synthase 3                                    579   0.0      
gb|AAL23710.2|  cellulose synthase                                      579   0.0      Populus tremuloides
gb|AHL45026.1|  cellulose synthase 3B                                   578   0.0      
gb|AIS86004.1|  cellulose synthase 3                                    579   0.0      
gb|AFZ78554.1|  cellulose synthase                                      579   0.0      
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    578   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78565.1|  cellulose synthase                                      578   0.0      
ref|NP_001059162.1|  Os07g0208500                                       579   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             578   0.0      
ref|XP_006838305.1|  hypothetical protein AMTR_s00103p00124340          579   0.0      
gb|ACC59195.1|  cellulose synthase                                      578   0.0      Betula platyphylla [Asian white birch]
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...    577   0.0      
ref|XP_006657551.1|  PREDICTED: probable cellulose synthase A cat...    578   0.0      
gb|AFI71894.1|  cellulose synthase 3                                    578   0.0      
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...    577   0.0      
gb|AFG25777.1|  cellulose synthase 3                                    578   0.0      
ref|NP_001105621.1|  cellulose synthase-4                               577   0.0      Zea mays [maize]
emb|CBI29854.3|  unnamed protein product                                582   0.0      
ref|XP_010088232.1|  OsCesA3 protein                                    577   0.0      
gb|AIS85987.1|  cellulose synthase 3                                    577   0.0      
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein        577   0.0      
gb|KDO83405.1|  hypothetical protein CISIN_1g001413mg                   577   0.0      
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...    577   0.0      
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    577   0.0      
gb|AGV22107.1|  cellulose synthase 2                                    577   0.0      
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             577   0.0      
gb|KDO83412.1|  hypothetical protein CISIN_1g001413mg                   577   0.0      
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             577   0.0      
gb|AAY43221.1|  cellulose synthase BoCesA4                              576   0.0      Bambusa oldhamii
gb|AGC65585.1|  CESA3ixr1-2                                             576   0.0      
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg             576   0.0      
ref|XP_002461675.1|  hypothetical protein SORBIDRAFT_02g006290          576   0.0      Sorghum bicolor [broomcorn]
gb|AAY60846.1|  cellulose synthase 4                                    576   0.0      Eucalyptus grandis [rose gum]
gb|AAY43220.1|  cellulose synthase BoCesA4                              576   0.0      Bambusa oldhamii
ref|XP_004135931.1|  PREDICTED: cellulose synthase A catalytic su...    576   0.0      
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...    571   0.0      
ref|XP_009364979.1|  PREDICTED: cellulose synthase A catalytic su...    576   0.0      
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    576   0.0      
ref|XP_006289427.1|  hypothetical protein CARUB_v10002932mg             575   0.0      
gb|AHL45025.1|  cellulose synthase 3A                                   575   0.0      
gb|AAC39336.1|  cellulose synthase catalytic subunit                    575   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY14127.1|  BnaC02g02440D                                          574   0.0      
gb|AAT66941.1|  CesA2                                                   575   0.0      Acacia mangium
dbj|BAJ33658.1|  unnamed protein product                                574   0.0      
emb|CDY52141.1|  BnaA03g55200D                                          574   0.0      
gb|ACT16002.1|  cellulose synthase                                      575   0.0      
gb|ACO06090.1|  cellulose synthase                                      574   0.0      Phyllostachys edulis [kikko-chiku]
emb|CDX80951.1|  BnaC03g02050D                                          574   0.0      
ref|NP_001051648.1|  Os03g0808100                                       574   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009125590.1|  PREDICTED: cellulose synthase A catalytic su...    574   0.0      
dbj|BAJ96780.1|  predicted protein                                      574   0.0      
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           573   0.0      Hordeum vulgare [barley]
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1         574   0.0      
emb|CDY04942.1|  BnaAnng01240D                                          573   0.0      
ref|XP_009130870.1|  PREDICTED: cellulose synthase A catalytic su...    573   0.0      
ref|XP_007052527.1|  Cellulose synthase family protein isoform 3        574   0.0      
dbj|BAJ85304.1|  predicted protein                                      566   0.0      
ref|XP_004955797.1|  PREDICTED: probable cellulose synthase A cat...    573   0.0      
ref|XP_008461291.1|  PREDICTED: cellulose synthase A catalytic su...    573   0.0      
gb|ACU87559.2|  cellulose synthase                                      572   0.0      
ref|NP_001104959.1|  cellulose synthase-9                               572   0.0      Zea mays [maize]
ref|XP_006296592.1|  hypothetical protein CARUB_v10012872mg             572   0.0      
ref|XP_003599196.1|  Cellulose synthase                                 572   0.0      
gb|AII73575.1|  cellulose synthase 3                                    572   0.0      
gb|AGC65584.1|  GFP-CESA3ixr1-2                                         579   0.0      
gb|AAY43222.1|  cellulose synthase BoCesA5                              572   0.0      Bambusa oldhamii
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    571   0.0      
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    570   0.0      
ref|XP_004981340.1|  PREDICTED: probable cellulose synthase A cat...    570   0.0      
gb|ADH95191.1|  cellulose synthase                                      570   0.0      
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    572   0.0      
gb|ACU80553.2|  cellulose synthase                                      569   0.0      
dbj|BAJ87858.1|  predicted protein                                      564   0.0      
tpg|DAA52080.1|  TPA: cellulose synthase5                               568   0.0      
ref|NP_001104955.1|  cellulose synthase5                                568   0.0      Zea mays [maize]
gb|EPS69824.1|  hypothetical protein M569_04932                         567   0.0      
ref|XP_003557396.1|  PREDICTED: probable cellulose synthase A cat...    568   0.0      
ref|XP_010228235.1|  PREDICTED: probable cellulose synthase A cat...    567   0.0      
gb|EMT09789.1|  Putative cellulose synthase A catalytic subunit 8...    566   0.0      
dbj|BAD06322.1|  putative cellulose synthase                            565   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_010464777.1|  PREDICTED: cellulose synthase A catalytic su...    564   0.0      
ref|XP_010464776.1|  PREDICTED: cellulose synthase A catalytic su...    564   0.0      
gb|AAQ63935.1|  cellulose synthase                                      563   0.0      Pinus radiata
ref|XP_006650766.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    562   0.0      
gb|AAQ63936.1|  cellulose synthase                                      561   0.0      Pinus radiata
ref|XP_010491404.1|  PREDICTED: cellulose synthase A catalytic su...    561   0.0      
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210          559   0.0      Sorghum bicolor [broomcorn]
ref|XP_010486710.1|  PREDICTED: cellulose synthase A catalytic su...    560   0.0      
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...    559   0.0      
ref|XP_010486709.1|  PREDICTED: cellulose synthase A catalytic su...    559   0.0      
gb|AAR29962.1|  putative cellulose synthase catalytic subunit           558   0.0      Hordeum vulgare [barley]
ref|XP_009146799.1|  PREDICTED: cellulose synthase A catalytic su...    553   0.0      
emb|CDY08570.1|  BnaA05g28060D                                          553   0.0      
ref|XP_010558902.1|  PREDICTED: cellulose synthase A catalytic su...    542   5e-178   
gb|AFJ12112.1|  cellulose synthase                                      516   1e-176   
gb|ACS88359.1|  cellulose synthase catalytic subunit                    525   2e-176   Gossypium hirsutum [American cotton]
gb|ABI78962.1|  cellulose synthase 10                                   523   2e-176   Physcomitrella patens
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              534   1e-174   
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    534   1e-174   
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    533   2e-174   
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    533   2e-174   
ref|XP_002983952.1|  family 2 glycosyltransferase                       533   2e-174   
gb|AAT48368.1|  cellulose synthase catalytic subunit                    523   2e-174   Physcomitrella patens
ref|XP_008392524.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    521   4e-174   
emb|CAN60659.1|  hypothetical protein VITISV_018069                     533   5e-174   Vitis vinifera
gb|ACF83181.1|  unknown                                                 507   7e-174   Zea mays [maize]
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    531   9e-174   
ref|XP_002983910.1|  family 2 glycosyltransferase                       531   1e-173   
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          531   1e-173   
gb|AAO25536.1|  cellulose synthase                                      531   1e-173   Populus tremuloides
ref|XP_002960761.1|  cellulose synthase 4-1                             531   1e-173   
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         531   2e-173   
gb|KHG16324.1|  putative cellulose synthase A catalytic subunit 1...    524   2e-173   
gb|AAP97497.1|  cellulose synthase                                      521   3e-173   Solanum tuberosum [potatoes]
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    530   3e-173   
ref|XP_002963550.1|  family 2 glycosyltransferase                       530   3e-173   
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    529   7e-173   
ref|XP_002455101.1|  hypothetical protein SORBIDRAFT_03g004320          510   8e-173   Sorghum bicolor [broomcorn]
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    529   9e-173   
ref|XP_007013842.1|  Cellulose synthase 1                               529   1e-172   
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                528   1e-172   
ref|XP_010905025.1|  PREDICTED: cellulose synthase A catalytic su...    526   2e-172   
ref|XP_010110357.1|  Protein radially swollen 1                         528   2e-172   
ref|XP_001775315.1|  predicted protein                                  511   4e-172   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              527   4e-172   
gb|KDO61693.1|  hypothetical protein CISIN_1g001399mg                   526   4e-172   
ref|XP_002960291.1|  family 2 glycosyltransferase                       527   5e-172   
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    527   5e-172   
ref|XP_009785781.1|  PREDICTED: cellulose synthase A catalytic su...    527   5e-172   
dbj|BAJ85785.1|  predicted protein                                      510   5e-172   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    526   5e-172   
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    526   6e-172   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             526   8e-172   
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    525   1e-171   
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    526   1e-171   
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...    526   1e-171   
ref|XP_001776974.1|  cellulose synthase 10, glycosyltransferase f...    526   1e-171   
gb|AFB18635.1|  CESA6                                                   526   1e-171   
ref|XP_009597841.1|  PREDICTED: cellulose synthase A catalytic su...    526   2e-171   
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    525   2e-171   
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    525   2e-171   
gb|AFW69155.1|  putative cellulose synthase family protein              522   2e-171   
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    525   3e-171   
ref|XP_006483337.1|  PREDICTED: cellulose synthase A catalytic su...    525   3e-171   
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    525   4e-171   
gb|AAY78952.3|  cellulose synthase CesA1                                520   4e-171   Boehmeria nivea [Chinese silk-plant]
gb|KHG11461.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    524   5e-171   
gb|AFZ78558.1|  cellulose synthase                                      524   7e-171   
ref|XP_001757832.1|  predicted protein                                  524   7e-171   
ref|XP_003638289.1|  hypothetical protein MTR_125s1017                  496   8e-171   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    523   9e-171   
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    523   9e-171   
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    523   1e-170   
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...    523   2e-170   
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    522   2e-170   
dbj|BAJ98234.1|  predicted protein                                      510   2e-170   
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    522   2e-170   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    522   2e-170   
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    523   3e-170   
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    522   3e-170   
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          521   3e-170   Sorghum bicolor [broomcorn]
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    522   3e-170   
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    521   3e-170   
ref|XP_002324291.1|  TGACG-motif binding family protein                 522   3e-170   Populus trichocarpa [western balsam poplar]
emb|CDP13491.1|  unnamed protein product                                522   3e-170   
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    522   3e-170   
gb|AAB37767.1|  cellulose synthase                                      509   4e-170   Gossypium hirsutum [American cotton]
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            521   4e-170   Zea mays [maize]
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    521   5e-170   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    520   5e-170   
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        521   6e-170   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    520   8e-170   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    520   9e-170   
ref|NP_001104954.1|  cellulose synthase-1                               521   1e-169   
gb|AFW81389.1|  cellulose synthase1                                     521   1e-169   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...    521   1e-169   
gb|AFW81388.1|  cellulose synthase1                                     521   1e-169   
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    520   1e-169   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          520   1e-169   
gb|AGC97433.2|  cellulose synthase                                      520   2e-169   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    520   2e-169   
gb|AAR29968.1|  putative cellulose synthase catalytic subunit           496   2e-169   
gb|ACC59196.1|  cellulose synthase                                      519   2e-169   
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    519   3e-169   
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    520   3e-169   
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     520   3e-169   
gb|AGV22109.1|  cellulose synthase 7                                    520   3e-169   
ref|NP_001105574.1|  cellulose synthase2                                520   3e-169   
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    518   3e-169   
emb|CAN73700.1|  hypothetical protein VITISV_013112                     518   4e-169   
dbj|BAD95078.1|  cellulose synthase catalytic subunit                   496   4e-169   
gb|KEH24275.1|  cellulose synthase-like protein                         518   4e-169   
gb|ACJ38665.1|  cellulose synthase                                      518   4e-169   
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             519   5e-169   
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                518   5e-169   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    518   5e-169   
gb|ABI78958.1|  cellulose synthase 5                                    519   5e-169   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    517   8e-169   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    515   9e-169   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    518   1e-168   
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    517   1e-168   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    518   1e-168   
gb|ACQ99194.1|  cellulose synthase                                      518   1e-168   
ref|NP_001054788.1|  Os05g0176100                                       518   1e-168   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    518   1e-168   
gb|AAY43217.1|  cellulose synthase BoCesA1                              518   1e-168   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    519   1e-168   
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    518   2e-168   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    518   2e-168   
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    516   2e-168   
gb|ADV58936.1|  cellulose synthase                                      518   2e-168   
gb|ADR74043.1|  cellulose synthase                                      518   2e-168   
ref|XP_002319002.2|  cellulose synthase 6 family protein                518   2e-168   
gb|AAP40636.1|  cellulose synthase 6                                    518   2e-168   
gb|ACN34304.1|  unknown                                                 493   3e-168   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    516   3e-168   
gb|AAF89963.1|AF200527_1  cellulose synthase-3                          509   3e-168   
ref|XP_006382504.1|  cellulose synthase 6 family protein                517   3e-168   
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    517   4e-168   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    518   4e-168   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    516   4e-168   
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     515   4e-168   
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   516   5e-168   
ref|NP_001063207.1|  Os09g0422500                                       516   5e-168   
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    516   5e-168   
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    516   5e-168   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    516   5e-168   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    517   5e-168   
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    516   6e-168   
ref|XP_004501313.1|  PREDICTED: cellulose synthase A catalytic su...    516   7e-168   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    514   8e-168   
gb|AAZ79659.1|  putative cellulose synthase                             488   9e-168   
ref|XP_010045345.1|  PREDICTED: probable cellulose synthase A cat...    499   9e-168   
dbj|BAJ85783.1|  predicted protein                                      515   1e-167   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          516   1e-167   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    514   1e-167   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    515   1e-167   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    516   1e-167   
gb|AGE09566.1|  cellulose synthase-like protein                         514   1e-167   
gb|AGJ71354.1|  cellulose synthase 3                                    514   1e-167   
ref|XP_002277713.1|  PREDICTED: probable cellulose synthase A cat...    516   1e-167   
gb|AAY43216.1|  cellulose synthase BoCesA8                              515   1e-167   
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     514   1e-167   
gb|ABI78960.1|  cellulose synthase 7                                    516   1e-167   
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     514   1e-167   
gb|AEK31217.1|  cellulose synthase A                                    514   1e-167   
gb|AAZ86086.1|  cellulose synthase catalytic subunit                    516   1e-167   
gb|EPS68064.1|  hypothetical protein M569_06709                         516   1e-167   
gb|ABI78959.1|  cellulose synthase 6                                    516   1e-167   
gb|AHL45023.1|  cellulose synthase 1A                                   515   1e-167   
gb|AAZ86087.1|  cellulose synthase catalytic subunit                    516   1e-167   
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    515   2e-167   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    516   2e-167   
gb|ACF80398.1|  unknown                                                 488   2e-167   
gb|AHL45024.1|  cellulose synthase 1B                                   515   2e-167   
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    514   2e-167   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             515   2e-167   
ref|XP_001769255.1|  cellulose synthase 8, glycosyltransferase fa...    515   2e-167   
gb|AFR58756.2|  cellulose synthase 3                                    514   2e-167   
ref|XP_007052525.1|  Cellulose synthase family protein isoform 1        519   3e-167   
ref|XP_004300066.1|  PREDICTED: probable cellulose synthase A cat...    515   3e-167   
gb|AFZ78555.1|  cellulose synthase                                      515   3e-167   
gb|AEK31219.1|  cellulose synthase A                                    514   3e-167   
gb|AFZ78563.1|  cellulose synthase                                      514   3e-167   
gb|AFP93559.1|  cellulose synthase A1                                   513   4e-167   
gb|ACJ38667.1|  cellulose synthase                                      514   4e-167   
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    513   4e-167   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          513   5e-167   
gb|ACT16001.1|  cellulose synthase                                      514   5e-167   
gb|ACZ82297.1|  cellulose synthase                                      514   5e-167   
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             514   6e-167   
gb|KDP36709.1|  hypothetical protein JCGZ_08000                         514   6e-167   
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           513   6e-167   
gb|KHG24504.1|  putative cellulose synthase A catalytic subunit 1...    498   9e-167   
gb|AGT16647.1|  cellulose synthase                                      513   1e-166   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    513   1e-166   
ref|XP_010645442.1|  PREDICTED: probable cellulose synthase A cat...    513   1e-166   
gb|AAQ63930.1|  cellulose synthase                                      488   1e-166   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    512   2e-166   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    513   2e-166   
emb|CDP02834.1|  unnamed protein product                                511   2e-166   
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...    512   2e-166   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             511   3e-166   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    511   4e-166   
gb|AFS95066.1|  cellulose synthase                                      512   4e-166   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    510   4e-166   
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    510   4e-166   
gb|AAY43218.1|  cellulose synthase BoCesA2                              511   5e-166   
ref|XP_006857480.1|  hypothetical protein AMTR_s00067p00196920          509   6e-166   
gb|EPS60781.1|  hypothetical protein M569_14019                         510   6e-166   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    511   7e-166   
gb|AEX20379.1|  cellulose synthase catalytic subunit 2-At               510   7e-166   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                     511   7e-166   
ref|XP_001767133.1|  cellulose synthase 4, glycosyltransferase fa...    511   7e-166   
tpg|DAA53225.1|  TPA: cellulose synthase3                               511   8e-166   
ref|XP_008673642.1|  PREDICTED: probable cellulose synthase A cat...    511   8e-166   
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...    511   8e-166   
gb|AAR29966.1|  putative cellulose synthase catalytic subunit           493   9e-166   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             509   9e-166   
gb|AEX20380.1|  cellulose synthase 2-Dt                                 509   9e-166   
ref|XP_011080097.1|  PREDICTED: cellulose synthase A catalytic su...    509   9e-166   
gb|EYU46413.1|  hypothetical protein MIMGU_mgv1a000605mg                505   1e-165   
gb|KHG10785.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    509   1e-165   
gb|KCW87523.1|  hypothetical protein EUGRSUZ_B03971                     502   1e-165   
ref|XP_010255732.1|  PREDICTED: probable cellulose synthase A cat...    511   1e-165   
gb|KDP26483.1|  hypothetical protein JCGZ_17641                         513   1e-165   
gb|AAR29967.1|  putative cellulose synthase catalytic subunit           510   1e-165   
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    511   1e-165   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...    511   1e-165   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          509   1e-165   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    509   1e-165   
gb|AFJ12110.1|  cellulose synthase                                      488   1e-165   
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        509   1e-165   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             509   1e-165   
gb|KHG02090.1|  Cellulose synthase A catalytic subunit 4 [UDP-for...    509   1e-165   
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    508   1e-165   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    510   1e-165   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    510   1e-165   
ref|XP_001753310.1|  putative cellulose synthase 3, glycosyltrans...    510   2e-165   
gb|AAY43219.2|  cellulose synthase BoCesA3                              510   2e-165   
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    510   2e-165   
emb|CBI37171.3|  unnamed protein product                                508   2e-165   
gb|AFB18637.1|  CESA8                                                   509   2e-165   
gb|KCW89002.1|  hypothetical protein EUGRSUZ_A01324                     505   2e-165   
ref|XP_002273521.1|  PREDICTED: cellulose synthase A catalytic su...    509   2e-165   
ref|XP_009383229.1|  PREDICTED: probable cellulose synthase A cat...    506   2e-165   
ref|XP_010091161.1|  OsCesA7 protein                                    509   2e-165   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...    510   2e-165   
gb|EMT03676.1|  Putative cellulose synthase A catalytic subunit 1...    509   2e-165   
gb|AFB18636.1|  CESA7                                                   508   3e-165   
gb|ACJ38666.1|  cellulose synthase                                      508   3e-165   
gb|EMT20923.1|  Putative cellulose synthase A catalytic subunit 1...    509   3e-165   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
gb|KDO60379.1|  hypothetical protein CISIN_1g001574mg                   508   4e-165   
ref|XP_006479463.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
ref|XP_010262430.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
ref|XP_006443764.1|  hypothetical protein CICLE_v10018639mg             508   4e-165   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    508   4e-165   
gb|KDO60380.1|  hypothetical protein CISIN_1g001574mg                   508   5e-165   
gb|AFZ78556.1|  cellulose synthase                                      508   5e-165   
gb|AFI71895.1|  cellulose synthase 6                                    509   5e-165   
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   508   5e-165   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    508   6e-165   
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             507   7e-165   
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    507   8e-165   
ref|XP_002308657.1|  cellulose synthase family protein                  508   8e-165   
gb|AAY43225.1|  cellulose synthase BoCesA3                              508   8e-165   
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...    508   9e-165   
gb|AFZ78551.1|  cellulose synthase                                      507   9e-165   
gb|ACC59197.1|  cellulose synthase                                      507   1e-164   
gb|AEE60897.1|  cellulose synthase                                      506   2e-164   
ref|XP_002325122.1|  cellulose synthase family protein                  506   2e-164   
dbj|BAJ88271.1|  predicted protein                                      506   2e-164   
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...    507   2e-164   
gb|EYU46412.1|  hypothetical protein MIMGU_mgv1a000605mg                506   3e-164   
ref|XP_009370338.1|  PREDICTED: cellulose synthase A catalytic su...    506   4e-164   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    505   4e-164   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    505   4e-164   
ref|XP_007158869.1|  hypothetical protein PHAVU_002G188600g             505   4e-164   
gb|AES65133.2|  cellulose synthase-like protein                         505   4e-164   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             505   4e-164   
ref|XP_003594882.1|  Cellulose synthase                                 505   4e-164   
ref|XP_008339053.1|  PREDICTED: cellulose synthase A catalytic su...    505   5e-164   
ref|XP_008339052.1|  PREDICTED: cellulose synthase A catalytic su...    505   6e-164   
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...    506   6e-164   
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    504   6e-164   
gb|AGG91493.1|  cellulose synthase A4                                   505   6e-164   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    505   7e-164   
ref|XP_009617929.1|  PREDICTED: probable cellulose synthase A cat...    506   7e-164   
ref|XP_009617930.1|  PREDICTED: probable cellulose synthase A cat...    506   7e-164   
ref|XP_006405185.1|  hypothetical protein EUTSA_v10000022mg             506   7e-164   
ref|XP_007050192.1|  Cellulose synthase A4 isoform 2                    504   1e-163   
gb|AGJ71353.1|  cellulose synthase 2                                    503   1e-163   
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    504   1e-163   
gb|AGX27216.1|  cellulose synthase 7                                    504   1e-163   
gb|AGX27211.1|  cellulose synthase 7                                    504   1e-163   
gb|AGX27206.1|  cellulose synthase 7                                    504   1e-163   
gb|AGX27238.1|  cellulose synthase 7                                    504   1e-163   
gb|AGX27235.1|  cellulose synthase 7                                    504   1e-163   
gb|AGX27215.1|  cellulose synthase 7                                    504   1e-163   
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...    505   1e-163   
gb|AGX27229.1|  cellulose synthase 7                                    504   1e-163   
ref|XP_007050191.1|  Cellulose synthase A4 isoform 1                    504   1e-163   
gb|AGX27233.1|  cellulose synthase 7                                    504   1e-163   
emb|CDX72357.1|  BnaC07g43790D                                          505   1e-163   
gb|AHH81946.1|  cellulose synthase                                      504   1e-163   
gb|AFG25776.1|  cellulose synthase 2                                    505   1e-163   
emb|CDY13484.1|  BnaA03g52020D                                          505   1e-163   



>gb|ADZ16122.1| truncated cellulose synthase A3 [Gossypium hirsutum]
Length=684

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  373   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  432

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  433   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  492

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  493   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  552

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  553   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  612

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  613   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  672

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  673   TGPDVEQCGINC  684



>gb|AEP33550.1| truncated cellulose synthase catalytic subunit [Gossypium hirsutum 
subsp. latifolium]
Length=684

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  373   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  432

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  433   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  492

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  493   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  552

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  553   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  612

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  613   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  672

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  673   TGPDVEQCGINC  684



>gb|AEP33542.1| truncated cellulose synthase catalytic subunit [Gossypium darwinii]
 gb|AEP33546.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. brasiliense]
 gb|AEP33548.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. peruvianum]
Length=684

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  373   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  432

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  433   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  492

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  493   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  552

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  553   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  612

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  613   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  672

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  673   TGPDVEQCGINC  684



>gb|AEP33544.1| truncated cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=684

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SV EDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  373   EIGWIYGSVIEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  432

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  433   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  492

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  493   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  552

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  553   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  612

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  613   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  672

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  673   TGPDVEQCGINC  684



>gb|ADZ16118.1| truncated cellulose synthase A3 [Gossypium barbadense]
Length=684

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  373   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  432

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  433   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  492

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  493   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  552

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQ W
Sbjct  553   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQLW  612

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  613   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  672

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  673   TGPDVEQCGINC  684



>dbj|BAF01916.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=431

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  119   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  178

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  179   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  238

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  239   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  298

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  299   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  358

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  359   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  418

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  419   VTGPDILECGINC  431



>ref|XP_010491045.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=347

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  35    MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  94

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  95    EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLLYCTLPAVCLFTNQFIIPQI  154

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  155   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVL  214

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  215   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  274

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  275   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  334

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  335   VTGPDILECGINC  347



>ref|XP_004229630.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Solanum lycopersicum]
Length=1083

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGYNGRLKWLER +Y+NTTIYP+TAIPLLIYC LPA+CLLTGKFIIPQIS
Sbjct  832   ILFSRHCPIWYGYNGRLKWLERFAYVNTTIYPITAIPLLIYCMLPAICLLTGKFIIPQIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  892   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+NLVGVVAGISYAVNSGYQSW
Sbjct  952   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAVNSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1012  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1071

Query  1128  TGPDVQECGINC  1163
             TGPDVQ CGINC
Sbjct  1072  TGPDVQACGINC  1083



>ref|XP_009601834.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
 ref|XP_009601835.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1087

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/312 (96%), Positives = 309/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYC+PKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  776   EIGWIYGSVTEDILTGFKMHARGWRSIYCIPKRPAFKGSAPINLSDRLNQVLRWALGSVE  835

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLLIYCTLPA+CLLTGKFIIPQIS
Sbjct  836   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLIYCTLPAICLLTGKFIIPQIS  895

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  896   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  955

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAGISYAVNSGYQSW
Sbjct  956   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGISYAVNSGYQSW  1015

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1016  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1075

Query  1128  TGPDVQECGINC  1163
             TGPDVQECGINC
Sbjct  1076  TGPDVQECGINC  1087



>ref|XP_009799381.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana sylvestris]
Length=1087

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  776   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  835

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLLIYC LPA+CLLTGKFIIPQIS
Sbjct  836   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLIYCMLPAICLLTGKFIIPQIS  895

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  896   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  955

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAGISYAVNSGYQSW
Sbjct  956   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGISYAVNSGYQSW  1015

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1016  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1075

Query  1128  TGPDVQECGINC  1163
             TGPDVQECGINC
Sbjct  1076  TGPDVQECGINC  1087



>gb|KDP26042.1| hypothetical protein JCGZ_21075 [Jatropha curcas]
Length=957

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  646   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPHRPAFKGSAPINLSDRLNQVLRWALGSVE  705

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  706   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLAYCTLPAVCLLTGKFIIPQIS  765

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  766   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  825

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  826   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  885

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  886   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  945

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  946   TGPDVQQCGINC  957



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGYNGRLKWLER +Y+NTTIYP+T+IPLLIYC LPA+CLLTGKFIIPQIS
Sbjct  832   ILFSRHCPIWYGYNGRLKWLERFAYVNTTIYPITSIPLLIYCMLPAICLLTGKFIIPQIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  892   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKATDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1012  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1071

Query  1128  TGPDVQECGINC  1163
             TGPDVQ CGINC
Sbjct  1072  TGPDVQACGINC  1083



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  765   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  824

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  825   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLAYCTLPAVCLLTGKFIIPQIS  884

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  885   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  944

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  945   GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1004

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1005  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1064

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1065  TGPDVQQCGINC  1076



>ref|XP_002278997.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Vitis vinifera]
Length=1081

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  830   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLVYCTLPAVCLLTGKFIIPQIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  890   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1070  TGPDVEQCGINC  1081



>gb|KHG03009.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1068

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  817   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  877   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1057  TGPDVEQCGINC  1068



>gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium schwendimanii]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
brasiliense]
 gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
peruvianum]
Length=1066

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  755   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  814

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  815   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  874

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  875   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  934

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  935   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  994

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  995   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1054

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1055  TGPDVEQCGINC  1066



>gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium darwinii]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium laxum]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|ADZ16121.1| cellulose synthase A3 [Gossypium raimondii]
Length=1067

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum]
 gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum]
Length=1067

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. 
latifolium]
Length=1067

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|ADZ16123.1| cellulose synthase A3 [Gossypium hirsutum]
Length=1067

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii]
 gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum]
Length=1067

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>ref|XP_007133819.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
 gb|ESW05813.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
Length=1074

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  763   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  822

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLLIYC LPAVCLLT KFIIPQIS
Sbjct  823   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPLTAIPLLIYCILPAVCLLTNKFIIPQIS  882

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  883   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  942

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSGYQSW
Sbjct  943   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINMVGVVAGISYAINSGYQSW  1002

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1003  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1062

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1063  TGPDVEECGINC  1074



>ref|XP_003540527.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1079

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLLIYC LPAVCLLT KFIIPQIS
Sbjct  828   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLIYCILPAVCLLTNKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1068  TGPDVEECGINC  1079



>gb|KHN19454.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1093

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  782   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  841

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLLIYC LPAVCLLT KFIIPQIS
Sbjct  842   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLIYCILPAVCLLTNKFIIPQIS  901

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  902   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  961

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  962   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1021

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFTTRV
Sbjct  1022  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTTRV  1081

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1082  TGPDVEECGINC  1093



>tpg|DAA39507.1| TPA: hypothetical protein ZEAMMB73_844715 [Zea mays]
Length=596

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  285   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  344

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLLIYC LPA+CLLTGKFIIP+IS
Sbjct  345   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLIYCILPAICLLTGKFIIPEIS  404

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  405   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  464

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  465   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  524

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  525   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  584

Query  1128  TGPDVQECGINC  1163
             TGPD + CGINC
Sbjct  585   TGPDTRTCGINC  596



>ref|XP_003542849.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006594411.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
 ref|XP_006594412.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Glycine max]
 ref|XP_006594413.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Glycine max]
Length=1080

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLLIYC LPAVCLLT KFIIPQIS
Sbjct  829   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLIYCILPAVCLLTNKFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN++GVVAGISYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINMIGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1069  TGPDVEECGINC  1080



>gb|ADZ16119.1| cellulose synthase A3 [Gossypium barbadense]
Length=1067

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLF VFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFTVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|KHN37622.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1091

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  780   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  839

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLLIYC LPAVCLLT KFIIPQIS
Sbjct  840   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLIYCILPAVCLLTNKFIIPQIS  899

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  900   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  959

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN++GVVAGISYA+NSGYQSW
Sbjct  960   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINMIGVVAGISYAINSGYQSW  1019

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1020  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1079

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1080  TGPDVEECGINC  1091



>gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFG LFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGNLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|KDP43475.1| hypothetical protein JCGZ_16762 [Jatropha curcas]
Length=1078

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +YINTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  827   ILFSRHCPIWYGYGGRLKWLERFAYINTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+N+VGVVAGISYA+NSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNIVGVVAGISYAINSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTT V
Sbjct  1007  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTSV  1066

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1067  TGPDVQQCGINC  1078



>gb|AEP33539.1| cellulose synthase catalytic subunit [Gossypium turneri]
Length=1067

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1056  TGPDVELCGINC  1067



>gb|AEP33536.1| cellulose synthase catalytic subunit [Gossypium thurberi]
Length=1067

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1056  TGPDVELCGINC  1067



>gb|AEP33545.1| cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=1067

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1056  TGPDVELCGINC  1067



>gb|AEP33553.1| cellulose synthase catalytic subunit [Gossypium harknessii]
Length=1067

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1056  TGPDVELCGINC  1067



>gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium trilobum]
Length=1067

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/312 (96%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1056  TGPDVELCGINC  1067



>gb|ADZ16120.1| cellulose synthase A3 [Gossypium herbaceum subsp. africanum]
Length=1067

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFACWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|AFZ78564.1| cellulose synthase [Populus tomentosa]
Length=1061

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  750   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  809

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLERL+YINTTIYPVTAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  810   ILLSRHCPIWYGYSGRLKWLERLAYINTTIYPVTAIPLLAYCTLPAVCLLTGKFIIPQIS  869

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  870   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  929

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  930   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLLINLVGVVAGVSYAINSGYQSW  989

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPFTTRV
Sbjct  990   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFTTRV  1049

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1050  TGPDVEQCGINC  1061



>ref|XP_011093547.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Sesamum indicum]
Length=1047

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  736   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  795

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  796   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLLYCTLPAVCLLTGKFIIPQIS  855

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  856   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  915

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  916   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  975

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  976   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1035

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1036  TGPDVEQCGINC  1047



>ref|XP_011087713.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
 ref|XP_011087722.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
Length=1066

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  755   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  814

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  815   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAVCLLTGKFIIPQIS  874

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  875   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  934

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  935   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  994

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  995   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1054

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1055  TGPDVEQCGINC  1066



>ref|XP_010241248.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1071

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  760   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPHRPAFKGSAPINLSDRLNQVLRWALGSVE  819

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYPVT+IPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  820   ILFSRHCPMWYGYGGRLKWLERFAYVNTTIYPVTSIPLLAYCTLPAVCLLTGKFIIPQIS  879

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  880   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  939

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  940   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  999

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1000  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1059

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1060  TGPDVQQCGINC  1071



>emb|CDP07782.1| unnamed protein product [Coffea canephora]
Length=1083

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS
Sbjct  832   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  892   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQ+W
Sbjct  952   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQTW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1012  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1071

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1072  TGPDVEQCGINC  1083



>ref|XP_003546888.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1073

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVT+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  822   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTSIPLLMYCTLPAVCLLTNKFIIPQIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  882   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  942   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1002  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1061

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1062  TGPDVEQCGINC  1073



>gb|KHG16921.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Gossypium 
arboreum]
Length=1064

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  753   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  812

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  813   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  872

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  873   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  932

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  933   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  992

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  993   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1052

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1053  TGPDVELCGINC  1064



>gb|AEK31218.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1080

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  829   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGP V++CGINC
Sbjct  1069  TGPAVEQCGINC  1080



>gb|KHN39939.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1073

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVT+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  822   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTSIPLLMYCTLPAVCLLTNKFIIPQIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  882   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  942   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1002  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1061

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1062  TGPDVEQCGINC  1073



>gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAV LLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVRLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|KHM98952.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1062

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  751   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  810

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVT+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  811   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTSIPLLMYCTLPAVCLLTNKFIIPQIS  870

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  871   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  930

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  931   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  990

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  991   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1050

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1051  TGPDVEQCGINC  1062



>ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1074

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  763   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  822

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVT+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  823   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTSIPLLMYCTLPAVCLLTNKFIIPQIS  882

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  883   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  942

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  943   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1002

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1003  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1062

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1063  TGPDVEQCGINC  1074



>ref|XP_002308955.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92478.1| cellulose synthase family protein [Populus trichocarpa]
Length=1058

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  747   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  806

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  807   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  866

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  867   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  926

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  927   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  986

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPFTTRV
Sbjct  987   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFTTRV  1046

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1047  TGPDVEQCGINC  1058



>ref|XP_011048033.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1061

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  750   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  809

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  810   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  869

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  870   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  929

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  930   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  989

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPFTTRV
Sbjct  990   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFTTRV  1049

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1050  TGPDVEQCGINC  1061



>ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1061

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKR AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  750   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRAAFKGSAPINLSDRLNQVLRWALGSVE  809

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGYNGRLKWLER +Y+NTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  810   ILFSRHCPLWYGYNGRLKWLERFAYVNTTIYPLTSIPLLAYCTLPAVCLLTGKFIIPQIS  869

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLAS+WF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  870   NLASVWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  929

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLV VVAGISYA+NSGYQSW
Sbjct  930   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVAVVAGISYAINSGYQSW  989

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  990   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1049

Query  1128  TGPDVQECGINC  1163
             TGPD+++CGINC
Sbjct  1050  TGPDIKQCGINC  1061



>ref|XP_011020351.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1085

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  774   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  833

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  834   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  893

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  894   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  953

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  954   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  1013

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPFTTRV
Sbjct  1014  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFTTRV  1073

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1074  TGPDVEQCGINC  1085



>ref|XP_007052526.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052530.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96683.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96687.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
Length=1068

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYPVTAIPL++YCTLPAVCLLT KFIIPQIS
Sbjct  817   ILFSRHCPLWYGYGGRLKWLERFAYVNTTIYPVTAIPLVMYCTLPAVCLLTNKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV+ CGINC
Sbjct  1057  TGPDVEVCGINC  1068



>ref|XP_002532166.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF30219.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1085

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  774   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  833

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  834   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTDKFIIPQIS  893

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  894   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  953

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLL+PPTTLLIIN +GVVAGIS+A+NSGYQSW
Sbjct  954   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLVPPTTLLIINFIGVVAGISHAINSGYQSW  1013

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNR PTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1014  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRMPTIVVVWSILLASIFSLLWVRVDPFTTRV  1073

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1074  TGPDVEQCGINC  1085



>ref|XP_010547260.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Tarenaya hassleriana]
Length=1078

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/312 (95%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +YINTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  827   ILFSRHCPIWYGYSGRLKWLERFAYINTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIIN+VGVVAGISYAVNSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINIVGVVAGISYAVNSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGPDVQECGINC
Sbjct  1067  TGPDVQECGINC  1078



>gb|KEH19084.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +YINTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  827   ILFSRHCPIWYGYGGRLKWLERFAYINTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+ KWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDSAELYMIKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGP  +ECGINC
Sbjct  1067  TGPKAEECGINC  1078



>ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN53854.1| hypothetical protein Csa_4G166980 [Cucumis sativus]
Length=1050

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYC+P RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  739   EIGWIYGSVTEDILTGFKMHARGWRSIYCIPDRPAFKGSAPINLSDRLNQVLRWALGSVE  798

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYP+T+IPLL YCTLPA+CLLTGKFIIPQIS
Sbjct  799   ILFSRHCPVWYGYGGRLKWLERFAYVNTTIYPITSIPLLAYCTLPAICLLTGKFIIPQIS  858

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  859   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  918

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSGYQSW
Sbjct  919   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIVGVVAGISYAINSGYQSW  978

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  979   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1038

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1039  TGPDVEQCGINC  1050



>ref|XP_007028786.1| Cellulose synthase family protein [Theobroma cacao]
 gb|EOY09288.1| Cellulose synthase family protein [Theobroma cacao]
Length=1069

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  758   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  817

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  818   ILLSRHCPIWYGYGGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  877

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  878   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  937

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  938   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  997

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNR PTIVVVW+ILLASIFSLLWVRIDPFTT+V
Sbjct  998   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRMPTIVVVWAILLASIFSLLWVRIDPFTTQV  1057

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1058  TGPDVEQCGINC  1069



>ref|XP_011033321.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1064

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  753   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  812

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  813   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  872

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  873   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  932

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  933   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  992

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTT+V
Sbjct  993   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTKV  1052

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1053  TGPDVAQCGINC  1064



>ref|XP_010534646.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Tarenaya hassleriana]
Length=833

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSD LNQVLRWALGSVE
Sbjct  522   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDCLNQVLRWALGSVE  581

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +YINTTIYP+T++PLL+YCTL AVCL T KFIIPQIS
Sbjct  582   ILFSRHCPIWYGYGGRLKWLERFAYINTTIYPITSVPLLMYCTLSAVCLFTNKFIIPQIS  641

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAH+FAVFQGLLKVLA
Sbjct  642   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHIFAVFQGLLKVLA  701

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSG QSW
Sbjct  702   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIVGVVAGISYAINSGCQSW  761

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  762   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  821

Query  1128  TGPDVQECGINC  1163
             TGPDVQECGINC
Sbjct  822   TGPDVQECGINC  833



>ref|XP_008460760.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1050

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYC+P RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  739   EIGWIYGSVTEDILTGFKMHARGWRSIYCIPDRPAFKGSAPINLSDRLNQVLRWALGSVE  798

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYP+T+IPLL YCTLPA+CLLTGKFIIPQIS
Sbjct  799   ILFSRHCPMWYGYGGRLKWLERFAYVNTTIYPITSIPLLAYCTLPAICLLTGKFIIPQIS  858

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  859   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  918

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSGYQSW
Sbjct  919   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIVGVVAGISYAINSGYQSW  978

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  979   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1038

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1039  TGPDVEQCGINC  1050



>ref|XP_011033320.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Populus euphratica]
Length=1068

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTT+V
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTKV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1057  TGPDVAQCGINC  1068



>gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=1067

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  816   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGIL+M+W+GVGID+WWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  876   NLASIWFISLFLSIFATGILKMKWNGVGIDQWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISY +NSGYQSW
Sbjct  936   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYVINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1056  TGPDVEQCGINC  1067



>gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Erythranthe guttata]
Length=1065

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP R AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  754   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRAAFKGSAPINLSDRLNQVLRWALGSVE  813

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGYNGRLKWLER +Y+NTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  814   ILFSRHCPIWYGYNGRLKWLERFAYVNTTIYPITSIPLLFYCTLPAVCLLTGKFIIPQIS  873

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  874   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  933

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+N+VGVVAGISYA+NSGYQSW
Sbjct  934   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNIVGVVAGISYAINSGYQSW  993

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  994   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1053

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1054  TGPDVEQCGINC  1065



>ref|XP_010278977.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278978.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1056

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/312 (95%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP  PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  745   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPNPPAFKGSAPINLSDRLNQVLRWALGSVE  804

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +YINTTIYPVTA+PLL YCTLPAVCLLTGKFIIPQIS
Sbjct  805   ILLSRHCPIWYGYGGRLKWLERFAYINTTIYPVTAVPLLAYCTLPAVCLLTGKFIIPQIS  864

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  865   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  924

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  925   GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  984

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  985   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1044

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1045  TGPDVQQCGINC  1056



>ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
Length=1070

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYC+P RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  759   EIGWIYGSVTEDILTGFKMHARGWRSIYCIPDRPAFKGSAPINLSDRLNQVLRWALGSVE  818

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYP+T+IPLL YCTLPA+CLLTGKFIIPQIS
Sbjct  819   ILFSRHCPVWYGYGGRLKWLERFAYVNTTIYPITSIPLLAYCTLPAICLLTGKFIIPQIS  878

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  879   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  938

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSGYQSW
Sbjct  939   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINIVGVVAGISYAINSGYQSW  998

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  999   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1058

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1059  TGPDVEQCGINC  1070



>ref|XP_008651867.1| PREDICTED: cellulose synthase-4 isoform X1 [Zea mays]
Length=870

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  559   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  618

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  619   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAICLLTGKFIIPEIS  678

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  679   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  738

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  739   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  798

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  799   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  858

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  859   TGPDTQTCGINC  870



>ref|XP_004306536.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1083

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/313 (94%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
              +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  771   QEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  830

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EIL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+TAIPLL YCTLPAVCLLT KFIIPQI
Sbjct  831   EILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITAIPLLAYCTLPAVCLLTNKFIIPQI  890

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  891   SNIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVL  950

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQS
Sbjct  951   AGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQS  1010

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTTR
Sbjct  1011  WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTR  1070

Query  1125  VTGPDVQECGINC  1163
             VTGPDV+ CGINC
Sbjct  1071  VTGPDVEVCGINC  1083



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  831   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  891   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVR+DPFTTRV
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTTRV  1070

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1071  TGPDVEQCGINC  1082



>gb|AFB18638.1| CESA10 [Gossypium hirsutum]
Length=1068

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPLRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNR PTIVVVW+ILLASIFSLLWVRIDPFTT+V
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRMPTIVVVWAILLASIFSLLWVRIDPFTTKV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1057  TGPDVEQCGINC  1068



>ref|XP_008231249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
 ref|XP_008231250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
Length=1082

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  831   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  891   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVR+DPFTTRV
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTTRV  1070

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1071  TGPDVEQCGINC  1082



>gb|KHG04072.1| putative cellulose synthase A catalytic subunit 8 [UDP-forming] 
[Gossypium arboreum]
Length=1068

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 306/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPLRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNR PTIVVVW+ILLASIFSLLWVRIDPFTT+V
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRMPTIVVVWAILLASIFSLLWVRIDPFTTKV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1057  TGPDVEQCGINC  1068



>ref|NP_001289668.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Eucalyptus 
grandis]
 gb|ABY25274.1| cellulose synthase [Eucalyptus grandis]
 gb|KCW66107.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
 gb|KCW66108.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
Length=1080

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  829   ILFSRHCPLWYGYGGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NVASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGP V++CGINC
Sbjct  1069  TGPAVEQCGINC  1080



>ref|XP_002322712.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF04473.1| cellulose synthase family protein [Populus trichocarpa]
Length=1068

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITSIPLLAYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTT+V
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTKV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1057  TGPDVTQCGINC  1068



>ref|XP_006373780.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
 gb|ERP51577.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
Length=1064

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  753   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  812

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  813   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITSIPLLAYCTLPAVCLLTGKFIIPQIS  872

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  873   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  932

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  933   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  992

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTT+V
Sbjct  993   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTKV  1052

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1053  TGPDVTQCGINC  1064



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW+SIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  755   EIGWIYGSVTEDILTGFKMHARGWKSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  814

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++PLL+YCTLPA+CLLTGKFIIPQIS
Sbjct  815   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSLPLLLYCTLPAICLLTGKFIIPQIS  874

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  875   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  934

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  935   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  994

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  995   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1054

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1055  TGPDVQQCGINC  1066



>ref|XP_011025442.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1079

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLFYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK+SDEDGDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKSSDEDGDFTELYMFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|KDO83413.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=918

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  607   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  666

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFI+PQIS
Sbjct  667   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQIS  726

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASI FISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  727   NLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  786

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  787   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  846

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  847   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  906

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  907   TGPDVEQCGINC  918



>ref|XP_010937172.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  826   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCTLPAVCLLTGKFIIPQIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  886   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1066  TGPDVQQCGINC  1077



>ref|XP_008790520.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1068

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 308/312 (99%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LERL+YINTTIYP+T++PLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILFSRHCPIWYGYGGRLKFLERLAYINTTIYPLTSVPLLLYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEEGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  997   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPD+Q+CGINC
Sbjct  1057  TGPDIQQCGINC  1068



>ref|XP_002298432.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 ref|XP_006369625.1| cellulose synthase family protein [Populus trichocarpa]
 ref|XP_006369626.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|EEE83237.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|ERP66194.1| cellulose synthase family protein [Populus trichocarpa]
 gb|ERP66195.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
Length=1081

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  830   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  890   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDG FAELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGGFAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1070  TGPDVEQCGINC  1081



>ref|XP_011047398.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011047399.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X2 [Populus euphratica]
 ref|XP_011047400.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1079

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVCQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLL+PPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLVPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AEE60898.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLFYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK+SDEDGDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKSSDEDGDFTELYMFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|XP_002314037.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE87992.1| cellulose synthase family protein [Populus trichocarpa]
Length=1079

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLFYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK+SDEDGDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKSSDEDGDFTELYMFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|ABY25277.1| cellulose synthase [Eucalyptus grandis]
Length=1080

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYP++AIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  829   ILFSRHCPLWYGYGGRLKWLERFAYVNTTIYPISAIPLLMYCTLPAVCLLTNKFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NVASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGP V++CGINC
Sbjct  1069  TGPAVEQCGINC  1080



>ref|XP_004510986.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1077

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +YINTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  826   ILLSRHCPIWYGYGGRLKWLERFAYINTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  886   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTR+
Sbjct  1006  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRI  1065

Query  1128  TGPDVQECGINC  1163
             TGP  +ECGINC
Sbjct  1066  TGPKAEECGINC  1077



>gb|AFZ78557.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLFYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK+SDEDGDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKSSDEDGDFTELYMFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|XP_008784835.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+TAIPLL+YC LPAVCLLTGKFIIPQIS
Sbjct  826   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTAIPLLLYCMLPAVCLLTGKFIIPQIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  886   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEEGDFTELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1066  TGPDVQQCGINC  1077



>ref|XP_010032436.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Eucalyptus grandis]
 ref|XP_010032437.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW51830.1| hypothetical protein EUGRSUZ_J01278 [Eucalyptus grandis]
Length=1079

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  828   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDF ELY FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEEGDFTELYTFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV+ECGINC
Sbjct  1068  TGPDVEECGINC  1079



>ref|XP_010906116.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
 ref|XP_010906117.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1068

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+ PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQPPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+TA+PLL+YCTLPAVCLLTGKFI+PQIS
Sbjct  817   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTALPLLLYCTLPAVCLLTGKFIMPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  997   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1057  TGPDVQQCGINC  1068



>ref|XP_010653789.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Vitis vinifera]
Length=1087

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  776   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  835

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  836   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLAYCTLPAVCLLTGKFIIPQIS  895

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  896   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVCQGLLKVLA  955

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  956   GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1015

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1016  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1075

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1076  TGPDVEQCGINC  1087



>gb|AIS86011.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS85996.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86001.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS85978.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85980.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85981.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85982.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85983.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85992.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85995.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85997.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85998.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85999.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86007.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86008.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|XP_009407595.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Musa acuminata subsp. malaccensis]
Length=1065

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW+SIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  754   EIGWIYGSVTEDILTGFKMHARGWKSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  813

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++PLL+YCTLPA+CLLTGKFIIPQIS
Sbjct  814   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSLPLLLYCTLPAICLLTGKFIIPQIS  873

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  874   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  933

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  934   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  993

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  994   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1053

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1054  TGPDVLQCGINC  1065



>gb|AIA10372.1| cellulose synthase [Boehmeria nivea]
Length=1079

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK  AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLAAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER SY+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYSGRLKWLERFSYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS86009.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS85989.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85993.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85994.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86000.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86002.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS85977.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|XP_008375180.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Malus domestica]
Length=1082

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  831   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  891   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVR+DPFTTRV
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTTRV  1070

Query  1128  TGPDVQECGINC  1163
             TGPD++ECGINC
Sbjct  1071  TGPDIEECGINC  1082



>ref|XP_009407580.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009407588.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 307/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW+SIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  755   EIGWIYGSVTEDILTGFKMHARGWKSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  814

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++PLL+YCTLPA+CLLTGKFIIPQIS
Sbjct  815   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSLPLLLYCTLPAICLLTGKFIIPQIS  874

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  875   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  934

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  935   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  994

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  995   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1054

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1055  TGPDVLQCGINC  1066



>gb|AIS86005.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AIS85991.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|EAZ03185.1| hypothetical protein OsI_25338 [Oryza sativa Indica Group]
Length=1063

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  752   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  811

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  812   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  871

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  872   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  931

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  932   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  991

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  992   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1051

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1052  TGPDTQTCGINC  1063



>gb|AIS85990.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86003.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86006.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86010.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AAL23710.2| cellulose synthase [Populus tremuloides]
Length=1078

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  827   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAICLLTDKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1007  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1066

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1067  TGPDVEQCGINC  1078



>gb|AHL45026.1| cellulose synthase 3B [Linum usitatissimum]
Length=1059

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/313 (93%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
              +IG IY SVTEDILTGFKMHARGW+SIYCMP+R AFKGSAPINLSDRLNQVLRWALGSV
Sbjct  747   QEIGWIYGSVTEDILTGFKMHARGWKSIYCMPERAAFKGSAPINLSDRLNQVLRWALGSV  806

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQI
Sbjct  807   EILFSRHCPMWYGYGGRLKFLERFAYINTTIYPITSIPLLAYCTLPAVCLLTGKFIIPQI  866

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  867   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  926

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKA+DEDGDFAELYLFKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQS
Sbjct  927   AGIDTNFTVTSKANDEDGDFAELYLFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQS  986

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR
Sbjct  987   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1046

Query  1125  VTGPDVQECGINC  1163
             VTGPDV +CGINC
Sbjct  1047  VTGPDVDQCGINC  1059



>gb|AIS86004.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AFZ78554.1| cellulose synthase [Populus tomentosa]
 gb|AIS85972.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85973.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85974.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85975.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85976.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85979.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85984.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85985.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85986.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85988.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86012.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|NP_196136.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q941L0.2|CESA3_ARATH RecName: Full=Cellulose synthase A catalytic subunit 3 [UDP-forming]; 
Short=AtCesA3; AltName: Full=Constitutive expression 
of VSP1 protein 1; AltName: Full=Isoxaben-resistant protein 
1; Short=Ath-B; AltName: Full=Protein ECTOPIC LIGNIN 1; AltName: 
Full=Protein RADIALLY SWOLLEN 5; Short=AtRSW5 [Arabidopsis 
thaliana]
 dbj|BAB09693.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAN86168.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED90836.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38644.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1065

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  873   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>gb|AFZ78565.1| cellulose synthase [Populus tomentosa]
Length=1064

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFK+HARGWRSIYCMPKR AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  753   EIGWIYGSVTEDILTGFKVHARGWRSIYCMPKRAAFKGSAPINLSDRLNQVLRWALGSVE  812

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  813   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTGKFIIPQIS  872

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  873   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  932

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  933   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGVSYAINSGYQSW  992

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR+DPFTTRV
Sbjct  993   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVDPFTTRV  1052

Query  1128  TGPDVQECGINC  1163
             TGPDV +CGINC
Sbjct  1053  TGPDVTQCGINC  1064



>ref|NP_001059162.1| Os07g0208500 [Oryza sativa Japonica Group]
 sp|Q84ZN6.1|CESA8_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
8 [UDP-forming]; AltName: Full=OsCesA8 [Oryza sativa Japonica 
Group]
 dbj|BAC57282.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAD30175.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAF21076.1| Os07g0208500 [Oryza sativa Japonica Group]
 gb|EAZ39084.1| hypothetical protein OsJ_23516 [Oryza sativa Japonica Group]
 dbj|BAG92935.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1081

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>ref|XP_002873198.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49457.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
Length=1065

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  873   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
 gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
Length=1088

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP  PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  777   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPHPPAFKGSAPINLSDRLNQVLRWALGSVE  836

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I  SRHCPIWYGY+GRLKWLER +Y++TTIYP+T+IPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  837   IFLSRHCPIWYGYSGRLKWLERFAYVSTTIYPITSIPLLMYCTLPAVCLLTGKFIIPQIS  896

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  897   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  956

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  957   GIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1016

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFTTRV
Sbjct  1017  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTTRV  1076

Query  1128  TGPDVQECGINC  1163
             TGPDVQ+CGINC
Sbjct  1077  TGPDVQQCGINC  1088



>gb|ACC59195.1| cellulose synthase [Betula platyphylla]
Length=1084

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  833   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  893   NVASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVCQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTT V
Sbjct  1013  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTTV  1072

Query  1128  TGPDVQECGINC  1163
             TGPDVQ CGINC
Sbjct  1073  TGPDVQLCGINC  1084



>ref|XP_010452418.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Camelina sativa]
Length=1060

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  748   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  807

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  808   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLLYCTLPAVCLFTNQFIIPQI  867

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  868   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVL  927

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  928   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  987

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  988   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1047

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1048  VTGPDILECGINC  1060



>ref|XP_006657551.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming]-like [Oryza brachyantha]
Length=1081

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++PLLIYC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSVPLLIYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>gb|AFI71894.1| cellulose synthase 3 [Paeonia lactiflora]
Length=1081

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLKWLER +YINTTIYP+TAIPLL YCTLPAVCLLT KFIIPQIS
Sbjct  830   ILLSRHCPIWYGYNGRLKWLERFAYINTTIYPITAIPLLAYCTLPAVCLLTNKFIIPQIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  890   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA DE+GDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW
Sbjct  950   GIDTNFTVTSKAGDEEGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGR+NRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRRNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD + CGINC
Sbjct  1070  TGPDTELCGINC  1081



>ref|XP_010491044.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=1061

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  749   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  808

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  809   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLLYCTLPAVCLFTNQFIIPQI  868

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  869   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVL  928

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  929   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  988

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  989   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1048

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1049  VTGPDILECGINC  1061



>gb|AFG25777.1| cellulose synthase 3 [Bambusa emeiensis]
Length=1081

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER SYINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPIWYGYGGRLKFLERFSYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELYLFKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEEGDFAELYLFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>ref|NP_001105621.1| cellulose synthase-4 [Zea mays]
 gb|AAF89964.1|AF200528_1 cellulose synthase-4 [Zea mays]
Length=1077

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  826   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAICLLTGKFIIPEIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  886   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1066  TGPDTQTCGINC  1077



>emb|CBI29854.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/312 (94%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  932   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  991

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYPVTAIPLL YCTLPAVCLLTGKFIIPQIS
Sbjct  992   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPVTAIPLLAYCTLPAVCLLTGKFIIPQIS  1051

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  1052  NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVCQGLLKVLA  1111

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  1112  GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1171

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1172  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1231

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1232  TGPDVEQCGINC  1243



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP  PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPNPPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  826   ILLSRHCPIWYGYKGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  886   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+ DFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+N+GYQSW
Sbjct  946   GIDTNFTVTSKASDEENDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINNGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1066  TGPDVEQCGINC  1077



>gb|AIS85987.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIW GY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  828   ILLSRHCPIWKGYGGRLKWLERFAYVNTTIYPITAIPLLLYCTLPAICLLTDKFIIPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  888   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYLFKWTTLLIPPTTLLI+NLVGVVAGIS+A+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDSAELYLFKWTTLLIPPTTLLIVNLVGVVAGISHAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTIRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>tpg|DAA59989.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1077

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  826   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAICLLTGKFIIPEIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  886   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1066  TGPDTQTCGINC  1077



>gb|KDO83405.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83406.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83407.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83408.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83409.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83410.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83411.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1079

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFI+PQIS
Sbjct  828   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASI FISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  888   NLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>ref|XP_004499886.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1078

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPK  AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKLAAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLKWLER +YINTTIYP+T+IPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  827   ILVSRHCPIWYGYNGRLKWLERFAYINTTIYPITSIPLLMYCTLPAICLLTNKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDFQELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGPD ++CGINC
Sbjct  1067  TGPDSEQCGINC  1078



>ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Citrus sinensis]
 ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Citrus sinensis]
Length=1079

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFI+PQIS
Sbjct  828   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASI FISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  888   NLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVEQCGINC  1079



>gb|AGV22107.1| cellulose synthase 2 [Betula luminifera]
Length=1084

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/312 (94%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER SY+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  833   ILLSRHCPIWYGYGGRLKWLERFSYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             ++ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIG VSAHLFAV QGLLKVLA
Sbjct  893   SVASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGDVSAHLFAVCQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1013  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1072

Query  1128  TGPDVQECGINC  1163
             TGPDVQ CGINC
Sbjct  1073  TGPDVQLCGINC  1084



>ref|XP_007148880.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
 gb|ESW20874.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
Length=1075

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK  AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  764   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLAAFKGSAPINLSDRLNQVLRWALGSVE  823

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPA+CLLT KFIIPQIS
Sbjct  824   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAICLLTNKFIIPQIS  883

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  884   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  943

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  944   GIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1003

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTT+V
Sbjct  1004  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTKV  1063

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1064  TGPDVEQCGINC  1075



>gb|KDO83412.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1082

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFI+PQIS
Sbjct  831   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASI FISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  891   NLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1070

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1071  TGPDVEQCGINC  1082



>ref|XP_006439113.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 ref|XP_006439114.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52353.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52354.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=1079

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFI+PQIS
Sbjct  828   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASI FISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  888   NLASIVFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPDV++CGINC
Sbjct  1068  TGPDVKQCGINC  1079



>gb|AAY43221.1| cellulose synthase BoCesA4 [Bambusa oldhamii]
Length=1067

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  756   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  815

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER SYINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  816   ILFSRHCPIWYGYGGRLKFLERFSYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  875

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  876   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  935

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  936   GIDTNFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  996   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1055

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1056  TGPDTQTCGINC  1067



>gb|AGC65585.1| CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1066

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTV SKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  934   AGIDTNFTVISKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>ref|XP_006398979.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
 gb|ESQ40432.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
Length=1065

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/313 (92%), Positives = 306/313 (98%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASI+F+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  873   SNIASIYFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGVLKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AG+DTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGVDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>ref|XP_002461675.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
 gb|EER98196.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
Length=1081

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>gb|AAY60846.1| cellulose synthase 4 [Eucalyptus grandis]
Length=1080

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  829   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATG+LEMRWSGVG DEWWRNEQ WVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NVASIWFISLFLSIFATGVLEMRWSGVGTDEWWRNEQLWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQ RTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQKRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGP V++CGINC
Sbjct  1069  TGPAVEQCGINC  1080



>gb|AAY43220.1| cellulose synthase BoCesA4 [Bambusa oldhamii]
Length=1061

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  750   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  809

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  810   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  869

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  870   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  929

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  930   GIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  989

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  990   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1049

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1050  TGPDTQTCGINC  1061



>ref|XP_004135931.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN45128.1| hypothetical protein Csa_7G428160 [Cucumis sativus]
Length=1083

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  832   ILLSRHCPIWYGYGGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWF++LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  892   NIASIWFLALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD+AELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKASDEDGDYAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTT V
Sbjct  1012  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTTV  1071

Query  1128  TGPDVQECGINC  1163
              GPDV+ECGINC
Sbjct  1072  IGPDVEECGINC  1083



>ref|XP_010228019.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming] isoform X3 [Brachypodium distachyon]
Length=931

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  620   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  679

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTG+FIIPQIS
Sbjct  680   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGRFIIPQIS  739

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  740   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  799

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  800   GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  859

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDPFTTRV
Sbjct  860   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVIVWAILLASIFSLLWVRIDPFTTRV  919

Query  1128  TGPDVQECGINC  1163
             TGPD+Q CGINC
Sbjct  920   TGPDIQMCGINC  931



>ref|XP_009364979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009364980.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1081

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  830   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QG+LKVLA
Sbjct  890   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGILKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGP++ ECGINC
Sbjct  1070  TGPNIDECGINC  1081



>ref|XP_009354747.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
 ref|XP_009354748.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1082

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  831   ILLSRHCPIWYGYSGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  891   NLASIWFITLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELY+FKWTTLLIPPTTLL+INLVGVVAGISYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPPTTLLVINLVGVVAGISYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVR+DPFTT V
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTTTV  1070

Query  1128  TGPDVQECGINC  1163
             TGPD++ECGINC
Sbjct  1071  TGPDIEECGINC  1082



>ref|XP_006289427.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
 gb|EOA22325.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
Length=1065

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLLYCTLPAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGV IDEWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  873   SNIASIWFLSLFLSIFATGILEMRWSGVRIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>gb|AHL45025.1| cellulose synthase 3A [Linum usitatissimum]
Length=1060

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/313 (93%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
              +IG IY SVTEDILTGFKMHARGW+SIYCMP+R AFKGSAPINLSDRLNQVLRWALGSV
Sbjct  748   QEIGWIYGSVTEDILTGFKMHARGWKSIYCMPERAAFKGSAPINLSDRLNQVLRWALGSV  807

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLL YCTLPAVCLLTGKFIIPQI
Sbjct  808   EILFSRHCPMWYGYGGRLKFLERFAYINTTIYPITSIPLLAYCTLPAVCLLTGKFIIPQI  867

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  868   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  927

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKA+DEDGDFAELYLFKWTTLLIPPTTLL+INLVGVVAG+SYA+NSGYQS
Sbjct  928   AGIDTNFTVTSKANDEDGDFAELYLFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQS  987

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFA WVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR
Sbjct  988   WGPLFGKLFFALWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1047

Query  1125  VTGPDVQECGINC  1163
             VTGP+V +CGINC
Sbjct  1048  VTGPNVDQCGINC  1060



>gb|AAC39336.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=1065

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTL AVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLLAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  873   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>emb|CDY14127.1| BnaC02g02440D [Brassica napus]
Length=1066

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL+YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLLYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>gb|AAT66941.1| CesA2 [Acacia mangium]
Length=1075

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/312 (92%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  764   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  823

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYP+TAIPL++YCTLPAVCLLT +FIIPQIS
Sbjct  824   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPITAIPLVMYCTLPAVCLLTNRFIIPQIS  883

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  884   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  943

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLIIN+VGVVAGISYA+NSGYQSW
Sbjct  944   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIINMVGVVAGISYAINSGYQSW  1003

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFL+GLMGRQNRTPTIVVVWSILLASIFSLLWVR DPF TRV
Sbjct  1004  GPLFGKLFFAFWVIIHLYPFLRGLMGRQNRTPTIVVVWSILLASIFSLLWVRADPFITRV  1063

Query  1128  TGPDVQECGINC  1163
              GPD ++CGINC
Sbjct  1064  RGPDTEQCGINC  1075



>dbj|BAJ33658.1| unnamed protein product [Thellungiella halophila]
Length=1065

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/313 (91%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  753   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  812

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  813   EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  872

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASI+F+SLFLSIFA GILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  873   SNIASIYFLSLFLSIFAPGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGVLKVL  932

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AG+DTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  933   AGVDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  992

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  993   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1052

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1053  VTGPDILECGINC  1065



>emb|CDY52141.1| BnaA03g55200D [Brassica napus]
Length=1066

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL+YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLLYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>gb|ACT16002.1| cellulose synthase [Phyllostachys edulis]
Length=1081

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLVYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>gb|ACO06090.1| cellulose synthase [Phyllostachys edulis]
Length=1065

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  754   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  813

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFIIP+IS
Sbjct  814   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLVYCVLPAICLLTGKFIIPEIS  873

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  874   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  933

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  934   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  993

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVR+DPFTTRV
Sbjct  994   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRVDPFTTRV  1053

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1054  TGPDTQTCGINC  1065



>emb|CDX80951.1| BnaC03g02050D [Brassica napus]
Length=1066

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 304/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL+YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLLYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>ref|NP_001051648.1| Os03g0808100 [Oryza sativa Japonica Group]
 sp|Q84M43.1|CESA2_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
2 [UDP-forming]; AltName: Full=OsCesA2 [Oryza sativa Japonica 
Group]
 sp|A2XN66.1|CESA2_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
2 [UDP-forming]; AltName: Full=OsCesA2 [Oryza sativa Indica 
Group]
 gb|AAP21426.1| putative cellulose synthase catalytic subunit [Oryza sativa Japonica 
Group]
 gb|AAS07381.1| cellulose synthase [Oryza sativa Japonica Group]
 gb|ABF99460.1| Cellulose synthase A catalytic subunit 3, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13562.1| Os03g0808100 [Oryza sativa Japonica Group]
 gb|EAY92276.1| hypothetical protein OsI_13999 [Oryza sativa Indica Group]
 gb|EAZ28997.1| hypothetical protein OsJ_13045 [Oryza sativa Japonica Group]
Length=1073

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFIIP+IS
Sbjct  822   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCILPAICLLTGKFIIPEIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  882   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  942   GIDTSFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1002  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1061

Query  1128  TGPDVQECGINC  1163
             TGPD Q+CGINC
Sbjct  1062  TGPDTQKCGINC  1073



>ref|XP_009125590.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
 gb|ACS68192.1| cellulose synthase 3.1 catalytic subunit [Brassica napus]
Length=1066

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 303/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLFYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>dbj|BAJ96780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1068

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTGKFIIPQIS
Sbjct  817   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAG SYA+NSGYQSW
Sbjct  937   GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGTSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPD+Q CGINC
Sbjct  1057  TGPDIQMCGINC  1068



>gb|AAR29963.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1051

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  740   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  799

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTGKFIIPQIS
Sbjct  800   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGKFIIPQIS  859

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  860   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  919

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAG SYA+NSGYQSW
Sbjct  920   GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGTSYAINSGYQSW  979

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  980   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1039

Query  1128  TGPDVQECGINC  1163
             TGPD+Q CGINC
Sbjct  1040  TGPDIQMCGINC  1051



>ref|XP_008668614.1| PREDICTED: cellulose synthase-9 isoform X1 [Zea mays]
 tpg|DAA39506.1| TPA: cellulose synthase9 [Zea mays]
Length=1079

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLLIYC LPA+CLLTGKFIIP+IS
Sbjct  828   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLIYCILPAICLLTGKFIIPEIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  888   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPD + CGINC
Sbjct  1068  TGPDTRTCGINC  1079



>emb|CDY04942.1| BnaAnng01240D [Brassica napus]
Length=1066

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 303/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLFYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>ref|XP_009130870.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
 ref|XP_009130871.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
Length=1066

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 303/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  754   MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  813

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGY+GRLK+LER +Y+NTTIYP+T++PLL YCTLPAVCL T +FIIPQI
Sbjct  814   EILFSRHCPIWYGYSGRLKFLERFAYVNTTIYPLTSVPLLFYCTLPAVCLFTNQFIIPQI  873

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL
Sbjct  874   SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  933

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG SYA+NSGYQS
Sbjct  934   AGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGFSYAINSGYQS  993

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT R
Sbjct  994   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTKR  1053

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1054  VTGPDILECGINC  1066



>ref|XP_007052527.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
 gb|EOX96684.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
Length=1108

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/309 (94%), Positives = 303/309 (98%), Gaps = 0/309 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLKWLER +Y+NTTIYPVTAIPL++YCTLPAVCLLT KFIIPQIS
Sbjct  817   ILFSRHCPLWYGYGGRLKWLERFAYVNTTIYPVTAIPLVMYCTLPAVCLLTNKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1056

Query  1128  TGPDVQECG  1154
             TGPDV++ G
Sbjct  1057  TGPDVEKVG  1065



>dbj|BAJ85304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=858

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/312 (89%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  547   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  606

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFI+P+IS
Sbjct  607   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLVYCILPAICLLTGKFIMPEIS  666

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  667   NLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  726

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIIN+VGVVAG SYA+NSGYQSW
Sbjct  727   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINMVGVVAGTSYAINSGYQSW  786

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VW++LLASIFSLLWVR+DPFTTR+
Sbjct  787   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLASIFSLLWVRVDPFTTRL  846

Query  1128  TGPDVQECGINC  1163
              GP++Q CGINC
Sbjct  847   AGPNIQTCGINC  858



>ref|XP_004955797.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming]-like [Setaria italica]
Length=1081

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGP+ Q CGINC
Sbjct  1070  TGPNTQTCGINC  1081



>ref|XP_008461291.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461292.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461293.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461294.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1083

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCP+WYGY GRLKWLER +Y+NTTIYP+T++PLL+YCTLPAVCLLT KFIIPQIS
Sbjct  832   ILLSRHCPMWYGYGGRLKWLERFAYVNTTIYPITSVPLLMYCTLPAVCLLTNKFIIPQIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWF++LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  892   NIASIWFLALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GD+AELY+FKWTTLLIPPTTLLI+NLVGVVAGISYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKASDEEGDYAELYMFKWTTLLIPPTTLLIVNLVGVVAGISYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTT V
Sbjct  1012  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTTV  1071

Query  1128  TGPDVQECGINC  1163
              GPD++ECGINC
Sbjct  1072  IGPDIEECGINC  1083



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/312 (91%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYC+PKR AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  764   EIGWIYGSVTEDILTGFKMHARGWRSIYCIPKRAAFKGSAPINLSDRLNQVLRWALGSVE  823

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+TAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  824   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITAIPLLMYCTLPAVCLLTNKFIIPQIS  883

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAV QGLLKVLA
Sbjct  884   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVVQGLLKVLA  943

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLLI+N+VGVVAGISYA+NSGYQSW
Sbjct  944   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLIVNMVGVVAGISYAINSGYQSW  1003

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVR+DPF TRV
Sbjct  1004  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRVDPFITRV  1063

Query  1128  TGPDVQECGINC  1163
              GPD ++CGINC
Sbjct  1064  RGPDTEQCGINC  1075



>ref|NP_001104959.1| cellulose synthase-9 [Zea mays]
 gb|AAF89969.1|AF200533_1 cellulose synthase-9 [Zea mays]
Length=1079

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLLIYC LPA+CLLTGKFIIP+IS
Sbjct  828   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLIYCILPAICLLTGKFIIPEIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  888   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFT RV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTNRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPD + CGINC
Sbjct  1068  TGPDTRTCGINC  1079



>ref|XP_006296592.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
 gb|EOA29490.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
Length=1077

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYPVT+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  826   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPVTSIPLLMYCTLPAVCLFTNQFIIPQIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  886   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYL KWTTLL+PPTTLLIINLVGVVAG+SYA+NSGYQSW
Sbjct  946   GIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPPTTLLIINLVGVVAGVSYAINSGYQSW  1005

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVRIDPFT+RV
Sbjct  1006  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRIDPFTSRV  1065

Query  1128  TGPDVQECGINC  1163
             TGPDV  CGINC
Sbjct  1066  TGPDVMLCGINC  1077



>ref|XP_003599196.1| Cellulose synthase [Medicago truncatula]
 gb|AES69447.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 301/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK  AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLAAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  827   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGP  + CGINC
Sbjct  1067  TGPKSEMCGINC  1078



>gb|AII73575.1| cellulose synthase 3 [Medicago sativa]
Length=1078

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 301/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK  AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLAAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWLER +YINTTIYP+T+IPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  827   ILLSRHCPIWYGYSGRLKWLERFAYINTTIYPITSIPLLMYCTLPAVCLLTNKFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  887   NIASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW
Sbjct  947   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIINLVGVVAGISYAVNSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGP  + CGINC
Sbjct  1067  TGPKSEMCGINC  1078



>gb|AGC65584.1| GFP-CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1344

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/313 (92%), Positives = 305/313 (97%), Gaps = 0/313 (0%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             M+IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSV
Sbjct  1032  MEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSV  1091

Query  405   EILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             EILFSRHCPIWYGYNGRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQI
Sbjct  1092  EILFSRHCPIWYGYNGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQI  1151

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             SN+ASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQG+LKVL
Sbjct  1152  SNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGILKVL  1211

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTV SKASDEDGDFAELYLFKWTTLLIPPTTLLI+NLVGVVAG+SYA+NSGYQS
Sbjct  1212  AGIDTNFTVISKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINSGYQS  1271

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFT+R
Sbjct  1272  WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTSR  1331

Query  1125  VTGPDVQECGINC  1163
             VTGPD+ ECGINC
Sbjct  1332  VTGPDILECGINC  1344



>gb|AAY43222.1| cellulose synthase BoCesA5 [Bambusa oldhamii]
Length=1080

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFIIP+IS
Sbjct  829   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSLPLLLYCILPAICLLTGKFIIPEIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  889   NFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDE+GDF ELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  949   GIDTSFTVTSKASDEEGDFTELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1068

Query  1128  TGPDVQECGINC  1163
             TGPD Q+CGINC
Sbjct  1069  TGPDTQKCGINC  1080



>ref|XP_010228016.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming] isoform X2 [Brachypodium distachyon]
Length=1068

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTG+FIIPQIS
Sbjct  817   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGRFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  877   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  937   GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDPFTTRV
Sbjct  997   GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVIVWAILLASIFSLLWVRIDPFTTRV  1056

Query  1128  TGPDVQECGINC  1163
             TGPD+Q CGINC
Sbjct  1057  TGPDIQMCGINC  1068



>ref|XP_010228012.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming] isoform X1 [Brachypodium distachyon]
Length=1078

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  767   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  826

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTG+FIIPQIS
Sbjct  827   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGRFIIPQIS  886

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  887   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  946

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  947   GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1006

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1007  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVIVWAILLASIFSLLWVRIDPFTTRV  1066

Query  1128  TGPDVQECGINC  1163
             TGPD+Q CGINC
Sbjct  1067  TGPDIQMCGINC  1078



>ref|XP_004981340.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming]-like [Setaria italica]
Length=1079

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/312 (91%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  768   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSIE  827

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YC LPAVCLLTGKFIIP+IS
Sbjct  828   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPLTSIPLLLYCILPAVCLLTGKFIIPEIS  887

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  888   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  947

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  948   GIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1007

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1008  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1067

Query  1128  TGPDVQECGINC  1163
             TGPD+ +CGINC
Sbjct  1068  TGPDIVKCGINC  1079



>gb|ADH95191.1| cellulose synthase [Phyllostachys edulis]
Length=1081

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/312 (91%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALG VE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGPVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFIIP+IS
Sbjct  830   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLVYCVLPAICLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  890   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTN TVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  950   GIDTNLTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVR+DPFTTRV
Sbjct  1010  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRVDPFTTRV  1069

Query  1128  TGPDVQECGINC  1163
             TGPD Q CGINC
Sbjct  1070  TGPDTQTCGINC  1081



>gb|EMT00418.1| Putative cellulose synthase A catalytic subunit 2 (UDP-forming) 
[Aegilops tauschii]
Length=1173

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/312 (92%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  862   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  921

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLLIYC LPAVCLLTGKFIIPQIS
Sbjct  922   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLIYCILPAVCLLTGKFIIPQIS  981

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  982   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  1041

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDED DFAELY+FKWTTLLIPPTT+LIINLVGVVAG SYA+NSGYQSW
Sbjct  1042  GIDTSFTVTSKASDEDNDFAELYMFKWTTLLIPPTTILIINLVGVVAGTSYAINSGYQSW  1101

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVI+HLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1102  GPLFGKLFFAFWVIIHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1161

Query  1128  TGPDVQECGINC  1163
             TGPD++ CGINC
Sbjct  1162  TGPDIRMCGINC  1173



>gb|ACU80553.2| cellulose synthase [Leucaena leucocephala]
Length=1073

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 299/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY+GRLKWLER +Y+NTTIYPVTAIPLL+YCTLPAVCLLT KFIIPQIS
Sbjct  822   ILFSRHCPIWYGYSGRLKWLERFAYVNTTIYPVTAIPLLMYCTLPAVCLLTNKFIIPQIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N+ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  882   NIASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+FKWTTLLIPPTTLLI+N+VGVVAGISYA+NSGYQSW
Sbjct  942   GIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPPTTLLIVNMVGVVAGISYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFW I+H YPF KG MGRQNRTPTIVVVWSILLASIFSLLWVR DPF TRV
Sbjct  1002  GPLFGKLFFAFWGIIHFYPFFKGFMGRQNRTPTIVVVWSILLASIFSLLWVRGDPFITRV  1061

Query  1128  TGPDVQECGINC  1163
              GPD ++CGINC
Sbjct  1062  RGPDTEQCGINC  1073



>dbj|BAJ87858.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=924

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/312 (88%), Positives = 303/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  613   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  672

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFI+P+IS
Sbjct  673   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLVYCILPAICLLTGKFIMPEIS  732

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  733   NLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  792

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIIN+VGVV G SYA+NSGYQSW
Sbjct  793   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINMVGVVTGTSYAINSGYQSW  852

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VW++LLASIFSLLWVR+DPFTTR+
Sbjct  853   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLASIFSLLWVRVDPFTTRL  912

Query  1128  TGPDVQECGINC  1163
              GP++Q CGINC
Sbjct  913   AGPNIQTCGINC  924



>tpg|DAA52080.1| TPA: cellulose synthase5 [Zea mays]
Length=1076

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/312 (91%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  765   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSIE  824

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPAVCLLTGKFIIP+IS
Sbjct  825   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCILPAVCLLTGKFIIPKIS  884

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NL S+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  885   NLESVWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  944

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  945   GIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1004

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVVVW+ILLASIFSL+WVRIDPFTTRV
Sbjct  1005  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVVWAILLASIFSLMWVRIDPFTTRV  1064

Query  1128  TGPDVQECGINC  1163
             TGPD+ +CGINC
Sbjct  1065  TGPDIAKCGINC  1076



>ref|NP_001104955.1| cellulose synthase5 [Zea mays]
 gb|AAF89965.1|AF200529_1 cellulose synthase-5 [Zea mays]
Length=1076

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/312 (91%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  765   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSIE  824

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPAVCLLTGKFIIP+IS
Sbjct  825   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCILPAVCLLTGKFIIPKIS  884

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NL S+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  885   NLESVWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  944

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  945   GIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1004

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVVVW+ILLASIFSL+WVRIDPFTTRV
Sbjct  1005  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVVWAILLASIFSLMWVRIDPFTTRV  1064

Query  1128  TGPDVQECGINC  1163
             TGPD+ +CGINC
Sbjct  1065  TGPDIAKCGINC  1076



>gb|EPS69824.1| hypothetical protein M569_04932, partial [Genlisea aurea]
Length=1067

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 302/312 (97%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YCTLPAVCLLTGKFIIPQIS
Sbjct  817   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPITSIPLLLYCTLPAVCLLTGKFIIPQIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVS+HLFAV QGLLKVLA
Sbjct  877   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVVQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE GDFAELY+FKWTTLL+PPTTLL+INLVGVVAGISYA+NSGYQ+W
Sbjct  937   GIDTNFTVTSKASDE-GDFAELYMFKWTTLLVPPTTLLVINLVGVVAGISYAINSGYQAW  995

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTT  
Sbjct  996   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTSF  1055

Query  1128  TGPDVQECGINC  1163
             TGPDVQ CGINC
Sbjct  1056  TGPDVQACGINC  1067



>ref|XP_003557396.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Brachypodium distachyon]
Length=1083

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFI+P+IS
Sbjct  832   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLVYCILPAICLLTGKFIMPEIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  892   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIV+VW+ILLASIFSLLWVR+DPFTTRV
Sbjct  1012  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVIVWAILLASIFSLLWVRVDPFTTRV  1071

Query  1128  TGPDVQECGINC  1163
             +GP++Q CGINC
Sbjct  1072  SGPNIQTCGINC  1083



>ref|XP_010228235.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Brachypodium distachyon]
Length=1082

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 305/312 (98%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPA+CLLTGKFI+P+IS
Sbjct  831   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSIPLLVYCILPAICLLTGKFIMPEIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  891   NFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIV+VW+ILLASIFSLLWVR+DPFTTRV
Sbjct  1011  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVIVWAILLASIFSLLWVRVDPFTTRV  1070

Query  1128  TGPDVQECGINC  1163
             +GP++Q CGINC
Sbjct  1071  SGPNIQTCGINC  1082



>gb|EMT09789.1| Putative cellulose synthase A catalytic subunit 8 (UDP-forming) 
[Aegilops tauschii]
Length=1080

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/312 (89%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFI+P+IS
Sbjct  829   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLVYCILPAICLLTGKFIMPEIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  889   NLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIIN+VGVVAG SYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINMVGVVAGTSYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VW++LLASIFSLLWVR+DPFTTR+
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLASIFSLLWVRVDPFTTRL  1068

Query  1128  TGPDVQECGINC  1163
              GP++Q CGINC
Sbjct  1069  AGPNIQTCGINC  1080



>dbj|BAD06322.1| putative cellulose synthase [Triticum aestivum]
Length=1080

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/312 (89%), Positives = 304/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFI+P+IS
Sbjct  829   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLVYCILPAICLLTGKFIMPEIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  889   NLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIIN+VGVVAG SYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPPTTILIINMVGVVAGTSYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VW++LLASIFSLLWVR+DPFTTR+
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLASIFSLLWVRVDPFTTRL  1068

Query  1128  TGPDVQECGINC  1163
              GP++Q CGINC
Sbjct  1069  AGPNIQTCGINC  1080



>ref|XP_010464777.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Camelina sativa]
Length=1072

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 299/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  761   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  820

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  821   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNRFIIPQIS  880

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  881   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  940

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYL KWTTLL+PPTTLL INL+GVVAG+SYA+NSGYQSW
Sbjct  941   GIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPPTTLLFINLLGVVAGVSYAINSGYQSW  1000

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQ+RTPTI+VVWS+LLASIFSLLWVR+DPF +RV
Sbjct  1001  GPLFGKLFFAFWVIVHLYPFLKGLMGRQSRTPTIIVVWSVLLASIFSLLWVRVDPFISRV  1060

Query  1128  TGPDVQECGINC  1163
             TGPDV  CGINC
Sbjct  1061  TGPDVLVCGINC  1072



>ref|XP_010464776.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Camelina sativa]
Length=1073

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 299/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  822   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNRFIIPQIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  882   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYL KWTTLL+PPTTLL INL+GVVAG+SYA+NSGYQSW
Sbjct  942   GIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPPTTLLFINLLGVVAGVSYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQ+RTPTI+VVWS+LLASIFSLLWVR+DPF +RV
Sbjct  1002  GPLFGKLFFAFWVIVHLYPFLKGLMGRQSRTPTIIVVWSVLLASIFSLLWVRVDPFISRV  1061

Query  1128  TGPDVQECGINC  1163
             TGPDV  CGINC
Sbjct  1062  TGPDVLVCGINC  1073



>gb|AAQ63935.1| cellulose synthase [Pinus radiata]
Length=1096

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 300/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  785   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  844

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLERL+YINTT+YP+T+IPLL YCTLPA+CLLTGKFIIP+IS
Sbjct  845   ILLSRHCPIWYGYTGRLKWLERLAYINTTVYPITSIPLLAYCTLPAICLLTGKFIIPEIS  904

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
              LAS+WFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  905   TLASLWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVIQGLLKVLA  964

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             G+DTNFTVTSKASDE GDFAELY+ KWT LLIPPTTLLIIN+VGVVAGISYA+++GY+SW
Sbjct  965   GVDTNFTVTSKASDEGGDFAELYIIKWTALLIPPTTLLIINIVGVVAGISYAISTGYRSW  1024

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPFTTR+
Sbjct  1025  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTTRI  1084

Query  1128  TGPDVQECGINC  1163
              GPD+Q+CGINC
Sbjct  1085  KGPDLQQCGINC  1096



>ref|XP_006650766.1| PREDICTED: LOW QUALITY PROTEIN: probable cellulose synthase A 
catalytic subunit 2 [UDP-forming]-like [Oryza brachyantha]
Length=1073

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 301/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMPKRPAFKGSAPIN SDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWWSIYCMPKRPAFKGSAPINFSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T++ LL+YC LPA+CLLTGKFIIP+IS
Sbjct  822   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSVSLLLYCILPAICLLTGKFIIPEIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N ASIWFISLF SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  882   NFASIWFISLFQSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKASDE+GDFAELY+FKWTTLLIPPTT+LIINLVGVVAGISYA+NSGYQSW
Sbjct  942   GIDTSFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSW  1001

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVW+ILLASIFSLLWVRIDPFTTRV
Sbjct  1002  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRV  1061

Query  1128  TGPDVQECGINC  1163
             TGPD Q+CGINC
Sbjct  1062  TGPDTQKCGINC  1073



>gb|AAQ63936.1| cellulose synthase [Pinus radiata]
Length=1066

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/312 (89%), Positives = 300/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  755   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  814

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRLKWLERL+YINTT+YP+T+IPL++YCTLPA+CLLTGKFIIPQIS
Sbjct  815   ILLSRHCPIWYGYGGRLKWLERLAYINTTVYPITSIPLVVYCTLPAICLLTGKFIIPQIS  874

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
               AS++FI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  875   TFASLFFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVVQGLLKVLA  934

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELYLFKWT LLIPPTTLL+IN+VGVVAGIS A++SGY +W
Sbjct  935   GIDTNFTVTSKASDEDGDFAELYLFKWTALLIPPTTLLVINIVGVVAGISQAISSGYAAW  994

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPFTT++
Sbjct  995   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFTTQI  1054

Query  1128  TGPDVQECGINC  1163
              GPD+Q+CGINC
Sbjct  1055  KGPDLQQCGINC  1066



>ref|XP_010491404.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=1071

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/312 (89%), Positives = 296/312 (95%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  760   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  819

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NT IYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  820   ILFSRHCPIWYGYGGRLKFLERFAYVNTAIYPITSIPLLMYCTLPAVCLFTNQFIIPQIS  879

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAH FAVFQGLLKV A
Sbjct  880   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHFFAVFQGLLKVFA  939

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELY+ KWTTLL+PPTTLL INLVGVVAG+SYA+NSGYQSW
Sbjct  940   GIDTNFTVTSKASDEDGDSAELYMIKWTTLLVPPTTLLFINLVGVVAGVSYAINSGYQSW  999

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPF +RV
Sbjct  1000  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFISRV  1059

Query  1128  TGPDVQECGINC  1163
             TGPDV  CGINC
Sbjct  1060  TGPDVLVCGINC  1071



>ref|XP_002463687.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
 gb|EER90685.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
Length=1032

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/312 (89%), Positives = 301/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  721   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSIE  780

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +YINTTIYP+T+IPLL+YC LPAVCLLTGKFIIP+IS
Sbjct  781   ILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCILPAVCLLTGKFIIPKIS  840

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NL S+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  841   NLESVWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  900

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT+FTVTSKA+DE+GDFAELY+FKWTTLLIPPTT+LIINL+GVVAG SYA+NSGYQSW
Sbjct  901   GIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPPTTILIINLIGVVAGTSYAINSGYQSW  960

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIV+VW+ LLASIFSLLWVRIDPFTTRV
Sbjct  961   GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVLVWATLLASIFSLLWVRIDPFTTRV  1020

Query  1128  TGPDVQECGINC  1163
             TGP +  CGINC
Sbjct  1021  TGPPIGNCGINC  1032



>ref|XP_010486710.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Camelina sativa]
Length=1071

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 297/312 (95%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  760   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  819

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  820   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQIS  879

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  880   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  939

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYL KWTTLL+PPTTLL INLVGVVAG+SYA+NSGYQSW
Sbjct  940   GIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPPTTLLFINLVGVVAGVSYAINSGYQSW  999

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPF +RV
Sbjct  1000  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFISRV  1059

Query  1128  TGPDVQECGINC  1163
             TGPD    GINC
Sbjct  1060  TGPDGLVYGINC  1071



>ref|XP_010695250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1050

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/312 (89%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  739   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  798

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+T+IPL++YCT+PA+CLLT KFIIPQI+
Sbjct  799   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITSIPLVLYCTIPAICLLTSKFIIPQIT  858

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAV QGLLKVLA
Sbjct  859   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVCQGLLKVLA  918

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDF ELYLFKWTTLLIPPTTLLIINLVGVVAGIS A+NSG+QSW
Sbjct  919   GIDTNFTVTSKASDEDGDFTELYLFKWTTLLIPPTTLLIINLVGVVAGISNAINSGFQSW  978

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFF+ WVI+HLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVR++PF T+V
Sbjct  979   GPLFGKLFFSLWVILHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRVNPFITKV  1038

Query  1128  TGPDVQECGINC  1163
             +GP++++CGINC
Sbjct  1039  SGPNLEQCGINC  1050



>ref|XP_010486709.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Camelina sativa]
Length=1071

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/312 (90%), Positives = 297/312 (95%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  760   EIGWIYGSVTEDILTGFKMHTRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  819

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  820   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQIS  879

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  880   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  939

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGD AELYL KWTTLL+PPTTLL INLVGVVAG+SYA+NSGYQSW
Sbjct  940   GIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPPTTLLFINLVGVVAGVSYAINSGYQSW  999

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTI+VVWS+LLASIFSLLWVR+DPF +RV
Sbjct  1000  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIIVVWSVLLASIFSLLWVRVDPFISRV  1059

Query  1128  TGPDVQECGINC  1163
             TGPD    GINC
Sbjct  1060  TGPDGLVYGINC  1071



>gb|AAR29962.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1080

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/312 (88%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRS+YCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSVYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCP+WYGY GRLK+LER +YINTTIYP+T++PLL+YC LPA+CLLTGKFI+P+IS
Sbjct  829   ILFSRHCPLWYGYGGRLKFLERFAYINTTIYPLTSLPLLVYCILPAICLLTGKFIMPEIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWFI+LFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGG+SAHLFAVFQGLLKVLA
Sbjct  889   NLASIWFIALFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DE+GDFAELY+FK TTLLIPPTT+LIIN+VGVVAG SYA+NSGYQSW
Sbjct  949   GIDTNFTVTSKANDEEGDFAELYMFKRTTLLIPPTTILIINMVGVVAGTSYAINSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VW++LLASIFSLLWV +DPFTTR+
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWAVLLASIFSLLWVCVDPFTTRL  1068

Query  1128  TGPDVQECGINC  1163
              GP++Q CGINC
Sbjct  1069  AGPNIQTCGINC  1080



>ref|XP_009146799.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Brassica rapa]
Length=1046

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/312 (88%), Positives = 298/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  735   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSIE  794

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIP+IS
Sbjct  795   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPEIS  854

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATG+LEMRWSGVGIDEWWRNEQFWVIGGVSAHLFA+ QGLLKVL 
Sbjct  855   NLASIWFLSLFLSIFATGVLEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALVQGLLKVLV  914

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GD AELYL KWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQ+W
Sbjct  915   GIDTNFTVTSKASDENGDSAELYLIKWTTLLIPPTTLLIINLVGVVAGISYALNSGYQTW  974

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPT++VVWS+LL+SIFSLLW+R+DPFT+R 
Sbjct  975   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTVIVVWSVLLSSIFSLLWIRVDPFTSRF  1034

Query  1128  TGPDVQECGINC  1163
              GPDV+ECG NC
Sbjct  1035  IGPDVKECGYNC  1046



>emb|CDY08570.1| BnaA05g28060D [Brassica napus]
Length=1046

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/312 (88%), Positives = 298/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  735   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSIE  794

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLK+LER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIP+IS
Sbjct  795   ILFSRHCPIWYGYGGRLKFLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPEIS  854

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLAS+WF+SLFLSIFATG+LEMRWSGVGIDEWWRNEQFWVIGGVSAHLFA+ QGLLKVL 
Sbjct  855   NLASVWFLSLFLSIFATGVLEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALVQGLLKVLV  914

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDE+GD AELYL KWTTLLIPPTTLLIINLVGVVAGISYA+NSGYQ+W
Sbjct  915   GIDTNFTVTSKASDENGDSAELYLIKWTTLLIPPTTLLIINLVGVVAGISYALNSGYQTW  974

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPT++VVWS+LL+SIFSLLW+R+DPFT+R 
Sbjct  975   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTVIVVWSVLLSSIFSLLWIRVDPFTSRF  1034

Query  1128  TGPDVQECGINC  1163
              GPDV+ECG NC
Sbjct  1035  IGPDVKECGYNC  1046



>ref|XP_010558902.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1077

 Score =   542 bits (1397),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 274/294 (93%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMPK PAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  769   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSVE  828

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWYGY GRLKWLER +Y+NTTIYP+T+IPLL+YCTLPAVCL T +FIIPQIS
Sbjct  829   ILFSRHCPIWYGYGGRLKWLERFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPQIS  888

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLASIWF+SLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  889   NLASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  948

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWTTLLIPPTTLL+IN++GVVAGISYAVNSGYQSW
Sbjct  949   GIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTLLVINIIGVVAGISYAVNSGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRID  1109
             GPLFGKLFFAFWVIVHLYPFLKGLMG+QNRTPTIVVVWSILLASIFSLLWVRID
Sbjct  1009  GPLFGKLFFAFWVIVHLYPFLKGLMGKQNRTPTIVVVWSILLASIFSLLWVRID  1062



>gb|AFJ12112.1| cellulose synthase, partial [Nicotiana tabacum]
Length=410

 Score =   516 bits (1329),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 261/314 (83%), Positives = 291/314 (93%), Gaps = 2/314 (1%)
 Frame = +3

Query  225   MQIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSV  404
             +++G IY S+TEDILTGFKMH RGWRS+YCMPK  AFKGSAPINLSDRLNQVLRWALGSV
Sbjct  98    LELGWIYGSITEDILTGFKMHCRGWRSVYCMPKVAAFKGSAPINLSDRLNQVLRWALGSV  157

Query  405   EILFSRHCPIWYGYNG-RLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQ  581
             EI FSRH PIWYG+ G +LKWLERLSY+NTT+YP T++PLL YCTLPAVCLLTGKFI+P+
Sbjct  158   EIFFSRHSPIWYGHKGGKLKWLERLSYVNTTVYPFTSLPLLAYCTLPAVCLLTGKFIMPE  217

Query  582   ISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKV  761
             IS  AS++FI+LFLSIFATGILE+RWSGV I+EWWRNEQFWVIGG+SAHLFAV QGLLK+
Sbjct  218   ISTFASLFFIALFLSIFATGILELRWSGVSIEEWWRNEQFWVIGGISAHLFAVVQGLLKI  277

Query  762   LAGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQ  941
             LAGIDTNFTVTSKA+D+D DF ELY FKWTTLLIPPTT+LIINLVGVVAGIS A+N+GYQ
Sbjct  278   LAGIDTNFTVTSKATDDD-DFGELYAFKWTTLLIPPTTILIINLVGVVAGISDAINNGYQ  336

Query  942   SWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTT  1121
             SWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WSILLASIFSLLWVRIDPF  
Sbjct  337   SWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSILLASIFSLLWVRIDPFVL  396

Query  1122  RVTGPDVQECGINC  1163
             +  GPDV++CG+NC
Sbjct  397   KTKGPDVKQCGLNC  410



>gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=657

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 264/313 (84%), Positives = 288/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  345   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  404

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRL+ LERL+YINT +YP+T+IPLL YC LPA CLLTGKFIIP+IS
Sbjct  405   ILLSRHCPIWYGYKGRLRLLERLAYINTIVYPLTSIPLLAYCMLPAFCLLTGKFIIPEIS  464

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  465   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  524

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LIINLVG+VAG+SYA+NSGYQSW
Sbjct  525   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIINLVGIVAGVSYAINSGYQSW  584

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  585   GPLFGKLFFAIWVIAHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEA  644

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  645   TKAAANGQCGINC  657



>gb|ABI78962.1| cellulose synthase 10, partial [Physcomitrella patens]
Length=601

 Score =   523 bits (1346),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 268/316 (85%), Positives = 289/316 (91%), Gaps = 5/316 (2%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMP R AFKGSAPINLSDRL QVLRWALGSVE
Sbjct  287   EIGWIYGSVTEDILTGFKMHCRGWRSIYCMPARAAFKGSAPINLSDRLQQVLRWALGSVE  346

Query  408   ILFSRHCPIWYGY----NGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFII  575
             I  SRHCP+WYGY    +G LK LERL+YINTTIYP+T++PLL YC LPAVCLLTGKFII
Sbjct  347   ISLSRHCPLWYGYGGGKHGELKCLERLAYINTTIYPLTSLPLLAYCVLPAVCLLTGKFII  406

Query  576   PQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL  755
             P I+NL S+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFA+FQGLL
Sbjct  407   PTITNLDSLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGLL  466

Query  756   KVLAGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSG  935
             KVLAGIDTNFTVTSK + ED DFAELY+ KWT LLIPPTTLL+IN++GVVAGIS A+N+G
Sbjct  467   KVLAGIDTNFTVTSKQA-EDEDFAELYMIKWTALLIPPTTLLVINMIGVVAGISDAINNG  525

Query  936   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPF  1115
             YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF
Sbjct  526   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF  585

Query  1116  TTRVTGPDVQECGINC  1163
               +VTGPD+ ECGINC
Sbjct  586   LAKVTGPDITECGINC  601



>ref|XP_002960719.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
 gb|EFJ38258.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
Length=1082

 Score =   534 bits (1375),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 268/312 (86%), Positives = 293/312 (94%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH+RGWRSIYCMP RPAFKGSAPINLSDRL+QVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHSRGWRSIYCMPARPAFKGSAPINLSDRLHQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWL+RL+YINT +YP+T+IPL+ YCTLPAVCLLT KFIIP IS
Sbjct  832   ILLSRHCPIWYGYSGRLKWLQRLAYINTIVYPLTSIPLVAYCTLPAVCLLTNKFIIPTIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N  S+WFISLFLSIFATGILE+RWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  892   NFDSLWFISLFLSIFATGILELRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK++D D DF ELY FKWTTLLIPPTTL+I+NLVGV AGIS AVN+GYQSW
Sbjct  952   GIDTNFTVTSKSAD-DEDFGELYEFKWTTLLIPPTTLIIVNLVGVAAGISDAVNNGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRI+PF  +V
Sbjct  1011  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRINPFLQKV  1070

Query  1128  TGPDVQECGINC  1163
              GP++++CGINC
Sbjct  1071  QGPNLEQCGINC  1082



>ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW80412.1| hypothetical protein EUGRSUZ_C01769 [Eucalyptus grandis]
Length=1082

 Score =   534 bits (1375),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 266/313 (85%), Positives = 291/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLKWLERL+YINT +YP+T+IPL+ YC LPA CLLTGKFIIP+IS
Sbjct  830   ILLSRHCPIWYGYNGRLKWLERLAYINTIVYPLTSIPLIAYCILPAFCLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  890   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1010  GPLFGKLFFAIWVIAHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDA  1069

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CGINC
Sbjct  1070  TKASAKGQCGINC  1082



>ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
Length=1081

 Score =   533 bits (1374),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/312 (85%), Positives = 290/312 (93%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LER++YINT +YP+T+IPL+ YC LPA CLLTGKFIIP+IS
Sbjct  830   ILLSRHCPIWYGYNGRLKLLERIAYINTIVYPITSIPLIAYCMLPAFCLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  890   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT+LI+N+VG+VAG+SYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVLIMNMVGIVAGVSYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1010  GPLFGKLFFALWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSAS  1069

Query  1128  TGPDVQECGINC  1163
             T     +CGINC
Sbjct  1070  TKAANGQCGINC  1081



>ref|XP_010648652.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Vitis vinifera]
Length=1084

 Score =   533 bits (1374),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/312 (85%), Positives = 291/312 (93%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YC LPA+CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLIAYCVLPAICLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+L++NLVG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLVVNLVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSSS  1072

Query  1128  TGPDVQECGINC  1163
             T     +CGINC
Sbjct  1073  TKAASGQCGINC  1084



>ref|XP_002983952.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14964.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1090

 Score =   533 bits (1374),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/312 (86%), Positives = 293/312 (94%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH+RGWRSIYCMP RPAFKGSAPINLSDRL+QVLRWALGSVE
Sbjct  780   EIGWIYGSVTEDILTGFKMHSRGWRSIYCMPARPAFKGSAPINLSDRLHQVLRWALGSVE  839

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLKWL+RL+YINT +YP+T+IPL+ YCTLPAVCLLT KFIIP IS
Sbjct  840   ILLSRHCPIWYGYSGRLKWLQRLAYINTIVYPLTSIPLVAYCTLPAVCLLTNKFIIPTIS  899

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N  S+WFISLFLSIFATGILE+RWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  900   NFDSLWFISLFLSIFATGILELRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  959

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK++D D DF ELY FKWTTLLIPPTTL+I+NLVGV AGIS AVN+GYQSW
Sbjct  960   GIDTNFTVTSKSAD-DEDFGELYEFKWTTLLIPPTTLIIVNLVGVAAGISDAVNNGYQSW  1018

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRI+PF  +V
Sbjct  1019  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRINPFLQKV  1078

Query  1128  TGPDVQECGINC  1163
              GP++++CGINC
Sbjct  1079  QGPNLEQCGINC  1090



>gb|AAT48368.1| cellulose synthase catalytic subunit, partial [Physcomitrella 
patens]
Length=768

 Score =   523 bits (1348),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 275/316 (87%), Positives = 293/316 (93%), Gaps = 5/316 (2%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  454   EIGWIYGSVTEDILTGFKMHCRGWRSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  513

Query  408   ILFSRHCPIWYGYNGR----LKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFII  575
             I  SRHCPIWYGY G     LK LERL+YINTT+YP+T++PLL YC LPAVCLLTGKFII
Sbjct  514   ICLSRHCPIWYGYGGGKSGGLKCLERLAYINTTVYPLTSLPLLAYCVLPAVCLLTGKFII  573

Query  576   PQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL  755
             P ISNLAS+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL
Sbjct  574   PSISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL  633

Query  756   KVLAGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSG  935
             KV AGIDTNFTVTSK+S ED DF ELY FKWT+LLIPPTTLLIINLVGVVAGIS A+N+G
Sbjct  634   KVFAGIDTNFTVTSKSS-EDEDFGELYAFKWTSLLIPPTTLLIINLVGVVAGISDAINNG  692

Query  936   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPF  1115
             YQ+WGPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF
Sbjct  693   YQTWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF  752

Query  1116  TTRVTGPDVQECGINC  1163
              T+VTGPD+Q+CGINC
Sbjct  753   LTKVTGPDLQQCGINC  768



>ref|XP_008392524.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 1 [UDP-forming]-like, partial [Malus domestica]
Length=720

 Score =   521 bits (1342),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 287/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  408   EIGWIYGSVTEDILTGFKMHARGWISVYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  467

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNG+LK LERL+YINT +YP+T+IPL+ YC LPA CLLT KFIIP+IS
Sbjct  468   ILLSRHCPIWYGYNGKLKLLERLAYINTIVYPLTSIPLIAYCLLPAFCLLTEKFIIPEIS  527

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SI ATGILE+RWSGV ID+WWRNEQFW+IGG SAHLFAVFQGLLKVLA
Sbjct  528   NFASMWFILLFVSIIATGILELRWSGVSIDDWWRNEQFWIIGGTSAHLFAVFQGLLKVLA  587

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK+SDEDGDFAELY+FKWT+LLIPPTT+L++N+VG+VAG+SYA+NSGYQSW
Sbjct  588   GIDTNFTVTSKSSDEDGDFAELYVFKWTSLLIPPTTVLLVNIVGIVAGVSYAINSGYQSW  647

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WV+ HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  648   GPLFGKLFFALWVVAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDK  707

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  708   TKAATNGQCGINC  720



>emb|CAN60659.1| hypothetical protein VITISV_018069 [Vitis vinifera]
Length=1097

 Score =   533 bits (1372),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 264/312 (85%), Positives = 291/312 (93%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  786   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  845

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YC LPA+CLLTGKFIIP+IS
Sbjct  846   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLIAYCVLPAICLLTGKFIIPEIS  905

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  906   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  965

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+L++NLVG+VAG+SYA+NSGYQSW
Sbjct  966   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLVVNLVGIVAGVSYAINSGYQSW  1025

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1026  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSSS  1085

Query  1128  TGPDVQECGINC  1163
             T     +CGINC
Sbjct  1086  TKAASGQCGINC  1097



>gb|ACF83181.1| unknown [Zea mays]
Length=348

 Score =   507 bits (1305),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 285/313 (91%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RP FKGSAPINLSDRLNQVLRWALGSVE
Sbjct  36    EIGWIYGSVTEDILTGFKMHARGWISIYCMPLRPCFKGSAPINLSDRLNQVLRWALGSVE  95

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YC LPA+CLLT KFIIP IS
Sbjct  96    ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPITSIPLVAYCVLPAICLLTNKFIIPAIS  155

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A  +FI LF SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  156   NYAGAFFILLFASIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  215

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+D+DGDFAELY+FKWTTLLIPPTT+L+INLVG+VAG+SYA+NSGYQSW
Sbjct  216   GIDTNFTVTSKATDDDGDFAELYVFKWTTLLIPPTTVLVINLVGIVAGVSYAINSGYQSW  275

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI+HLYPFLKGLMG+QNRTPTIV+VWS+LLASIFSLLWV+IDPF +  
Sbjct  276   GPLFGKLFFAIWVILHLYPFLKGLMGKQNRTPTIVIVWSVLLASIFSLLWVKIDPFISPT  335

Query  1128  TGPDVQ-ECGINC  1163
                  + +CG+NC
Sbjct  336   QKALSRGQCGVNC  348



>ref|XP_008466397.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Cucumis melo]
Length=1081

 Score =   531 bits (1369),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 263/312 (84%), Positives = 290/312 (93%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LER++YINT +YP+T+IPL+ YC LPA CLLTGKFIIP+IS
Sbjct  830   ILLSRHCPIWYGYNGRLKLLERIAYINTIVYPITSIPLIAYCMLPAFCLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  890   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LI+N+VG+VAG+SYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIMNMVGIVAGVSYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1010  GPLFGKLFFALWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSAS  1069

Query  1128  TGPDVQECGINC  1163
             T     +CGINC
Sbjct  1070  TKAANGQCGINC  1081



>ref|XP_002983910.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14922.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1072

 Score =   531 bits (1368),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 267/312 (86%), Positives = 291/312 (93%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP R AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRAAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I+ SRHCPIWYGY G LK+LER++YINT +YP+T+IPLL YCTLPAVCLLT KFIIP+IS
Sbjct  822   IMLSRHCPIWYGYGGGLKFLERVAYINTIVYPLTSIPLLAYCTLPAVCLLTNKFIIPEIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS++FISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  882   NFASLFFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK SD D +F ELY FKWTTLLIPPTTLL+IN++GVVAGIS A+N+GYQSW
Sbjct  942   GIDTNFTVTSKTSD-DEEFGELYAFKWTTLLIPPTTLLVINMIGVVAGISDAINNGYQSW  1000

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPF  + 
Sbjct  1001  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFLPKT  1060

Query  1128  TGPDVQECGINC  1163
              GP++Q+CGINC
Sbjct  1061  KGPNLQQCGINC  1072



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   531 bits (1368),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 266/312 (85%), Positives = 291/312 (93%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRLK LERL+YINT +YP+T++PL+ YC LPAVCLLTGKFIIP IS
Sbjct  833   ILLSRHCPIWYGYSGRLKVLERLAYINTIVYPLTSLPLVAYCVLPAVCLLTGKFIIPAIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIF+TGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NYASMWFILLFISIFSTGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT LLIPPTT+L+IN+VG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGDFAELYVFKWTALLIPPTTVLLINMVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+R 
Sbjct  1013  GPLFGKLFFALWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSRT  1072

Query  1128  TGPDVQECGINC  1163
             +    Q CGINC
Sbjct  1073  STAQGQ-CGINC  1083



>gb|AAO25536.1| cellulose synthase [Populus tremuloides]
Length=1083

 Score =   531 bits (1368),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/313 (84%), Positives = 291/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T++PLL YC LPAVCL++GKFIIP+IS
Sbjct  831   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSLPLLAYCVLPAVCLVSGKFIIPEIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  891   NYASMWFILLFISIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT++++N+VG+VAG+SYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVIVLNMVGIVAGVSYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1011  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDS  1070

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  1071  TKAAANGQCGINC  1083



>ref|XP_002960761.1| cellulose synthase 4-1 [Selaginella moellendorffii]
 gb|EFJ38300.1| cellulose synthase 4-1 [Selaginella moellendorffii]
Length=1072

 Score =   531 bits (1367),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 267/312 (86%), Positives = 291/312 (93%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP R AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  762   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPPRAAFKGSAPINLSDRLNQVLRWALGSVE  821

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I+ SRHCPIWYGY G LK+LER++YINT +YP+T+IPLL YCTLPAVCLLT KFIIP+IS
Sbjct  822   IMLSRHCPIWYGYGGGLKFLERVAYINTIVYPLTSIPLLAYCTLPAVCLLTNKFIIPEIS  881

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS++FISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA
Sbjct  882   NFASLFFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  941

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSK SD D +F ELY FKWTTLLIPPTTLL+IN++GVVAGIS A+N+GYQSW
Sbjct  942   GIDTNFTVTSKTSD-DEEFGELYAFKWTTLLIPPTTLLVINMIGVVAGISDAINNGYQSW  1000

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWS+LLASIFSLLWVRIDPF  + 
Sbjct  1001  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDPFLPKT  1060

Query  1128  TGPDVQECGINC  1163
              GP++Q+CGINC
Sbjct  1061  KGPNLQQCGINC  1072



>gb|KDP33612.1| hypothetical protein JCGZ_07183 [Jatropha curcas]
Length=1084

 Score =   531 bits (1368),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 263/312 (84%), Positives = 290/312 (93%), Gaps = 0/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNG+LK LERL+YINT +YP+T+IPL+ YC LPA CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPIWYGYNGKLKLLERLAYINTIVYPLTSIPLIAYCMLPAFCLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NFASMWFILLFISIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DG+FAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDS  1072

Query  1128  TGPDVQECGINC  1163
             T     +CGINC
Sbjct  1073  TASSNGQCGINC  1084



>gb|KHG16324.1| putative cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Gossypium arboreum]
Length=855

 Score =   524 bits (1349),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 288/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  543   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  602

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRL+ LERL+YINT +YP+T+IPLL YC LPA CLLTGKFIIP+IS
Sbjct  603   ILLSRHCPIWYGYKGRLRLLERLAYINTIVYPLTSIPLLAYCMLPAFCLLTGKFIIPEIS  662

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  663   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  722

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DG+FAELY+FKWT+LLIPPTT+LIINLVG+VAG+SYA+NSGYQSW
Sbjct  723   GIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPPTTVLIINLVGIVAGVSYAINSGYQSW  782

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  783   GPLFGKLFFAIWVIAHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEA  842

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  843   TKAAANGQCGINC  855



>gb|AAP97497.1| cellulose synthase [Solanum tuberosum]
Length=771

 Score =   521 bits (1341),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 259/313 (83%), Positives = 288/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  459   EIGWIYGSVTEDILTGFKMHARGWYSLYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  518

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRL  LERL+YINT +YP+T++PLL YCTLPA+CLLTGKFIIP+IS
Sbjct  519   ILLSRHCPIWYGYSGRLMLLERLAYINTIVYPLTSLPLLAYCTLPAICLLTGKFIIPEIS  578

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A +WFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  579   NYAGMWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  638

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDT FTVTSKA+DEDGDF ELY+FKWTTLLIPPT +LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  639   GIDTTFTVTSKANDEDGDFVELYVFKWTTLLIPPTAILIMNLVGIVAGVSYAINSGYQSW  698

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VW++LLASIFSLLWVRIDPFT+  
Sbjct  699   GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDA  758

Query  1128  TGPDVQ-ECGINC  1163
             +    + +CGINC
Sbjct  759   SKTAARGQCGINC  771



>ref|XP_011081578.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   530 bits (1366),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 291/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNG+L+ LERL+YINT +YP+T+IPLL YC LPA+CLLT KFIIP+IS
Sbjct  832   ILLSRHCPIWYGYNGKLQLLERLAYINTIVYPLTSIPLLAYCVLPAICLLTNKFIIPEIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILEMRWSGV +++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  892   NFASMWFILLFVSIFATGILEMRWSGVSVEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LI+N+VG+VAG+SYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIVNMVGIVAGVSYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1012  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEA  1071

Query  1128  TGPDVQ-ECGINC  1163
             T    Q +CGINC
Sbjct  1072  TRRAAQGQCGINC  1084



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   530 bits (1366),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 265/312 (85%), Positives = 290/312 (93%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGWRSIYCMP+R AFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  783   EIGWIYGSVTEDILTGFKMHARGWRSIYCMPQRAAFKGSAPINLSDRLNQVLRWALGSVE  842

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I  SRHCP+WYGY GRLKWLER +YINTT+YP+T+IPL+ YCTLPAVCLLTGKFIIP+IS
Sbjct  843   IFLSRHCPLWYGYGGRLKWLERFAYINTTVYPLTSIPLVAYCTLPAVCLLTGKFIIPEIS  902

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFIS+F+SIFAT ILEMRWS VGI+EWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  903   NFASLWFISMFVSIFATAILEMRWSNVGIEEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  962

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+D D +F ELY  KWTTLL+PPTTLLIINLVGVVAG++ A+NSGYQSW
Sbjct  963   GIDTNFTVTSKATD-DEEFGELYTLKWTTLLVPPTTLLIINLVGVVAGLADAINSGYQSW  1021

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF  + 
Sbjct  1022  GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLPKT  1081

Query  1128  TGPDVQECGINC  1163
              GP +Q+CG+NC
Sbjct  1082  QGPHLQQCGLNC  1093



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   529 bits (1363),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 266/313 (85%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWVSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPLL YC LPA+CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLLAYCVLPAICLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLAS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHL AVFQGLLKVLA
Sbjct  893   NLASMWFILLFISIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLVAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DG+FAELY+FKWT+LLIPPTT+LIIN VG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPPTTVLIINFVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI+HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVILHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDS  1072

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CGINC
Sbjct  1073  TKTATKGQCGINC  1085



>ref|XP_002455101.1| hypothetical protein SORBIDRAFT_03g004320 [Sorghum bicolor]
 gb|EES00221.1| hypothetical protein SORBIDRAFT_03g004320 [Sorghum bicolor]
Length=504

 Score =   510 bits (1313),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 286/313 (91%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RP FKGSAPINLSDRLNQVLRWALGSVE
Sbjct  192   EIGWIYGSVTEDILTGFKMHARGWISIYCMPLRPCFKGSAPINLSDRLNQVLRWALGSVE  251

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YC LPA+CLLT KFIIP+IS
Sbjct  252   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPITSIPLIAYCVLPAICLLTNKFIIPEIS  311

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A  +FI LF SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  312   NYAGAFFILLFASIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  371

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+D+DGDFAELY+FKWT+LLIPPTT+L+INLVG+VAG+SYA+NSGYQSW
Sbjct  372   GIDTNFTVTSKATDDDGDFAELYVFKWTSLLIPPTTVLVINLVGIVAGVSYAINSGYQSW  431

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI+HLYPFLKGLMG+QNRTPTIV+VWSILLASIFSLLWV+IDPF +  
Sbjct  432   GPLFGKLFFAIWVILHLYPFLKGLMGKQNRTPTIVIVWSILLASIFSLLWVKIDPFISPT  491

Query  1128  TGPDVQ-ECGINC  1163
                  + +CG+NC
Sbjct  492   QKAISRGQCGVNC  504



>ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   529 bits (1363),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWVSIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YC LPA+CLLT KFIIP+IS
Sbjct  833   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPITSIPLIAYCVLPAICLLTNKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             NLAS+WFI LF+SIF+TGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NLASMWFILLFISIFSTGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DG+FAELY+FKWT+LLIPPTT+LIIN VG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPPTTVLIINFVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI+HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVILHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CGINC
Sbjct  1073  TKAAAKGQCGINC  1085



>ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao]
 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao]
Length=1085

 Score =   529 bits (1362),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 265/313 (85%), Positives = 289/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCP+WYGYNGRLK LERL+YINT +YP+T+IPLL YC LPA CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPMWYGYNGRLKLLERLAYINTIVYPLTSIPLLAYCMLPAFCLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWTTLLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGDFAELYVFKWTTLLIPPTTVLIVNLVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  1073  TKSAANGQCGINC  1085



>gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Erythranthe guttata]
Length=1084

 Score =   528 bits (1361),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/313 (84%), Positives = 289/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWISVYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRL+ LERL+YINT +YP+T+IPLL YC LPAVCLLT KFIIP+IS
Sbjct  832   ILLSRHCPIWYGYSGRLQLLERLAYINTIVYPLTSIPLLAYCVLPAVCLLTNKFIIPEIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILEMRWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  892   NFASMWFIFLFMSIFATGILEMRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+L+IPPTT+L IN+VG+VAG+S A+NSGYQSW
Sbjct  952   GIDTNFTVTSKASDEDGDFAELYVFKWTSLIIPPTTVLFINMVGIVAGVSAAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWS+LLASIFSLLWVRIDPFT+  
Sbjct  1012  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSVLLASIFSLLWVRIDPFTSDA  1071

Query  1128  TGPDVQ-ECGINC  1163
             T    Q +CG+NC
Sbjct  1072  TKKAAQGQCGVNC  1084



>ref|XP_010905025.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
isoform X2 [Elaeis guineensis]
Length=1007

 Score =   526 bits (1354),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             ++G IY S+TEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  695   ELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  754

Query  408   ILFSRHCPIWYGY-NGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             I FSRH P+WYGY NG LKWLER +Y+NTTIYP T++PLL YCTLPAVCLLTGKFI+P I
Sbjct  755   IFFSRHSPVWYGYKNGHLKWLERFAYVNTTIYPFTSLPLLAYCTLPAVCLLTGKFIMPTI  814

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             S  AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  815   STFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGGVSAHLFAVIQGLLKVL  874

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKA+D++ +F ELY FKWTTLLIPPTTLLIINLVGVVAGIS A+N+GYQS
Sbjct  875   AGIDTNFTVTSKATDDEDEFGELYAFKWTTLLIPPTTLLIINLVGVVAGISDAINNGYQS  934

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLASIFSLLWVRIDPF  +
Sbjct  935   WGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVMK  994

Query  1125  VTGPDVQECGINC  1163
               GPDV++CGINC
Sbjct  995   AKGPDVRQCGINC  1007



>ref|XP_010110357.1| Protein radially swollen 1 [Morus notabilis]
 gb|EXC26044.1| Protein radially swollen 1 [Morus notabilis]
Length=1080

 Score =   528 bits (1359),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 263/312 (84%), Positives = 288/312 (92%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPLL YCTLPA CLLTGKFIIP+IS
Sbjct  830   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLLAYCTLPAFCLLTGKFIIPEIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  890   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+L++NLVG+VAG+SYA+NSGYQSW
Sbjct  950   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLLVNLVGIVAGVSYAINSGYQSW  1009

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWS LLASIFSLLWVRIDPFT+  
Sbjct  1010  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSTLLASIFSLLWVRIDPFTSDS  1069

Query  1128  TGPDVQECGINC  1163
                  Q CG+NC
Sbjct  1070  KASSGQ-CGVNC  1080



>ref|XP_001775315.1| predicted protein [Physcomitrella patens]
 ref|XP_001775317.1| predicted protein [Physcomitrella patens]
 gb|EDQ59920.1| predicted protein [Physcomitrella patens]
 gb|EDQ59922.1| predicted protein [Physcomitrella patens]
Length=593

 Score =   511 bits (1317),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 268/316 (85%), Positives = 289/316 (91%), Gaps = 5/316 (2%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  279   EIGWIYGSVTEDILTGFKMHCRGWRSIYCMPTRPAFKGSAPINLSDRLNQVLRWALGSVE  338

Query  408   ILFSRHCPIWYGYNGR----LKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFII  575
             I  SRHCP+WYGY G     LK LERL+YINTTIYP+T++PLL YC LPAVCLLTGKFII
Sbjct  339   ISLSRHCPLWYGYGGGKNGGLKCLERLAYINTTIYPLTSLPLLAYCVLPAVCLLTGKFII  398

Query  576   PQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL  755
             P ISNLAS+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFA+FQGLL
Sbjct  399   PTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGLL  458

Query  756   KVLAGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSG  935
             KV AGIDTNFTVTSK + ED DFAELY+ KWT LLIPPTTL++IN++GVVAGIS A+N+G
Sbjct  459   KVFAGIDTNFTVTSKQA-EDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG  517

Query  936   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPF  1115
             YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF
Sbjct  518   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF  577

Query  1116  TTRVTGPDVQECGINC  1163
               +V GPD+ +CGINC
Sbjct  578   LAKVKGPDLSQCGINC  593



>ref|XP_002967423.1| hypothetical protein SELMODRAFT_86720 [Selaginella moellendorffii]
 gb|EFJ32022.1| hypothetical protein SELMODRAFT_86720 [Selaginella moellendorffii]
Length=1076

 Score =   527 bits (1358),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/312 (84%), Positives = 293/312 (94%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW+SIYCMP RPAFKGSAPINLSDRL+QVLRWALGSVE
Sbjct  766   EIGWIYGSVTEDILTGFKMHARGWKSIYCMPARPAFKGSAPINLSDRLHQVLRWALGSVE  825

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I+ SRHCPIWYGY G LK L+R++YINT +YP+T+IPL+ YCTLPA+CLLT KFIIP IS
Sbjct  826   IMLSRHCPIWYGYGGGLKLLQRVAYINTIVYPLTSIPLVAYCTLPAICLLTNKFIIPTIS  885

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFISLF+SIFATGILE+RWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  886   NFASLWFISLFVSIFATGILEIRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  945

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVT+KA+ ED DFAELY FKWTTLLIPPTTLL+IN+VGVVAG+S A+N+GYQSW
Sbjct  946   GIDTNFTVTTKAA-EDEDFAELYTFKWTTLLIPPTTLLVINMVGVVAGLSDAINNGYQSW  1004

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF  +V
Sbjct  1005  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLPKV  1064

Query  1128  TGPDVQECGINC  1163
              GP++Q+CG+NC
Sbjct  1065  RGPNLQQCGLNC  1076



>gb|KDO61693.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1059

 Score =   526 bits (1356),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 291/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  747   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  806

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YCTLPA CLLT KFIIP+IS
Sbjct  807   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLIAYCTLPAFCLLTNKFIIPEIS  866

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  867   NFASMWFILLFISIFATGILEIRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  926

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+S+A+NSGYQSW
Sbjct  927   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSWAINSGYQSW  986

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVR+DPFT+  
Sbjct  987   GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTSDD  1046

Query  1128  TGPDVQ-ECGINC  1163
             T  +   +CGINC
Sbjct  1047  TKANSNGQCGINC  1059



>ref|XP_002960291.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ37830.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1080

 Score =   527 bits (1357),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 262/312 (84%), Positives = 293/312 (94%), Gaps = 1/312 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW+SIYCMP RPAFKGSAPINLSDRL+QVLRWALGSVE
Sbjct  770   EIGWIYGSVTEDILTGFKMHARGWKSIYCMPARPAFKGSAPINLSDRLHQVLRWALGSVE  829

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             I+ SRHCPIWYGY G LK L+R++YINT +YP+T+IPL+ YCTLPA+CLLT KFIIP IS
Sbjct  830   IMLSRHCPIWYGYGGGLKLLQRVAYINTIVYPLTSIPLVAYCTLPAICLLTNKFIIPTIS  889

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFISLF+SIFATGILE+RWSGVGIDEWWRNEQFWVIGGVS+HLFAVFQGLLKVLA
Sbjct  890   NFASLWFISLFVSIFATGILEIRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLA  949

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVT+KA+ ED DFAELY FKWTTLLIPPTTL++IN+VGVVAG+S A+N+GYQSW
Sbjct  950   GIDTNFTVTTKAA-EDEDFAELYTFKWTTLLIPPTTLIVINMVGVVAGLSDAINNGYQSW  1008

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGK+FFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF  +V
Sbjct  1009  GPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFLPKV  1068

Query  1128  TGPDVQECGINC  1163
              GP++Q+CG+NC
Sbjct  1069  RGPNLQQCGLNC  1080



>ref|XP_011039709.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Populus euphratica]
Length=1097

 Score =   527 bits (1358),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  785   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  844

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T++PLL YC LPAVCL++GKFIIP+IS
Sbjct  845   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSLPLLAYCVLPAVCLVSGKFIIPEIS  904

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAH FAVFQGLLKVLA
Sbjct  905   NYASMWFILLFISIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHFFAVFQGLLKVLA  964

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT++++N+VG+VAG+SYA+NSGYQSW
Sbjct  965   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVILLNMVGIVAGVSYAINSGYQSW  1024

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1025  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDS  1084

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  1085  TKAVANGQCGINC  1097



>ref|XP_009785781.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana sylvestris]
Length=1085

 Score =   527 bits (1358),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 259/313 (83%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNG+LK LER++YINT +YP+T++PLL YC LPA+CLLTGKFI+P+IS
Sbjct  833   ILLSRHCPIWYGYNGKLKLLERIAYINTIVYPITSLPLLAYCILPAICLLTGKFIVPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NYASMWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDG+FAELY+FKWT+L+IPPTT+LI+N+VG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGEFAELYVFKWTSLIIPPTTVLILNMVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFG+LFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWS+LLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGRLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSVLLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CG+NC
Sbjct  1073  TQNAAKGQCGVNC  1085



>dbj|BAJ85785.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   510 bits (1314),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 286/313 (91%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RP FKGSAPINLSDRLNQVLRWALGSVE
Sbjct  254   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPCFKGSAPINLSDRLNQVLRWALGSVE  313

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             ILFSRHCPIWY Y GRLK LER++YINT +YP+T++PL+ YC LPA+CLLT KFIIP+IS
Sbjct  314   ILFSRHCPIWYNYGGRLKLLERVAYINTIVYPITSLPLIAYCVLPAICLLTNKFIIPEIS  373

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A ++FI +F SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  374   NYAGMFFILMFASIFATGILELRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  433

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELY+FKWT+LLIPPTT+L+INLVG+VAGISYA+NSGYQSW
Sbjct  434   GIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPPTTVLVINLVGMVAGISYAINSGYQSW  493

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFF+ WVI+HLYPFLKGLMG+QNRTPTIV+VWSILLASIFSLLWV+IDPF +  
Sbjct  494   GPLFGKLFFSIWVILHLYPFLKGLMGKQNRTPTIVIVWSILLASIFSLLWVKIDPFISDT  553

Query  1128  TGP-DVQECGINC  1163
                  + +CG+NC
Sbjct  554   QKAVAMGQCGVNC  566



>ref|XP_010905024.1| PREDICTED: cellulose synthase A catalytic subunit 9 [UDP-forming] 
isoform X1 [Elaeis guineensis]
Length=1048

 Score =   526 bits (1354),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             ++G IY S+TEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  736   ELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  795

Query  408   ILFSRHCPIWYGY-NGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             I FSRH P+WYGY NG LKWLER +Y+NTTIYP T++PLL YCTLPAVCLLTGKFI+P I
Sbjct  796   IFFSRHSPVWYGYKNGHLKWLERFAYVNTTIYPFTSLPLLAYCTLPAVCLLTGKFIMPTI  855

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             S  AS++FI+LF+SIFATGILE+RWSGV I+EWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  856   STFASLFFIALFISIFATGILELRWSGVSIEEWWRNEQFWVIGGVSAHLFAVIQGLLKVL  915

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKA+D++ +F ELY FKWTTLLIPPTTLLIINLVGVVAGIS A+N+GYQS
Sbjct  916   AGIDTNFTVTSKATDDEDEFGELYAFKWTTLLIPPTTLLIINLVGVVAGISDAINNGYQS  975

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFF+FWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLASIFSLLWVRIDPF  +
Sbjct  976   WGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVMK  1035

Query  1125  VTGPDVQECGINC  1163
               GPDV++CGINC
Sbjct  1036  AKGPDVRQCGINC  1048



>ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Fragaria vesca subsp. vesca]
Length=1069

 Score =   526 bits (1356),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 260/313 (83%), Positives = 289/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  757   EIGWIYGSVTEDILTGFKMHARGWISVYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  816

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGR+K LER++YINT +YP+T+IPL+ YC LPA CLLT KFIIP+IS
Sbjct  817   ILLSRHCPIWYGYNGRMKLLERIAYINTIVYPLTSIPLIAYCMLPAFCLLTNKFIIPEIS  876

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SI ATGILE+RWSGVGID+WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  877   NFASMWFILLFVSIAATGILELRWSGVGIDDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  936

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  937   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSYAINSGYQSW  996

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WV+ HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  997   GPLFGKLFFAMWVVAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDA  1056

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CG+NC
Sbjct  1057  TKAAAKGQCGVNC  1069



>ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 gb|KDO61692.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1085

 Score =   526 bits (1356),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 291/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRLK LERL+YINT +YP+T+IPL+ YCTLPA CLLT KFIIP+IS
Sbjct  833   ILLSRHCPIWYGYNGRLKLLERLAYINTIVYPLTSIPLIAYCTLPAFCLLTNKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGVGI++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NFASMWFILLFISIFATGILEIRWSGVGIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+S+A+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSWAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVR+DPFT+  
Sbjct  1013  GPLFGKLFFAIWVIAHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRVDPFTSDD  1072

Query  1128  TGPDVQ-ECGINC  1163
             T  +   +CGINC
Sbjct  1073  TKANSNGQCGINC  1085



>ref|XP_008790154.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 9 [UDP-forming]-like [Phoenix dactylifera]
Length=1048

 Score =   525 bits (1353),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/313 (84%), Positives = 289/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             ++G IY S+TEDILTGFKMH RGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  736   ELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  795

Query  408   ILFSRHCPIWYGY-NGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQI  584
             I FSRH P+WYGY NG LKWLER +YINTTIYP T++PLL YCTLPAVCLLTGKFI+P I
Sbjct  796   IFFSRHSPVWYGYKNGHLKWLERFAYINTTIYPFTSLPLLAYCTLPAVCLLTGKFIMPTI  855

Query  585   SNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVL  764
             S  AS++FISLF+SIFATGILE+RWSGV I+EWWRNEQFWVIGGVSAHLFAV QGLLKVL
Sbjct  856   STFASLFFISLFISIFATGILELRWSGVSIEEWWRNEQFWVIGGVSAHLFAVIQGLLKVL  915

Query  765   AGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQS  944
             AGIDTNFTVTSKA+D++ ++ +LY FKWTTL IPPTTLLIINLVGVVAGIS A+N+GYQS
Sbjct  916   AGIDTNFTVTSKATDDEDEYGDLYAFKWTTLXIPPTTLLIINLVGVVAGISDAINNGYQS  975

Query  945   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTR  1124
             WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVV+WS+LLASIFSLLWVRIDPF  +
Sbjct  976   WGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVIK  1035

Query  1125  VTGPDVQECGINC  1163
               GPDV++CGINC
Sbjct  1036  AKGPDVRQCGINC  1048



>ref|XP_009768318.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1085

 Score =   526 bits (1355),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWYSLYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRL  LER++YINT +YP+T++PLL YCTLPA+CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPIWYGYSGRLMLLERIAYINTIVYPITSLPLLAYCTLPAICLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A IWFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NYAGIWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTILIVNLVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VW++LLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
                  + +CG+NC
Sbjct  1073  AKTAARGQCGVNC  1085



>ref|XP_009623502.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1085

 Score =   526 bits (1355),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWYSLYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRL  LER++YINT +YP+T++PLL YCTLPA+CLLTGKFIIP+IS
Sbjct  833   ILLSRHCPIWYGYSGRLMLLERIAYINTIVYPITSLPLLAYCTLPAICLLTGKFIIPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A IWFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NYAGIWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDGDFAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPPTTILIVNLVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VW++LLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
                  + +CG+NC
Sbjct  1073  AKTAARGQCGVNC  1085



>ref|XP_001776974.1| cellulose synthase 10, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|EDQ58223.1| cellulose synthase 10, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1095

 Score =   526 bits (1355),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 268/316 (85%), Positives = 289/316 (91%), Gaps = 5/316 (2%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMH RGWRSIYCMP R AFKGSAPINLSDRL QVLRWALGSVE
Sbjct  781   EIGWIYGSVTEDILTGFKMHCRGWRSIYCMPARAAFKGSAPINLSDRLQQVLRWALGSVE  840

Query  408   ILFSRHCPIWYGY----NGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFII  575
             I  SRHCP+WYGY    +G LK LERL+YINTTIYP+T++PLL YC LPAVCLLTGKFII
Sbjct  841   ISLSRHCPLWYGYGGGKHGELKCLERLAYINTTIYPLTSLPLLAYCVLPAVCLLTGKFII  900

Query  576   PQISNLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLL  755
             P I+NL S+WFISLF+SIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFA+FQGLL
Sbjct  901   PTITNLDSLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGLL  960

Query  756   KVLAGIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSG  935
             KVLAGIDTNFTVTSK + ED DFAELY+ KWT LLIPPTTLL+IN++GVVAGIS A+N+G
Sbjct  961   KVLAGIDTNFTVTSKQA-EDEDFAELYMIKWTALLIPPTTLLVINMIGVVAGISDAINNG  1019

Query  936   YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPF  1115
             YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIV+VWSILLASIFSLLWVRIDPF
Sbjct  1020  YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF  1079

Query  1116  TTRVTGPDVQECGINC  1163
               +VTGPD+ ECGINC
Sbjct  1080  LAKVTGPDITECGINC  1095



>gb|AFB18635.1| CESA6 [Gossypium hirsutum]
Length=1083

 Score =   526 bits (1354),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 264/313 (84%), Positives = 288/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  771   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  830

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY GRL+ LERL+YINT +YP+T+IPLL YC LPA CLLTGKFIIP+IS
Sbjct  831   ILLSRHCPIWYGYKGRLRLLERLAYINTIVYPLTSIPLLAYCMLPAFCLLTGKFIIPEIS  890

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  891   NFASMWFILLFVSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  950

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DGDFAELY+FKWT+LLIPPTT+LIINLVG+VAG+SYA+NSGYQSW
Sbjct  951   GIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPPTTVLIINLVGIVAGVSYAINSGYQSW  1010

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVI HLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1011  GPLFGKLFFAIWVIAHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEA  1070

Query  1128  TGPDVQ-ECGINC  1163
             T      +CGINC
Sbjct  1071  TKAAANGQCGINC  1083



>ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1085

 Score =   526 bits (1354),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 258/313 (82%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  773   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  832

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNG+LK LER++YINT +YP+T++PLL YC LPA+CLLTGKFI+P+IS
Sbjct  833   ILLSRHCPIWYGYNGKLKLLERIAYINTIVYPITSLPLLAYCILPAICLLTGKFIVPEIS  892

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  893   NYASMWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  952

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASDEDG+F+ELY+FKWT+L+IPPTT+LI+N+VG+VAG+SYA+NSGYQSW
Sbjct  953   GIDTNFTVTSKASDEDGEFSELYVFKWTSLIIPPTTVLILNMVGIVAGVSYAINSGYQSW  1012

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFG+LFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWS+LLASIFSLLWVRIDPFT+  
Sbjct  1013  GPLFGRLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSVLLASIFSLLWVRIDPFTSDA  1072

Query  1128  TGPDVQ-ECGINC  1163
             T    + +CG+NC
Sbjct  1073  TKTAARGQCGVNC  1085



>ref|XP_011071168.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   525 bits (1353),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 289/313 (92%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW SIYCMP RPAFKGSAPINLSDRLNQVLRWALGS+E
Sbjct  772   EIGWIYGSVTEDILTGFKMHARGWISIYCMPPRPAFKGSAPINLSDRLNQVLRWALGSIE  831

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGYNGRL+ LERL+YINT +YP+T+IPLL YC LPA+CLLT KFIIP+IS
Sbjct  832   ILLSRHCPIWYGYNGRLQLLERLAYINTIVYPLTSIPLLAYCVLPAICLLTNKFIIPEIS  891

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N AS+WFI LF+SIFATGILEMRW GV +++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  892   NFASMWFILLFVSIFATGILEMRWGGVSVEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  951

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKASD+DG+FAELY+FKWT+LLIPPTT+LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  952   GIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPPTTVLIVNLVGIVAGVSYAINSGYQSW  1011

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VWSILLASIFSLLWVRIDPFT+  
Sbjct  1012  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEA  1071

Query  1128  TGPDVQ-ECGINC  1163
             T      +CG+NC
Sbjct  1072  TRRAANGQCGVNC  1084



>ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Solanum tuberosum]
Length=1086

 Score =   525 bits (1353),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +3

Query  228   QIG*IYCSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVE  407
             +IG IY SVTEDILTGFKMHARGW S+YCMP RPAFKGSAPINLSDRLNQVLRWALGSVE
Sbjct  774   EIGWIYGSVTEDILTGFKMHARGWYSLYCMPPRPAFKGSAPINLSDRLNQVLRWALGSVE  833

Query  408   ILFSRHCPIWYGYNGRLKWLERLSYINTTIYPVTAIPLLIYCTLPAVCLLTGKFIIPQIS  587
             IL SRHCPIWYGY+GRL  LERL+YINT +YP+T++PLL YCTLPA+CLLTGKFIIP+IS
Sbjct  834   ILLSRHCPIWYGYSGRLMLLERLAYINTIVYPLTSLPLLAYCTLPAICLLTGKFIIPEIS  893

Query  588   NLASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGLLKVLA  767
             N A +WFI LFLSIFATGILE+RWSGV I++WWRNEQFWVIGG SAHLFAVFQGLLKVLA
Sbjct  894   NYAGMWFILLFLSIFATGILELRWSGVSIEDWWRNEQFWVIGGTSAHLFAVFQGLLKVLA  953

Query  768   GIDTNFTVTSKASDEDGDFAELYLFKWttllippttlliiNLVGVVAGISYAVNSGYQSW  947
             GIDTNFTVTSKA+DEDGDFAELY+FKWTTLLIPPT +LI+NLVG+VAG+SYA+NSGYQSW
Sbjct  954   GIDTNFTVTSKANDEDGDFAELYVFKWTTLLIPPTAILIMNLVGIVAGVSYAINSGYQSW  1013

Query  948   GPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSILLASIFSLLWVRIDPFTTRV  1127
             GPLFGKLFFA WVIVHLYPFLKGL+GRQNRTPTIV+VW++LLASIFSLLWVRIDPFT+  
Sbjct  1014  GPLFGKLFFAIWVIVHLYPFLKGLLGRQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDA  1073

Query  1128  TGPDVQ-ECGINC  1163
             +    + +CGINC
Sbjct  1074  SKTAARGQCGINC  1086



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4460266560568