BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22448_g1_i1 len=2795 path=[3698:0-468 440:469-505 928:506-554
4250:555-597 4293:598-757 4453:758-776 4472:777-2794]

Length=2795
                                                                      Score     E

ref|XP_009769146.1|  PREDICTED: G-type lectin S-receptor-like ser...    954   0.0     
ref|XP_009589083.1|  PREDICTED: uncharacterized protein LOC104086517    943   0.0     
ref|XP_010317324.1|  PREDICTED: uncharacterized protein LOC101264093    928   0.0     
ref|XP_006347190.1|  PREDICTED: uncharacterized protein LOC102586591    925   0.0     
ref|XP_009782161.1|  PREDICTED: G-type lectin S-receptor-like ser...    921   0.0     
ref|XP_009607303.1|  PREDICTED: G-type lectin S-receptor-like ser...    919   0.0     
ref|XP_006352641.1|  PREDICTED: G-type lectin S-receptor-like ser...    897   0.0     
ref|XP_010646879.1|  PREDICTED: G-type lectin S-receptor-like ser...    891   0.0     
emb|CDO99664.1|  unnamed protein product                                889   0.0     
ref|XP_010327269.1|  PREDICTED: G-type lectin S-receptor-like ser...    877   0.0     
ref|XP_006467932.1|  PREDICTED: G-type lectin S-receptor-like ser...    848   0.0     
ref|XP_002316681.2|  hypothetical protein POPTR_0011s03790g             845   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011096222.1|  PREDICTED: uncharacterized protein LOC105175473    864   0.0     
ref|XP_006467933.1|  PREDICTED: G-type lectin S-receptor-like ser...    833   0.0     
gb|KHG07568.1|  G-type lectin S-receptor-like serine/threonine-pr...    832   0.0     
ref|XP_011008148.1|  PREDICTED: G-type lectin S-receptor-like ser...    831   0.0     
ref|XP_002524721.1|  S-locus-specific glycoprotein S6 precursor, ...    830   0.0     Ricinus communis
ref|XP_002304962.2|  S-locus lectin protein kinase                      830   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006467934.1|  PREDICTED: G-type lectin S-receptor-like ser...    829   0.0     
ref|XP_010268933.1|  PREDICTED: G-type lectin S-receptor-like ser...    825   0.0     
ref|XP_002304965.2|  hypothetical protein POPTR_0004s02700g             824   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011011560.1|  PREDICTED: G-type lectin S-receptor-like ser...    819   0.0     
ref|XP_007025862.1|  S-locus lectin protein kinase family protein...    816   0.0     
gb|KDP20854.1|  hypothetical protein JCGZ_21325                         807   0.0     
ref|XP_008224905.1|  PREDICTED: G-type lectin S-receptor-like ser...    803   0.0     
ref|XP_010106717.1|  G-type lectin S-receptor-like serine/threoni...    801   0.0     
ref|XP_011011557.1|  PREDICTED: G-type lectin S-receptor-like ser...    800   0.0     
ref|XP_010059473.1|  PREDICTED: putative G-type lectin S-receptor...    792   0.0     
gb|KHN19084.1|  G-type lectin S-receptor-like serine/threonine-pr...    788   0.0     
ref|XP_006594639.1|  PREDICTED: G-type lectin S-receptor-like ser...    786   0.0     
ref|NP_193870.1|  G-type lectin S-receptor-like serine/threonine-...    786   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594640.1|  PREDICTED: G-type lectin S-receptor-like ser...    786   0.0     
dbj|BAF01045.1|  serine/threonine kinase - like protein                 785   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148274.1|  hypothetical protein PHAVU_006G194500g             783   0.0     
gb|EYU27870.1|  hypothetical protein MIMGU_mgv1a002421mg                775   0.0     
gb|AID21646.1|  At4g21390p-like protein                                 782   0.0     
ref|XP_010439484.1|  PREDICTED: G-type lectin S-receptor-like ser...    780   0.0     
gb|ADQ37350.1|  unknown                                                 780   0.0     
gb|ADQ37364.1|  unknown                                                 779   0.0     
ref|XP_009372035.1|  PREDICTED: G-type lectin S-receptor-like ser...    780   0.0     
gb|ADQ37384.1|  unknown                                                 778   0.0     
ref|XP_010449072.1|  PREDICTED: G-type lectin S-receptor-like ser...    778   0.0     
gb|AID21689.1|  At4g21390p-like protein                                 778   0.0     
ref|XP_002867851.1|  hypothetical protein ARALYDRAFT_914538             778   0.0     
gb|AGN12870.1|  putative S-locus lectin protein kinase-like protein     776   0.0     
gb|ADQ37375.1|  unknown                                                 777   0.0     
gb|AID21588.1|  At4g21390p-like protein                                 777   0.0     
ref|XP_010434186.1|  PREDICTED: G-type lectin S-receptor-like ser...    777   0.0     
ref|XP_006449174.1|  hypothetical protein CICLE_v10014386mg             771   0.0     
gb|AID21660.1|  At4g21390p-like protein                                 774   0.0     
ref|XP_008345158.1|  PREDICTED: G-type lectin S-receptor-like ser...    774   0.0     
ref|XP_010059472.1|  PREDICTED: G-type lectin S-receptor-like ser...    773   0.0     
ref|XP_010057706.1|  PREDICTED: G-type lectin S-receptor-like ser...    773   0.0     
emb|CCI61484.1|  unnamed protein product                                773   0.0     
gb|ADQ37393.1|  unknown                                                 771   0.0     
gb|KHN33627.1|  G-type lectin S-receptor-like serine/threonine-pr...    768   0.0     
ref|XP_004485683.1|  PREDICTED: G-type lectin S-receptor-like ser...    769   0.0     
gb|KHG16273.1|  G-type lectin S-receptor-like serine/threonine-pr...    766   0.0     
ref|XP_010057704.1|  PREDICTED: G-type lectin S-receptor-like ser...    766   0.0     
ref|XP_010057705.1|  PREDICTED: G-type lectin S-receptor-like ser...    760   0.0     
gb|AGN12879.1|  putative S-locus lectin protein kinase-like protein     760   0.0     
ref|XP_010059466.1|  PREDICTED: G-type lectin S-receptor-like ser...    760   0.0     
gb|KCW74912.1|  hypothetical protein EUGRSUZ_E03659                     758   0.0     
ref|XP_010533859.1|  PREDICTED: putative G-type lectin S-receptor...    756   0.0     
ref|XP_008355977.1|  PREDICTED: G-type lectin S-receptor-like ser...    756   0.0     
gb|KCW74922.1|  hypothetical protein EUGRSUZ_E03669                     755   0.0     
emb|CAN70165.1|  hypothetical protein VITISV_024701                     763   0.0     Vitis vinifera
emb|CAA73134.1|  serine/threonine kinase                                754   0.0     Brassica oleracea
ref|XP_009134704.1|  PREDICTED: G-type lectin S-receptor-like ser...    753   0.0     
ref|XP_006598304.1|  PREDICTED: uncharacterized protein LOC100797331    783   0.0     
ref|XP_004169144.1|  PREDICTED: G-type lectin S-receptor-like ser...    753   0.0     
gb|ABD32350.1|  Protein kinase; S-locus glycoprotein; Curculin-li...    749   0.0     Medicago truncatula
gb|KCW74925.1|  hypothetical protein EUGRSUZ_E03671                     747   0.0     
ref|XP_006282832.1|  hypothetical protein CARUB_v10006676mg             745   0.0     
gb|KCW74915.1|  hypothetical protein EUGRSUZ_E03662                     743   0.0     
ref|XP_010418128.1|  PREDICTED: putative G-type lectin S-receptor...    742   0.0     
ref|XP_010059467.1|  PREDICTED: G-type lectin S-receptor-like ser...    743   0.0     
gb|AES63666.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    740   0.0     
ref|XP_010665844.1|  PREDICTED: G-type lectin S-receptor-like ser...    740   0.0     
ref|XP_004504969.1|  PREDICTED: uncharacterized protein LOC101504189    767   0.0     
ref|XP_003608275.1|  Cysteine-rich receptor-like protein kinase         747   0.0     
gb|AES90472.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    747   0.0     
ref|XP_010418129.1|  PREDICTED: putative G-type lectin S-receptor...    734   0.0     
gb|KHN07687.1|  G-type lectin S-receptor-like serine/threonine-pr...    735   0.0     
ref|XP_003528424.1|  PREDICTED: G-type lectin S-receptor-like ser...    734   0.0     
ref|XP_008439931.1|  PREDICTED: G-type lectin S-receptor-like ser...    734   0.0     
ref|XP_010473368.1|  PREDICTED: putative G-type lectin S-receptor...    731   0.0     
ref|XP_010907389.1|  PREDICTED: G-type lectin S-receptor-like ser...    731   0.0     
ref|XP_008439932.1|  PREDICTED: G-type lectin S-receptor-like ser...    730   0.0     
ref|XP_010529374.1|  PREDICTED: G-type lectin S-receptor-like ser...    728   0.0     
ref|NP_176355.1|  putative G-type lectin S-receptor-like serine/t...    726   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391988.1|  hypothetical protein EUTSA_v10023270mg             725   0.0     
ref|XP_007213623.1|  hypothetical protein PRUPE_ppa002243mg             718   0.0     
gb|KHN45742.1|  G-type lectin S-receptor-like serine/threonine-pr...    719   0.0     
ref|XP_002888080.1|  predicted protein                                  721   0.0     
ref|XP_009124660.1|  PREDICTED: putative G-type lectin S-receptor...    719   0.0     
ref|XP_006300732.1|  hypothetical protein CARUB_v10019792mg             719   0.0     
emb|CDY48826.1|  BnaC01g43340D                                          718   0.0     
ref|XP_009124659.1|  PREDICTED: putative G-type lectin S-receptor...    717   0.0     
emb|CDY49030.1|  BnaA01g22760D                                          713   0.0     
gb|KCW74920.1|  hypothetical protein EUGRSUZ_E03667                     709   0.0     
emb|CDY49029.1|  BnaA01g22750D                                          712   0.0     
ref|XP_004134964.1|  PREDICTED: uncharacterized protein LOC101207147    760   0.0     
ref|XP_011008149.1|  PREDICTED: G-type lectin S-receptor-like ser...    705   0.0     
ref|XP_007159234.1|  hypothetical protein PHAVU_002G220500g             708   0.0     
gb|AES63664.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    706   0.0     
ref|XP_003593413.1|  Cysteine-rich receptor-like protein kinase         705   0.0     
gb|KEH29518.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    704   0.0     
ref|XP_010928165.1|  PREDICTED: G-type lectin S-receptor-like ser...    704   0.0     
ref|XP_010268928.1|  PREDICTED: G-type lectin S-receptor-like ser...    704   0.0     
gb|KFK40685.1|  hypothetical protein AALP_AA2G028000                    703   0.0     
ref|XP_009123577.1|  PREDICTED: putative G-type lectin S-receptor...    704   0.0     
ref|XP_010240981.1|  PREDICTED: G-type lectin S-receptor-like ser...    697   0.0     
ref|XP_009385294.1|  PREDICTED: G-type lectin S-receptor-like ser...    696   0.0     
ref|XP_010928191.1|  PREDICTED: G-type lectin S-receptor-like ser...    694   0.0     
gb|AID21611.1|  At4g21390p-like protein                                 688   0.0     
gb|AID21597.1|  At4g21390p-like protein                                 688   0.0     
ref|XP_009398187.1|  PREDICTED: G-type lectin S-receptor-like ser...    692   0.0     
gb|KFK28718.1|  hypothetical protein AALP_AA7G038000                    689   0.0     
ref|XP_008803875.1|  PREDICTED: uncharacterized protein LOC103717326    726   0.0     
ref|XP_009402802.1|  PREDICTED: G-type lectin S-receptor-like ser...    682   0.0     
emb|CDY62912.1|  BnaC01g41150D                                          670   0.0     
ref|XP_004295380.1|  PREDICTED: uncharacterized protein LOC101310880    725   0.0     
emb|CDX79056.1|  BnaA01g11230D                                          664   0.0     
ref|XP_002304960.2|  hypothetical protein POPTR_0004s02640g             668   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006387750.1|  hypothetical protein POPTR_0608s00200g             665   0.0     
gb|EAZ04277.1|  hypothetical protein OsI_26419                          665   0.0     Oryza sativa Indica Group [Indian rice]
gb|KCW72107.1|  hypothetical protein EUGRSUZ_E00547                     661   0.0     
ref|XP_010646877.1|  PREDICTED: G-type lectin S-receptor-like ser...    662   0.0     
ref|XP_010430168.1|  PREDICTED: putative G-type lectin S-receptor...    658   0.0     
ref|XP_006851221.1|  hypothetical protein AMTR_s00043p00231180          660   0.0     
gb|KCW72108.1|  hypothetical protein EUGRSUZ_E00547                     658   0.0     
ref|XP_011004258.1|  PREDICTED: G-type lectin S-receptor-like ser...    658   0.0     
ref|XP_010646878.1|  PREDICTED: G-type lectin S-receptor-like ser...    657   0.0     
ref|XP_008776768.1|  PREDICTED: G-type lectin S-receptor-like ser...    677   0.0     
ref|XP_006464588.1|  PREDICTED: G-type lectin S-receptor-like ser...    655   0.0     
emb|CBI25710.3|  unnamed protein product                                654   0.0     
ref|XP_010646876.1|  PREDICTED: G-type lectin S-receptor-like ser...    654   0.0     
ref|XP_002262971.3|  PREDICTED: G-type lectin S-receptor-like ser...    654   0.0     Vitis vinifera
ref|XP_002316678.2|  hypothetical protein POPTR_0011s03900g             654   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007022283.1|  Serine/threonine kinases,protein kinases,ATP...    654   0.0     
gb|KCW74916.1|  hypothetical protein EUGRSUZ_E03662                     649   0.0     
ref|XP_010268956.1|  PREDICTED: G-type lectin S-receptor-like ser...    658   0.0     
ref|NP_001059941.1|  Os07g0550900                                       652   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010547141.1|  PREDICTED: G-type lectin S-receptor-like ser...    648   0.0     
gb|KEH22744.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    648   0.0     
ref|XP_010547149.1|  PREDICTED: G-type lectin S-receptor-like ser...    647   0.0     
ref|XP_010909793.1|  PREDICTED: G-type lectin S-receptor-like ser...    647   0.0     
ref|XP_009395388.1|  PREDICTED: uncharacterized protein LOC103980655    671   0.0     
ref|XP_010907385.1|  PREDICTED: G-type lectin S-receptor-like ser...    646   0.0     
ref|XP_003593415.1|  Cysteine-rich receptor-like protein kinase         641   0.0     
gb|KEH22751.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    643   0.0     
gb|KEH22748.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    643   0.0     
ref|XP_004514287.1|  PREDICTED: G-type lectin S-receptor-like ser...    643   0.0     
ref|XP_010052476.1|  PREDICTED: G-type lectin S-receptor-like ser...    643   0.0     
ref|XP_009411995.1|  PREDICTED: G-type lectin S-receptor-like ser...    643   0.0     
ref|XP_010052475.1|  PREDICTED: G-type lectin S-receptor-like ser...    643   0.0     
ref|XP_007022282.1|  Serine/threonine kinases,protein kinases,ATP...    642   0.0     
ref|NP_001059942.1|  Os07g0551300                                       642   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KEH22752.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    640   0.0     
gb|KEH22750.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    640   0.0     
ref|XP_006494689.1|  PREDICTED: G-type lectin S-receptor-like ser...    639   0.0     
ref|XP_010052477.1|  PREDICTED: G-type lectin S-receptor-like ser...    640   0.0     
ref|XP_006494688.1|  PREDICTED: G-type lectin S-receptor-like ser...    637   0.0     
ref|XP_010052478.1|  PREDICTED: G-type lectin S-receptor-like ser...    638   0.0     
ref|XP_010924049.1|  PREDICTED: receptor-like serine/threonine-pr...    638   0.0     
ref|XP_010052422.1|  PREDICTED: G-type lectin S-receptor-like ser...    637   0.0     
emb|CDP04297.1|  unnamed protein product                                637   0.0     
ref|XP_006417365.1|  hypothetical protein EUTSA_v10006795mg             636   0.0     
ref|XP_010647319.1|  PREDICTED: G-type lectin S-receptor-like ser...    635   0.0     
ref|XP_010547161.1|  PREDICTED: G-type lectin S-receptor-like ser...    635   0.0     
emb|CDP04301.1|  unnamed protein product                                636   0.0     
gb|AAC95353.1|  receptor-like protein kinase                            635   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547170.1|  PREDICTED: G-type lectin S-receptor-like ser...    634   0.0     
ref|NP_172600.1|  G-type lectin S-receptor-like serine/threonine-...    634   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462991.1|  hypothetical protein SORBIDRAFT_02g035930          635   0.0     Sorghum bicolor [broomcorn]
ref|XP_010052421.1|  PREDICTED: G-type lectin S-receptor-like ser...    633   0.0     
ref|XP_007021377.1|  S-locus lectin protein kinase family protein...    632   0.0     
ref|NP_001184962.1|  G-type lectin S-receptor-like serine/threoni...    633   0.0     
ref|XP_006427832.1|  hypothetical protein CICLE_v10027468mg             631   0.0     
ref|XP_009148462.1|  PREDICTED: G-type lectin S-receptor-like ser...    634   0.0     
ref|XP_010529375.1|  PREDICTED: G-type lectin S-receptor-like ser...    629   0.0     
emb|CDP04302.1|  unnamed protein product                                631   0.0     
emb|CDX97950.1|  BnaA06g07010D                                          632   0.0     
gb|KDO53989.1|  hypothetical protein CISIN_1g003599mg                   629   0.0     
ref|XP_002462992.1|  hypothetical protein SORBIDRAFT_02g035940          631   0.0     Sorghum bicolor [broomcorn]
gb|KDO53988.1|  hypothetical protein CISIN_1g003599mg                   629   0.0     
ref|XP_002889863.1|  S-locus lectin protein kinase family protein       630   0.0     
ref|XP_010268929.1|  PREDICTED: G-type lectin S-receptor-like ser...    629   0.0     
ref|XP_010476053.1|  PREDICTED: G-type lectin S-receptor-like ser...    629   0.0     
ref|XP_010237216.1|  PREDICTED: G-type lectin S-receptor-like ser...    629   0.0     
gb|AES63671.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    626   0.0     
ref|XP_010667681.1|  PREDICTED: G-type lectin S-receptor-like ser...    625   0.0     
ref|NP_172602.1|  G-type lectin S-receptor-like serine/threonine-...    625   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KEH22681.1|  S-locus lectin kinase family protein                    625   0.0     
sp|Q9SXB4.1|Y1130_ARATH  RecName: Full=G-type lectin S-receptor-l...    624   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025881.1|  S-locus lectin protein kinase family protein...    625   0.0     
ref|XP_010476045.1|  PREDICTED: G-type lectin S-receptor-like ser...    624   0.0     
ref|XP_009148465.1|  PREDICTED: G-type lectin S-receptor-like ser...    623   0.0     
ref|XP_010492578.1|  PREDICTED: G-type lectin S-receptor-like ser...    623   0.0     
ref|XP_008775529.1|  PREDICTED: receptor-like serine/threonine-pr...    622   0.0     
emb|CDY34839.1|  BnaA09g47650D                                          622   0.0     
ref|XP_011009495.1|  PREDICTED: receptor-like serine/threonine-pr...    624   0.0     
emb|CDP04303.1|  unnamed protein product                                622   0.0     
ref|XP_003562945.1|  PREDICTED: G-type lectin S-receptor-like ser...    623   0.0     
ref|XP_006370370.1|  hypothetical protein POPTR_0001s42050g             621   0.0     
emb|CDX97948.1|  BnaA06g06990D                                          622   0.0     
gb|AES63672.2|  G-type lectin S-receptor-like Serine/Threonine-ki...    622   0.0     
ref|XP_007140616.1|  hypothetical protein PHAVU_008G127100g             622   0.0     
ref|XP_006423695.1|  hypothetical protein CICLE_v10027849mg             620   0.0     
ref|XP_007021379.1|  S-locus lectin protein kinase family protein       621   0.0     
ref|XP_006657817.1|  PREDICTED: G-type lectin S-receptor-like ser...    622   0.0     
gb|KFK35677.1|  hypothetical protein AALP_AA4G022800                    621   0.0     
ref|XP_010458519.1|  PREDICTED: G-type lectin S-receptor-like ser...    622   0.0     
ref|XP_009118190.1|  PREDICTED: G-type lectin S-receptor-like ser...    620   0.0     
emb|CDY19356.1|  BnaC05g08650D                                          622   0.0     
ref|XP_009110726.1|  PREDICTED: G-type lectin S-receptor-like ser...    619   0.0     
ref|XP_009118189.1|  PREDICTED: G-type lectin S-receptor-like ser...    620   0.0     
ref|XP_009118191.1|  PREDICTED: G-type lectin S-receptor-like ser...    619   0.0     
ref|XP_008235408.1|  PREDICTED: G-type lectin S-receptor-like ser...    620   0.0     
ref|XP_002889861.1|  predicted protein                                  619   0.0     
emb|CDX97949.1|  BnaA06g07000D                                          620   0.0     
ref|XP_008446571.1|  PREDICTED: uncharacterized protein LOC103489262    643   0.0     
ref|XP_006409430.1|  hypothetical protein EUTSA_v10022559mg             618   0.0     
emb|CDY20990.1|  BnaA08g25350D                                          617   0.0     
ref|XP_006304884.1|  hypothetical protein CARUB_v10012649mg             616   0.0     
ref|XP_010317325.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    640   0.0     
emb|CDY34650.1|  BnaC08g42090D                                          616   0.0     
ref|XP_010928033.1|  PREDICTED: receptor-like serine/threonine-pr...    629   0.0     
ref|XP_003593421.1|  Cysteine-rich receptor-like protein kinase         618   0.0     
ref|XP_007021380.1|  S-locus lectin protein kinase family protein       615   0.0     
ref|XP_010646864.1|  PREDICTED: G-type lectin S-receptor-like ser...    638   0.0     
ref|XP_011096221.1|  PREDICTED: uncharacterized protein LOC105175472    640   0.0     
emb|CAN63401.1|  hypothetical protein VITISV_024545                     615   0.0     Vitis vinifera
ref|XP_010646865.1|  PREDICTED: G-type lectin S-receptor-like ser...    615   0.0     
ref|XP_009775470.1|  PREDICTED: G-type lectin S-receptor-like ser...    614   0.0     
ref|XP_010644282.1|  PREDICTED: G-type lectin S-receptor-like ser...    625   0.0     
ref|XP_010927986.1|  PREDICTED: G-type lectin S-receptor-like ser...    612   0.0     
emb|CDY34838.1|  BnaA09g47640D                                          640   0.0     
ref|XP_004237185.1|  PREDICTED: G-type lectin S-receptor-like ser...    612   0.0     
gb|KDP38978.1|  hypothetical protein JCGZ_00735                         611   0.0     
sp|Q9SXB5.1|Y1135_ARATH  RecName: Full=G-type lectin S-receptor-l...    611   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446560.1|  PREDICTED: uncharacterized protein LOC103489252    635   0.0     
ref|XP_008235406.1|  PREDICTED: G-type lectin S-receptor-like ser...    612   0.0     
ref|XP_003532567.1|  PREDICTED: G-type lectin S-receptor-like ser...    612   0.0     
ref|XP_010458518.1|  PREDICTED: G-type lectin S-receptor-like ser...    611   0.0     
ref|XP_006417366.1|  hypothetical protein EUTSA_v10006785mg             612   0.0     
ref|XP_010665847.1|  PREDICTED: G-type lectin S-receptor-like ser...    611   0.0     
ref|XP_007159227.1|  hypothetical protein PHAVU_002G219900g             611   0.0     
ref|XP_007021383.1|  S-locus lectin protein kinase family protein       610   0.0     
ref|XP_008653201.1|  PREDICTED: G-type lectin S-receptor-like ser...    612   0.0     
ref|XP_008803876.1|  PREDICTED: G-type lectin S-receptor-like ser...    633   0.0     
ref|XP_006449167.1|  hypothetical protein CICLE_v10014259mg             610   0.0     
ref|XP_010247751.1|  PREDICTED: G-type lectin S-receptor-like ser...    610   0.0     
ref|XP_010240986.1|  PREDICTED: G-type lectin S-receptor-like ser...    609   0.0     
ref|XP_009402881.1|  PREDICTED: receptor-like serine/threonine-pr...    609   0.0     
emb|CAA18703.1|  putative serine/threonine kinase (fragment)            603   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448592.1|  hypothetical protein SORBIDRAFT_06g029770          607   0.0     Sorghum bicolor [broomcorn]
ref|XP_009397154.1|  PREDICTED: receptor-like serine/threonine-pr...    607   0.0     
ref|XP_007021381.1|  S-locus lectin protein kinase family protein       627   0.0     
ref|XP_010268934.1|  PREDICTED: receptor-like serine/threonine-pr...    607   0.0     
ref|XP_007021134.1|  S-locus lectin protein kinase family protein...    606   0.0     
ref|XP_009118498.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    631   0.0     
ref|XP_009133046.1|  PREDICTED: G-type lectin S-receptor-like ser...    605   0.0     
ref|XP_002316694.2|  hypothetical protein POPTR_0011s03600g             607   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010040817.1|  PREDICTED: receptor-like serine/threonine-pr...    607   0.0     
ref|XP_010054457.1|  PREDICTED: G-type lectin S-receptor-like ser...    613   0.0     
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                   605   0.0     
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg             605   0.0     
ref|XP_009402882.1|  PREDICTED: receptor-like serine/threonine-pr...    605   0.0     
ref|XP_007214638.1|  hypothetical protein PRUPE_ppa001615mg             603   0.0     
emb|CDY19355.1|  BnaC05g08640D                                          605   0.0     
ref|XP_010240989.1|  PREDICTED: G-type lectin S-receptor-like ser...    604   0.0     
ref|XP_010501429.1|  PREDICTED: G-type lectin S-receptor-like ser...    627   0.0     
gb|KHG05572.1|  hypothetical protein F383_31410                         604   0.0     
ref|XP_002518601.1|  S-locus-specific glycoprotein S6 precursor, ...    604   0.0     Ricinus communis
ref|XP_011096223.1|  PREDICTED: G-type lectin S-receptor-like ser...    620   0.0     
ref|XP_007025866.1|  S-locus-specific glycoprotein S6, putative         603   0.0     
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    629   0.0     
gb|KDP38975.1|  hypothetical protein JCGZ_00732                         602   0.0     
gb|KCW84809.1|  hypothetical protein EUGRSUZ_B01614                     601   0.0     
ref|XP_008668820.1|  PREDICTED: receptor-like serine/threonine-pr...    602   0.0     
ref|XP_009775463.1|  PREDICTED: G-type lectin S-receptor-like ser...    602   0.0     
gb|KHN19085.1|  G-type lectin S-receptor-like serine/threonine-pr...    602   0.0     
gb|KCW84813.1|  hypothetical protein EUGRSUZ_B01621                     602   0.0     
ref|XP_011009803.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    629   0.0     
emb|CAN70167.1|  hypothetical protein VITISV_024703                     600   0.0     
ref|XP_002304971.2|  hypothetical protein POPTR_0004s02820g             601   0.0     
gb|KDP20843.1|  hypothetical protein JCGZ_21314                         601   0.0     
ref|XP_008235409.1|  PREDICTED: G-type lectin S-receptor-like ser...    600   0.0     
ref|XP_009768621.1|  PREDICTED: receptor-like serine/threonine-pr...    602   0.0     
ref|XP_008383964.1|  PREDICTED: G-type lectin S-receptor-like ser...    600   0.0     
ref|XP_011096175.1|  PREDICTED: G-type lectin S-receptor-like ser...    599   0.0     
ref|XP_011011563.1|  PREDICTED: G-type lectin S-receptor-like ser...    596   0.0     
ref|XP_002534316.1|  S-locus-specific glycoprotein S6 precursor, ...    598   0.0     
gb|KDO75653.1|  hypothetical protein CISIN_1g003237mg                   598   0.0     
ref|XP_010059623.1|  PREDICTED: G-type lectin S-receptor-like ser...    606   0.0     
ref|XP_010684167.1|  PREDICTED: G-type lectin S-receptor-like ser...    598   0.0     
ref|NP_172597.2|  protein EGM1                                          621   0.0     
ref|XP_004146630.1|  PREDICTED: G-type lectin S-receptor-like ser...    598   0.0     
ref|XP_007021378.1|  S-locus lectin protein kinase family protein...    595   0.0     
ref|XP_011029380.1|  PREDICTED: G-type lectin S-receptor-like ser...    597   0.0     
ref|XP_008363254.1|  PREDICTED: G-type lectin S-receptor-like ser...    598   0.0     
emb|CDY34652.1|  BnaC08g42110D                                          606   0.0     
ref|XP_010247744.1|  PREDICTED: G-type lectin S-receptor-like ser...    597   0.0     
ref|XP_010064914.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    604   0.0     
ref|XP_006383983.1|  hypothetical protein POPTR_0004s02820g             597   0.0     
ref|XP_006576562.1|  PREDICTED: G-type lectin S-receptor-like ser...    597   0.0     
ref|XP_009406495.1|  PREDICTED: receptor-like serine/threonine-pr...    597   0.0     
ref|XP_009760633.1|  PREDICTED: G-type lectin S-receptor-like ser...    597   0.0     
ref|XP_006658677.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_009417412.1|  PREDICTED: receptor-like serine/threonine-pr...    620   0.0     
ref|XP_003593409.1|  Serine/threonine protein kinase                    597   0.0     
ref|XP_007021124.1|  S-locus lectin protein kinase family protein...    596   0.0     
ref|XP_009355540.1|  PREDICTED: G-type lectin S-receptor-like ser...    596   0.0     
ref|XP_007025867.1|  S-locus-specific glycoprotein S6, putative         596   0.0     
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881    620   0.0     
ref|XP_011008144.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    627   0.0     
gb|AAM94304.1|  receptor-like kinase                                    595   0.0     
ref|XP_006417369.1|  hypothetical protein EUTSA_v10009404mg             595   0.0     
ref|XP_002528889.1|  ATP binding protein, putative                      617   0.0     
ref|XP_010316641.1|  PREDICTED: G-type lectin S-receptor-like ser...    595   0.0     
ref|XP_010928178.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_006370371.1|  S-locus protein kinase                             594   0.0     
ref|XP_006594796.1|  PREDICTED: G-type lectin S-receptor-like ser...    594   0.0     
ref|XP_010054453.1|  PREDICTED: uncharacterized protein LOC104442758    618   0.0     
ref|XP_003634654.2|  PREDICTED: receptor-like serine/threonine-pr...    593   0.0     
ref|XP_006355085.1|  PREDICTED: uncharacterized protein LOC102588603    617   0.0     
ref|XP_004978260.1|  PREDICTED: receptor-like serine/threonine-pr...    593   0.0     
ref|XP_010247456.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_007025876.1|  S-locus lectin protein kinase family protein       592   0.0     
ref|XP_009355538.1|  PREDICTED: G-type lectin S-receptor-like ser...    592   0.0     
ref|XP_009148780.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    617   0.0     
ref|XP_009775117.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_006370367.1|  hypothetical protein POPTR_0001s42020g             592   0.0     
dbj|BAK00132.1|  predicted protein                                      593   0.0     
ref|XP_009775118.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_009775116.1|  PREDICTED: G-type lectin S-receptor-like ser...    593   0.0     
ref|XP_009119925.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    592   0.0     
ref|XP_008226744.1|  PREDICTED: G-type lectin S-receptor-like ser...    591   0.0     
ref|XP_008364109.1|  PREDICTED: receptor-like serine/threonine-pr...    593   0.0     
gb|KHN36756.1|  G-type lectin S-receptor-like serine/threonine-pr...    592   0.0     
ref|XP_010111027.1|  G-type lectin S-receptor-like serine/threoni...    597   0.0     
ref|XP_009622070.1|  PREDICTED: G-type lectin S-receptor-like ser...    592   0.0     
ref|XP_009355004.1|  PREDICTED: G-type lectin S-receptor-like ser...    591   0.0     
ref|XP_009622069.1|  PREDICTED: G-type lectin S-receptor-like ser...    592   0.0     
ref|XP_009622068.1|  PREDICTED: G-type lectin S-receptor-like ser...    591   0.0     
emb|CAN77004.1|  hypothetical protein VITISV_027305                     590   0.0     
gb|EEE67374.1|  hypothetical protein OsJ_24675                          590   0.0     
emb|CAE02985.2|  OSJNBa0043L09.4                                        590   0.0     
ref|XP_010057544.1|  PREDICTED: G-type lectin S-receptor-like ser...    590   0.0     
dbj|BAJ93270.1|  predicted protein                                      590   0.0     
ref|XP_002518599.1|  S-locus-specific glycoprotein S6 precursor, ...    589   0.0     
ref|XP_009355541.1|  PREDICTED: G-type lectin S-receptor-like ser...    589   0.0     
emb|CDY67672.1|  BnaCnng55880D                                          590   0.0     
ref|XP_007134101.1|  hypothetical protein PHAVU_010G018900g             589   0.0     
emb|CAH67718.1|  H0613A10.1                                             588   0.0     
ref|XP_009612738.1|  PREDICTED: receptor-like serine/threonine-pr...    589   0.0     
ref|XP_004158056.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    588   0.0     
emb|CAE02982.2|  OSJNBa0043L09.1                                        588   0.0     
ref|XP_007134100.1|  hypothetical protein PHAVU_010G018900g             588   0.0     
ref|XP_010111023.1|  G-type lectin S-receptor-like serine/threoni...    588   0.0     
ref|XP_007025863.1|  S-locus-specific glycoprotein S6                   588   0.0     
ref|XP_007213469.1|  hypothetical protein PRUPE_ppa023906mg             586   0.0     
ref|XP_010656038.1|  PREDICTED: G-type lectin S-receptor-like ser...    609   0.0     
gb|EYU27875.1|  hypothetical protein MIMGU_mgv1a001357mg                587   0.0     
ref|XP_006452189.1|  hypothetical protein CICLE_v10007468mg             587   0.0     
ref|XP_009609145.1|  PREDICTED: G-type lectin S-receptor-like ser...    587   0.0     
ref|XP_010644287.1|  PREDICTED: G-type lectin S-receptor-like ser...    586   0.0     
ref|XP_010317453.1|  PREDICTED: G-type lectin S-receptor-like ser...    587   0.0     
ref|XP_007025879.1|  S-locus lectin protein kinase family protein...    586   0.0     
ref|XP_011003375.1|  PREDICTED: G-type lectin S-receptor-like ser...    586   0.0     
ref|XP_010111024.1|  G-type lectin S-receptor-like serine/threoni...    587   0.0     
ref|XP_004234263.1|  PREDICTED: G-type lectin S-receptor-like ser...    586   0.0     
ref|XP_009799574.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    586   0.0     
ref|XP_009345819.1|  PREDICTED: receptor-like serine/threonine-pr...    586   0.0     
ref|XP_011014316.1|  PREDICTED: G-type lectin S-receptor-like ser...    585   0.0     
gb|KDP34761.1|  hypothetical protein JCGZ_10541                         585   0.0     
ref|XP_010644286.1|  PREDICTED: G-type lectin S-receptor-like ser...    584   0.0     
ref|XP_008226746.1|  PREDICTED: G-type lectin S-receptor-like ser...    584   0.0     
ref|XP_002889866.1|  hypothetical protein ARALYDRAFT_471279             585   0.0     
ref|XP_009369833.1|  PREDICTED: G-type lectin S-receptor-like ser...    585   0.0     
ref|XP_006468224.1|  PREDICTED: uncharacterized protein LOC102627899    608   0.0     
gb|KCW58376.1|  hypothetical protein EUGRSUZ_H01060                     583   0.0     
ref|XP_009628971.1|  PREDICTED: G-type lectin S-receptor-like ser...    583   0.0     
ref|XP_009609149.1|  PREDICTED: receptor-like serine/threonine-pr...    582   0.0     
ref|XP_010040818.1|  PREDICTED: uncharacterized protein LOC104429679    606   0.0     
ref|XP_009609150.1|  PREDICTED: G-type lectin S-receptor-like ser...    581   0.0     
ref|XP_008671072.1|  PREDICTED: receptor-like serine/threonine-pr...    582   0.0     
ref|XP_010644274.1|  PREDICTED: receptor-like serine/threonine-pr...    603   0.0     
ref|XP_008225012.1|  PREDICTED: uncharacterized protein LOC103324693    608   0.0     
ref|XP_010665762.1|  PREDICTED: G-type lectin S-receptor-like ser...    582   0.0     
ref|XP_010553422.1|  PREDICTED: G-type lectin S-receptor-like ser...    582   0.0     
gb|KDP20853.1|  hypothetical protein JCGZ_21324                         582   0.0     
ref|XP_002886546.1|  S-locus lectin protein kinase family protein       580   0.0     
ref|XP_007214794.1|  hypothetical protein PRUPE_ppa014934mg             580   0.0     
ref|XP_008232167.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    581   0.0     
gb|KCW84530.1|  hypothetical protein EUGRSUZ_B01365                     579   0.0     
ref|XP_007025873.1|  Receptor kinase 3 isoform 1                        580   0.0     
emb|CDY50228.1|  BnaC08g14760D                                          577   0.0     
ref|XP_009361851.1|  PREDICTED: G-type lectin S-receptor-like ser...    580   0.0     
ref|XP_010476054.1|  PREDICTED: G-type lectin S-receptor-like ser...    580   0.0     
ref|XP_010059656.1|  PREDICTED: G-type lectin S-receptor-like ser...    588   0.0     
ref|XP_010064869.1|  PREDICTED: G-type lectin S-receptor-like ser...    579   0.0     
emb|CDY34651.1|  BnaC08g42100D                                          594   0.0     
emb|CDY35354.1|  BnaA04g14930D                                          579   0.0     
ref|XP_009377301.1|  PREDICTED: G-type lectin S-receptor-like ser...    578   0.0     
gb|KGN49169.1|  hypothetical protein Csa_6G516770                       575   0.0     
ref|XP_008441725.1|  PREDICTED: G-type lectin S-receptor-like ser...    579   0.0     
ref|XP_007212862.1|  hypothetical protein PRUPE_ppa021546mg             578   0.0     
ref|XP_010665856.1|  PREDICTED: G-type lectin S-receptor-like ser...    600   0.0     
ref|XP_011086149.1|  PREDICTED: G-type lectin S-receptor-like ser...    578   0.0     
ref|XP_011002465.1|  PREDICTED: G-type lectin S-receptor-like ser...    578   0.0     
ref|XP_007021195.1|  S-locus lectin protein kinase family protein...    587   0.0     
ref|XP_004976939.1|  PREDICTED: receptor-like serine/threonine-pr...    578   0.0     
gb|KHN45738.1|  G-type lectin S-receptor-like serine/threonine-pr...    577   0.0     
gb|KHN45740.1|  Receptor-like serine/threonine-protein kinase SD1-8     578   0.0     
ref|XP_003593412.1|  Serine/threonine protein kinase                    578   0.0     
ref|XP_004976938.1|  PREDICTED: receptor-like serine/threonine-pr...    578   0.0     
ref|XP_010059458.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    600   0.0     
ref|XP_010112094.1|  G-type lectin S-receptor-like serine/threoni...    577   0.0     
ref|XP_002316693.1|  hypothetical protein POPTR_0011s03620g             576   0.0     
ref|XP_006392006.1|  hypothetical protein EUTSA_v10023284mg             576   0.0     
ref|XP_008392323.1|  PREDICTED: G-type lectin S-receptor-like ser...    577   0.0     
ref|XP_010247749.1|  PREDICTED: G-type lectin S-receptor-like ser...    577   0.0     
ref|XP_010665760.1|  PREDICTED: receptor-like serine/threonine-pr...    578   0.0     
ref|XP_010106354.1|  G-type lectin S-receptor-like serine/threoni...    576   0.0     
gb|AAF16650.1|AC011661_28  T23J18.2                                     576   0.0     
ref|XP_010458531.1|  PREDICTED: G-type lectin S-receptor-like ser...    576   0.0     
ref|XP_006306761.1|  hypothetical protein CARUB_v10008301mg             576   0.0     
ref|XP_011008153.1|  PREDICTED: G-type lectin S-receptor-like ser...    576   0.0     
ref|XP_009613917.1|  PREDICTED: G-type lectin S-receptor-like ser...    575   0.0     
ref|XP_011008156.1|  PREDICTED: G-type lectin S-receptor-like ser...    576   0.0     
ref|XP_011087025.1|  PREDICTED: uncharacterized protein LOC105168588    599   0.0     
ref|XP_009355686.1|  PREDICTED: G-type lectin S-receptor-like ser...    575   0.0     
gb|KFK40716.1|  hypothetical protein AALP_AA2G031600                    574   0.0     
ref|XP_006370403.1|  hypothetical protein POPTR_0001s42280g             574   0.0     
sp|Q9ZT07.3|RKS1_ARATH  RecName: Full=G-type lectin S-receptor-li...    575   0.0     
ref|XP_009371703.1|  PREDICTED: G-type lectin S-receptor-like ser...    574   0.0     
ref|XP_009768622.1|  PREDICTED: G-type lectin S-receptor-like ser...    574   0.0     
ref|XP_010052484.1|  PREDICTED: receptor-like serine/threonine-pr...    575   0.0     
gb|EYU36707.1|  hypothetical protein MIMGU_mgv1a001407mg                574   0.0     
ref|XP_004295392.1|  PREDICTED: G-type lectin S-receptor-like ser...    574   0.0     
ref|XP_009113129.1|  PREDICTED: G-type lectin S-receptor-like ser...    573   0.0     
ref|XP_002299160.2|  hypothetical protein POPTR_0001s01730g             573   0.0     
ref|XP_006582219.1|  PREDICTED: G-type lectin S-receptor-like ser...    573   0.0     
ref|XP_010458539.1|  PREDICTED: G-type lectin S-receptor-like ser...    575   0.0     
gb|EYU19178.1|  hypothetical protein MIMGU_mgv1a020642mg                573   0.0     
ref|XP_010458537.1|  PREDICTED: G-type lectin S-receptor-like ser...    575   0.0     
ref|XP_004485681.1|  PREDICTED: receptor-like serine/threonine-pr...    574   0.0     
dbj|BAD53293.1|  putative serine/threonine kinase                       572   0.0     
ref|NP_172601.2|  G-type lectin S-receptor-like serine/threonine-...    575   0.0     
ref|XP_011002460.1|  PREDICTED: G-type lectin S-receptor-like ser...    573   0.0     
ref|XP_008386058.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
ref|XP_011008155.1|  PREDICTED: G-type lectin S-receptor-like ser...    573   0.0     
ref|XP_007212501.1|  hypothetical protein PRUPE_ppa017634mg             572   0.0     
ref|XP_008364124.1|  PREDICTED: G-type lectin S-receptor-like ser...    573   0.0     
ref|XP_003541760.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
ref|XP_006594644.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
ref|XP_004982563.1|  PREDICTED: receptor-like serine/threonine-pr...    574   0.0     
ref|XP_009148479.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
gb|AAC95352.1|  receptor-like protein kinase                            572   0.0     
ref|XP_010492761.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...    572   0.0     
ref|XP_008386059.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_006370405.1|  hypothetical protein POPTR_0001s42300g             570   0.0     
ref|XP_007148272.1|  hypothetical protein PHAVU_006G194300g             567   0.0     
ref|XP_009611415.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_008347111.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_008226159.1|  PREDICTED: G-type lectin S-receptor-like ser...    577   0.0     
ref|XP_009781340.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
emb|CDX97951.1|  BnaA06g07020D                                          570   0.0     
ref|XP_009620665.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_011009489.1|  PREDICTED: G-type lectin S-receptor-like ser...    571   0.0     
ref|XP_002530266.1|  S-locus-specific glycoprotein S13 precursor,...    569   0.0     
ref|XP_006300737.1|  hypothetical protein CARUB_v10019797mg             570   0.0     
ref|XP_010054468.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    570   0.0     
ref|XP_010060395.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
ref|XP_009148463.1|  PREDICTED: G-type lectin S-receptor-like ser...    570   0.0     
ref|XP_011009488.1|  PREDICTED: G-type lectin S-receptor-like ser...    570   0.0     
ref|XP_008664739.1|  PREDICTED: receptor-like serine/threonine-pr...    571   0.0     
ref|XP_011002478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    592   0.0     
gb|KCW67093.1|  hypothetical protein EUGRSUZ_F00872                     567   0.0     
ref|XP_008813305.1|  PREDICTED: uncharacterized protein LOC103723979    592   0.0     
gb|KDO75649.1|  hypothetical protein CISIN_1g041312mg                   565   0.0     
gb|KEH31162.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    568   0.0     
ref|XP_010087207.1|  G-type lectin S-receptor-like serine/threoni...    569   0.0     
ref|XP_010046030.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
ref|XP_009611414.1|  PREDICTED: G-type lectin S-receptor-like ser...    567   0.0     
ref|XP_011008152.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
ref|XP_011009490.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
gb|EEC78082.1|  hypothetical protein OsI_17558                          567   0.0     
gb|KDP20847.1|  hypothetical protein JCGZ_21318                         568   0.0     
ref|XP_008386061.1|  PREDICTED: G-type lectin S-receptor-like ser...    567   0.0     
ref|NP_001147960.1|  receptor-like kinase precursor                     568   0.0     
ref|XP_006660946.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
ref|XP_011008158.1|  PREDICTED: G-type lectin S-receptor-like ser...    568   0.0     
ref|XP_002447171.1|  hypothetical protein SORBIDRAFT_06g029740          568   0.0     
dbj|BAJ99098.1|  predicted protein                                      566   0.0     



>ref|XP_009769146.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Nicotiana sylvestris]
Length=843

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/829 (60%), Positives = 622/829 (75%), Gaps = 21/829 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D+I  G+ +KD G+NI S    FVLGFFSP G+S RY+GIWY  +  Q+VVWVANR +
Sbjct  26    ADDRITIGEILKD-GDNITSKEGNFVLGFFSPTGSSKRYLGIWYAHVTVQTVVWVANRHK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTD--GWR  2236
             P+ DKNG F I   G  VV +G   S+W +N +V + N+T  L +   L+IL  D    R
Sbjct  85    PVPDKNGTFSIDQIGNLVVKNGHGDSLWLSNVTVATKNSTACLLDNGNLVILNNDKNAAR  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              N  +WQSF  PTDTFLPGMRV  +  + E K+F+SWTN  +PSPGR+S+G+DPR +PQI
Sbjct  145   LNTELWQSFLHPTDTFLPGMRVFVERQSKEHKVFSSWTNESDPSPGRYSLGVDPRGAPQI  204

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP--MRTDFVYGFDLITENDNLYLEYKSSSSDL-IMFK  1891
             VIW+G  R WRSGH+DG  F GVP   R+    GF +  E+   +  Y +S + L + F+
Sbjct  205   VIWDGSDRRWRSGHFDGVEFTGVPNVTRSTLFSGFKINNEDGKSFFTYTASDTSLFVRFQ  264

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G E+QQRW+E ++QW  +Q  P+  C +YN CG FA C         C+C+ GF P
Sbjct  265   IDVTGIELQQRWDEDKEQWSTLQSMPSGVCDLYNFCGNFAECHEQV-----CLCVEGFVP  319

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
                 QW+A N TGGC RRT L+C+K+++      A+ DGF  V  +KLPD+ADI  + ++
Sbjct  320   RVEEQWHAGNRTGGCIRRTELECRKSSSVPRNDNAKDDGFLAVHKVKLPDYADIIADAQN  379

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
              + C+ KC  +CSCNAYA     GI+CM+W  +LVD+ Q +EG G+TL+VRL  SE   K
Sbjct  380   TDTCRTKCLNNCSCNAYA--FVKGINCMIWTEDLVDIEQFEEG-GNTLYVRLDPSEF-GK  435

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFSA  1180
             +++T +I+ VSV+ A+A++V+ ++WL+C  RAR R  KR +EIP+  L  SGEFS+D S 
Sbjct  436   NNRTIVIIIVSVLVALALVVMAAVWLVCRYRARKRESKRINEIPKNHLVRSGEFSADLSG  495

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               DL  EG  G  S+L FFSFS +A ATD F LANKLGQGGFG VYKG LPCGQE+AVKR
Sbjct  496   PGDLNAEGHQGNGSELAFFSFSMVATATDDFCLANKLGQGGFGPVYKGRLPCGQEVAVKR  555

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS+RSGQG +EF NE+T+IAKLQHRNLVRLLGCCIEG+EK+LLYEYMPNKSLD+F+FDPA
Sbjct  556   LSQRSGQGDEEFKNEITLIAKLQHRNLVRLLGCCIEGEEKILLYEYMPNKSLDTFLFDPA  615

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             ++S+L+WRKRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARI
Sbjct  616   RKSQLDWRKRFSIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARI  675

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGGNQNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFG+LLLEI+SGRRNTSFR+D+H
Sbjct  676   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGILLLEIISGRRNTSFRSDEH  735

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
             SGII YAWE+WDEG+PM+L+D SI+  C   E LRCI L +LCVQDLAVHRPNMS+VVL 
Sbjct  736   SGIIGYAWEKWDEGRPMDLVDRSIWDGCQHDEALRCIHLAMLCVQDLAVHRPNMSSVVLM  795

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LETDN+ LP+PR PTYT SMRRSVD D W+ N +LPSSN++T+SV++GR
Sbjct  796   LETDNMRLPLPRQPTYT-SMRRSVDADMWHGNQDLPSSNNVTISVLIGR  843



>ref|XP_009589083.1| PREDICTED: uncharacterized protein LOC104086517 [Nicotiana tomentosiformis]
Length=1703

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/829 (60%), Positives = 623/829 (75%), Gaps = 21/829 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A DKI  G+ +KD G+NI S    FVLGFFSP G+S RY+GIWY ++  Q+VVWVANR +
Sbjct  26    ADDKITIGEILKD-GDNITSKEGNFVLGFFSPTGSSKRYLGIWYADVTVQTVVWVANRHK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTD--GWR  2236
             P+ DKNG F I   G  VV +G   S+W +N +V + N+T  L +   L+IL  D    R
Sbjct  85    PVPDKNGTFLIDQIGNLVVKNGHGDSLWWSNVTVATKNSTACLLDNGNLVILNYDRNAAR  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              N  +WQSF  PTDTFLP M+V +     E K+F+SWTN  +PSPGR+S+G+DPR +PQI
Sbjct  145   LNKELWQSFLHPTDTFLPEMKVFMERQGKERKVFSSWTNESDPSPGRYSLGVDPRGAPQI  204

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP--MRTDFVYGFDLITENDNLYLEYKSS-SSDLIMFK  1891
             VIW+G  R WRSGH+DG  F GVP   R+    GF +  E+D  Y  Y +S +S  + F+
Sbjct  205   VIWDGPNRRWRSGHFDGVEFSGVPNVTRSTLFSGFKINNEDDTSYFTYTASDTSFFVRFQ  264

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +   G E+QQRW+E ++QW  +Q +P+  C +YN CG FA C         C+C+ GF P
Sbjct  265   ITVIGNELQQRWDEDKEQWSTLQSRPSGGCDLYNFCGNFAECHEQV-----CLCVKGFVP  319

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
                 QW+A N TGGC RRT L+C+K++       A+ DGF  V+ +KLPD+ADI  + ++
Sbjct  320   RVEEQWHAGNRTGGCIRRTELECRKSSIVQRNDSAKDDGFVAVQRVKLPDYADIIADAQN  379

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
              + CK KC  +CSCNAYA     GI+CM+W  +LVD+ Q +EG G+TL+VRL  SE+  K
Sbjct  380   TDACKTKCLSNCSCNAYA--FVKGINCMIWTEDLVDIEQFEEG-GNTLYVRLDPSEV-GK  435

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFSA  1180
              ++T II+ +SV+ AVA++V+ ++WL+C  RAR R  KR +EIP+  L  SGEFS+D S 
Sbjct  436   KNRTIIIIIISVLVAVALVVMAAVWLVCRYRARKRESKRINEIPKNHLVRSGEFSADLSG  495

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               DL+ EG  G  S+L FFSFS +A ATD FSLANKLGQGGFG V+KG LPCGQE+AVKR
Sbjct  496   PGDLSAEGHQGNGSELAFFSFSMVAKATDDFSLANKLGQGGFGPVFKGRLPCGQEVAVKR  555

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS++SGQG +EF NE+T+IAKLQHR+LVRLLGCCIEG+EK+LLYEYMPNKSLD+F+FDPA
Sbjct  556   LSQKSGQGDEEFKNEITLIAKLQHRSLVRLLGCCIEGEEKILLYEYMPNKSLDTFLFDPA  615

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             ++S+L+WRKRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARI
Sbjct  616   RKSQLDWRKRFSIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARI  675

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGGNQNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFG+LLLEI+ GRRNTSFR+D+H
Sbjct  676   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGILLLEIICGRRNTSFRSDEH  735

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
             SGII YAWE+WDEG+PM+L+D SI+  C   E LRCI L +LCVQDLAVHRPNMS+VVL 
Sbjct  736   SGIIGYAWEKWDEGRPMDLVDRSIWDGCQHDEALRCIHLAMLCVQDLAVHRPNMSSVVLM  795

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LETDN+ LP+PR PTYT SMRRSVD D W+ N +LPSSN++T+SV++GR
Sbjct  796   LETDNMRLPLPRQPTYT-SMRRSVDADMWHGNQDLPSSNNVTISVLIGR  843


 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/837 (42%), Positives = 497/837 (59%), Gaps = 36/837 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D I Q Q +   G+ + SA++ F LGFFSP  +S RY+GIW+  I P+ VVWVANRE 
Sbjct  885   ASDTILQSQKLLV-GDTLTSASQVFELGFFSPANSSKRYLGIWFKNIPPRKVVWVANRES  943

Query  2409  P--ILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             P  + D   +  I+ NG  V+LDG         + + SSN  +   NT E+++L +    
Sbjct  944   PLNVSDSAASLSISKNGNLVILDG-------VQNVIWSSNVYVPTNNTVEVVLLDSGNLV  996

Query  2235  PNNTI-----WQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPR  2077
               + I     ++SF  P DTFLPGM++  +   GE  L +SW    +PSPG FS+GI  +
Sbjct  997   LKDNISGQCFFESFDYPCDTFLPGMKIGFNRITGERWLLSSWQKESDPSPGNFSIGISDQ  1056

Query  2076  ASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY----GFDLITENDNLYLEYKSSSS  1909
                Q  IW     Y+R+G W+G  F+G+P      Y     F    +    Y  +  ++S
Sbjct  1057  LPSQFFIWNKSTPYYRTGEWNGLKFIGLPYIDSAAYIVQFVFQQDFQQGTAYFTFLPNTS  1116

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L   ++   G     +W +    W    +     C +YN CG  A C  S +    C C
Sbjct  1117  FLTFVELQSTGFVQVVQWTDGAPAWEVYAKMVHPPCDIYNTCGPSAIC--SKNKYPTCSC  1174

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQK--NNTEGGGAEKDGFREVKHIKLPDFADI  1555
             + GF P   ++W+  NWTGGC R+T L CQ+  N T  G  ++DGF +   +KLPD A I
Sbjct  1175  LRGFVPRSSDEWSRGNWTGGCVRQTKLLCQRKGNGTSPGVGQQDGFLKFSGLKLPDLAAI  1234

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
              R + S  +C++ C  +CSC AYA     GI CM+W  +L+DM      SG  LF+RL  
Sbjct  1235  FR-LDSASECERLCLNNCSCTAYA--YVAGIRCMVWSGDLLDMQDYSY-SGEDLFLRLAY  1290

Query  1374  SELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARI--RAKKRDEIPRTELPTSGE  1201
             SEL   S K  +  A+ + AAV   + + I L C  + +I    +K        +  S  
Sbjct  1291  SEL-VFSGKRKLKRALIICAAVLSSLFLGIALYCLLKNKIYQTGQKGKGTISFRIGDSCN  1349

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
              S +++ +       K     +L    F  IAAAT++F + NKLG+GGFG V+KG L  G
Sbjct  1350  ISKEYALESFWVGNLKKEDPIELPLIEFELIAAATNNFKVDNKLGEGGFGPVFKGKLKGG  1409

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             QEIAVKRLS R+GQG++EF NE+ +I+KLQHRNLVRLLGCCIEG+E +++YEYMPN+SLD
Sbjct  1410  QEIAVKRLSNRTGQGIEEFKNEIVLISKLQHRNLVRLLGCCIEGEELLIIYEYMPNRSLD  1469

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
              F+FD +++  L+W KRF+II+ +ARGLLYLHRDS L IIHRDLK SNILLD EMNPKIS
Sbjct  1470  KFLFDTSQKELLDWPKRFNIIQGVARGLLYLHRDSCLNIIHRDLKVSNILLDEEMNPKIS  1529

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFG+AR F   Q   +T+RV GTYGYM+PEYA+ G+FS KSDV+SFGVLLLEI+SG++N+
Sbjct  1530  DFGLARTFQKQQQLVHTHRVAGTYGYMSPEYALRGVFSEKSDVFSFGVLLLEIISGKKNS  1589

Query  480   SFR-TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             SF   +++  ++ YAW+ W E   ++ +D  + +S  P+E+ RC+ +GLLCVQ+    RP
Sbjct  1590  SFHYVEENLNLLNYAWKLWSEESGLDFMDGILINSFSPEEITRCLHVGLLCVQECPRDRP  1649

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              M+A++L L ++ +    P+ PT+       +D+    ++N+  S N ++ S+  GR
Sbjct  1650  TMAAIILMLNSE-MKCSTPKQPTF--KFETYLDLACSAKDNDKCSVNEVSASLSQGR  1703



>ref|XP_010317324.1| PREDICTED: uncharacterized protein LOC101264093 [Solanum lycopersicum]
Length=1668

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/829 (60%), Positives = 621/829 (75%), Gaps = 23/829 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D++  G+ I  DG+N+ S    FVLGFFSP GTS RY+GIWY +I  ++ +WVANR +
Sbjct  853   GGDRVTLGE-IYKDGDNLTSKGGDFVLGFFSPAGTSKRYLGIWYVDIPVKTYIWVANRNK  911

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTD--GWR  2236
              + DKNG F I   G  VV DG    +W++N SV + N+T  LR+   L+IL  D    R
Sbjct  912   LVHDKNGTFSIDTIGNLVVKDGNGDLLWSSNVSVQTRNSTACLRDDGNLVILNNDRDAAR  971

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDLS-AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              N+ +W+SF  PTDT++PGM V +   GE K+F SWTN  +PSPGR+SMG+DPR +PQI+
Sbjct  972   LNSELWESFSDPTDTYVPGMEVLIERQGEQKVFRSWTNESDPSPGRYSMGVDPRGTPQII  1031

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP--MRTDFVYGFDLITENDN-LYLEYKSS-SSDLIMFK  1891
             IW+G  R WRSGH+DG  F+GVP  +RT+F  GF ++ E DN L L Y +S +S  + F+
Sbjct  1032  IWDGPNRRWRSGHFDGAEFIGVPDVIRTNFFSGFRILNEGDNKLLLTYSASNTSSFLRFQ  1091

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +   G E+QQRWNE   +W  +Q +P   C +YN CG F+ C+        C C+ GF P
Sbjct  1092  LTVTGNELQQRWNEDEGEWNTLQSRPVGGCDLYNFCGNFSECNKEV-----CQCLEGFVP  1146

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
             S   +W+A N TGGC R+T L+C+KN++      ++ DGF  ++ +KLPD AD+     S
Sbjct  1147  SVQEEWHAGNRTGGCVRKTELECRKNSSVSRNDSSKDDGFSTIRRVKLPDHADVAE--IS  1204

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
              E+CK KC  DCSCN YA     GI+CM+WR++LVD+   +EG G+TL+VRLH S++  K
Sbjct  1205  TEECKIKCLNDCSCNGYAHVR--GINCMVWRDDLVDIEHFEEG-GNTLYVRLHPSDI-GK  1260

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFSA  1180
               KT IIV +S++AA+A++V+V+IWL+C  RAR R  KR  EIP+  L  SGEFS ++S 
Sbjct  1261  KKKTIIIVVISILAALALVVMVAIWLVCKYRARKRESKRTSEIPKNHLVRSGEFSMEYSG  1320

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               D++ EG  G  S+L FFSFS +A ATD FSLANKLGQGGFG VYKG LPCGQE+AVKR
Sbjct  1321  PGDISAEGHQGNGSELAFFSFSMVATATDDFSLANKLGQGGFGPVYKGKLPCGQEVAVKR  1380

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS++SGQG +EF NE+T+IAKLQHRNLVRLLGCC+EG+EKML+YEYMPNKSLD+F+FD A
Sbjct  1381  LSQKSGQGDEEFKNEITLIAKLQHRNLVRLLGCCVEGEEKMLIYEYMPNKSLDTFLFDTA  1440

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             ++S L+WRKRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EM PKISDFGMARI
Sbjct  1441  RKSLLDWRKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMTPKISDFGMARI  1500

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGGNQNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFG++LLEI+ GRRNTSFRTD+H
Sbjct  1501  FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGIILLEIICGRRNTSFRTDEH  1560

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
             SGII YAWE+WDEG+PM+L+D SI+  C   E LRCI L LLCVQDLA HRPNMS+VVL 
Sbjct  1561  SGIIGYAWEKWDEGRPMDLVDRSIWDGCQHNEALRCIHLALLCVQDLAAHRPNMSSVVLM  1620

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LETDNV LP+PR PTYT SMRRSVD D W+ N +L SSN++T+SV++GR
Sbjct  1621  LETDNVRLPLPRQPTYT-SMRRSVDEDIWHGNQDLTSSNNVTVSVLIGR  1668


 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/802 (43%), Positives = 487/802 (61%), Gaps = 35/802 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQ-SVVWVANRE  2413
             A+D I   + ++D G  + S+ ++F LGFFSP  ++NRYVGI +N   P  + VWVANR+
Sbjct  23    ASDIITSSEPLRDSG-TVFSSGKRFKLGFFSPGNSANRYVGIMFNLPSPTPTAVWVANRD  81

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             +PI D +G   ++ +G  V+L+G    IW+++ S +  N+T  L +T  L++  +   + 
Sbjct  82    KPINDSSGLLTLSEDGNLVILNGLKEIIWSSSISNSMKNSTAQLLDTGNLVLKDSSNGK-  140

Query  2232  NNTIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +W+SF  PTD+ L  M+  +D S   + L  SW +  +PS G FS GI  +  PQ  
Sbjct  141   --VLWESFQYPTDSLLQLMKMGIDKSTNSTALLKSWRSPDDPSVGSFSAGIQLQYIPQAF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEN-DNLYLEYKSSSSDLIMF-KV  1888
             IW     YWR+  WD ++++G+P M++ +  G +L+ +N    Y  Y + +   I++  +
Sbjct  199   IWNNTVPYWRTSPWDKQIYIGIPEMKSSYRSGVELVADNAGTAYQTYSNGNQSWILYYSL  258

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             +  G   ++ W++S+K W+     P  +C +Y  CG F  C+  SS    C CI GF P 
Sbjct  259   NSTGSYQEKVWDQSKKDWVVTWANPRSECDIYAKCGAFGSCNPKSSP--ICSCIQGFKPK  316

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +W    W+GGC RRT L C++N T+    +KDGF +++ + +PDF        S   
Sbjct  317   NEGEWEKGEWSGGCIRRTALDCERNKTDVETGKKDGFLKMQTMGVPDFVI----WVSSAK  372

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
                + +   +C+  A     GI CM W   L+D+ +      + LF+RL  SEL     K
Sbjct  373   EDCESDCLSNCSCMAYSYYTGIGCMHWNRSLIDIQEYSMDGAADLFIRLAYSELAANDKK  432

Query  1347  ----TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPT---SGEFSSD  1189
                   I + VS+ + + +L     W L ++  R R +K +   R   P    +G    D
Sbjct  433   DFPVAAIAITVSIGSIIVILCGYLFWKLLAKH-RERKRKSEAFLREASPKCYQNGMIKDD  491

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              +    + +E       D+  +SF  +A ATD F  A+KLGQGGFG VYKG LP GQEIA
Sbjct  492   IN---QVKIE-------DITLYSFDMLATATDRFHSASKLGQGGFGPVYKGKLPDGQEIA  541

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLS  SGQG+QEF NE+ VI++LQHRNLVRLLGCC E  EK+L+Y++MPN+SLD+++F
Sbjct  542   VKRLSHSSGQGLQEFMNEVVVISRLQHRNLVRLLGCCTERGEKILVYDFMPNRSLDAYLF  601

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
                +   L+W KR  IIE   RGLLYLHRDSRLRIIHRDLKASNILLD  +NPKISDFGM
Sbjct  602   GSHQEKFLDWSKRAIIIEGTGRGLLYLHRDSRLRIIHRDLKASNILLDEYLNPKISDFGM  661

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGGNQ++A T RVVGTYGYMAPEYAM G FS KSDVYSFGVL+LEIVSGR+N+SF  
Sbjct  662   ARIFGGNQDQARTIRVVGTYGYMAPEYAMHGRFSEKSDVYSFGVLILEIVSGRKNSSFYD  721

Query  468   DDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
             D+    ++ YAW+ W+E   + L+DP IF S   ++++RC+ +G LCVQ+ A  RPN+S+
Sbjct  722   DEGELTLLAYAWKLWNENNIIKLIDPKIFDSSFEKQMVRCVHIGFLCVQEYAEDRPNVSS  781

Query  291   VVLFLETDNVTLPVPRPPTYTA  226
             V+  L +D   L  P+ P +T 
Sbjct  782   VLSMLTSDMAELSTPKQPAFTG  803



>ref|XP_006347190.1| PREDICTED: uncharacterized protein LOC102586591 [Solanum tuberosum]
Length=1665

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/829 (60%), Positives = 619/829 (75%), Gaps = 24/829 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D++ +G+ I  DG+NI S    FVLGFFSP  TS RY+GIWY ++  ++ +WVANR  
Sbjct  27    GGDRVTRGE-IYKDGDNITSKGGDFVLGFFSPANTSKRYLGIWYVDVPVKTYIWVANRNN  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTD--GWR  2236
             P+ DKNG F I  NG  VV DG    +W++N SV ++N+T  LR+   L+IL  D    R
Sbjct  86    PVHDKNGTFSINENGNLVVKDGHGDLLWSSNVSVKTTNSTACLRDEGNLVILNNDRNATR  145

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              N+ +W+SF  PTDTFLPGM V  +    E K+F SWTN  +PSPGR+SMG+DPR +PQI
Sbjct  146   LNSELWESFSDPTDTFLPGMEVLIERQGQEQKVFRSWTNESDPSPGRYSMGVDPRGTPQI  205

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP--MRTDFVYGFDLITENDN-LYLEYKSS-SSDLIMF  1894
             VIW+G  R WRSGH+DG  F+GVP  +RT F  GF +  E DN L L Y +S +S  + F
Sbjct  206   VIWDGPNRRWRSGHFDGAEFIGVPDVIRTTFFSGFRIQNEGDNKLLLTYSASNTSSFVRF  265

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
             ++   G E+QQRWNE + +W  +Q +P   C +YN CG FA CD        C C+ GF 
Sbjct  266   QITVTGNELQQRWNEDQGEWNTLQSRPVGGCDLYNFCGNFAECDKDV-----CQCLKGFV  320

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             P    QW+A N T GC R+T L+C++N++      ++ DGF  ++ +KLPD A++     
Sbjct  321   PRVQEQWHAGNRTEGCVRKTELECRRNSSVSRNDSSKDDGFSTIRRVKLPDHANVSE--I  378

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
             + ++CK +C  DCSCNAYA     GI+CM+WRN+LVD+    EG G+TL+VRLH S++  
Sbjct  379   TIDECKIRCLNDCSCNAYA--YVRGINCMMWRNDLVDIEHFQEG-GNTLYVRLHPSDI-G  434

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFS  1183
             K  KT IIV +S++AA+A++V+V+IWL+C  RAR R  KR  EIP+  L  SGEFS+++S
Sbjct  435   KKKKTIIIVVISILAALALVVMVAIWLVCKYRARKRESKRTSEIPKNHLVRSGEFSTEYS  494

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
                D++ EG  G  S+L FFSFS +A ATD FSLANKLGQGGFG VYKG LPCGQE+AVK
Sbjct  495   GPGDISAEGHQGNGSELAFFSFSMVATATDDFSLANKLGQGGFGPVYKGKLPCGQEVAVK  554

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS++SGQG +EF NE+T+IAKLQHRNLVRLLGCC+EG+EKML+YEYMPNKSLD+F+FD 
Sbjct  555   RLSQKSGQGDEEFKNEITLIAKLQHRNLVRLLGCCVEGEEKMLIYEYMPNKSLDTFLFDT  614

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
              ++S+L+WRKRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EM PKISDFGMAR
Sbjct  615   VRKSQLDWRKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMTPKISDFGMAR  674

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFG++LLEI+ GRRNTSFRTD+
Sbjct  675   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGIILLEIICGRRNTSFRTDE  734

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             HSGII YAWE+W+EG+PM+L+D SI+  C   E LRCI L LLCVQDLA HRPNMS+VVL
Sbjct  735   HSGIIGYAWEKWEEGRPMDLVDRSIWDGCQHNEALRCIHLALLCVQDLAAHRPNMSSVVL  794

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVG  136
              LETDNV LP+PR PTYT SMRRSVD D W+ N ++ SSN++T+SV++G
Sbjct  795   MLETDNVRLPLPRQPTYT-SMRRSVDEDIWHGNQDVTSSNNVTVSVLIG  842


 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/831 (42%), Positives = 489/831 (59%), Gaps = 24/831 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D IQQ  W    GE + SA++ F  GFF+P  +  RY+GIW+  I P  VVWVANRE 
Sbjct  847   ASDTIQQ-SWKLLVGETLTSASQVFEFGFFTPANSDERYLGIWFKNIPPIKVVWVANRES  905

Query  2409  P--ILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             P  + D   +  I+  G  V+LDG    IW++N SV ++N   V+   S  ++LK +   
Sbjct  906   PLKVSDSAVSLSISEYGNLVLLDGTQTVIWSSNVSVPTNNTVAVVLLDSGNLVLKDN--V  963

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
                + W+SF  P DTFLPGM++  ++  GE  L +SW    +PS G FS+GI  + SPQ 
Sbjct  964   SGQSFWESFDYPCDTFLPGMKIGFNSKTGEKWLLSSWQKENDPSLGNFSIGISEQLSPQF  1023

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND----NLYLEYKSSSSDLIMF  1894
              IW     Y+R+G W+G  F+G+P      Y    + + D      Y  +  ++S L   
Sbjct  1024  FIWNKVTPYYRTGEWNGLKFIGLPCIDSAAYIIQFVFQQDFQEGTTYFTFLPNTSFLTFV  1083

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
             ++   G     +W      W          C +YN CG  A C  S  N   C C+ GF 
Sbjct  1084  ELQSTGSVQVVQWTSGAPAWEIYATMVHAPCDIYNTCGPSAVC--SKHNFPTCSCLRGFV  1141

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQK--NNTEGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             P   ++W+  NWTGGC RRT L CQ+  N+   G   +D F ++  +KLPD A I R + 
Sbjct  1142  PHSSDEWSKGNWTGGCVRRTELLCQQKGNSLSPGVGLQDRFFKLSGLKLPDLAAIFR-LD  1200

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD-  1363
             S  +C+K C  +CSC AYA     GI CM+W  +L+DM      SG  LF+RL  SEL  
Sbjct  1201  SASECEKLCLNNCSCTAYA--YVAGIRCMVWSGDLLDMQDYSY-SGEDLFLRLAYSELVF  1257

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFS  1183
             +   K    + +       + +  +++ L   +  I  +KR       L  S   S D++
Sbjct  1258  SGKRKRKRALIICSAVFSCLFLGFALFCLLKHKIYITGQKRKVARSFSLGDSCYISKDYT  1317

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
              +       K     +L    F  I  AT++F + NKLG+GGFG V+KG L  G EIAVK
Sbjct  1318  VESLWVGNLKKEDPIELPLIEFEVIVTATNNFKVENKLGEGGFGPVFKGKLKDGPEIAVK  1377

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS R+GQG++EF NE+ +I+KLQHRNLVRLLGCCIEG+E +++YEYMPN+SLD  +FD 
Sbjct  1378  RLSNRTGQGIEEFKNEIVLISKLQHRNLVRLLGCCIEGEELLIIYEYMPNRSLDKSLFDA  1437

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             +++  L+W KRF+II+ +ARGLLYLHRDS L IIHRDLK SNILLD EMNPKISDFG+AR
Sbjct  1438  SQKELLDWPKRFNIIQGVARGLLYLHRDSCLNIIHRDLKVSNILLDEEMNPKISDFGLAR  1497

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR-TD  466
              F   Q   +T+RV GTYGYM+PEYA+ G+FS KSDV+SFGVLLLEI+SG++N+SF   +
Sbjct  1498  TFQKQQQLVHTHRVAGTYGYMSPEYALRGVFSEKSDVFSFGVLLLEIISGKKNSSFHYVE  1557

Query  465   DHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
             ++  ++ YAW+ W E K ++ +D ++ +S  P+E+ RC+ +GLLCVQ+    RP M+ ++
Sbjct  1558  ENLNLLNYAWKLWSEQKGLDFMDGTLINSFSPEEITRCLHVGLLCVQEHPRDRPTMADII  1617

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             L L ++ +    P+ PT+       +D+    ++NE  S N ++ S+  GR
Sbjct  1618  LILNSE-MKCSSPKQPTF--KFETYLDLGGSAKDNERCSVNELSASLSQGR  1665



>ref|XP_009782161.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Nicotiana sylvestris]
Length=832

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/825 (60%), Positives = 610/825 (74%), Gaps = 24/825 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A++KI+QG+ ++D G+NI+S   KF LGFFSP G+  R++GIWY ++   SVVWVANR++
Sbjct  26    ASNKIRQGEILRD-GDNIISPKGKFNLGFFSPNGSKQRFLGIWYADVPVISVVWVANRDK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D+NG F I  NG  VV DG+   +     S V ++N+T+ L +T  L+IL  +    
Sbjct  85    PVSDQNGVFTIEKNGNLVVKDGRGDLLWSTNVSVVETTNSTVSLLDTGNLVILNDN----  140

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             N  +WQSF  PTDTFLP MRV +      +  SWT+  +PSPGR+S+G+DPRASPQIVIW
Sbjct  141   NKDLWQSFQHPTDTFLPEMRVYMDG----VLRSWTSESDPSPGRYSLGVDPRASPQIVIW  196

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSS-SSDLIMFKVDWN  1879
             +G  R WRSG+WDG  F GVP M+  +  GF L  E + L+  Y ++ +S+L+ F +  +
Sbjct  197   DGSNRRWRSGYWDGLSFTGVPDMKALYFNGFKLYNEGNRLHFTYTAANTSNLVRFHISPS  256

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWN  1699
             G E+QQ W+  ++QW  IQ  P   C VYN CG FA+CD S S  + C C+ GF P DW 
Sbjct  257   GYELQQMWDIDKRQWNMIQSHPLGDCDVYNSCGNFAKCDISKS--LRCTCLYGFVPKDWE  314

Query  1698  QWNARNWTGGCTRRTPLQCQKNNTE--GGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
             QWNARNW+GGC RRT L+C +N++         DGF E+K IKLPDFAD      + ++C
Sbjct  315   QWNARNWSGGCVRRTQLECGRNSSVLWSDSGNGDGFLEIKGIKLPDFADT-AAAENIDEC  373

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             K KC E+CSC AYA     GI CM+W  +LVD+ Q +EG G+TL+VRL  SE   K S+T
Sbjct  374   KSKCLENCSCTAYA--FVTGIYCMIWSGDLVDLQQFNEG-GNTLYVRLAHSEF-GKKSRT  429

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFSAQCDL  1168
               +V +S++ AVA ++ ++IWLLC  +A+ R   R +E+P  +   SGE   D S   DL
Sbjct  430   IKLVLISILVAVAFVICIAIWLLCKYKAKRRGSIRINEMPIRDPIRSGELPIDLSGPGDL  489

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
             +VEG  G+ S+L FFSFSSI AAT +FS  NKLGQGGFG VYKG L  G+EIAVKRLSR+
Sbjct  490   SVEGHQGSGSELKFFSFSSIVAATRNFSNENKLGQGGFGPVYKGKLQSGEEIAVKRLSRK  549

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQGV+EF NE+ +IAKLQHRNLVRLLGCCIEG+EK+LLYEYMPN+SLDSF+FDPAK+++
Sbjct  550   SGQGVEEFKNEIMLIAKLQHRNLVRLLGCCIEGEEKILLYEYMPNRSLDSFLFDPAKQAQ  609

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             LNWRKRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGGN
Sbjct  610   LNWRKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGN  669

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGII  448
             QNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFGVLLLEI+ G RNTSFR D HS II
Sbjct  670   QNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGVLLLEIICGWRNTSFRADQHSSII  729

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAWE+WDEG+PM+L+D SI+  C   EVLRCI L LLCVQD+AVHRPNMS+VVL LETD
Sbjct  730   GYAWEKWDEGRPMDLVDRSIWDECQHNEVLRCIHLALLCVQDMAVHRPNMSSVVLMLETD  789

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             N+ LP+PR PTYT SMR+  D D WN+  +  SSN +T+SVIVGR
Sbjct  790   NIRLPLPRQPTYT-SMRKYEDADIWNEKQDF-SSNDVTISVIVGR  832



>ref|XP_009607303.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Nicotiana tomentosiformis]
Length=832

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/825 (59%), Positives = 603/825 (73%), Gaps = 24/825 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A++KI+QG+ ++D G+ I+S   KF LGFFSP+G++ RY+GIWY ++   SVVWVANR+ 
Sbjct  26    ASNKIRQGEILRD-GDKIISPKGKFNLGFFSPKGSNQRYLGIWYADVPVISVVWVANRDS  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D+NG F I  NG  VV DG+   +     S + ++N+T+ L +T  L++L  +    
Sbjct  85    PVSDRNGVFTIEKNGNLVVKDGRGDLLWSTNVSVIETTNSTVSLLDTGNLVMLNNN----  140

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             N  +WQSF  PTDTFLP MRV +      +  SWT+  +PSPGR+S+G+DPR SPQIVIW
Sbjct  141   NKALWQSFQHPTDTFLPEMRVYMDG----VLRSWTSESDPSPGRYSLGVDPRGSPQIVIW  196

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSS-SSDLIMFKVDWN  1879
             +G  R WRSG+WDG  F GVP M+  ++ GF L  E + LY  Y ++ +S+ + F +  +
Sbjct  197   DGSNRRWRSGYWDGLSFTGVPEMKAVYLNGFKLYNEGNRLYFTYTAANTSNFVKFHISPS  256

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWN  1699
             G E+QQ+W+  R+QW  IQ  P   C VYN CG FA+CD   SN + C C+ GF P+DW 
Sbjct  257   GYELQQKWDIDRRQWSMIQSHPLGDCDVYNPCGNFAKCD--ISNSLKCTCLYGFVPNDWE  314

Query  1698  QWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
             QWNARNW+GGC RRT L+C +N++         DGF E+K IKLPDFAD      +    
Sbjct  315   QWNARNWSGGCVRRTRLECGRNSSVLRSDSGNGDGFLEIKGIKLPDFAD---RAAAENID  371

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             + K +   +C++ A     GI CM+W  +LVD+ Q  EG G+TL+VRL  SE   K S+T
Sbjct  372   ECKSKCLENCSSTAYAFVTGIYCMIWSGDLVDLQQFKEG-GNTLYVRLAHSEF-CKKSRT  429

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKR-DEIPRTELPTSGEFSSDFSAQCDL  1168
               IV +S++ AVA ++ ++IWLLC  +A+ R   R +E+P      SGE   D S   DL
Sbjct  430   IKIVVISILVAVAFVICIAIWLLCKYKAKKRESNRINEMPMRNPIRSGELPIDLSGPGDL  489

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
             +VEG  G+ S+L FFSFSSI AAT +FS  NKLGQGGFG VYKG L  G+EIAVKRLSR+
Sbjct  490   SVEGHQGSGSELKFFSFSSIVAATRNFSNENKLGQGGFGPVYKGKLQSGEEIAVKRLSRK  549

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQGV+EF NE+ +IAKLQHRNLVRLLGCCIEG+EK+LLYEYMPN+SLDSF+FDPAK+++
Sbjct  550   SGQGVEEFKNEIMLIAKLQHRNLVRLLGCCIEGEEKILLYEYMPNRSLDSFLFDPAKQAQ  609

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             LNWRKRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EM PKISDFGMARIFGGN
Sbjct  610   LNWRKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDQEMKPKISDFGMARIFGGN  669

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGII  448
             QNEANTNRVVGTYGYMAPEYAMEGLFS KSDVYSFGVLLLEI+ G RNTSFR+D H GII
Sbjct  670   QNEANTNRVVGTYGYMAPEYAMEGLFSGKSDVYSFGVLLLEIICGWRNTSFRSDQHLGII  729

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAWE+WDEG+PM+L+D SI+  C   EVLRCI L LLCVQD+AVHRPNMS+VVL LETD
Sbjct  730   GYAWEKWDEGRPMDLVDRSIWDECQHDEVLRCIHLALLCVQDMAVHRPNMSSVVLMLETD  789

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             N+ LP+PR P YT SMR+  D D WN+  +  SSN++T+SVIVGR
Sbjct  790   NIRLPLPRQPNYT-SMRKYEDADIWNEKQDF-SSNNVTISVIVGR  832



>ref|XP_006352641.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Solanum tuberosum]
Length=792

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/808 (58%), Positives = 600/808 (74%), Gaps = 23/808 (3%)
 Frame = -3

Query  2538  IVSANEKFVLGFFSPEGTSN-RYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITGNGT  2362
             ++S   KF LGFFSP  ++N R+VGIWY +    S VWVANR++PI DKNG F I  NG 
Sbjct  2     LISPKRKFNLGFFSPNVSNNQRFVGIWYVDGPKNSFVWVANRDKPIFDKNGVFTIEKNGN  61

Query  2361  FVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLP  2182
              VV +G+   +W +N +  ++N T  L +   L++   +    N  +WQSFH PTDTFLP
Sbjct  62    LVVKNGRGDLMWTSNVAAMNNNCTAHLSDYGNLMMFNGN----NRELWQSFHHPTDTFLP  117

Query  2181  GMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVF  2002
              MR  L     ++  SWT+  +PSPGR+S+G++ R SPQIVI++GEKR WRSG+WDGR+F
Sbjct  118   EMRFYLD----EVLRSWTSESDPSPGRYSLGVNTRGSPQIVIFDGEKRRWRSGYWDGRIF  173

Query  2001  LGVP-MRTDFVYGFDLITENDNLYLEYK-SSSSDLIMFKVDWNGKEVQQRWNESRKQWIK  1828
              GV  M+ ++++GF L  E D LY  Y  S  SDL+ F +   G E++QRW++  + W  
Sbjct  174   TGVTDMKPEYLHGFKLYNEGDKLYFTYTVSDPSDLVRFHISPTGYELEQRWDKDNENWSI  233

Query  1827  IQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPL  1648
             IQ  P+  C +YN CG FA+CD +      C+C+VGF P D  QWNARNW+ GC RR  +
Sbjct  234   IQSHPSGDCDLYNLCGNFAKCDITYLK--KCICLVGFVPKDLGQWNARNWSEGCVRRKEV  291

Query  1647  QCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPV  1474
             +C+ NN+  + G  +KDGF E++ IKLPDFAD    +++ ++C+  C E+CSC AYA   
Sbjct  292   ECRGNNSVLKSGSGKKDGFFEIEKIKLPDFADTAY-LQNIDECRSMCLENCSCTAYA--F  348

Query  1473  PGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlvi  1294
               GI+CM+W  +LVDM Q  EG G+TL+VRL  SE    S+KT  IV +SV+ A A LV 
Sbjct  349   VSGINCMMWSGDLVDMQQFQEG-GNTLYVRLADSEFAG-SNKTVKIVVISVMVAGAFLVC  406

Query  1293  vsIWLLCSRRARIRAKKRDEIPRTELPT-SGEFSSDFSAQCDLTVEGKAGASSDLVFFSF  1117
             + ++LLC  +A+ R   +     T +PT SGEFS + S   DL++EG  G+ S+L+FFSF
Sbjct  407   MVVFLLCKYKAKTRVSNKINQMETSVPTRSGEFSMNTSGAGDLSIEGHQGSGSELIFFSF  466

Query  1116  SSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAK  937
             S +AAATD+FS  NKLGQGGFG VYKG L CG EIAVKRLSR+SGQGV+EF NE+ +IAK
Sbjct  467   SGVAAATDNFSNENKLGQGGFGPVYKGKLLCGVEIAVKRLSRKSGQGVEEFKNEIKLIAK  526

Query  936   LQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGL  757
             LQHRNLVRL+GCCIEG+EKML YEYM N+SLDSF+FDP K+++L+WRKRF+IIE IARGL
Sbjct  527   LQHRNLVRLMGCCIEGEEKMLFYEYMANRSLDSFLFDPVKQAQLDWRKRFNIIEGIARGL  586

Query  756   LYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMA  577
             LYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGGN+NEANTNRVVGTYGYMA
Sbjct  587   LYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGNENEANTNRVVGTYGYMA  646

Query  576   PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLD  397
             PEYAMEGLFS KSDVYSFGVLLLEI+ GRRNTS+R+++HSGII YAW++WDEG PM+L+D
Sbjct  647   PEYAMEGLFSGKSDVYSFGVLLLEIICGRRNTSYRSNEHSGIIGYAWQKWDEGTPMDLVD  706

Query  396   PSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMR  217
              SI+  C   E LRCIQL L+CVQD+AVHRP++S++VL LETDN+ LP+PR PTYT SMR
Sbjct  707   RSIWDECQYDEALRCIQLALICVQDMAVHRPSISSIVLMLETDNIRLPLPRQPTYT-SMR  765

Query  216   RSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +  D ++WN+  +  S+N++T+SVIVGR
Sbjct  766   KHEDAETWNEKQDF-SANNVTISVIVGR  792



>ref|XP_010646879.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Vitis vinifera]
Length=857

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/830 (57%), Positives = 605/830 (73%), Gaps = 21/830 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ + QGQ I+D GE + S+++ F LGFFSPE +++RYVGIWYN+I  Q+VVWVANR+ 
Sbjct  38    AANTLTQGQSIRD-GETVNSSSQHFALGFFSPENSTSRYVGIWYNKIEGQTVVWVANRDS  96

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG-WRP  2233
             PI   +G   +   G  VV DG   SIW++N+S +SSN+T +L +T  L++  +D     
Sbjct  97    PISGTDGVLSLDKTGNLVVFDGNGSSIWSSNASASSSNSTAILLDTGNLVLSSSDNVGDT  156

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
             +   WQSF+  TDTFLPGM+V  D + GE+++FTSW    +PSPG ++MG+DPRA+PQIV
Sbjct  157   DKAFWQSFNSSTDTFLPGMKVLVDETMGENRVFTSWKTEVDPSPGNYTMGVDPRAAPQIV  216

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNL-YLEYK-SSSSDLIMFKV  1888
             IW+G  R+WRSGHW+G +F G+P M   + YGF   T+ D   Y  Y  S+SSDL+ F+V
Sbjct  217   IWDGSIRWWRSGHWNGLIFTGIPDMMAVYSYGFKYTTDEDGKSYFTYTPSNSSDLLRFQV  276

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q RW+  +K+W  +Q QP ++C  YN CG F  C  S  N  +C C+ GF+P 
Sbjct  277   RWNGTEEQLRWDGDKKEWGVVQSQPDNECEEYNKCGAFGIC--SFENSASCSCLEGFHPR  334

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QWN  NW+GGC RRT LQC ++ +  G  E DGF  V+ +KLPDFAD  R     ++
Sbjct  335   HVDQWNKGNWSGGCVRRTQLQCDRSTSANGTGEGDGFLTVEGVKLPDFAD--RVNLENKE  392

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+K+C ++CSC AYA     GI CM+W  +LVD+    EG  +TL +RL  SEL  K   
Sbjct  393   CEKQCLQNCSCMAYAHVT--GIGCMMWGGDLVDIQHFAEGGRTTLHLRLAGSELGGKG--  448

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRA-----KKRDEIPRTELPTSGEFSSDFS  1183
                +V V +V   AV + +S WLL   RA++RA     ++++E+P   +    EFS DFS
Sbjct  449   IAKLVIVIIVVVGAVFLSLSTWLLWRFRAKLRAFLNLGQRKNELPILYVSGGREFSKDFS  508

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
                DL  EGK G+ S+L  F+F  +AAAT +FS  NKLGQGGFG VYKG+LP G+EIAVK
Sbjct  509   GSVDLVGEGKQGSGSELPLFNFKCVAAATGNFSDENKLGQGGFGPVYKGMLPGGEEIAVK  568

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLSRRSGQG++EF NE+T+IAKLQHRNLVRLLGCCIEG+EKMLLYEYMPNKSLD F+FDP
Sbjct  569   RLSRRSGQGLEEFKNEMTLIAKLQHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDFFIFDP  628

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             AK++EL+WRKRF IIE IARGLLYLHRDSRLRIIHRD+KASNILLD EMNPKISDFGMAR
Sbjct  629   AKQAELDWRKRFTIIEGIARGLLYLHRDSRLRIIHRDMKASNILLDEEMNPKISDFGMAR  688

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IFGG+QNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  +
Sbjct  689   IFGGDQNEANTTRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRLTE  748

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             HS ++ +AW+ W+EGK M  +D SI  SC   EVLRCI++G+LCVQD  ++RP MS VVL
Sbjct  749   HSNLLSFAWQLWNEGKAMEFVDSSIRDSCSQDEVLRCIKVGMLCVQDSTIYRPTMSTVVL  808

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              LE++  TLP+PR PT+T S R S+D+D +++  E+ SSN+IT+S +VGR
Sbjct  809   MLESETATLPMPRQPTFT-STRSSIDLDLFSEGLEIVSSNNITLSAVVGR  857



>emb|CDO99664.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/833 (57%), Positives = 602/833 (72%), Gaps = 28/833 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             + D+I  G  +KD G+ IVSA +KF LGFF       RYVGIW+  I  Q++VWVANR++
Sbjct  39    STDRISSGHPVKD-GDVIVSAGKKFALGFFRSGNPDLRYVGIWFYGIPEQTIVWVANRDK  97

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI    G   +  +G   +LD    SIW+TN    S N+T +L ++  LI+     W  +
Sbjct  98    PIHGLGGTLTVGNHGNLAILDANGDSIWSTNVPAASRNSTAILEDSGNLIL-----WTNH  152

Query  2229  NTI-WQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               + WQSF  PTDTFLP M+   ++SAGE++ FTSW ++ +PS G +SMGIDPR SPQI+
Sbjct  153   RKLSWQSFDNPTDTFLPDMQFYFNVSAGENRFFTSWRSANDPSLGNYSMGIDPRGSPQIL  212

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITE-NDNLYLEYK-SSSSDLIMFKV  1888
             IWEG  R+WRSG+W+G +F G+P M   ++YGF LI E N  L+L Y  S+SSDLI F++
Sbjct  213   IWEGRNRHWRSGYWNGLIFTGIPSMTAIYLYGFKLINEGNGRLHLTYTPSNSSDLIKFQL  272

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+ W+   K+W  IQ QP +QC +YN CG F  CD    N   C C+ G+ P 
Sbjct  273   LWNGTEEQRTWDTGLKEWSLIQLQPVNQCELYNRCGPFGVCD--VMNSPICTCLKGYVPK  330

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGG--AEKDGFREVKHIKLPDFADIDRNMRSP  1534
             D +QWN  NW+GGC RRT LQC+     G G   EKDGF EV+ +KLPDF D    + S 
Sbjct  331   DNDQWNIGNWSGGCIRRTQLQCETKGGRGVGESGEKDGFLEVEDLKLPDFVDY---VGSE  387

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
                + + +   +C+  A     GISCM+W  +LVD+ Q   G+ +T+F+RL  SEL   +
Sbjct  388   NVQECRNKCLHNCSCIAFSFASGISCMIWSKDLVDIQQFQYGA-NTVFLRLAHSELGG-T  445

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIR-----AKKRDEIPRTELPTSGEFSSD  1189
              K T ++ V+ V    + + +SIWLL  R+ +++     +K+R+  P T    SGE S D
Sbjct  446   RKVTKLLIVATVMVGVLFLGLSIWLLWRRKDKLQEVFKSSKQRERFPETHPIQSGELSRD  505

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
             FS Q DL+VEG+  +  +L +F+FSS+AAAT++FS  NKLGQGGFGHVYKG LP GQ+IA
Sbjct  506   FSGQDDLSVEGQECSGKELTYFTFSSVAAATNNFSDINKLGQGGFGHVYKGKLPGGQDIA  565

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSR+SGQG++EF NE+ +IA+LQHRNLVRLLGCCIEG+EK+LLYEYMPNKSLDSF+F
Sbjct  566   VKRLSRKSGQGLEEFKNEVMLIARLQHRNLVRLLGCCIEGEEKILLYEYMPNKSLDSFLF  625

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K+++L+WR RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM
Sbjct  626   DPVKQNQLDWRTRFLIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  685

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFG+LLLEIVSGRRNTSFR+
Sbjct  686   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGILLLEIVSGRRNTSFRS  745

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
              +HS II YAW+ WD G+ ++LLDPSI  +C P EV RCI +G+LCVQD A HRP MSAV
Sbjct  746   AEHSNIIGYAWDLWDRGRAIDLLDPSIADTCSPNEVFRCIHIGMLCVQDSASHRPTMSAV  805

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDS-WNQNNELPSSNSITMSVIVGR  133
             VL LE++N  LP+P+ PT+T S+RRS+DVD  WN+ +++ +SN++T+S I+GR
Sbjct  806   VLMLESENANLPMPKQPTFT-SLRRSLDVDDMWNEIHDVVTSNNVTLSAILGR  857



>ref|XP_010327269.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Solanum lycopersicum]
Length=792

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/808 (58%), Positives = 587/808 (73%), Gaps = 23/808 (3%)
 Frame = -3

Query  2538  IVSANEKFVLGFFSPEGTSN-RYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITGNGT  2362
             ++S   KF+LGFFSP  T+N R+VGIWY +    S VWVANR++PI DKNG F I  NG 
Sbjct  2     LISPKRKFILGFFSPNVTNNQRFVGIWYVDGPENSFVWVANRDKPIFDKNGVFTIEKNGN  61

Query  2361  FVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLP  2182
              VV +G    +W +N    S+N T +L +   L++  ++    N  +WQSF  PTDTFLP
Sbjct  62    LVVKNGHGDIMWTSNVEAISNNCTALLSDYGNLVLFNSN----NKVLWQSFQHPTDTFLP  117

Query  2181  GMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVF  2002
              M+        ++  SWT+  +PS GR+S+G+    SPQIVIW+G  + WRSG+WDGR+F
Sbjct  118   EMKF----YTDEVLRSWTSESDPSTGRYSLGVTSHGSPQIVIWDGGNKRWRSGYWDGRIF  173

Query  2001  LGV-PMRTDFVYGFDLITENDNLYLEYK-SSSSDLIMFKVDWNGKEVQQRWNESRKQWIK  1828
              GV  M+ +F++GF L  E DNLY  Y  S++SDL+ F +   G EV+QRW++   +W  
Sbjct  174   TGVIDMKPEFLHGFKLNNEGDNLYFTYTVSNTSDLVRFHISPTGYEVEQRWDKDNNKWSI  233

Query  1827  IQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPL  1648
             +Q  P+  C +YN CG FA CD +      C+C+ GF P D  QWNA NW+ GC RR  +
Sbjct  234   VQSHPSGDCDLYNLCGNFAMCDVTYFE--KCICLGGFVPKDLGQWNAGNWSEGCVRRKEV  291

Query  1647  QCQKNNT--EGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPV  1474
             +C+ NN+  + G  +KD F  V+ IKLPDFAD   ++ + ++C+  C E+CSC AYA   
Sbjct  292   ECRGNNSVLKSGSEKKDRFYGVEKIKLPDFADT-ADVLNIDECRSMCLENCSCTAYA--F  348

Query  1473  PGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlvi  1294
               GI CM+W  +LVDM Q  EG G TL+VRL SSE D  S++   IV +SV+   A LV 
Sbjct  349   VSGIDCMMWSGDLVDMQQFQEG-GYTLYVRLDSSEFDG-SNRAVKIVVISVMVVGAFLVC  406

Query  1293  vsIWLLCSRRARIRAKKRDEIPRTELPT-SGEFSSDFSAQCDLTVEGKAGASSDLVFFSF  1117
             + ++LLC  +A+ RA  R     T  PT SGEFS D S   D+T+EG  G+ S+L+FFSF
Sbjct  407   MVVFLLCRHKAKTRASNRINQMETVDPTRSGEFSMDTSVAGDMTIEGHQGSGSELIFFSF  466

Query  1116  SSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAK  937
             S +AAATD+FS  NKLGQGGFG VYKG L CG EIAVKRLSR+SGQGV+EF NE+ +IAK
Sbjct  467   SGVAAATDNFSNENKLGQGGFGPVYKGKLLCGVEIAVKRLSRKSGQGVEEFKNEIRLIAK  526

Query  936   LQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGL  757
             LQHRNLVRLLGCCIEG+EKMLLYEYM N+SLDSF+FD  K+ +L+WRKRF+IIE IARGL
Sbjct  527   LQHRNLVRLLGCCIEGEEKMLLYEYMANRSLDSFLFDTVKQVQLDWRKRFNIIEGIARGL  586

Query  756   LYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMA  577
             LYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGGN+NEANT RVVGTYGYMA
Sbjct  587   LYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGNENEANTIRVVGTYGYMA  646

Query  576   PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLD  397
             PEYAMEGLFS KSDVYSFGVLLLEI+ GRRNTSFR+D+HSGII YAW++WDEG PM+L+D
Sbjct  647   PEYAMEGLFSGKSDVYSFGVLLLEIICGRRNTSFRSDEHSGIIGYAWQKWDEGTPMDLID  706

Query  396   PSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMR  217
              SI+  C   E LRCIQL L+CVQD+AVHRP++S++VL LETDN+ LP+PR PTYT SMR
Sbjct  707   RSIWDECQHDEALRCIQLALICVQDMAVHRPSISSIVLMLETDNIPLPLPRQPTYT-SMR  765

Query  216   RSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +  D ++WN+  +  S+N++T+SVI GR
Sbjct  766   KHEDAETWNEKQDF-SANNVTISVIAGR  792



>ref|XP_006467932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X1 [Citrus sinensis]
Length=854

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/834 (56%), Positives = 600/834 (72%), Gaps = 25/834 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I +GQ IKD GE+++S  E F LGFFSPE +S RYVGIWY++I  ++VVWVANR R
Sbjct  31    AVNTITKGQSIKD-GESLISNGEIFELGFFSPENSSLRYVGIWYHQIDEKAVVWVANRNR  89

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT-DGWRP  2233
             PI D+ G   I  +G  +VL+G ++++W++N+SV S+N   +L +   LI+  + D    
Sbjct  90    PISDERGTLTIGNDGNLMVLNGNSIAVWSSNASVVSNNTAALLEDDGNLILTNSEDIGNL  149

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                 WQSF+ PTDT LPGMRV +++  GE+++FTSW ++ +PSPG F+MG+DP+ SPQIV
Sbjct  150   GKAYWQSFNHPTDTHLPGMRVGVNSALGENRVFTSWKSASDPSPGNFTMGVDPQGSPQIV  209

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLIT-END-NLYLEY-KSSSSDLIM  1897
             IWE  KR WRSG W+  +F GVP     T F++GF L   E+D ++Y  Y  +++S L+ 
Sbjct  210   IWEQLKRRWRSGQWNSVIFTGVPTMATLTSFLFGFKLSPRESDGSMYFTYVPANASYLLR  269

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E Q RW+ S K+W  IQ+QPAD C +YN CG F  C+   S    C C+ GF
Sbjct  270   FRIGWDGNEEQLRWDGSAKKWSVIQKQPADDCELYNFCGNFGICNALGST--KCTCMEGF  327

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG-GAEKDGFREVKHIKLPDFADIDRNMR  1540
              P  + QW   NW+ GC RRT LQCQ+N +E G    +DGF+  K++KLPDFAD+     
Sbjct  328   VPKHFEQWRMGNWSAGCIRRTQLQCQRNRSEAGESGGEDGFKVFKNVKLPDFADVVS--V  385

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
               E CK KC ++CSCNAYA     GI CMLWR EL+D+   ++G G+ L VRL  SEL  
Sbjct  386   GQETCKDKCLQNCSCNAYADI--NGIGCMLWRGELIDVKSFEKG-GNLLHVRLPDSELGG  442

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRA-----RIRAKKRDEIPRTELPTSGEFS  1195
             +S K +  V   +V   A+L+  S+WLL   RA      I   K ++    ++    E S
Sbjct  443   RS-KISNAVIAIIVVIGALLLGASVWLLWRFRALCKDSTISCCKNNDTQLIDMSKGQEIS  501

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             +DFS   D+ V G     +DL  F+F++IA AT+ FS  NKLG+GGFG V+KG LP GQ+
Sbjct  502   TDFSGPSDMVVGGSQVNGTDLPMFNFNTIAVATNYFSEGNKLGRGGFGPVHKGKLPEGQD  561

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSR+SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EKML+YEYMPNKSLD F
Sbjct  562   IAVKRLSRKSGQGLEEFKNEIILIAKLQHRNLVRLLGCCIQGEEKMLIYEYMPNKSLDLF  621

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDPAK++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDF
Sbjct  622   IFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMNPKISDF  681

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             GMARIFG NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  682   GMARIFGFNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  741

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R +++S +IE+AW  W+EGK M+L+DP+I  S    +VLRCI +G+LCVQD A++RP M+
Sbjct  742   RLEENSSLIEHAWNLWNEGKAMDLVDPNIRDSSSQNQVLRCIHVGMLCVQDSAMYRPTMA  801

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +VVL LE +  TLPVPR PT+T SMR SVD D + + ++  SSN +T++++VGR
Sbjct  802   SVVLMLENETPTLPVPRQPTFT-SMRSSVDGDHFMEAHDTVSSNDLTVTMVVGR  854



>ref|XP_002316681.2| hypothetical protein POPTR_0011s03790g [Populus trichocarpa]
 gb|EEE97293.2| hypothetical protein POPTR_0011s03790g [Populus trichocarpa]
Length=805

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/825 (55%), Positives = 573/825 (69%), Gaps = 51/825 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + + +GQ IKD GE ++S +E F LGFFSP  +++RYVG+ Y++I  Q+V+WVANR++
Sbjct  26    ATNTLTKGQSIKD-GETLISVDENFELGFFSPGNSTSRYVGVRYSKIQDQAVIWVANRDK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   +G   I  +G  +V+DG   S+W++N+S  SSN T++L  T  LI+   D     
Sbjct  85    PISGTDGVLRIGEDGNLMVVDGNGSSVWSSNASFVSSNTTLMLDTTGNLILSSNDSIGDT  144

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF+ PTDT+LP M+V + + E   FTSW ++ +PSPG F+MG+DPR +PQIV+W
Sbjct  145   DKAYWQSFNNPTDTYLPNMKVLIGSAEIHAFTSWKSTSDPSPGNFTMGVDPRGAPQIVVW  204

Query  2052  EGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITEND-NLYLEYKSSS-SDLIMFKV  1888
             E  +R WRSGHW+ ++F GVP     T + YGF +   ND   YL Y  S  S+L+ F++
Sbjct  205   EQSRRRWRSGHWNSQIFSGVPSMAASTTYRYGFKVTPGNDGKFYLTYNPSDPSELMKFQI  264

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+RWNES K W  +Q QP+++C  YNHCG F  C  S S   NC C+ GF P 
Sbjct  265   TWNGFEEQKRWNESTKAWQVMQSQPSEECEKYNHCGNFGVCTPSGSP--NCRCLEGFQPR  322

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   N +GGC RR+PLQCQ+N + GG   +DGF+ V+  KLPDFAD+ +   S +D
Sbjct  323   HPDQWRLGNLSGGCERRSPLQCQRNTSNGG---EDGFKAVRCTKLPDFADVYQ--LSSDD  377

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             CKK C+ +CSC AYA     GI CM+W  +L D+ Q    SG+TL++RL  SEL   +S 
Sbjct  378   CKKWCQNNCSCKAYAHVT--GIQCMIWNGDLTDV-QNHMQSGNTLYMRLAYSELATSASM  434

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             +T                                   E+   +L  S E+++D S   DL
Sbjct  435   ST---------------------------------NHELQVYDLSRSKEYTTDLSGPGDL  461

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
              +EG      DL  F+F+ +AAAT++FS  NKLGQGGFGHVYKG LP G+EIAVKRLS+ 
Sbjct  462   VLEGSQVNGPDLPMFNFNFVAAATNNFSEENKLGQGGFGHVYKGKLPGGEEIAVKRLSKI  521

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG+QEF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F+FDP K+  
Sbjct  522   SGQGLQEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYFLFDPEKQGL  581

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFGMARIFG N
Sbjct  582   LEWNKRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEGMNPKISDFGMARIFGAN  641

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGII  448
             QNE NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  DH  +I
Sbjct  642   QNEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRMTDHVILI  701

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAW+ W EGK M ++DPSI  SC   EVLRCIQLG+LCVQD A+HRPNM++VVL LE+ 
Sbjct  702   AYAWDLWSEGKAMEMVDPSIRDSCNENEVLRCIQLGMLCVQDSALHRPNMASVVLMLESS  761

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               ++P+PR PT+T S+R S+D +++ +  E+ SSN +T+S++ GR
Sbjct  762   TTSIPLPREPTFT-SVRASIDTETFMEAQEITSSNDLTVSMVAGR  805



>ref|XP_011096222.1| PREDICTED: uncharacterized protein LOC105175473 [Sesamum indicum]
Length=1723

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/828 (56%), Positives = 593/828 (72%), Gaps = 21/828 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA +I +GQ I  DGE ++S   +F LGFF P+G+ +RYVGIWY E+  +SVVWVANRER
Sbjct  29    AASRITRGQSI-GDGETMISEGGRFALGFFGPQGSGSRYVGIWYQEVGNESVVWVANRER  87

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI    G   I  +G  +V+DG    +W+TN SV SSN+T VL +T  L++  ++    +
Sbjct  88    PISGNGGVLTIGNDGNLMVMDGNGDVVWSTNLSVRSSNSTAVLMDTGNLVLFGSENL--S  145

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               +WQSF  PTDT+LP M+V  D+   E ++FTSW ++ +PSPG +SMGIDPR SPQIVI
Sbjct  146   RGLWQSFDHPTDTYLPNMKVYMDVRGEERRVFTSWRSAFDPSPGNYSMGIDPRWSPQIVI  205

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNL----YLEYKSSSSDLIMFK  1891
             W+G  R WRSGHWDG  F GVP M+T  + GF L+TE D +    ++  +S+ SDLI F+
Sbjct  206   WDGANRRWRSGHWDGLTFTGVPGMKTSILSGFRLLTEADVVGKAYFIYSQSNGSDLIKFR  265

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             ++W G +  + W + RK+W   Q  P D+C  YNHCG F +C+        C C+ GF P
Sbjct  266   INWEGIQRLESWVDERKEWSLTQLHPGDECDRYNHCGPFGKCNEVEVP--KCSCMEGFVP  323

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
              D  QW+  NW+GGC R+T LQC +NN+       D F    ++KLPD+ D        +
Sbjct  324   KDTYQWSRENWSGGCVRQTNLQCMENNSLSVNKVNDDFVTATNVKLPDYVDY-VGREDIQ  382

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR-LHSSELDNKS  1354
              C+  C ++CSC AYA      I CM+W  +LVD+ Q  +  GSTLF+R  HS  +    
Sbjct  383   QCQNMCLQNCSCTAYA--FLERIGCMIWYRDLVDVQQF-QAEGSTLFIRRAHSELVAGDK  439

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARI-RAKKRDEIPRTELPTSGEFSSDFSAQ  1177
             S  T IV +++V A  +LV VSIWLL  R+ +      R+E+P+  +  SGEFS+DFS  
Sbjct  440   SHVTKIVIITIVIAGLLLVCVSIWLLVKRKTKCSEILHRNEMPK--VGPSGEFSTDFSGP  497

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
             CDL VEG+    ++L  F+F+ +AAAT++FS  NKLGQGGFGHVYKG LP GQ+IAVKRL
Sbjct  498   CDLGVEGQKPTGNELAMFNFNHVAAATNNFSSENKLGQGGFGHVYKGTLPGGQQIAVKRL  557

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             SR+SGQG++EF NE+ +IAKLQHRNLVRLLGCCIEG+EKMLLYEYMPNKSLDS++FD  K
Sbjct  558   SRKSGQGLEEFKNEIMLIAKLQHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDSYLFDTDK  617

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +++L W KRF IIE IARGL+YLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIF
Sbjct  618   KAQLAWSKRFSIIEGIARGLVYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIF  677

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             GGNQNEANTNRVVGTYGYMAPEYAMEGLFS+KSDVYSFGVLLLEI+SGRRNTSFR+  +S
Sbjct  678   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSLKSDVYSFGVLLLEIISGRRNTSFRSTKYS  737

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              II YAW+ WD G+ M L+DPSI +SC  ++V+RC+ +GLLCVQD+A HRPNM  VVL L
Sbjct  738   NIIGYAWDLWDRGRAMELVDPSISNSCSEEQVVRCVNVGLLCVQDMADHRPNMPTVVLML  797

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             E++  TL +P+ PT+T SMR +++ D WN+  +  SSNS+T++ I+GR
Sbjct  798   ESEKATLSLPKQPTFT-SMRHNLNADMWNEIQDAVSSNSVTITAILGR  844


 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/850 (44%), Positives = 523/850 (62%), Gaps = 55/850 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             + D I   Q++  D + +VSA ++F LGFFS   ++N Y+GIWY  I  +++VWVANR+ 
Sbjct  898   SIDLITPTQFLDKD-QTLVSAGQEFELGFFSYARSNNWYIGIWYKNIEQRTIVWVANRDS  956

Query  2409  PILDKNGAFGIT-GNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ + +G   I+  +G  +++D    S+W++N S  + N+   L +    ++   +   P
Sbjct  957   PLRNSSGILKISPDDGNLLLVDEAGKSVWSSNHSGMAKNSVAELLDNGNFVVRPENEQDP  1016

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              N +WQSF  PT+T LPGM++  D   G ++  TSW ++ +PS G +S  ID    P+I 
Sbjct  1017  ENYLWQSFDYPTNTLLPGMKMGWDSKTGLNRYITSWKSADDPSSGDYSFQIDVNGFPEIY  1076

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +   E+ Y+RSG W+G  F GVP M++  ++ F  + E D +   +  S+  +    +  
Sbjct  1077  LMNKERIYYRSGPWNGLRFSGVPEMKSSTLFSFLFVMEPDEVSYSFDVSNKSVYSRLMVK  1136

Query  1881  NGKEVQQR-WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             +  E+Q+  W  + K W      P DQC  Y  CG +  CD ++S    C CI GF P +
Sbjct  1137  HSGELQRFIWIPATKIWSLFWYAPKDQCDRYRECGVYGICDANASP--VCKCIQGFEPKN  1194

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD--FADIDRNMRSPe  1531
                WN R+ + GC R + L C+           DGF  + H+KLP+   A +D+ M + +
Sbjct  1195  PQAWNLRDGSDGCFRVSKLDCRS----------DGFLTLNHVKLPESGTAFVDKQM-NLD  1243

Query  1530  dckkkceedCSCNAYAPP--VPGGISCMLWRNELVDMMQ--LDEGSGSTLFVRLHSSELD  1363
              C++ C ++CSC  Y+      GG  C +W ++L DM Q  + EG G   +VR+ +++L+
Sbjct  1244  QCQELCRKNCSCRGYSNINITGGGTGCAIWIDDLYDMRQYAVAEG-GQDFYVRVPAADLE  1302

Query  1362  -----------NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTEL  1216
                        NK+ K  + V ++V   +  L +  +W    +R + R+ K++ I   E 
Sbjct  1303  RSGAVGTRDDSNKTGKIVMAVGIAVGVLLVGLAVFFVW----KRGKSRSAKKNII---EH  1355

Query  1215  PTSGEFSSDFSAQCDLTVEGK-------AGASSDLVFFSFSSIAAATDSFSLANKLGQGG  1057
                 E S DF      T+  K       A    DL  F  SS+  ATD+FS ANKLGQGG
Sbjct  1356  RGPRERSQDFLLNV-ATIPNKRDHSGETAADELDLPLFDLSSLLIATDNFSNANKLGQGG  1414

Query  1056  FGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKM  877
             FG VYKG+L  GQ IAVKRLS+ SGQG+ EF NE+ +IA+LQHRNLVRLLGCCIE +EKM
Sbjct  1415  FGCVYKGMLVEGQVIAVKRLSKNSGQGIDEFKNEVKLIARLQHRNLVRLLGCCIEMEEKM  1474

Query  876   LLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASN  697
             L+YEYM NKSLDS +F   K S L+W +RF+II  IARGLLYLH+DSR RIIHRDLKASN
Sbjct  1475  LVYEYMENKSLDSILFKKDKSSMLDWERRFNIICGIARGLLYLHQDSRFRIIHRDLKASN  1534

Query  696   ILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV  517
             ILLD EMNPKISDFGMARIFGG+Q EANT RVVGTYGYM+PEYAM+GLFS+KSDV+SFGV
Sbjct  1535  ILLDKEMNPKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSIKSDVFSFGV  1594

Query  516   LLLEIVSGRRNTSF-RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLG  340
             L+LEIVSG +N  F +T++H  ++ YAW+ + EG+ + L+D +   S    EV+RCIQ+G
Sbjct  1595  LVLEIVSGTKNRGFYQTNNHLNLLAYAWKLYREGRGLELMDTAAGESYSASEVMRCIQVG  1654

Query  339   LLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQN-NELPSSN  163
             LLCVQ+ A  RPNMS VVL L +D V++P P+ P Y    RR  D DS++   +E  + N
Sbjct  1655  LLCVQEHAEDRPNMSTVVLMLSSDFVSMPQPKHPGYCLG-RRPADTDSFSSKPDESCTVN  1713

Query  162   SITMSVIVGR  133
              +T++++ GR
Sbjct  1714  QVTVTMLDGR  1723



>ref|XP_006467933.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X2 [Citrus sinensis]
Length=852

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/819 (56%), Positives = 588/819 (72%), Gaps = 25/819 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I +GQ IKD GE+++S  E F LGFFSPE +S RYVGIWY++I  ++VVWVANR R
Sbjct  31    AVNTITKGQSIKD-GESLISNGEIFELGFFSPENSSLRYVGIWYHQIDEKAVVWVANRNR  89

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT-DGWRP  2233
             PI D+ G   I  +G  +VL+G ++++W++N+SV S+N   +L +   LI+  + D    
Sbjct  90    PISDERGTLTIGNDGNLMVLNGNSIAVWSSNASVVSNNTAALLEDDGNLILTNSEDIGNL  149

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                 WQSF+ PTDT LPGMRV +++  GE+++FTSW ++ +PSPG F+MG+DP+ SPQIV
Sbjct  150   GKAYWQSFNHPTDTHLPGMRVGVNSALGENRVFTSWKSASDPSPGNFTMGVDPQGSPQIV  209

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLIT-END-NLYLEY-KSSSSDLIM  1897
             IWE  KR WRSG W+  +F GVP     T F++GF L   E+D ++Y  Y  +++S L+ 
Sbjct  210   IWEQLKRRWRSGQWNSVIFTGVPTMATLTSFLFGFKLSPRESDGSMYFTYVPANASYLLR  269

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E Q RW+ S K+W  IQ+QPAD C +YN CG F  C+   S    C C+ GF
Sbjct  270   FRIGWDGNEEQLRWDGSAKKWSVIQKQPADDCELYNFCGNFGICNALGST--KCTCMEGF  327

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG-GAEKDGFREVKHIKLPDFADIDRNMR  1540
              P  + QW   NW+ GC RRT LQCQ+N +E G    +DGF+  K++KLPDFAD+     
Sbjct  328   VPKHFEQWRMGNWSAGCIRRTQLQCQRNRSEAGESGGEDGFKVFKNVKLPDFADVVS--V  385

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
               E CK KC ++CSCNAYA     GI CMLWR EL+D+   ++G G+ L VRL  SEL  
Sbjct  386   GQETCKDKCLQNCSCNAYADI--NGIGCMLWRGELIDVKSFEKG-GNLLHVRLPDSELGG  442

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRA-----RIRAKKRDEIPRTELPTSGEFS  1195
             +S K +  V   +V   A+L+  S+WLL   RA      I   K ++    ++    E S
Sbjct  443   RS-KISNAVIAIIVVIGALLLGASVWLLWRFRALCKDSTISCCKNNDTQLIDMSKGQEIS  501

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             +DFS   D+ V G     +DL  F+F++IA AT+ FS  NKLG+GGFG V+KG LP GQ+
Sbjct  502   TDFSGPSDMVVGGSQVNGTDLPMFNFNTIAVATNYFSEGNKLGRGGFGPVHKGKLPEGQD  561

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSR+SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EKML+YEYMPNKSLD F
Sbjct  562   IAVKRLSRKSGQGLEEFKNEIILIAKLQHRNLVRLLGCCIQGEEKMLIYEYMPNKSLDLF  621

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDPAK++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDF
Sbjct  622   IFDPAKQALLDWTKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMNPKISDF  681

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             GMARIFG NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  682   GMARIFGFNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  741

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R +++S +IE+AW  W+EGK M+L+DP+I  S    +VLRCI +G+LCVQD A++RP M+
Sbjct  742   RLEENSSLIEHAWNLWNEGKAMDLVDPNIRDSSSQNQVLRCIHVGMLCVQDSAMYRPTMA  801

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE  178
             +VVL LE +  TLPVPR PT+T SMR SVD D + + ++
Sbjct  802   SVVLMLENETPTLPVPRQPTFT-SMRSSVDGDHFMEAHD  839



>gb|KHG07568.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Gossypium arboreum]
Length=854

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/840 (54%), Positives = 579/840 (69%), Gaps = 34/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I+QG+ + D G+++VS NE F LGFFSPE ++ RYVGIWY  +  ++VVWVANR+ 
Sbjct  28    AVDTIRQGESVADGGDSLVSENETFELGFFSPENSTFRYVGIWY-RVDVKTVVWVANRDN  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI  KNG   I  +G  VVL+G    +W++N +  S+N   +LR+T  L++  TD  + +
Sbjct  87    PIPTKNGVLRIGVDGNLVVLNGNTNLVWSSNLTGLSNNTAAILRDTGNLVLSNTDTSKVH  146

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                WQSF  PTDTFLPGMR  +S+  GE  +F SW +S +PS G F+MG+DP   PQI+I
Sbjct  147   ---WQSFEHPTDTFLPGMRAPVSSLIGEFHVFRSWKSSNDPSLGNFTMGVDPNGGPQIII  203

Query  2055  WEGEK-RYWRSGHWDGRVFLGVPMRTD---FVYGFDLIT--ENDNLYLEYKSSS-SDLIM  1897
             W+  K R WRSG W+  +F G+P  +D   F+YGF L    EN   Y  Y  SS SDL+ 
Sbjct  204   WDQNKGRRWRSGQWNSVIFTGIPNMSDIASFLYGFKLSQPDENRTQYFTYDPSSPSDLLR  263

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
             F++ W+G+E Q RW++ RK W  +Q QP   + C +YNHCG  A CDN  +  + C CI 
Sbjct  264   FRLTWDGREQQSRWDDDRKMWTVMQTQPDPGNVCDLYNHCGNHATCDNFEA--VKCSCID  321

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
             GF P   +QW+  NW+GGC RR  LQCQ+ N   G A +DGF+ +KH+KLPD +++  + 
Sbjct  322   GFRPKSPDQWSKGNWSGGCERRIELQCQRTN---GSAGEDGFKGLKHVKLPDSSNLLLSA  378

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
              + + C+  C  +CSC AYA     GI CM W  +LVD+  LDE +    F R+H SELD
Sbjct  379   GNIDACETSCLGNCSCTAYA--FISGIGCMTWEGDLVDLQHLDEAANLQFFYRVHRSELD  436

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK---------KRDEIPRTELPT  1210
               S K + IV + +    A  ++V+IWLL   + ++R           K D++       
Sbjct  437   G-SRKISNIVIIIISVLGACFLVVTIWLLWRYKKQLRGLPVVSSMPCCKEDDVAVINESK  495

Query  1209  SGEFSSDFSA-QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
             + EFS+D S    D+ ++G      +L   +FSS+AAAT +FS AN+LG GGFG VYKG 
Sbjct  496   NKEFSADLSGGPVDILIDGSQVNEPELTVINFSSLAAATKNFSEANRLGHGGFGTVYKGE  555

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             LP GQEIAVKRLS +SGQG++EF NE+ +IAKLQHRNLVRLLGC IEGDEKML+YEYMPN
Sbjct  556   LPGGQEIAVKRLSGQSGQGLEEFKNEIILIAKLQHRNLVRLLGCSIEGDEKMLIYEYMPN  615

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD  +FD  K+++L+WR RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMN
Sbjct  616   KSLDYILFDETKQAKLDWRTRFGIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDAEMN  675

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG
Sbjct  676   PKISDFGMARIFGGNQNEANTIRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  735

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RRNTSFR+ D++ +I YAW  W+E K M ++DPSI  SC   +VL+CI +G+LCVQD A+
Sbjct  736   RRNTSFRSSDYTSLIAYAWSLWNEDKAMEMVDPSIRDSCSTTQVLKCIHIGMLCVQDSAM  795

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             HRP M+AVVL LET+  TLP+P+ PTYT SMR  +D +     +E  SS  +T++++ GR
Sbjct  796   HRPTMAAVVLMLETETPTLPMPKQPTYT-SMRSLMDAEYSMDIHETASSKDVTVTMVDGR  854



>ref|XP_011008148.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Populus euphratica]
Length=850

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/824 (55%), Positives = 574/824 (70%), Gaps = 21/824 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + + +GQ IKD GE + S +E F LGFFSP  +++RYVG+ Y++I  Q+V+WVANR++
Sbjct  27    ATNTLTKGQSIKD-GEILTSVDENFELGFFSPGNSTSRYVGVRYSKIQDQAVIWVANRDK  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   +G   I  +G  +V++G   S+W++N+S  SSN  ++L  T  LI+   D     
Sbjct  86    PISGTDGVVKIGEDGNLLVVNGNGSSVWSSNASFVSSNTALMLDTTGNLILSSNDSIGDT  145

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF+ PTDT+LP M+V + + E   FTSW ++ +PSPG F+MG+DPR +PQIV+W
Sbjct  146   DKAYWQSFNNPTDTYLPDMKVLIGSAEIYAFTSWKSTSDPSPGNFTMGVDPRGAPQIVVW  205

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFV---YGFDLITEND-NLYLEYKSSS-SDLIMFKV  1888
             E  +R WRSGHW+G +F GVP    F    YGF +  END  LY  Y  S  S+L+ F++
Sbjct  206   EQSRRRWRSGHWNGLIFSGVPSMAAFTTYRYGFKITRENDGKLYFTYNPSDPSELMKFQI  265

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+RWN+S K W  +Q QP+++C  YNHCG F  C  S S   NC C+ GF P 
Sbjct  266   TWNGFEEQKRWNKSAKAWQVMQSQPSEECEKYNHCGNFGVCTPSGSP--NCRCLEGFQPR  323

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ N + GG   +DGF+ V+  KLPDFAD+ +   S +D
Sbjct  324   HPDQWRLGNWSGGCERRSPLQCQMNTSNGG---EDGFKAVRCAKLPDFADVYQ--LSSDD  378

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             CKKKC+ +CSC AYA     GI CM+W  +L D+ Q    SG+TL++RL  SELD+    
Sbjct  379   CKKKCQNNCSCKAYAHVT--GIRCMIWNGDLTDV-QNHIQSGNTLYMRLAYSELDHSRLP  435

Query  1347  T---TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
             T    +IV   +V     + ++ +     +          E+   +L  S E+++D S  
Sbjct  436   TYVIVLIVLAGLVFVAISIWLLWMLKKKLKATSASMSTNHELQVHDLSRSKEYTTDLSGP  495

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
              DL +EG      DL  F+F+ +A AT++FS  NKLGQGGFG VYKG LP G+EIAVKRL
Sbjct  496   GDLVLEGSQVNGPDLPMFNFNFVAVATNNFSEENKLGQGGFGLVYKGKLPGGEEIAVKRL  555

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             S+ SGQG+ EF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F+FDP K
Sbjct  556   SKISGQGLLEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYFLFDPEK  615

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +  L W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFGMARIF
Sbjct  616   QGLLEWNKRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEGMNPKISDFGMARIF  675

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             G NQNE NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  DH 
Sbjct  676   GANQNEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRMTDHV  735

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              +I YAW+ W EGK M ++DPSI  SC   EVLRCIQLG+LCVQD A+HRPNM++VVL L
Sbjct  736   ILIAYAWDLWSEGKAMEMVDPSIRDSCNQNEVLRCIQLGMLCVQDSALHRPNMASVVLML  795

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             E+   ++P+PR PT+T S+R S+D ++  +  E+ SSN +T+S+
Sbjct  796   ESSTTSIPLPREPTFT-SVRASIDTETLMEAQEITSSNDLTVSM  838



>ref|XP_002524721.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF37740.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=849

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/830 (54%), Positives = 579/830 (70%), Gaps = 27/830 (3%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I +GQ + D GE I+S +E F LGFFSP  ++ RYVGI Y++I  Q V+WVANR+ PI D
Sbjct  32    ITKGQLVPD-GEIILSEDENFELGFFSPGISTFRYVGIRYHKIQDQPVIWVANRQTPISD  90

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
             K G   I  +G  +V +G+ + +W++N S   SN T      S  ++L  +G     T W
Sbjct  91    KTGVLTIGEDGNLIVRNGRGLEVWSSNVSSLLSNNTQATLADSGNLVLSGNG----ATYW  146

Query  2217  QSFHQPTDTFLPGMRVDLSAGE-SKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEK  2041
             +SF  PTDTFLP M+V  S+ E +K FTSW ++ +PSPG F+MG+DPR +PQIVIWE  +
Sbjct  147   ESFKHPTDTFLPNMKVLASSSEENKAFTSWKSANDPSPGNFTMGVDPRGAPQIVIWEQSR  206

Query  2040  RYWRSGHWDGRVFLGVP---MRTDFVYGFDLITENDNLYLEYK-SSSSDLIMFKVDWNGK  1873
             R WRSG+W+G++F GVP     T+ +YGF    ++ N+Y+ Y  SS+SD + F++  +G 
Sbjct  207   RRWRSGYWNGQIFTGVPNMTALTNLLYGFKTEIDDGNMYITYNPSSASDFMRFQISIDGH  266

Query  1872  EVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQW  1693
             E Q +WNES+ +W  +Q QPA+ C  YN CG F  C  ++S    C C+ GF P + +QW
Sbjct  267   EEQLKWNESQNKWDVMQRQPANDCEFYNFCGDFGVC--TASENPRCRCMEGFEPRNEHQW  324

Query  1692  NARNWTGGCTRRTPLQCQKNNTEGGGAEKDG-FREVKHIKLPDFADIDRNMRSPedckkk  1516
                NW+GGC RR+PL+CQ+N + GGG+  D  F+E+K  KLPDF D+   +   EDC+  
Sbjct  325   RRGNWSGGCVRRSPLRCQRNTSIGGGSSTDDKFKELKCNKLPDFVDV-HGVLPLEDCQIL  383

Query  1515  ceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD-NKSSKTTi  1339
             C  DCSCNAYA  V   I CM+W   L+D+       G  + +RL +SE D +K S   I
Sbjct  384   CLSDCSCNAYA--VVANIGCMIWGENLIDVQDFGR-PGIVMHLRLAASEFDESKLSTAVI  440

Query  1338  ivavsvvaavavlvivsIWLLCSR------RARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
              + V        + I  +W+L  +       A +   K  E P +++  S  +SS+ S  
Sbjct  441   ALIVVAGVVFVAICICLLWVLKRKLKVLPAAASVSLNKPSETPFSDMSKSKGYSSEMSGP  500

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
              DL ++G      DL  F+FS++AAATD+F+  NKLGQGGFGHVYKG LP G+EIAVKRL
Sbjct  501   ADLVIDGSQVNGPDLPLFNFSAVAAATDNFAEENKLGQGGFGHVYKGKLPSGEEIAVKRL  560

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             S+ SGQG++EF NE+ +IAKLQHRNLVRLLGCCI G+EK+LLYEYMPNKSLD F+FDPAK
Sbjct  561   SKISGQGLEEFKNEIILIAKLQHRNLVRLLGCCIHGEEKLLLYEYMPNKSLDFFLFDPAK  620

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             ++ L+W+ RF II+ IARGL+YLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIF
Sbjct  621   QAMLDWKTRFTIIKGIARGLVYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIF  680

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             GGNQNE NTNRVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  DH+
Sbjct  681   GGNQNELNTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRQSDHA  740

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              +I YAWE W+E K + L+DPSI  SC  +EVLRCIQ+G+LCVQD AV RP MS++VL L
Sbjct  741   SLIAYAWELWNEDKAIELVDPSIRDSCCKKEVLRCIQVGMLCVQDSAVQRPTMSSIVLML  800

Query  276   ETDNV-TLPVPRPPTYTASMRRSVDV-DSWNQNNELPSSNSITMSVIVGR  133
             E++    LP+PR PTYT SMR S+D  D +    E+ SSN +T++++VGR
Sbjct  801   ESNTAPNLPLPRQPTYT-SMRASIDTSDIYLDGQEIVSSNDVTVTMVVGR  849



>ref|XP_002304962.2| S-locus lectin protein kinase [Populus trichocarpa]
 gb|EEE85473.2| S-locus lectin protein kinase [Populus trichocarpa]
Length=846

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/831 (55%), Positives = 586/831 (71%), Gaps = 26/831 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + +  GQ +KD GE+++S +E F LGFFSP  +S RY GI Y +I  Q+ +WVANRE+
Sbjct  30    ANNTLTIGQSLKD-GESLISVDENFELGFFSPGNSSLRYCGIRYYKIRDQAAIWVANREK  88

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   NG   I  +G  +V DG    +W++N+SV S+N   +L  T  LI+   D     
Sbjct  89    PISGSNGVLRIGEDGNLLVTDGNGSPVWSSNTSVVSNNTAAMLDTTGNLILSSNDSIGET  148

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF+ PTDT+LP M+V +S+ E   FTSW ++ +PSPG F+MG+DPR +PQIVIW
Sbjct  149   DKAYWQSFNNPTDTYLPHMKVLISSAEIHAFTSWKSANDPSPGNFTMGVDPRGAPQIVIW  208

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRT---DFVYGFDLITEND-NLYLEYK-SSSSDLIMFKV  1888
             E  +R WRSGHW+G +F GVP  T    + YGF +  E+D N YL Y  S SS+L+ F++
Sbjct  209   ERSRRRWRSGHWNGLIFSGVPYMTALTTYRYGFKVTRESDGNFYLTYNPSDSSELMRFQI  268

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+RWNES K W  +Q QP+++C  YN+CG F  C  +SS    C C+ GF P 
Sbjct  269   TWNGFEEQKRWNESAKTWQVMQSQPSEECENYNYCGNFGVC--TSSGSPKCRCMEGFEPR  326

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ+N + GG   +DGF+ ++  KLPDFAD++    S + 
Sbjct  327   HPDQWRLGNWSGGCGRRSPLQCQRNTSSGG---EDGFKTLRGSKLPDFADVES--ISLDA  381

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C++ C  +CSC AYA      I CM+W  +L+D+    EG G+TL+VRL  SEL      
Sbjct  382   CREMCLNNCSCKAYAHV--SQIQCMIWNGDLIDVQHFVEG-GNTLYVRLADSELGRNRMP  438

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRTELPTSGEFSSDF  1186
             T   V + +V A    + +SIWLL   + R++A        + E+P  +L  S E+S+D 
Sbjct  439   T--YVIILIVLAGLAFLAISIWLLWMLKKRLKAATSACTSSKCELPVYDLSKSKEYSTDA  496

Query  1185  SAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
             S   DL  EG     SDL  F+F+ +AAATD+FS  NKLGQGGFG VYKG LP G+EIAV
Sbjct  497   SGSADLLKEGSQVNGSDLPMFNFNCLAAATDNFSEENKLGQGGFGLVYKGTLPGGEEIAV  556

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLS+ SGQG+QEF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F+FD
Sbjct  557   KRLSKISGQGLQEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYFLFD  616

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
             P K++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMA
Sbjct  617   PEKQALLDWSKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMA  676

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD  466
             RIFGGNQ+E NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  
Sbjct  677   RIFGGNQSEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRQT  736

Query  465   DHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
             +   +I YAW+ W+EGK M+++D SI  SC  +EVLRCIQ+G+LCVQD A+HRPNM++VV
Sbjct  737   ERMILIAYAWDLWNEGKAMDIVDLSIRDSCDEKEVLRCIQIGMLCVQDSALHRPNMASVV  796

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + LE+   ++P+PR PT+T S+R S+D +   +  E+ SS+ +T+ V+ GR
Sbjct  797   VMLESSTTSIPLPRQPTFT-SVRASIDPEISLEVQEVASSSDLTVKVVAGR  846



>ref|XP_006467934.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X3 [Citrus sinensis]
Length=847

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/834 (55%), Positives = 594/834 (71%), Gaps = 32/834 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I +GQ IKD GE+++S  E F LGFFSPE +S RYVGIWY++I  ++VVWVANR R
Sbjct  31    AVNTITKGQSIKD-GESLISNGEIFELGFFSPENSSLRYVGIWYHQIDEKAVVWVANRNR  89

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT-DGWRP  2233
             PI D+ G   I  +G  +VL+G ++++W++N+SV S+N   +L +   LI+  + D    
Sbjct  90    PISDERGTLTIGNDGNLMVLNGNSIAVWSSNASVVSNNTAALLEDDGNLILTNSEDIGNL  149

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                 WQSF+ PTDT LPGMRV +++  GE+++FTSW ++ +PSPG F+MG+DP+ SPQIV
Sbjct  150   GKAYWQSFNHPTDTHLPGMRVGVNSALGENRVFTSWKSASDPSPGNFTMGVDPQGSPQIV  209

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLIT-END-NLYLEY-KSSSSDLIM  1897
             IWE  KR WRSG W+  +F GVP     T F++GF L   E+D ++Y  Y  +++S L+ 
Sbjct  210   IWEQLKRRWRSGQWNSVIFTGVPTMATLTSFLFGFKLSPRESDGSMYFTYVPANASYLLR  269

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E Q RW+ S K+W  IQ+QPAD C +YN CG F  C+   S    C C+ GF
Sbjct  270   FRIGWDGNEEQLRWDGSAKKWSVIQKQPADDCELYNFCGNFGICNALGST--KCTCMEGF  327

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG-GAEKDGFREVKHIKLPDFADIDRNMR  1540
              P  + QW   NW+ GC RRT LQCQ+N +E G    +DGF+  K++KLPDFAD+     
Sbjct  328   VPKHFEQWRMGNWSAGCIRRTQLQCQRNRSEAGESGGEDGFKVFKNVKLPDFADVVS--V  385

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
               E CK KC ++CSCNAYA     GI CMLWR EL+D+   ++G G+ L VRL  SEL  
Sbjct  386   GQETCKDKCLQNCSCNAYADI--NGIGCMLWRGELIDVKSFEKG-GNLLHVRLPDSELGG  442

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRA-----RIRAKKRDEIPRTELPTSGEFS  1195
             +S K +  V   +V   A+L+  S+WLL   RA      I   K ++    ++    E S
Sbjct  443   RS-KISNAVIAIIVVIGALLLGASVWLLWRFRALCKDSTISCCKNNDTQLIDMSKGQEIS  501

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             +DFS   D+ V G     +DL  F+F++IA AT+ FS  NKLG+GGFG V+KG LP GQ+
Sbjct  502   TDFSGPSDMVVGGSQVNGTDLPMFNFNTIAVATNYFSEGNKLGRGGFGPVHKGKLPEGQD  561

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSR+SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EKML+YEYMPNK     
Sbjct  562   IAVKRLSRKSGQGLEEFKNEIILIAKLQHRNLVRLLGCCIQGEEKMLIYEYMPNK-----  616

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
               +PAK++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDF
Sbjct  617   --NPAKQALLDWTKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMNPKISDF  674

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             GMARIFG NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  675   GMARIFGFNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  734

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R +++S +IE+AW  W+EGK M+L+DP+I  S    +VLRCI +G+LCVQD A++RP M+
Sbjct  735   RLEENSSLIEHAWNLWNEGKAMDLVDPNIRDSSSQNQVLRCIHVGMLCVQDSAMYRPTMA  794

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +VVL LE +  TLPVPR PT+T SMR SVD D + + ++  SSN +T++++VGR
Sbjct  795   SVVLMLENETPTLPVPRQPTFT-SMRSSVDGDHFMEAHDTVSSNDLTVTMVVGR  847



>ref|XP_010268933.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Nelumbo nucifera]
Length=851

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/833 (53%), Positives = 585/833 (70%), Gaps = 22/833 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA  + +G+ I+D G  I+S    F LGFFSP  ++NRYVGIWY ++  Q+VVWVANR+ 
Sbjct  27    AASTLTRGRPIRDGG-TIISEGNNFQLGFFSPVNSTNRYVGIWYYKVSVQTVVWVANRDN  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELII-LKTDGWRP  2233
             P+LD NG F I G+G  +VLDG   S+W+TN S  S N+T  L ++  LI+    D    
Sbjct  86    PVLDTNGVFTIGGSGNLMVLDGNGNSLWSTNVSAVSGNSTAYLTDSGNLILSTGNDAGDT  145

Query  2232  NNTIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              NT+WQSF  PTDT+LPGM+  ++L  G ++LF SW ++ +PS G +SMG+DP  SPQIV
Sbjct  146   GNTLWQSFDDPTDTYLPGMKASLNLRTGNTRLFVSWKSANDPSIGNYSMGVDPVGSPQIV  205

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDN--LYLEYK-SSSSDLIMFK  1891
             +WEG KR WRSG W+G+ F+GVP MR  ++YGF L+ + +    Y  Y  ++S+D++ F+
Sbjct  206   MWEGSKRRWRSGQWNGQTFMGVPNMRPLYIYGFRLVNDEEGGLRYFTYTMTNSTDILKFR  265

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             + W+G E    WN  +K+W  I  QP D+C +YN CG +  C+  SS    C C+ GF P
Sbjct  266   IRWDGIEDHLLWNSEKKEWTTIWSQPVDECELYNQCGTYGICNRMSSP--VCTCLQGFEP  323

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
                 +W+  NW+GGC RRT LQCQ+N++     E DGF +V+ IKLPDF++   +++   
Sbjct  324   KSPLEWSRGNWSGGCVRRTQLQCQRNSSVEN-IEGDGFLKVQGIKLPDFSNW-VSIQGRG  381

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS-  1354
             +C+ +C ++CSC AYA     G+ CMLW  +LVD+    EG G+TL++RL  SEL     
Sbjct  382   ECEDECLKNCSCRAYA--YVNGVGCMLWERDLVDIQHFPEG-GNTLYIRLADSELGQGGM  438

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELP-----TSGEFSSD  1189
             SK   +V + +     V + +SI+LL    A+ + K    +P  ELP      S E S D
Sbjct  439   SKILKLVIIIIALLGFVFLSLSIYLLWRFNAKRKVKGSLVMPNKELPLPDLSISEELSKD  498

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              S   D  +E K G   +L  F+F+ +A +T++FS ANKLG+GGFG VYKG LPCG+E+A
Sbjct  499   LSVLGDAAIEAKQGDGPELPLFNFNFVAFSTNNFSDANKLGEGGFGPVYKGKLPCGREVA  558

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSRRSGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+LLYE+MPN SLDSF+F
Sbjct  559   VKRLSRRSGQGLEEFKNEIILIAKLQHRNLVRLLGCCIQGEEKILLYEFMPNSSLDSFIF  618

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             +P ++ +L W KRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNP+ISDFGM
Sbjct  619   EPERQGKLEWGKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPRISDFGM  678

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             A+IFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT FR+
Sbjct  679   AKIFGGNQNEANTTRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTHFRS  738

Query  468   DDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              +HS  ++ YAW+ W E K M  +DPSI  SC   EVLRCI +GLLCVQD A+ RP MS+
Sbjct  739   QEHSLNLLGYAWKLWIEDKAMEFIDPSISGSCSKWEVLRCIHVGLLCVQDSAMDRPTMSS  798

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+L LE++  TLPVP+ PT+T       DV    +++E+ S+N +T+++IVGR
Sbjct  799   VILMLESETATLPVPKQPTFTIVRNHPTDVCISVESHEIASTNDVTVTMIVGR  851



>ref|XP_002304965.2| hypothetical protein POPTR_0004s02700g [Populus trichocarpa]
 gb|EEE85476.2| hypothetical protein POPTR_0004s02700g [Populus trichocarpa]
Length=836

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/807 (56%), Positives = 568/807 (70%), Gaps = 26/807 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + +  GQ +KD GE ++S +E F LGFFSP  +S RYVGI Y +I  Q+V+WVANRE+
Sbjct  30    ANNTLTIGQSLKD-GETLISVDENFELGFFSPGNSSLRYVGIRYYKIQDQAVIWVANREK  88

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   NG   I  +G  +V DG    +W++N+SV SSN   +L  T  LI+   D     
Sbjct  89    PISGSNGVLRIGEDGNLLVTDGNGSPVWSSNASVVSSNTAAMLDVTGNLILSSNDSIGET  148

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF+ PTDT+LP M+V +S  E  +FTSW ++ +PSPG F+MG+DPR +PQIV+W
Sbjct  149   DKAYWQSFNNPTDTYLPHMKVLVSTAEIHVFTSWKSANDPSPGNFTMGVDPRGTPQIVVW  208

Query  2052  EGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLITEND-NLYLEYK-SSSSDLIMFKV  1888
             EG +R WRSGHW+G +F GVP     T + YGF    E+D N Y+ Y  S +S+ + F++
Sbjct  209   EGSRRRWRSGHWNGIIFSGVPYMKAFTTYQYGFKFSPESDGNFYVTYNPSDNSEFLRFQI  268

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E  ++WNES K W  IQ QP+++C  YN+CG F  C  S S    C C+ GF P 
Sbjct  269   TWNGFEETKKWNESAKTWQVIQAQPSEECENYNYCGNFGVCTPSGSP--KCRCMEGFEPR  326

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ+N + GG   +DGF+ V+ +KLPDFAD+     S + 
Sbjct  327   HPDQWRLGNWSGGCGRRSPLQCQRNTSSGG---EDGFKTVRCMKLPDFADVKS--ISLDA  381

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C++ C  +CSC AYA      I CM+W  +L+D+    EG G TL++RL  SELD   S+
Sbjct  382   CREMCLNNCSCKAYAHV--SEIQCMIWNGDLIDVQHSVEG-GDTLYLRLADSELDR--SR  436

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRTELPTSGEFSSDF  1186
              ++ V + +V A    + +SIWLL   + R++A        + E+P  +L  S E+S+D 
Sbjct  437   MSMYVIILIVLAGLAFLAISIWLLWMLKKRLKAATSACTSSKCELPVYDLSKSKEYSTDA  496

Query  1185  SAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
             S   DL  EG     SDL  F+F+ +AAATD+FS  NKLGQGGFG VYKG LP G+EIAV
Sbjct  497   SGSADLLKEGSQVNGSDLPMFNFNCLAAATDNFSEENKLGQGGFGLVYKGKLPGGEEIAV  556

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLS  SGQG+ EF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F+FD
Sbjct  557   KRLSNISGQGLLEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYFLFD  616

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
             P K++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMA
Sbjct  617   PEKQALLDWSKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMA  676

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD  466
             RIFGGNQ+E NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  
Sbjct  677   RIFGGNQSEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRQT  736

Query  465   DHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
             +   +I YAW+ W+EGK M ++DPSI  SC   EVLRCIQ+G+LCVQD A+HRP+M++VV
Sbjct  737   ERMILIAYAWDLWNEGKTMEIVDPSIRDSCDENEVLRCIQIGMLCVQDSALHRPSMASVV  796

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVD  205
             + LE+    +P+PR P +T S+R S+D
Sbjct  797   VMLESCTTNIPLPRQPNFT-SVRASID  822



>ref|XP_011011560.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Populus euphratica]
Length=849

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/834 (54%), Positives = 585/834 (70%), Gaps = 29/834 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + + +GQ +KD GE+++S +E F LGFFSP  +S RY GI Y +I  Q+ +WVANRE+
Sbjct  30    ANNTLTRGQSLKD-GESLISVDENFELGFFSPGNSSLRYFGIRYYKIRDQAAIWVANREK  88

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   +G   I  +G  +V DG    +W++N+SV S+N   +L  T  LI+   D     
Sbjct  89    PISGSDGVLRIGEDGNLLVADGNGSPVWSSNASVVSNNTAAMLDPTGNLILSSNDSIGET  148

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF  PTDT+LP M+V +S+ E   FTSW ++ +PSPG F+MG+DPR +PQIV+W
Sbjct  149   DKAYWQSFSNPTDTYLPNMKVLISSAEIHAFTSWKSANDPSPGNFTMGVDPRGAPQIVVW  208

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRT---DFVYGFDLITEND-NLYLEYK-SSSSDLIMFKV  1888
             E  +R WRSGHW+G +F GVP  T    + YGF +  E+D   Y  Y  S +S+L+ F++
Sbjct  209   ERSRRRWRSGHWNGLIFSGVPYMTALTTYRYGFKVTRESDGKFYFTYNPSDNSELMRFQI  268

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+RWNES K W  +Q QP+++C  YN+CG F  C +S S+   C C+ GF P 
Sbjct  269   TWNGFEEQKRWNESAKTWQVMQSQPSEECENYNYCGNFGVCTSSGSH--KCRCMEGFEPR  326

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ+N + GG   +DGF+ ++ +KLPDFAD++    S + 
Sbjct  327   QPDQWRRGNWSGGCGRRSPLQCQRNTSSGG---EDGFKTLRGLKLPDFADVES--ISLDA  381

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C++ C  +CSC AYA      I CM+W  +L+D+ +  EG G+TL+VRL  SEL    S+
Sbjct  382   CREMCLNNCSCKAYAHV--SQIQCMIWNGDLIDVQRFVEG-GNTLYVRLADSELGR--SR  436

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRA---------KKRDEIPRTELPTSGEFS  1195
                 V + +V A    + +SIWLL   +  ++            + E+P  +L  S E+S
Sbjct  437   MPTYVIILIVLAGLAFLAISIWLLWMLKKSLKVLPAATSACTSSKCELPVYDLSKSKEYS  496

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             +D S   DL +EG     SDL  F+F+ +AAAT++FS  NKLGQGGFG VYKG LP G+E
Sbjct  497   TDASGSADLVIEGSQVNGSDLPMFNFNCLAAATNNFSEENKLGQGGFGLVYKGKLPGGKE  556

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLS+ SGQG+QEF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F
Sbjct  557   IAVKRLSKISGQGLQEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYF  616

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP K++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDF
Sbjct  617   LFDPDKQALLDWSKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDF  676

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             GMARIFGGNQ+E NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  677   GMARIFGGNQSEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  736

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R  +   +I YAW+ W+EGK M+++D SI  SC   EVLRCIQ+G+LCVQD A+HRP M+
Sbjct  737   RQTERMILIAYAWDLWNEGKAMDIVDLSIRDSCDENEVLRCIQIGMLCVQDSALHRPTMA  796

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +VVL LE+   ++P+PR PT+T S+R S+D +   +  E+ SS+ +T+ V+ GR
Sbjct  797   SVVLMLESSTTSIPLPRQPTFT-SVRASIDPEISLEVQEVASSSDLTVKVVAGR  849



>ref|XP_007025862.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY28484.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=853

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/835 (54%), Positives = 578/835 (69%), Gaps = 31/835 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D+I  GQ I+D G+ +VS  E F LGFF+PE ++  +VGIWY  I  ++VVWVANR+R
Sbjct  30    AVDRITPGQTIRD-GDTLVSRAEIFELGFFNPENSTFIFVGIWY-RIDVKAVVWVANRDR  87

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI  ++G   I  +G  VVLDG N  +W++N S  S+N T VL +T   ++   +    +
Sbjct  88    PISGRSGVLRIGVDGNLVVLDGNNNLVWSSNVSGLSNNTTAVLWDTGNFVLSSNES--VD  145

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +T WQSF  PTDTFLPGMRV +++  GE   F +W ++ +PSPG +SMG+DP   PQIVI
Sbjct  146   DTHWQSFDNPTDTFLPGMRVPVNSAIGEYPAFHAWKSASDPSPGNYSMGVDPHGGPQIVI  205

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTD---FVYGFDL--ITENDNLYLEY-KSSSSDLIMF  1894
             W+  +R WRSG W+G +F GVP  +    F+YGF L  + EN   Y  Y   + S+L+ F
Sbjct  206   WDHGRRRWRSGQWNGVIFTGVPNMSSIASFLYGFKLSQLDENRTQYFTYYPPNPSNLLRF  265

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
             ++ W G+E Q  W++  K+W  +Q+QP  A+QC +YNHCG +A CDN   N   C C+ G
Sbjct  266   RIGWEGREQQLMWDDGEKKWKVLQQQPDLANQCELYNHCGNYATCDNL--NSPKCNCLKG  323

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG-GAEKDGFREVKHIKLPDFADIDRNM  1543
             F P   +QWN  NW+GGC RRT LQCQ+ N   G   + DGF+ +K  KLPD A++  + 
Sbjct  324   FRPKLQDQWNRGNWSGGCERRTELQCQRTNGAAGENGKPDGFKGLKCTKLPDLANLTLSA  383

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
              + E C+  C  +CSC AYA     GI CM W  +L+D+   D+      F+RLH SELD
Sbjct  384   GNSEACRTSCLGNCSCRAYA--FISGIGCMTWTVDLIDL-HFDQSGSLQFFLRLHHSELD  440

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK---------KRDEIPRTELPT  1210
              +  K +I+V + +    A  ++VS+WLL   R +++           K D++   ++  
Sbjct  441   GRR-KISILVIIIITVLGACFLVVSLWLLWRYRNKLKGLPAVSSMPCCKDDDVAVFDVSK  499

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S EFS+D S   D+ ++G      +L  FSFS +A AT++F +ANKLGQGGFG V+KG L
Sbjct  500   SKEFSADLSGPSDILIDGNQINGPELPMFSFSCVATATENFCVANKLGQGGFGDVFKGEL  559

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P GQEIAVKRLS  SGQG++EF NE+ +IAKLQHRNLVRLLGC I+G+EKML+YEYMPNK
Sbjct  560   PGGQEIAVKRLSGHSGQGLEEFKNEIILIAKLQHRNLVRLLGCSIQGEEKMLIYEYMPNK  619

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD+F+FD AK+++L+WR R  IIE IARGLLYLHRDSRLRIIHRDLK SNILLD EMNP
Sbjct  620   SLDNFLFDEAKQAQLDWRTRLSIIEGIARGLLYLHRDSRLRIIHRDLKTSNILLDAEMNP  679

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGR
Sbjct  680   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  739

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+  H+ +I YAW  W E K M+L+DPSI  SC P EVL+CI +G+LCVQD A+H
Sbjct  740   RNTSVRSSQHTSLIGYAWHLWSEDKAMDLVDPSIQDSCFPTEVLKCIHIGMLCVQDNAMH  799

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             RP M+AVVL LE++  TLP+PR PTYT SMR S+D +      E+ SSN +T+++
Sbjct  800   RPTMAAVVLMLESETPTLPMPRQPTYT-SMRSSIDAEFTMDGQEIVSSNDVTVTM  853



>gb|KDP20854.1| hypothetical protein JCGZ_21325 [Jatropha curcas]
Length=854

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/810 (55%), Positives = 564/810 (70%), Gaps = 35/810 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D+I+ G+ I+D GE +VS+ E F LGFF+PE ++ RYVGI Y++I  Q V+WVANR+R
Sbjct  23    AIDRIKNGESIQD-GETLVSSEEIFELGFFNPENSTLRYVGIRYHKIPGQPVIWVANRDR  81

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI ++NG+F I  +G  ++ DG   SIW++N +++++N   +L N+  L  L +D    N
Sbjct  82    PISNRNGSFKIGEDGNLIITDGNGNSIWSSNQNISNNNTVAILENSGTLK-LSSD----N  136

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               +W+SF  PTDTFLP M+V   LSAGE ++FTSW ++ +PSPG F+MGIDP  +PQI+I
Sbjct  137   EELWESFEHPTDTFLPNMKVRASLSAGEQRVFTSWKSATDPSPGNFTMGIDPSGAPQILI  196

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRT---DFVYGFDLITENDNLYLEYK-SSSSDLIMFKV  1888
             W+   R WRSG+WDG++F GVP  T   +  YGF  + +    ++ Y  S+SSDL+ F +
Sbjct  197   WKNSTRRWRSGYWDGQIFTGVPNMTILANIRYGFKFVMD----FMTYTPSNSSDLMRFHI  252

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+G E Q +WN  + +W  +Q QPA+ C +YN CG F  C  SS+    C C+ GF+P 
Sbjct  253   RWDGYEEQLKWNVEKNEWDVMQTQPANDCELYNFCGSFGVCKESSNP--KCKCLDGFSPR  310

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               ++W   NW+GGC R   LQCQ+N T GG    DGF+E+   KLPDFA + R   S E 
Sbjct  311   HPDEWMKGNWSGGCVRTAELQCQRNTTNGG---NDGFKELSCNKLPDFAVV-RTGVSLES  366

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS-S  1351
             C++ C  +CSCNA+A  V   I CM+W  +L+D+          + +RL  SE D K  S
Sbjct  367   CQEMCLSNCSCNAFA--VVQNIGCMIWNGDLIDIQDFGIPR-IVMHLRLADSEFDGKKLS  423

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAK-------KRDEIPRTELPTSGEFSS  1192
                I + V        L ++ IW L  RR ++          ++ E P  +   S E+S+
Sbjct  424   AAVIALIVVAGVIFVALFVLLIWGL-QRRLKVSPAAISASLMRKSEKPFFDKSKSKEYST  482

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             + S   DL ++G      DL  ++F+S+ AAT++FS  NKLGQGGFGHVYKG LP G+EI
Sbjct  483   EMSGPADLFIDGSPVNGPDLPLYNFNSVVAATNNFSEENKLGQGGFGHVYKGKLPGGEEI  542

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLS+ SGQG+QEF NE+ +IAKLQHRNLVRLLGCCIEG+EKMLLYEYMPNKSLD F+
Sbjct  543   AVKRLSKISGQGLQEFKNEIILIAKLQHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDGFL  602

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FD AK++ L+W+ RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFG
Sbjct  603   FDSAKQALLDWKTRFDIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFG  662

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             MARIFGGNQNE NTNRVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR
Sbjct  663   MARIFGGNQNELNTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  722

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
             +  H  +I YAWE W E + M L+D SI  SC   EVL+CI +G+LCVQD AVHRP MSA
Sbjct  723   STIHVSLIAYAWELWRENRTMELVDLSIRDSCNESEVLKCIHVGMLCVQDSAVHRPTMSA  782

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDV  202
             V+L LET++ TLP+PR PTYT S R S+D 
Sbjct  783   VLLMLETNSPTLPLPRQPTYT-STRTSIDT  811



>ref|XP_008224905.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Prunus mume]
Length=871

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/842 (53%), Positives = 584/842 (69%), Gaps = 33/842 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQ--SVVWVANR  2416
             AA  I QG+ ++D GE ++S  +KF LGFFSPE +  RYVGIWY  I     SV+WVANR
Sbjct  40    AASSITQGRSLRD-GETLISDGKKFELGFFSPENSPYRYVGIWYYNIATSEPSVIWVANR  98

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             ERPI DK G   I  NG  VVLDG N ++W++N+S +S++    + N    ++L   G  
Sbjct  99    ERPIFDKLGILKIGSNGNVVVLDGNNTAVWSSNASASSNSTA--ILNDEGNLVLSNSG-D  155

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              +   WQSF  PT+TFLPGM+V++++  GE++  TSW +  +PSPG +SMG+DPR SPQI
Sbjct  156   TSKQYWQSFADPTNTFLPGMKVEVNSAIGENRFLTSWKSENDPSPGAYSMGVDPRGSPQI  215

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMF  1894
             VIWEG  R WRSGHW+ ++F+GVP M T + YGF L  EN N  +Y  Y   + S  + F
Sbjct  216   VIWEGSNRRWRSGHWNKQLFIGVPNMPTTYSYGFKLSDENGNGSMYFTYTPWNVSAKLRF  275

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
             ++ W+G E Q  W   + QW  IQ QP  ++ C +YN CG+F  C  S  +G  C C+ G
Sbjct  276   QIRWDGYEEQLMWVGDKNQWEVIQSQPNKSNDCELYNRCGKFGVCSTSHGSGSECSCMHG  335

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG--GAEKDGFREVKHIKLPDFADIDRN  1546
             F P+D +QW   NW+ GC+R+T LQC +N T G     E+DGF  ++  KLPDFAD+   
Sbjct  336   FQPTDLDQWIKGNWSDGCSRKTLLQCHRNRTIGTEENDEEDGFVGLRCAKLPDFADLVVP  395

Query  1545  MRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
               S E+C++ C ++CSC AYA     GI CM+W  +L+D+ +  +G G+TL +RL  S+L
Sbjct  396   F-SDENCEEICLKNCSCTAYA--FVQGIGCMIWTEDLLDVQKFTKG-GNTLNIRLAHSDL  451

Query  1365  DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK---------KRDEIPRTELP  1213
               K  K + +V + +  A A+ +++ + LL   +A+++           + ++ P  +  
Sbjct  452   GGKK-KLSTLVIIVISVAGALFLVIFMLLLWRFKAKLKVLPTTSSISWLRNNDPPMLDAS  510

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S EFS+D S   DL  EG     S+L  F+F+ +AAAT++FS  NKLG+GGFG VYKG 
Sbjct  511   KSNEFSTDVSGSIDLFAEGNQVNGSELPLFNFTCVAAATNNFSEENKLGKGGFGTVYKGN  570

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             LP  QE+A+KRLSRRSGQG++EF NE+++IAKLQHRNLVRLLGCCI+G+EKMLLYEYMPN
Sbjct  571   LPGLQEVAIKRLSRRSGQGLEEFKNEISLIAKLQHRNLVRLLGCCIQGEEKMLLYEYMPN  630

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD F+F+P+K++ L+WRKRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +M 
Sbjct  631   KSLDFFLFNPSKQALLDWRKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMI  690

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG
Sbjct  691   PKISDFGMARIFGGNQNEANTTRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  750

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQ--EVLRCIQLGLLCVQDL  319
             RRNTS R+ +H  +I +AW  W+E + ++L+DPSI  +C     E+LRCIQ+GLLCVQD 
Sbjct  751   RRNTSLRSSEHLSLIGFAWHLWNENRAVDLIDPSIAETCSQNQAELLRCIQVGLLCVQDS  810

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIV  139
             A+ RP M +VVL LE++   L VP  P +T S+RR VD        +L SSN +T++++ 
Sbjct  811   AIFRPTMPSVVLMLESETANLQVPIQPIFT-SIRRYVDTKFSTDGQDLASSNDVTITMVD  869

Query  138   GR  133
             GR
Sbjct  870   GR  871



>ref|XP_010106717.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
 gb|EXC11585.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
Length=829

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/825 (53%), Positives = 563/825 (68%), Gaps = 26/825 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D I QG  +KD GE+IVS  + F LGFFSP  ++ RYVGIWY+ I   +VVWVANRER
Sbjct  25    ASDTITQGGSLKD-GESIVSDGDIFELGFFSPGNSTLRYVGIWYHNIQELTVVWVANRER  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI  K G   I  +G  V+LDG N     ++++  SSN T    N    ++L        
Sbjct  84    PISGKTGVLTIDSDGNLVILDGNNSGSIWSSNASVSSNNTTAKLNDEGNLVLSGS---TE  140

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                WQSF QPTDTFLPGM+V+ S+  GE+  F+SW +  +PSPG +SMG+DPR SPQIVI
Sbjct  141   KVYWQSFEQPTDTFLPGMKVEASSRKGENWAFSSWKSPNDPSPGNYSMGVDPRGSPQIVI  200

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEY-KSSSSDLIMFKVDW  1882
              +G +R WRSGHW+ ++F GVP M ++++YGF L  ++   Y+ Y  S+ SD + F+++ 
Sbjct  201   RKGLERRWRSGHWNKQIFTGVPNMSSNYLYGFKLQEQDGTSYISYVPSNGSDKLRFRIER  260

Query  1881  NGKEVQQRWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             NG E Q RW E   +W   Q QP   ++C +YN CG+F  C  SS     C C+ GF P 
Sbjct  261   NGFEEQLRWEEDNNKWRVTQYQPDKTNECELYNKCGKFGVC--SSWESPICECMDGFEPV  318

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             D  +W   NW+ GC RRT  +C+ N++ G   E+DGF  +K +K+PDFAD+     S   
Sbjct  319   DLVEWRRGNWSKGCKRRTKWKCETNSSSG--IEEDGFVVMKSVKMPDFADL-VTPGSATS  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C ++CSC AYA     GI C++W   L+D+    +G G+TL VR+  S+L  KS K
Sbjct  376   CEDMCLKNCSCAAYAEA--SGIGCLIWTTNLLDVQHFKKG-GNTLNVRVAHSDLGGKSKK  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             +T ++    V    +       L+    + +   +  EI  ++   S E S+D S   D+
Sbjct  433   STALIITLTVVGAIL-------LVLPNPSPVSWLRSSEILPSDAGKSKEHSTDLSGSIDV  485

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
              +E      S+L  F F  +A +T++FS  NKLG+GGFGHVYKG LP  QEIAVKRLSR+
Sbjct  486   -IECSQVNRSELPLFCFDVVATSTNNFSEENKLGEGGFGHVYKGKLPGEQEIAVKRLSRK  544

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EKMLLYEYMPNKSLD F+FD  KR+ 
Sbjct  545   SGQGLEEFKNEIILIAKLQHRNLVRLLGCCIQGEEKMLLYEYMPNKSLDFFLFDTEKRAL  604

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+WRKRF+IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGGN
Sbjct  605   LDWRKRFNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGN  664

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGII  448
             QNE NTNRVVGT+GYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  +H  +I
Sbjct  665   QNELNTNRVVGTFGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRNTEHLSLI  724

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              +AW  W EG+ M LLDPSI  +C   EVLRCIQLG+LCVQD  +HRP MS+V+L LE++
Sbjct  725   GFAWNIWHEGRAMELLDPSIAETCSQNEVLRCIQLGVLCVQDSPLHRPTMSSVILMLESE  784

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             N  LP+PR PT+T+     VD+D +++  +  S + +T++++ GR
Sbjct  785   NANLPLPRQPTFTSMRGNIVDMDLFSEGRDHASVSDVTVTMVDGR  829



>ref|XP_011011557.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Populus euphratica]
Length=839

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/809 (54%), Positives = 561/809 (69%), Gaps = 29/809 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + + +GQ +KD GE+++S +E F LGFFSP  +S RYVGI Y +I  Q+V+WVANRE+
Sbjct  30    AINTLTRGQSLKD-GESLISVDENFELGFFSPGNSSLRYVGIRYYKIQDQAVIWVANREK  88

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   NG   I  +G  +V DG    +W++N+SV SSN   +L  T  LI+   D     
Sbjct  89    PISGSNGVLRIGEDGNLLVADGNGSPVWSSNASVVSSNTAAMLDVTGNLILSSNDTIGET  148

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF  PTDT+LP M+V +S+ E   FTSW ++ +PSPG F+MG+DPR  PQIV+W
Sbjct  149   DKAYWQSFSNPTDTYLPNMKVLISSAEIHAFTSWKSANDPSPGNFTMGVDPRGIPQIVVW  208

Query  2052  EGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLITEND-NLYLEYK-SSSSDLIMFKV  1888
             EG +R WRSGHW+G +F GVP     T + +GF    E+D N Y+ Y  S++S+ + F++
Sbjct  209   EGSRRRWRSGHWNGIIFSGVPYMKAFTTYQFGFKFSRESDGNCYVTYNPSNNSEFLRFQI  268

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E  ++WNES K W  +Q QP+++C  YN+CG F  C  +SS    C C+ GF P 
Sbjct  269   TWNGFEESRKWNESAKTWQVMQSQPSEECENYNYCGNFGVC--TSSGSPKCRCMEGFEPR  326

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ+N + GG   +DGF+ VK  KLPDFAD++    S + 
Sbjct  327   HPDQWRLGNWSGGCGRRSPLQCQRNTSSGG---EDGFKTVKCTKLPDFADVES--ISLDA  381

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+++C  +CSC AYA      I CM+W  +L+D+    EG G TL++RL  SEL    S+
Sbjct  382   CRERCLNNCSCKAYAHV--SEIQCMIWNGDLIDVQYSVEGEG-TLYLRLADSELGR--SR  436

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRA---------KKRDEIPRTELPTSGEFS  1195
                 + + +V A    + +SIWLL   +  ++            + E P  +L    EF+
Sbjct  437   MPTYMIILIVLAGLAFLAISIWLLWMLKKSLKVMPAATSAFTSTKCEFPVYDLSKGKEFA  496

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             +D S   DL +E      SDL   SF+ +AAATD+FS  NKLGQGGFG VYKG LP G+E
Sbjct  497   TDASGSADLVIEVCQVNGSDLPILSFNCVAAATDNFSEENKLGQGGFGLVYKGKLPGGEE  556

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLS  SGQG  EF NE+ +IAKLQHRNLVRLLGC ++G+EKML+YEYMPNKSLD F
Sbjct  557   IAVKRLSNISGQGFLEFKNEIMLIAKLQHRNLVRLLGCSLQGNEKMLIYEYMPNKSLDYF  616

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP K++ L+W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDF
Sbjct  617   LFDPDKQALLDWSKRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDF  676

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             GMARIFGGNQ+E NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  677   GMARIFGGNQSEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  736

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R  +   +I YAW+ W+EGK M+++D SI  SC   EVLRCIQ+G+LCVQD A+HRP M+
Sbjct  737   RQTERMILIAYAWDLWNEGKAMDIVDLSIRDSCDENEVLRCIQIGMLCVQDSALHRPCMA  796

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSV  208
             +V++ LE+    +P+PR PT+T S+R S+
Sbjct  797   SVMVMLESCTTNIPLPRQPTFT-SVRASI  824



>ref|XP_010059473.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Eucalyptus grandis]
Length=867

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/844 (52%), Positives = 581/844 (69%), Gaps = 39/844 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I QGQ++  D E ++S++  F LGFFSP+ +S RYVGIWY ++   +VVWVANR+ 
Sbjct  38    AANSISQGQFVGKD-ETLISSSGNFELGFFSPQNSSRRYVGIWYRKMSVNTVVWVANRDS  96

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIILKT----  2248
             P+ D++G   ++G+G  VVLDG  + V     NSS   +N+T VL +T  L++L +    
Sbjct  97    PVSDESGVLTVSGDGNLVVLDGNNRTVWSSGINSSSVRTNSTAVLMDTGNLVLLASADAG  156

Query  2247  ------DGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSM  2092
                   DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW +  +PS G F M
Sbjct  157   SASAYGDG---SNSYWQSFEHPTDTYLPGMRVRVNPVAGENRAFRSWKSLDDPSSGDFFM  213

Query  2091  GIDPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYK  1921
             GIDPR  PQIVIW    R WRSGHW+G +F GV  M  +F YGF L  I  + N+Y  Y 
Sbjct  214   GIDPRLPPQIVIWGQSGREWRSGHWNGVIFTGVQNMTGNFQYGFKLSDIDADGNMYFTYT  273

Query  1920  SS-SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNG  1744
             SS SS+ +MF++ WNGKE Q  W+E+  +W  +QEQPA +C +YN CG FA C+   S  
Sbjct  274   SSNSSNHLMFRILWNGKEEQLGWDETSNEWTVLQEQPAKECDLYNKCGNFAICNEMDSP-  332

Query  1743  INCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLP  1570
               C C+  F+P   +QWN  NW+ GC R+T LQC+ N++   G G+  DGF ++  +KLP
Sbjct  333   -KCSCMKEFSPKSPDQWNRGNWSAGCARKTQLQCRDNSSISVGDGSRMDGFLKLDGVKLP  391

Query  1569  DFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLF  1390
             DFAD   +  S E+C+ KC  +CSC+AYA  +  GI C+LW  +L D+   DEG G TL 
Sbjct  392   DFAD-STSATSTEECEAKCLANCSCDAYAFAI--GIKCLLWSEDLTDVQLFDEG-GLTLQ  447

Query  1389  VRLHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR----DEIPRT  1222
             +RL +SEL  KS K + +  + +V   A ++ V++WLL  RR +   K      +E+P +
Sbjct  448   IRLANSELGTKS-KISNLFIIIIVLVGAFVLGVAVWLL--RRFKDNLKGEILFCEELPLS  504

Query  1221  -ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHV  1045
              +   +GE S++ S    L  + K    +D+  F+FS+I AAT+ FS  NKLG GGFG V
Sbjct  505   HDFVENGELSAELSRPNGLARDDKQVGGADIPVFNFSTIEAATNFFSEENKLGLGGFGPV  564

Query  1044  YKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYE  865
             YKG L  GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLV LLG C++G++KML+YE
Sbjct  565   YKGKLFGGQEIAVKRLSRKSSQGLEEFKNEVMLIAKLQHRNLVGLLGFCVQGEDKMLVYE  624

Query  864   YMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLD  685
             YMPNKSLD F+FD   R +L+W+KRF IIE IARGLLYLHRDSRLRIIHRDLK SNILLD
Sbjct  625   YMPNKSLDCFIFDSVMRVQLDWKKRFEIIEGIARGLLYLHRDSRLRIIHRDLKVSNILLD  684

Query  684   GEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  505
              EMNPKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFG+LLLE
Sbjct  685   KEMNPKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGILLLE  744

Query  504   IVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQ  325
             I++G++N  F T +HS +I +AW +W+EGK + L+DP I  SC   EVLRCIQ+GLLCVQ
Sbjct  745   IITGKKNLGFHTPEHSNLISHAWHRWNEGKGIELIDPCIRDSCSTDEVLRCIQIGLLCVQ  804

Query  324   DLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             D  VHRP M  VVL L ++ V LP+P+ P  + S+  S+D  S  ++ E+ SSN IT+S 
Sbjct  805   DSTVHRPAMPTVVLLLGSETVDLPIPKLPM-SISITGSMDTYSLFESQEIESSNGITVSS  863

Query  144   IVGR  133
             + GR
Sbjct  864   VDGR  867



>gb|KHN19084.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Glycine soja]
Length=847

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/845 (51%), Positives = 561/845 (66%), Gaps = 51/845 (6%)
 Frame = -3

Query  2580  KIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             +I QG  I+D + E +VS    F +GFFS + +S+RYVGIWY+ I    V+WVANR++PI
Sbjct  25    RITQGVTIRDKEHETLVSEELNFAMGFFSSDNSSSRYVGIWYDNIPGPEVIWVANRDKPI  84

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
                 GA  I+ +G  VVLDG        N +    + N++  LR+   L++         
Sbjct  85    NGTGGAITISNDGNLVVLDGAMNHVWSTNVSIDDNNKNSSATLRDDGNLVLTCE-----R  139

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA-GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
               +WQSF  PTDT++PGM+V +     S +FTSW ++ +PS G ++MG+DP   PQIV+W
Sbjct  140   KEVWQSFENPTDTYMPGMKVSVGGLSTSHVFTSWKSATDPSKGNYTMGVDPEGLPQIVVW  199

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDWN  1879
             EGEKR WRSG+WDGR+F G+ +   ++YGF L  +     Y  Y   + +D + F++ W+
Sbjct  200   EGEKRRWRSGYWDGRMFQGLSIAASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGWD  259

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN----CVCIVGFNP  1711
             G E + RWNE  K W +IQ+ P  +C VYN CG FA CD  + +  +    C CI GF P
Sbjct  260   GYEREFRWNEDEKSWNEIQKGPFHECDVYNKCGSFAACDVLTLSPEDLVPVCTCIRGFEP  319

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQK-NNTEGGGAE--KDGFREVKHIKLPDFA------D  1558
                +QW+  NW+GGCTR TPL+ Q+ N T G G    +DGF + K +KLPDFA      D
Sbjct  320   KHKDQWDKGNWSGGCTRMTPLKAQRINVTSGTGVSVGEDGFLDRKSMKLPDFALVVGTND  379

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              DR   S          + SC AYA     G+ CM+W  +LVD+  L+ G G+TL++RL 
Sbjct  380   CDRECFS----------NDSCTAYANV--NGLGCMVWHGDLVDIQHLESG-GNTLYIRLA  426

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA----------KKRDEIP  1228
              S+LD+   KT  IV +S V A  + + + +WL+   +A+++           K  + +P
Sbjct  427   HSDLDD-GGKTNRIVIISTVVAGLICLGIFVWLVWRFKAKLKVLPTVSSVSCCKSSNVLP  485

Query  1227  RTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGH  1048
               +   S E S++FS   DLT+EG   +  +   F+FS I+ AT++FS  NKLGQGGFG 
Sbjct  486   VFDENKSREMSAEFSGSADLTLEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGGFGP  545

Query  1047  VYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLY  868
             VYKG LP G++IAVKRLSRRSGQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+L+Y
Sbjct  546   VYKGKLPGGEQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLVY  605

Query  867   EYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILL  688
             EYMPNKSLD F+FDP K+++L W +RF IIE IAR LLYLHRDSRLRIIHRDLKASNILL
Sbjct  606   EYMPNKSLDCFLFDPVKQTQLPWTRRFEIIESIARALLYLHRDSRLRIIHRDLKASNILL  665

Query  687   DGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  508
             D  MNPKISDFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL
Sbjct  666   DENMNPKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  725

Query  507   EIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCV  328
             EI+SGRRNTSFR  D S +I YAW  W+E + M LLDP I  S    + LRCI +G+LCV
Sbjct  726   EILSGRRNTSFRHSDDSSLIGYAWHLWNEHRAMELLDPCIRDSSPRNKALRCIHIGMLCV  785

Query  327   QDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMS  148
             QD A HRPNMSAVVL LE++  TLP+P  P  T SMRR+ D   +     L  SN +T++
Sbjct  786   QDSAAHRPNMSAVVLMLESEATTLPMPTQPLIT-SMRRTEDRQFYMDG--LDVSNDLTVT  842

Query  147   VIVGR  133
             ++VGR
Sbjct  843   MVVGR  847



>ref|XP_006594639.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X1 [Glycine max]
Length=851

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/845 (51%), Positives = 560/845 (66%), Gaps = 51/845 (6%)
 Frame = -3

Query  2580  KIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             +I QG  I+D + E +VS    F +GFFS + +S+RYVGIWY+ I    V+WVANR++PI
Sbjct  29    RITQGVTIRDKEHETLVSEELNFAMGFFSFDNSSSRYVGIWYDNIPGSEVIWVANRDKPI  88

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
                 GA  I  +G  VVLDG        N +    + N++  LR+   L++         
Sbjct  89    NGTVGAITIANDGNLVVLDGAMNHVWSTNVSIDDNNKNSSATLRDDGNLVLTC-----ER  143

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA-GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
               +WQSF  PTDT++PGM+V +     S +FTSW ++ +PS G ++MG+DP   PQIV+W
Sbjct  144   KEVWQSFENPTDTYMPGMKVSVGGLSTSHVFTSWKSATDPSKGNYTMGVDPEGLPQIVVW  203

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDWN  1879
             EGEKR WRSG+WDGR+F G+ +   ++YGF L  +     Y  Y   + +D + F++ W+
Sbjct  204   EGEKRRWRSGYWDGRMFQGLSIAASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGWD  263

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN----CVCIVGFNP  1711
             G E + RWNE  K W +IQ+ P  +C VYN CG FA CD  + +  +    C CI GF P
Sbjct  264   GYEREFRWNEDEKSWNEIQKGPFHECDVYNKCGSFAACDVLTLSPEDLVPVCTCIRGFEP  323

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQK-NNTEGGGAE--KDGFREVKHIKLPDFA------D  1558
                +QW+  NW+GGCTR TPL+ Q+ N T G G    +DGF + K +KLPDFA      D
Sbjct  324   KHKDQWDKGNWSGGCTRMTPLKAQRINVTSGTGVSVGEDGFLDRKSMKLPDFALVVGTND  383

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              DR   S          + SC AYA     G+ CM+W  +LVD+  L+ G G+TL++RL 
Sbjct  384   CDRECFS----------NDSCTAYANV--NGLGCMVWHGDLVDIQHLESG-GNTLYIRLA  430

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA----------KKRDEIP  1228
              S+LD+   KT  IV +S V A  + + + +WL+   +A+++           K  + +P
Sbjct  431   HSDLDD-GGKTNRIVIISTVVAGLICLGIFVWLVWRFKAKLKVLPTVSSVSCCKSSNVLP  489

Query  1227  RTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGH  1048
               +   S E S++FS   DLT+EG   +  +   F+FS I+ AT++FS  NKLGQGGFG 
Sbjct  490   VFDENKSREMSAEFSGSADLTLEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGGFGP  549

Query  1047  VYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLY  868
             VYKG LP G++IAVKRLSRRSGQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+L+Y
Sbjct  550   VYKGKLPGGEQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLVY  609

Query  867   EYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILL  688
             EYMPNKSLD F+FDP K+++L W +RF IIE IAR LLYLHRDSRLRIIHRDLKASNILL
Sbjct  610   EYMPNKSLDCFLFDPVKQTQLPWTRRFEIIESIARALLYLHRDSRLRIIHRDLKASNILL  669

Query  687   DGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  508
             D  MNPKISDFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL
Sbjct  670   DENMNPKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  729

Query  507   EIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCV  328
             EI+SGRRNTSFR  D S +I YAW  W+E + M LLDP I  S    + LRCI +G+LCV
Sbjct  730   EILSGRRNTSFRHSDDSSLIGYAWHLWNEHRAMELLDPCIRDSSPRNKALRCIHIGMLCV  789

Query  327   QDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMS  148
             QD A HRPNMSAVVL LE++  TLP+P  P  T SMRR+ D   +     L  SN +T++
Sbjct  790   QDSAAHRPNMSAVVLMLESEATTLPMPTQPLIT-SMRRTEDRQFYMDG--LDVSNDLTVT  846

Query  147   VIVGR  133
             ++VGR
Sbjct  847   MVVGR  851



>ref|NP_193870.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Arabidopsis thaliana]
 sp|O81906.1|B120_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase B120; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA20204.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB81246.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 gb|ABV21215.1| At4g21390 [Arabidopsis thaliana]
 gb|AEE84447.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Arabidopsis thaliana]
Length=849

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/843 (51%), Positives = 579/843 (69%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AA+ I++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AANTIRRGESLRDGINHKPLVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               RP   IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDRP---IWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+WEG K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWEGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
              S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   PSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
             + N+  PEDC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   EHNLVDPEDCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +N+ +K  +IVAV V   +  +  + +W    ++    A         +   +L  
Sbjct  429   SEVGENRKTKIAVIVAVLVGVILIGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVADLTK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VYKGVL
Sbjct  489   SKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM++V+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMASVLLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>ref|XP_006594640.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X2 [Glycine max]
Length=847

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/841 (51%), Positives = 559/841 (66%), Gaps = 47/841 (6%)
 Frame = -3

Query  2580  KIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             +I QG  I+D + E +VS    F +GFFS + +S+RYVGIWY+ I    V+WVANR++PI
Sbjct  29    RITQGVTIRDKEHETLVSEELNFAMGFFSFDNSSSRYVGIWYDNIPGSEVIWVANRDKPI  88

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
                 GA  I  +G  VVLDG        N +    + N++  LR+   L++         
Sbjct  89    NGTVGAITIANDGNLVVLDGAMNHVWSTNVSIDDNNKNSSATLRDDGNLVLTC-----ER  143

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA-GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
               +WQSF  PTDT++PGM+V +     S +FTSW ++ +PS G ++MG+DP   PQIV+W
Sbjct  144   KEVWQSFENPTDTYMPGMKVSVGGLSTSHVFTSWKSATDPSKGNYTMGVDPEGLPQIVVW  203

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDWN  1879
             EGEKR WRSG+WDGR+F G+ +   ++YGF L  +     Y  Y   + +D + F++ W+
Sbjct  204   EGEKRRWRSGYWDGRMFQGLSIAASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGWD  263

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN----CVCIVGFNP  1711
             G E + RWNE  K W +IQ+ P  +C VYN CG FA CD  + +  +    C CI GF P
Sbjct  264   GYEREFRWNEDEKSWNEIQKGPFHECDVYNKCGSFAACDVLTLSPEDLVPVCTCIRGFEP  323

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQK-NNTEGGGAE--KDGFREVKHIKLPDFA------D  1558
                +QW+  NW+GGCTR TPL+ Q+ N T G G    +DGF + K +KLPDFA      D
Sbjct  324   KHKDQWDKGNWSGGCTRMTPLKAQRINVTSGTGVSVGEDGFLDRKSMKLPDFALVVGTND  383

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              DR   S          + SC AYA     G+ CM+W  +LVD+  L+ G G+TL++RL 
Sbjct  384   CDRECFS----------NDSCTAYANV--NGLGCMVWHGDLVDIQHLESG-GNTLYIRLA  430

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR------DEIPRTEL  1216
              S+LD+   KT  IV +S V A  + + + +WL+   +A+++          + +P  + 
Sbjct  431   HSDLDD-GGKTNRIVIISTVVAGLICLGIFVWLVWRFKAKLKVSSVSCCKSSNVLPVFDE  489

Query  1215  PTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKG  1036
               S E S++FS   DLT+EG   +  +   F+FS I+ AT++FS  NKLGQGGFG VYKG
Sbjct  490   NKSREMSAEFSGSADLTLEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGGFGPVYKG  549

Query  1035  VLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMP  856
              LP G++IAVKRLSRRSGQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+L+YEYMP
Sbjct  550   KLPGGEQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLVYEYMP  609

Query  855   NKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEM  676
             NKSLD F+FDP K+++L W +RF IIE IAR LLYLHRDSRLRIIHRDLKASNILLD  M
Sbjct  610   NKSLDCFLFDPVKQTQLPWTRRFEIIESIARALLYLHRDSRLRIIHRDLKASNILLDENM  669

Query  675   NPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVS  496
             NPKISDFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI+S
Sbjct  670   NPKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEILS  729

Query  495   GRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
             GRRNTSFR  D S +I YAW  W+E + M LLDP I  S    + LRCI +G+LCVQD A
Sbjct  730   GRRNTSFRHSDDSSLIGYAWHLWNEHRAMELLDPCIRDSSPRNKALRCIHIGMLCVQDSA  789

Query  315   VHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVG  136
              HRPNMSAVVL LE++  TLP+P  P  T SMRR+ D   +     L  SN +T++++VG
Sbjct  790   AHRPNMSAVVLMLESEATTLPMPTQPLIT-SMRRTEDRQFYMDG--LDVSNDLTVTMVVG  846

Query  135   R  133
             R
Sbjct  847   R  847



>dbj|BAF01045.1| serine/threonine kinase - like protein [Arabidopsis thaliana]
Length=849

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/841 (51%), Positives = 579/841 (69%), Gaps = 38/841 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AA+ I++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AANTIRRGESLRDGINHKPLVSPQKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ATPISDQSGVLMISNDGNLVLLDGKNITVWSSNIESSTTNNNNRVVSIHDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               RP   IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDRP---IWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+WEG K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWEGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
              S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   PSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
             + N+  PEDC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   EHNLVDPEDCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +N+ +K  +IVAV V   +  +  + +W    ++    A         +   +L  
Sbjct  429   SEVGENRKTKIAVIVAVLVGVILIGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVADLTK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VYKGVL
Sbjct  489   SKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKGVL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCSKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVIVG  136
             RPNM++ +L LE+D  TL  PR PT+T++ R S+DV+    +++  + SSN IT +V++G
Sbjct  789   RPNMASALLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVLG  848

Query  135   R  133
             R
Sbjct  849   R  849



>ref|XP_007148274.1| hypothetical protein PHAVU_006G194500g [Phaseolus vulgaris]
 gb|ESW20268.1| hypothetical protein PHAVU_006G194500g [Phaseolus vulgaris]
Length=849

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/836 (51%), Positives = 549/836 (66%), Gaps = 36/836 (4%)
 Frame = -3

Query  2580  KIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             +I     I+D D E +VS    FV+GFF  + +S+RYVGIWY+ I    V+WVANR++PI
Sbjct  30    RITHDVVIRDNDRETLVSEELNFVMGFFGLDNSSSRYVGIWYHNIPATPVIWVANRDKPI  89

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
                 G+  +  +G  VVLDG        N +   ++ N +  L +T  LI+         
Sbjct  90    NGTGGSITVANDGNLVVLDGAKNLVWSTNVSIDSSNKNCSATLHDTGNLILSSE-----K  144

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAGESK----LFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
               +W SF  PTDTF+PGMRV + A   K    +F+SW +S +PS G ++MG+DP   PQI
Sbjct  145   KELWHSFENPTDTFMPGMRVPVGAATGKSGGYVFSSWKSSTDPSRGNYTMGVDPEGLPQI  204

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKV  1888
             V+WEG+KR WR+G+WDG  F GV MR +F+YGF L  +     Y  Y   + +D + F++
Sbjct  205   VVWEGDKRRWRTGYWDGITFEGVSMRGNFLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQM  264

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+G E + RWNE  K+W  IQ  P+ +C VYN CG FA CD S S+   C CI GF P 
Sbjct  265   GWDGYETEFRWNEDEKRWDVIQRGPSHECEVYNKCGSFAACDVSPSDLPVCACIRGFEPK  324

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEK-----DGFREVKHIKLPDFADIDRNM  1543
               +QWN  NW+ GCTR TPL+ Q+ N    G  +     D F E + +KLPD A +    
Sbjct  325   SRDQWNKGNWSSGCTRMTPLKAQRKNVTSAGTTQVSVGEDEFLERRSMKLPDLARV----  380

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
                 DC + C  D SC AYA     GI CM+W  +LVD+ + D G G+TL +RL  S+LD
Sbjct  381   VGTNDCHQVCLNDDSCTAYANV--NGIGCMVWNGDLVDIQRYD-GGGNTLHIRLADSDLD  437

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRTELPTSGE  1201
             +   K  I +  +VVA    L I   WL+   R +++       K  D +P  +   S +
Sbjct  438   DGGKKNIIAIISAVVAGFICLGIFV-WLVYRFRGKLKVSPASCCKNSDVLPVFDGSKSRD  496

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
              S++FS   D ++EG      +   F+FS I+ AT++FS  NKLG+GGFG VYKG LP G
Sbjct  497   MSAEFSGSADHSLEGSQLRGPEFPLFNFSCISVATNNFSEENKLGKGGFGPVYKGKLPDG  556

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             ++IAVKRLSRRSGQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+L+YEYMPNKSLD
Sbjct  557   EQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLVYEYMPNKSLD  616

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
              F+FDP K+++L+WR+RF IIE IARGLLYLHRDSRLRIIHRDLKASN+LLD  MNPKIS
Sbjct  617   CFLFDPFKQTQLDWRRRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNVLLDESMNPKIS  676

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI+SGRRNT
Sbjct  677   DFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEILSGRRNT  736

Query  480   SFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             SFR  D S +I YAW  W+E + M L+DP I +S      LRCI +G+LCVQD A  RPN
Sbjct  737   SFRHTDDSSLIGYAWHLWNEQRAMELVDPCIRNSSPKSRALRCIHIGMLCVQDSAAQRPN  796

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             MSAVVL LE++  TLP P  P  T SMRRS D   + +   L  SN +T++++VGR
Sbjct  797   MSAVVLMLESEATTLPTPTQPLIT-SMRRSEDRQFYMEG--LDVSNDLTVTMVVGR  849



>gb|EYU27870.1| hypothetical protein MIMGU_mgv1a002421mg [Erythranthe guttata]
Length=677

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/688 (58%), Positives = 514/688 (75%), Gaps = 19/688 (3%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVFL  1999
             + +++  GE ++FTSW  + +PSPG ++MG+DPR SPQIVIWEG  R WR+GHW+G VF+
Sbjct  3     VHMNIEQGEKRVFTSWKTATDPSPGNYTMGVDPRGSPQIVIWEGRNRRWRTGHWNGFVFI  62

Query  1998  GVP-MRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDWNGKEVQQRWNESRKQWIK  1828
             GV  MR  ++ GF L+ E D  LY  Y   +SSDL+ F+++W+G E Q+RW +SR++W  
Sbjct  63    GVQGMRAVYLQGFKLLNEGDGGLYFIYTLLNSSDLVKFQINWDGVEKQERWIDSRREWSV  122

Query  1827  IQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPL  1648
             +Q  P ++C  YNHCG F RC+        C C+ GF P D + W+  NW+GGC R+T L
Sbjct  123   LQSHPVEECDSYNHCGAFGRCNEIDVP--KCSCVKGFVPKDNDAWSRGNWSGGCVRKTEL  180

Query  1647  QC-QKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPVP  1471
             QC +KNN+       DGF +V ++KLPDF D   N+ + +  +   +   SC AYA    
Sbjct  181   QCREKNNSV---EANDGFVKVDNVKLPDFVDYVGNIDAEDCREMCLKNC-SCTAYA--FV  234

Query  1470  GGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlviv  1291
              GI+CM+W  ELVD+ Q  +  G TLF+RL  SE  N  ++   ++ ++ V A   LV V
Sbjct  235   SGINCMIWNRELVDVQQFGQ-DGRTLFIRLARSEFGN-CARVIKVIVITAVVAGIFLVCV  292

Query  1290  sIWLLCSRRARIR-AKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFS  1114
             S+W L  R+++ +   KR+EIP+ +   SGE S+D S  CD  VE +    ++L  ++F+
Sbjct  293   SVWFLFKRKSKCKDILKRNEIPKVD--PSGECSTDISGPCDFGVESEQPNGTELPIYTFN  350

Query  1113  SIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKL  934
             S+ AAT++FS  NKLGQGGFG VYKG LPCGQEIA+KRLSR+SGQGV+EF NE+ +IAKL
Sbjct  351   SVVAATNNFSDENKLGQGGFGPVYKGTLPCGQEIAIKRLSRKSGQGVEEFKNEIMLIAKL  410

Query  933   QHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLL  754
             QHRNLVRLLGCCI+G+EKML+YEYMPNKSLDS++FDP K+++L+W KRF+IIE IARGLL
Sbjct  411   QHRNLVRLLGCCIQGEEKMLIYEYMPNKSLDSYLFDPDKKAQLDWSKRFNIIEGIARGLL  470

Query  753   YLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAP  574
             YLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAP
Sbjct  471   YLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAP  530

Query  573   EYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDP  394
             EYAMEGLFS+KSDVYSFGVLLLEI++GRRNTSFR+ D+S II YAW  WD G+ + L+DP
Sbjct  531   EYAMEGLFSLKSDVYSFGVLLLEIITGRRNTSFRSTDYSNIIGYAWNLWDSGRAIELVDP  590

Query  393   SIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRR  214
              I +S   ++VLRCI +G+LCVQD+A HRPNM AV+L LE++N  LP+PR PT+T SMR 
Sbjct  591   LISNSYSREQVLRCIHVGMLCVQDVAGHRPNMPAVILMLESENSGLPMPRQPTFT-SMRH  649

Query  213   SVDVDSWNQNNE-LPSSNSITMSVIVGR  133
             ++D D WN+NN+ + SSN++T+SVI+GR
Sbjct  650   NLDGDMWNENNQDVVSSNNVTISVILGR  677



>gb|AID21646.1| At4g21390p-like protein [Arabidopsis lyrata]
Length=851

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/843 (50%), Positives = 580/843 (69%), Gaps = 40/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGSIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi-----wntnssvtssnatmVLRNTSELIILK  2251
              +PI D++G   I+ +G  V+LDGKN+++      ++ ++  ++N  + + +T   ++ +
Sbjct  85    AKPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNNNRVVSIHDTGNFVLSE  144

Query  2250  TDGWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPR  2077
             TD  R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP 
Sbjct  145   TDTDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPS  201

Query  2076  ASPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-K  1921
              +P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  
Sbjct  202   GAPEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVP  261

Query  1920  SSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI  1741
             S SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI
Sbjct  262   SDSSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI  321

Query  1740  NCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFA  1561
              C CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF 
Sbjct  322   -CSCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFE  371

Query  1560  DIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRL  1381
                 ++  P DC+++C  +CSCNAY+  V GGI CM+W  +LVD+ Q + G GS L +RL
Sbjct  372   IPAHDLVDPADCRERCLRNCSCNAYS--VVGGIGCMIWNQDLVDLQQFEAG-GSLLHIRL  428

Query  1380  HSSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTEL  1216
               SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++
Sbjct  429   ADSEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADM  488

Query  1215  PTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKG  1036
             P S E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKG
Sbjct  489   PKSKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKENELGRGGFGPVYKG  548

Query  1035  VLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMP  856
             VL  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMP
Sbjct  549   VLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMP  608

Query  855   NKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEM  676
             NKSLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EM
Sbjct  609   NKSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEM  668

Query  675   NPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVS  496
             NPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVS
Sbjct  669   NPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVS  728

Query  495   GRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
             G+RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A
Sbjct  729   GKRNTSLRSSEHGSLIGYAWYLYTYGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSA  788

Query  315   VHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVI  142
               RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV+    +++  + SSN IT +V+
Sbjct  789   AERPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQYIVSSNEITSTVV  848

Query  141   VGR  133
             +GR
Sbjct  849   LGR  851



>ref|XP_010439484.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Camelina sativa]
Length=849

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/843 (51%), Positives = 574/843 (68%), Gaps = 40/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGEN--IVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AA+ +++G+ +KD   +  +VS  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  23    AAETLRRGESLKDGVHHKPLVSPQKTFELGFFSPGASTSRYLGIWYGNIEDKAVVWVANR  82

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKn----vsiwntnssvtssnatmVLRNTSELIILKT  2248
             E PILD++G   I+ +G  V+LDGKN     +   ++S+  ++N  + + +T   ++ +T
Sbjct  83    ETPILDQSGVLTISNDGNLVLLDGKNITVWSTNIKSSSNNNNNNRIVSIHDTGNFVLSET  142

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D    +  IW+SF  PTDTFLP M  RV+   G++ +F SW +  +PSPG +S+G+DP  
Sbjct  143   D---TDTAIWESFDHPTDTFLPQMKVRVNPQTGDNHVFVSWRSETDPSPGNYSLGVDPSG  199

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+WEG   R WRSG W+  VF G+P   + T+++YGF L +   E  ++Y  Y  S
Sbjct  200   APEIVLWEGNNTRKWRSGQWNSAVFTGIPIMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  259

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
               S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   +NGI 
Sbjct  260   DPSMLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDTECDQYNRCGKFGICDMKGTNGI-  318

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C C+ G+ P      +  NW+ GC RRTPL+C++N + G    +  F  +K +KLPDF  
Sbjct  319   CSCVHGYEPV-----SVGNWSRGCRRRTPLKCERNVSVG----EHEFLTLKSVKLPDFEI  369

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              + ++  P DCK++C ++CSCNAY   V GGI CM+W  +LVD+ Q + G GS+L +R+ 
Sbjct  370   PEHDLVDPSDCKERCLKNCSCNAYT--VIGGIGCMIWNQDLVDLQQFEAG-GSSLHIRVA  426

Query  1377  SSEL--DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA---KKRDEIPRTELP  1213
              SE+    KS K  IIVAV V   +  +  + +W    ++    A   K  D      + 
Sbjct  427   DSEIGEKKKSKKMVIIVAVLVGVVLLGVFALLLWRFKRKKDVSGAYCGKSTDTSVVVAVT  486

Query  1212  T-SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKG  1036
             T S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VYKG
Sbjct  487   TKSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAVATNDFCKENELGRGGFGPVYKG  546

Query  1035  VLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMP  856
             VL  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMP
Sbjct  547   VLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMP  606

Query  855   NKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEM  676
             NKSLD F+FD  K+  ++W  RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDGEM
Sbjct  607   NKSLDFFLFDETKQELIDWNLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEM  666

Query  675   NPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVS  496
             NPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVS
Sbjct  667   NPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVS  726

Query  495   GRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
             G+RNTS R+ +H  +I YAW  +  G+    +DP I  +C  +E LRCI + +LCVQD A
Sbjct  727   GKRNTSLRSSEHGSLIGYAWYLYTHGRSEEFVDPKIRVTCNKREALRCIHVAMLCVQDSA  786

Query  315   VHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVI  142
               RPNM+AV+L LE+D  TL VPR PT+T++ R S+DV+    +++  + SSN IT +V+
Sbjct  787   ADRPNMAAVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>gb|ADQ37350.1| unknown [Arabidopsis lyrata]
Length=851

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/843 (50%), Positives = 581/843 (69%), Gaps = 40/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGSIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi-----wntnssvtssnatmVLRNTSELIILK  2251
              +PI D++G   I+ +G  V+LDGKN+++      ++ ++  ++N  + + +T   ++ +
Sbjct  85    AKPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNNNRVVSIHDTGNFVLSE  144

Query  2250  TDGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPR  2077
             TD  R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +S+G+DP 
Sbjct  145   TDTDR---VIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPS  201

Query  2076  ASPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-K  1921
              +P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  
Sbjct  202   GAPEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVP  261

Query  1920  SSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI  1741
             S SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  C+   SNGI
Sbjct  262   SDSSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICNMKGSNGI  321

Query  1740  NCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFA  1561
              C CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF 
Sbjct  322   -CSCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFE  371

Query  1560  DIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRL  1381
                 ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL
Sbjct  372   IPAHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRL  428

Query  1380  HSSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTEL  1216
               SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++
Sbjct  429   ADSEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKKKKDVSGAYCGKNTDTSVVVADM  488

Query  1215  PTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKG  1036
               + E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKG
Sbjct  489   TKNKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAIATNDFCKENELGRGGFGPVYKG  548

Query  1035  VLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMP  856
             VL  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMP
Sbjct  549   VLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMP  608

Query  855   NKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEM  676
             NKSLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EM
Sbjct  609   NKSLDVFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEM  668

Query  675   NPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVS  496
             NPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVS
Sbjct  669   NPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVS  728

Query  495   GRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
             G+RNTS R+ DH  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A
Sbjct  729   GKRNTSLRSSDHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSA  788

Query  315   VHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVI  142
               RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV+    +++  + SSN IT +V+
Sbjct  789   AERPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQYIVSSNEITSTVV  848

Query  141   VGR  133
             +GR
Sbjct  849   LGR  851



>gb|ADQ37364.1| unknown [Arabidopsis lyrata]
Length=849

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/843 (51%), Positives = 575/843 (68%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  ++ RY+GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTRRYLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ASPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNRVVSIHDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   SSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   AHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  
Sbjct  429   SEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKKKKDVSGAYCGKNTDTSVVVADMTK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             + E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKGVL
Sbjct  489   NKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAIATNDFCKENELGRGGFGPVYKGVL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTYGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>ref|XP_009372035.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Pyrus x bretschneideri]
Length=865

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/836 (53%), Positives = 565/836 (68%), Gaps = 43/836 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DGE ++S  +KFVLGFFSP  +S RYVGI Y  I   SVVWVANRE PI  ++G F I  
Sbjct  43    DGETLISDGQKFVLGFFSPGNSSFRYVGIRYYNISDPSVVWVANRENPISGESGVFKIGS  102

Query  2370  NGTFVVLDGKnvsi-----wntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFH  2206
             +G  VVLDG   ++         ++ T++N T  L +   L++  +         W+SF 
Sbjct  103   DGNLVVLDGNGTAVWSTNASTATNTSTATNTTATLSDEGSLVLSGS-----GEVYWESFD  157

Query  2205  QPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYW  2032
                DTFLPGM+V++  + GES+  TSW +  +PS G +SMG+DPR SPQ V+WEG +R W
Sbjct  158   HAADTFLPGMKVEVNDAIGESRFLTSWKSESDPSAGGYSMGVDPRGSPQFVVWEGSERRW  217

Query  2031  RSGHWDGRVFLGVP-MRTDFVYGFDLITENDN--LYLEYKSSSSDL-IMFKVDWNGKEVQ  1864
             RSGHW+ ++F+G+P M T++  GF L  EN N   Y  YK SS+ + + F++ W+G E Q
Sbjct  218   RSGHWNKQIFIGIPTMPTNYESGFRLSDENANGSSYFTYKLSSTSMKLRFRMRWDGYEEQ  277

Query  1863  QRWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWN  1690
               W E + QW  I+ QP   +QC  YN CG+F  C  S  +G  C C+ GF P D +QW 
Sbjct  278   LTWVEEKNQWEVIESQPNKTNQCEFYNKCGKFGVCSASDDSGSICSCMHGFQPRDSDQWM  337

Query  1689  ARNWTGGCTRRTPLQCQKNNTEGGGA--EKDGFREVKHIKLPDFADIDRNMRSPedckkk  1516
               NW+ GC R+T LQCQ+N+T G  A  EKDGF  ++  KLPDFAD+  N    E C++K
Sbjct  338   KGNWSEGCLRKTLLQCQRNSTNGTAASDEKDGFVGIRGAKLPDFADL-VNAGPGESCEEK  396

Query  1515  ceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTii  1336
             C E+CSC AYA     GI CM+W  +L+D+ Q   G G+TL +R+  S+L NK   +T++
Sbjct  397   CLENCSCTAYA--FVEGIGCMIWTGDLIDVEQFTLG-GNTLQIRVAHSDLGNKKKLSTVV  453

Query  1335  vavsvvaavavlvivsIWL-----------LCSRRARIRAKKRDEIPRTELPTSGEFSSD  1189
             +AV  VA    +VI+ + L           + S  +R+R     + P  +   SGEFS+D
Sbjct  454   IAVISVAGAVFVVIILLLLWRFKAKLKVLPISSSISRLRGS---DTPMLDAGKSGEFSTD  510

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              S   ++  EG     S+L  F+FSS+AAAT++FS  NKLG+GGFG VYKG LP   +IA
Sbjct  511   TSGSVNVFAEGNQVNGSELPLFNFSSVAAATNNFSEENKLGKGGFGTVYKGSLPGLPQIA  570

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSRRS QG++EF NE+++IAKLQHRNLVRLLGCCIEG+EK+L+YEYMPNKSLD F+F
Sbjct  571   VKRLSRRSTQGLEEFKNEISLIAKLQHRNLVRLLGCCIEGEEKLLVYEYMPNKSLDFFLF  630

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
              PA RS L+WRKRF IIE IARGL+YLHRDSRLRIIHRDLKASNILLD +M PKISDFGM
Sbjct  631   HPANRSLLDWRKRFTIIEGIARGLVYLHRDSRLRIIHRDLKASNILLDEDMIPKISDFGM  690

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGGN+ E NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS R+
Sbjct  691   ARIFGGNEKEENTARVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSLRS  750

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQ--EVLRCIQLGLLCVQDLAVHRPNMS  295
              +H  +I YAW  W+E + M+L+DPSI  +C     EV RCI +GLLCVQD A  RP MS
Sbjct  751   TEHLSLIGYAWHLWNENRAMDLVDPSIAETCSQNETEVSRCIHVGLLCVQDHAASRPTMS  810

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDS--WNQNNELPSSNSITMSVIVGR  133
             AVVL LE++   L +P  P +T S++R V VD+    +  ++  SN +TM+++ GR
Sbjct  811   AVVLMLESEAANLQLPVEPIFT-SIKRHVVVDTKFSTEGQDIAPSNDVTMTMVEGR  865



>gb|ADQ37384.1| unknown [Arabidopsis lyrata]
Length=849

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/843 (50%), Positives = 576/843 (68%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ASPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNRVVSIHDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   SSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   AHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  
Sbjct  429   SEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKNVSGAYCGKNTDTSVVVADMNK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKG+L
Sbjct  489   SKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGLL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>ref|XP_010449072.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Camelina sativa]
Length=849

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/845 (51%), Positives = 575/845 (68%), Gaps = 46/845 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  25    AADTMRRGESLRDGINHKPLVSRQKTFELGFFSPGASTSRYLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDG  2242
             E PI D++G   I+ +G  V+LDGKN++    N  SS  ++N  + + +T   ++ +T+ 
Sbjct  85    ETPISDQSGVLTISNDGNLVLLDGKNITVWSTNIKSSNNNNNRIVSIHDTGNFVLSETE-  143

Query  2241  WRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
                +  IW+SF+ PTDTFLP M  RV+   G++ +F SW +  +PSPG +S+G+DP  +P
Sbjct  144   --TDTAIWESFNHPTDTFLPQMKVRVNPETGDNHVFVSWRSENDPSPGNYSLGVDPSGAP  201

Query  2067  QIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSS  1912
             +IV+WEG K R WRSG W+  VF G+P   + T+++YGF L +   E  ++Y  Y  S  
Sbjct  202   EIVLWEGNKTRKWRSGQWNSAVFTGIPIMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDP  261

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   +NGI C 
Sbjct  262   SMLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDTECDQYNRCGKFGICDMKGTNGI-CS  320

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADID  1552
             C+ G+ P      +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   +
Sbjct  321   CVHGYEPV-----SVGNWSRGCRRRTPLKCERNVSVG----EDEFLTLKSVKLPDFEIPE  371

Query  1551  RNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
              ++  P DC+++C ++CSCNAY   V GGI CM+W  +LVD+ Q + G GS L +R+  S
Sbjct  372   HDLVDPSDCRERCLKNCSCNAYT--VIGGIGCMIWNQDLVDLQQFEAG-GSLLHIRVADS  428

Query  1371  ELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIR-------AKKRDEIPRTELP  1213
             E+  K  K +  V + V   V V+++    LL  R  R +        K  D      + 
Sbjct  429   EIGEK--KKSKNVVIIVAVLVGVVLLGVFALLLWRFKRKKDVSGAYCGKSTDTSVVVAVT  486

Query  1212  T-SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKG  1036
             T S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VYKG
Sbjct  487   TKSKETTSGFSGSVDIMIEGKAVNTSELPVFSLNAIAIATNDFCKENELGRGGFGPVYKG  546

Query  1035  VLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMP  856
             VL  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMP
Sbjct  547   VLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMP  606

Query  855   NKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEM  676
             NKSLD F+FD  K+  ++W  RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDGEM
Sbjct  607   NKSLDFFLFDETKQELIDWNLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEM  666

Query  675   NPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVS  496
             NPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVS
Sbjct  667   NPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVS  726

Query  495   GRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
             G+RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A
Sbjct  727   GKRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSA  786

Query  315   VHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMS  148
               RPNM+AV+L LE+D  TL VPR PT+T++ R S+DV    DS  Q   + SSN IT +
Sbjct  787   ADRPNMAAVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSQQ--YIVSSNEITST  844

Query  147   VIVGR  133
             V++GR
Sbjct  845   VVLGR  849



>gb|AID21689.1| At4g21390p-like protein [Arabidopsis lyrata]
Length=849

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/843 (50%), Positives = 577/843 (68%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ASPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNRVVSILDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDR---VIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   SSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   AHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  
Sbjct  429   SEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMNK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKG+L
Sbjct  489   SKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGLL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>ref|XP_002867851.1| hypothetical protein ARALYDRAFT_914538 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44110.1| hypothetical protein ARALYDRAFT_914538 [Arabidopsis lyrata subsp. 
lyrata]
Length=849

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/843 (50%), Positives = 576/843 (68%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGSIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
              +PI D++G   I+ +   V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    AKPISDQSGVLTISNDENLVLLDGKNITVWSSNIESSTNNNNNRVVSIHDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   SSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   AHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  
Sbjct  429   SEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKKKKDVSGAYCGKNTDTSVVVADMTK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             + E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKGVL
Sbjct  489   NKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAIATNDFCKENELGRGGFGPVYKGVL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>gb|AGN12870.1| putative S-locus lectin protein kinase-like protein [Leavenworthia 
alabamica]
Length=833

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/844 (50%), Positives = 579/844 (69%), Gaps = 37/844 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AADKI++G+ ++D  + + +VS+ + F LGFFSP  ++ RY+GIWY  I  ++VVWVANR
Sbjct  2     AADKIRRGESLRDGINHKPLVSSQKTFELGFFSPGSSTFRYLGIWYGNIEDKAVVWVANR  61

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKT  2248
               PI DK+G   I  +G  V+LDG+N+++       N++  ++N  + + +T   ++ + 
Sbjct  62    ATPISDKSGVLTINNDGNLVLLDGRNITVWSSDIKPNNNNNNNNRVVTIHDTGNFVLSEI  121

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D  R    IW+SF+ PTDTFLP MRV +++  G++  F SW +  +PSPG +++G+DP  
Sbjct  122   DTER---VIWESFNHPTDTFLPQMRVRVNSQTGDNLAFVSWKSENDPSPGNYTLGVDPTG  178

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+WE  K R WRSG W+  VF G+P   + T+++YGF L +   E  ++Y  Y  S
Sbjct  179   APEIVLWERNKTRKWRSGQWNSAVFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  238

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
               S L+ FKV +NG E + RWNE+ K+W   Q +P  +C  YN CG+F  CD   SNGI 
Sbjct  239   DPSVLLRFKVLYNGTEEELRWNETLKKWTTFQSEPDSECDNYNRCGRFGICDMKGSNGI-  297

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C CI G+ P      +  NW+ GC RRTPL+C++N +      +D F  +K +KLPDF  
Sbjct  298   CSCIKGYEPV-----SVGNWSRGCRRRTPLKCERNTSVEVVRGEDEFFTLKSVKLPDFET  352

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              + ++  P+DCK++C  +CSC+AY+  + GGI CM+W  +LVD+ Q + G GS+L +RL 
Sbjct  353   PEHDLVDPQDCKRRCLNNCSCSAYS--LVGGIGCMIWNQDLVDIQQFEAG-GSSLHIRLA  409

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRAR-------IRAKKRDEIPRTE  1219
              SE+  K    T+++ V VVA   + + V++ L   +R R        +     ++   +
Sbjct  410   DSEVGEKKKTKTVVIVVVVVAVFLLGIFVALLLWRFKRKRDVSGTYCCKNTDTSDVIVVD  469

Query  1218  LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYK  1039
             +P S E S+ FS   D+ +EGKA  +S+L  FS  +I AAT+ F   N+LG+GGFG VYK
Sbjct  470   MPKSKEASTAFSGSVDIMIEGKAINTSELPVFSMKTIVAATNDFCKENELGRGGFGPVYK  529

Query  1038  GVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYM  859
             GVL  GQEIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYM
Sbjct  530   GVLEDGQEIAVKRLSVKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYM  589

Query  858   PNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGE  679
             PNKSLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD E
Sbjct  590   PNKSLDFFLFDETKQALIDWKLRFEIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAE  649

Query  678   MNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIV  499
             MNPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIV
Sbjct  650   MNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIV  709

Query  498   SGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDL  319
             SG+RNTS R+ +H  +I Y W  +  G+   L+DP I  +C  +E LRCI + +LCVQD 
Sbjct  710   SGKRNTSLRSTEHGSLIGYGWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDS  769

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSV  145
             A  RPNM+AV+L LE+D  TLPVP+ PT+T++ R S+DV+    +++  + SSN IT ++
Sbjct  770   AAERPNMAAVLLMLESDTSTLPVPKQPTFTSNRRNSIDVNFALDSSQQYIVSSNEITNTI  829

Query  144   IVGR  133
             ++GR
Sbjct  830   VLGR  833



>gb|ADQ37375.1| unknown [Arabidopsis lyrata]
Length=849

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/843 (50%), Positives = 576/843 (68%), Gaps = 42/843 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +++R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTHRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTD  2245
               PI D++G   I+ +G  V+LDGKN++       +S+  ++N  + + +T   ++ +TD
Sbjct  85    ASPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNNRVVSILDTGNFVLSETD  144

Query  2244  GWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  +
Sbjct  145   TDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGA  201

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSS  1915
             P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  202   PEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  261

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C
Sbjct  262   SSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-C  320

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF   
Sbjct  321   SCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIP  371

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  
Sbjct  372   AHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLAD  428

Query  1374  SEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPT  1210
             SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  
Sbjct  429   SEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMTK  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             + E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKGVL
Sbjct  489   NKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAIATNDFCKENELGRGGFGPVYKGVL  548

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  549   EDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  608

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNP
Sbjct  609   SLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNP  668

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  669   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  728

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  
Sbjct  729   RNTSLRSSEHGSLIGYAWYLYTYGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAE  788

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVI  142
             RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V+
Sbjct  789   RPNMAAVLLMLESDTATLAAPREPTFTSNRRNSIDVNFALDSSQQ--YIVSSNEITSTVV  846

Query  141   VGR  133
             +GR
Sbjct  847   LGR  849



>gb|AID21588.1| At4g21390p-like protein [Arabidopsis halleri]
Length=848

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/842 (51%), Positives = 574/842 (68%), Gaps = 41/842 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  ++ R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTRRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDG  2242
              +PI D++G   I+ +G  V+LDGKN++    N  SS  ++N  + + +T   ++ +TD 
Sbjct  85    AKPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSTNNNNRVVSIHDTGNFVLSETDT  144

Query  2241  WRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
              R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  +P
Sbjct  145   DR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAP  201

Query  2067  QIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSS  1912
             +IV+W G   R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S S
Sbjct  202   EIVLWGGNNTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDS  261

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C 
Sbjct  262   SMLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-CS  320

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADID  1552
             CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF    
Sbjct  321   CIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEIPA  371

Query  1551  RNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
              ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL  S
Sbjct  372   HDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLADS  428

Query  1371  EL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELPTS  1207
             E+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++  S
Sbjct  429   EIGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMNKS  488

Query  1206  GEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLP  1027
              E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKGVL 
Sbjct  489   KETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGVLE  548

Query  1026  CGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKS  847
              G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKS
Sbjct  549   DGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKS  608

Query  846   LDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPK  667
             LD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNPK
Sbjct  609   LDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPK  668

Query  666   ISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRR  487
             ISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+R
Sbjct  669   ISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKR  728

Query  486   NTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHR  307
             NTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  R
Sbjct  729   NTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAER  788

Query  306   PNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPSSNSITMSVIV  139
             PNM+AV+L LE+D  TL  PR PT+T++ R S+DV    DS  Q   + SSN IT +V++
Sbjct  789   PNMAAVLLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQ--YIVSSNEITSTVVL  846

Query  138   GR  133
             GR
Sbjct  847   GR  848



>ref|XP_010434186.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Camelina sativa]
Length=852

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/845 (50%), Positives = 576/845 (68%), Gaps = 42/845 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AA+ +++G+ ++D  + + +VS  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  24    AAETLRRGESLRDGVNHKPLVSPQKTFELGFFSPGASTSRYLGIWYGNIEEKAVVWVANR  83

Query  2415  ERPILDKNGAFGITGNGTFVVLDGK------nvsiwntnssvtssnatmVLRNTSELIIL  2254
               PI D++G   I+ +G  V+LDGK           ++N++  ++N  + + +T   ++ 
Sbjct  84    ATPISDQSGVLTISNDGNLVLLDGKNITVWSTSIKSSSNNNNNNNNRIVSIHDTGNFVLS  143

Query  2253  KTDGWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDP  2080
             +TD    +  IW+SF  PTDTFLP M  RV+   G++ +F SW +  +PSPG +S+G+DP
Sbjct  144   ETD---TDTAIWESFDHPTDTFLPQMKVRVNPQTGDNHVFVSWRSETDPSPGNYSLGVDP  200

Query  2079  RASPQIVIWEGEK-RYWRSGHWDGRVFLGVPMR---TDFVYGFDLIT---ENDNLYLEY-  1924
               +P+IV+WEG K R WRSG W+  VF G+P+    T+++YGF L +   E  ++Y  Y 
Sbjct  201   SGAPEIVLWEGNKTRKWRSGQWNSAVFTGIPIMSRLTNYLYGFKLSSPPDETGSVYFTYV  260

Query  1923  KSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNG  1744
              S  S L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   +NG
Sbjct  261   PSDPSMLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDTECDQYNRCGKFGICDMKGTNG  320

Query  1743  INCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDF  1564
             I C C+ G+ P      +  NW+ GC RRTPL+C++N + G     D F  +K +KLPDF
Sbjct  321   I-CSCVHGYEPV-----SVGNWSRGCRRRTPLKCERNKSVG----DDEFLTLKSVKLPDF  370

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
                + ++  P DC+++C ++CSCNAY   V GGI CM+W  +LVD+ Q + G GS+L +R
Sbjct  371   EIPEHDLVDPSDCRERCLKNCSCNAYT--VIGGIGCMIWNQDLVDLQQFEAG-GSSLHIR  427

Query  1383  LHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRAR-----IRAKKRDEIPRTE  1219
             +  SE+  K     +++ V+VV  V +L + +++L   +R +        K  D      
Sbjct  428   VADSEIGGKKKSKNVVIIVAVVVGVVLLGVFALFLWRFKRKKDVSGAYCGKSTDTSVVVA  487

Query  1218  LPT-SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVY  1042
             + T S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VY
Sbjct  488   VTTKSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIATATNDFCKENELGRGGFGPVY  547

Query  1041  KGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEY  862
             KGVL  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEY
Sbjct  548   KGVLEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEY  607

Query  861   MPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDG  682
             MPNKSLD F+FD  K+  ++W  RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDG
Sbjct  608   MPNKSLDFFLFDETKQELIDWNLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDG  667

Query  681   EMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI  502
             EMNPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI
Sbjct  668   EMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEI  727

Query  501   VSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQD  322
             VSG+RNTS R+ +H  +I +AW  +  G+   L+DP I  +C  +E LRCI + +LCVQD
Sbjct  728   VSGKRNTSLRSSEHGSLIGHAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQD  787

Query  321   LAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMS  148
              A  RPNM+AV+L LE+D  TL VPR PT+T++ R S+DV+    +++  + SSN IT +
Sbjct  788   SAADRPNMAAVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITST  847

Query  147   VIVGR  133
             V++GR
Sbjct  848   VVLGR  852



>ref|XP_006449174.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
 gb|ESR62414.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
Length=748

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/757 (56%), Positives = 551/757 (73%), Gaps = 24/757 (3%)
 Frame = -3

Query  2358  VVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT-DGWRPNNTIWQSFHQPTDTFLP  2182
             +VLDG ++++W++N+SV S+N   +L +   LI+  + D        WQSF+ PTDT LP
Sbjct  1     MVLDGNSIAVWSSNASVVSNNTAALLEDDGNLILTNSEDIGNLGKAYWQSFNHPTDTHLP  60

Query  2181  GMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGR  2008
             GMRV +++  GE+++FTSW ++ +PSPG F+MG+DP+ SPQIVIWE  KR WRSG W+  
Sbjct  61    GMRVGVNSALGENRVFTSWKSASDPSPGNFTMGVDPQGSPQIVIWEQLKRRWRSGQWNSV  120

Query  2007  VFLGVPMR---TDFVYGFDLIT-END-NLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNES  1846
             +F GVP     T F++GF L   E+D ++Y  Y  +++S L+ F++ W+G E Q RW+ S
Sbjct  121   IFTGVPTMATLTSFLFGFKLSPRESDGSMYFTYVPANASYLLRFRIGWDGNEEQLRWDGS  180

Query  1845  RKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGC  1666
              K+W  +Q+QPAD C +YN CG F  C+   S    C C+ GF P  + QW   NW+ GC
Sbjct  181   AKKWSVMQKQPADDCELYNFCGNFGICNALGST--KCTCMEGFVPKHFEQWTMGNWSAGC  238

Query  1665  TRRTPLQCQKNNTEGG-GAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNA  1489
              RRT LQCQ+N +E G    +DGF+  K++KLPDFAD+       E CK KC ++CSCNA
Sbjct  239   VRRTQLQCQRNRSEAGESGGEDGFKVFKNVKLPDFADVVS--VGQETCKDKCLQNCSCNA  296

Query  1488  YAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaav  1309
             YA  +PG I CMLWR EL+D+   ++G G+ L VRL  SEL  +S K +  V   +V   
Sbjct  297   YAD-IPG-IGCMLWRGELIDVKSFEKG-GNLLHVRLPDSELGGRS-KISNAVIAIIVVIG  352

Query  1308  avlvivsIWLLCSRRA-----RIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGA  1144
             A+L+  S+WLL   RA      I   K ++    ++  S E S+DFS   D+ V+G    
Sbjct  353   ALLLGASVWLLWRFRALCKDSTISCCKNNDTQLIDMGKSQEISTDFSGPSDMVVDGSQIN  412

Query  1143  SSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEF  964
              +DL  F+F+++A AT+ FS  NKLG+GGFG V+KG LP GQ+IAVKRLSR+SGQG++EF
Sbjct  413   GTDLPMFNFNTLAVATNYFSEGNKLGRGGFGPVHKGKLPEGQDIAVKRLSRKSGQGLEEF  472

Query  963   TNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFH  784
              NE+ +IAKLQHRNLVRLLGCCI+G+EKML+YEYMPNKSLD F+FDPAK++ L+W KRF 
Sbjct  473   KNEIILIAKLQHRNLVRLLGCCIQGEEKMLIYEYMPNKSLDLFIFDPAKQALLDWTKRFA  532

Query  783   IIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNR  604
             IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDFGMARIFG NQNEANTNR
Sbjct  533   IIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMNPKISDFGMARIFGFNQNEANTNR  592

Query  603   VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWD  424
             VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR +++S +IE+AW  W+
Sbjct  593   VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRLEENSSLIEHAWNLWN  652

Query  423   EGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPR  244
             EGK M+L+DP+I  S    +VLRCI +G+LCVQD A++RP M++VVL LE++  TLPVPR
Sbjct  653   EGKAMDLVDPNIRDSSSQNQVLRCIHVGMLCVQDSAMYRPTMASVVLMLESETPTLPVPR  712

Query  243   PPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              PT+T SMR SVD D + + ++  SSN +T++++VGR
Sbjct  713   QPTFT-SMRSSVDGDHFMEAHDTVSSNDLTVTMVVGR  748



>gb|AID21660.1| At4g21390p-like protein [Arabidopsis lyrata]
Length=850

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/842 (50%), Positives = 577/842 (69%), Gaps = 39/842 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  +  R++GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSRQRFLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKT  2248
               PI D++G   I+ +G  V+LDG+N+++      ++++  ++N  + + +T   ++ +T
Sbjct  85    ASPISDQSGVLTISNDGNLVLLDGRNITVWSSNIESSTNNNNNNRVVSIHDTGNFVLSET  144

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D  R    IW+SF+ PTDTFLP M  RV+   G++  F SW +  +PSPG +S+G+DP  
Sbjct  145   DTDR---VIWESFNHPTDTFLPQMKVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSG  201

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S
Sbjct  202   APEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  261

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
              SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI 
Sbjct  262   DSSVLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-  320

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF  
Sbjct  321   CSCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEI  371

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
                ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL 
Sbjct  372   PAHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLA  428

Query  1377  SSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELP  1213
              SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++ 
Sbjct  429   DSEVGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMN  488

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKG+
Sbjct  489   KSKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGL  548

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             L  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPN
Sbjct  549   LEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPN  608

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMN
Sbjct  609   KSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMN  668

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG
Sbjct  669   PKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  728

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             +RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A 
Sbjct  729   KRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAA  788

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVIV  139
              RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV+    +++  + SSN IT +V++
Sbjct  789   ERPNMAAVLLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVL  848

Query  138   GR  133
             GR
Sbjct  849   GR  850



>ref|XP_008345158.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Malus domestica]
Length=858

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/825 (52%), Positives = 549/825 (67%), Gaps = 28/825 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DGE ++S  + F LGFFS   +S+RYVGI Y +I   SV+WVANRE PI DK+G      
Sbjct  43    DGETLISDGQIFELGFFSLGNSSSRYVGIRYYKISDPSVIWVANRENPISDKSGVLEFRS  102

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VVLDG   ++W+TN+S  +++   +  N    +IL   G   +   WQSF    DT
Sbjct  103   DGNLVVLDGNGXTVWSTNASAATNSTARL--NDEGSLILSRRG-XASMVYWQSFDDAADT  159

Query  2190  FLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGM+V++S   GE++  +SW +  +PS G +SMG+DPR SPQIVIWEG KR WRSGHW
Sbjct  160   FLPGMKVEVSDEIGENRFLSSWKSESDPSAGGYSMGVDPRGSPQIVIWEGSKRRWRSGHW  219

Query  2016  DGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKS-SSSDLIMFKVDWNGKEVQQRWNESR  1843
             + ++F+G P M T + YGF L  EN   Y  YK  + SD + F++ W+G E Q +W E +
Sbjct  220   NKQIFIGXPNMPTTYAYGFKLSDENGKSYFTYKPWNPSDKLRFRIRWDGYEEQLKWAEEK  279

Query  1842  KQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGG  1669
              QW  IQ QP   +QC  YN CG+F  C  S  +   C C+ GF P + +QW   NW+ G
Sbjct  280   SQWDVIQSQPNKTNQCEFYNKCGRFGVCSASDESSSICXCMRGFQPRNLDQWTGGNWSEG  339

Query  1668  CTRRTPLQCQKNNTEGGGA--EKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSC  1495
             C R+TPLQCQ N+T G  A  EKDGF  ++  KLPDFAD    +      +K  E   +C
Sbjct  340   CXRKTPLQCQGNSTNGXVASDEKDGFVAIRCAKLPDFADXVVXVPGESCEEKCLENC-AC  398

Query  1494  NAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvva  1315
              AYA     GI CM+W  +L+D+    +G G+TL +R+  S+L +K+ K +  V   +  
Sbjct  399   TAYA--XVQGIGCMMWTEDLIDVEXFTKG-GNTLHIRVAHSDLGSKN-KLSTAVIAVISV  454

Query  1314  avavlvivsIWLLCSRRARIRAK---------KRDEIPRTELPTSGEFSSDFSAQCDLTV  1162
             A A+  ++ + LL   +A+++           +  +        S EFS+D S   D+  
Sbjct  455   AGALFAVIILLLLWKFKAKLKVLPTTSSISWLRGGDTSTLNAGKSTEFSTDASGSVDVYA  514

Query  1161  EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSG  982
             EG     S+L   + S +AAAT++F   NKLG+GGFG VYKG LP   +IAVKRLSRRS 
Sbjct  515   EGNQVNRSELRLLNLSCVAAATNNFCEENKLGKGGFGTVYKGSLPGLPQIAVKRLSRRST  574

Query  981   QGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELN  802
             QG++EF NE+++IAKLQHRNLVRLLGCCIEG+EKML+YEYMPNKSLD F+FDPA +S L+
Sbjct  575   QGLEEFKNEISLIAKLQHRNLVRLLGCCIEGEEKMLVYEYMPNKSLDFFLFDPANQSLLD  634

Query  801   WRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQN  622
             WRKRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +M PKISDFGMARIFGGN+N
Sbjct  635   WRKRFTIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMIPKISDFGMARIFGGNEN  694

Query  621   EANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEY  442
             E NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS R+ +H  +I Y
Sbjct  695   EENTARVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSLRSTEHLSLIGY  754

Query  441   AWEQWDEGKPMNLLDPSIFSSCVPQ--EVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
             AW  W+E + ++L+DPSI  +C     E+LRCI +GLLCVQD A  RP M AVVL LE++
Sbjct  755   AWHLWNENRAVDLIDPSIAETCSQNETELLRCIHVGLLCVQDYAASRPTMPAVVLMLESE  814

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
                L +P  P +T S+RR VD     +  ++ SSN++T++ + GR
Sbjct  815   AANLQLPVQPXFT-SIRRPVDTKFGTEGQDVASSNNVTITXLEGR  858



>ref|XP_010059472.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Eucalyptus grandis]
Length=862

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/840 (52%), Positives = 577/840 (69%), Gaps = 36/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I +GQ+++D GE ++S++  F LGFFSP  +S RYVGIWY+ +  ++VVWVANR+ 
Sbjct  38    AANSISRGQFVRD-GETLISSSGNFELGFFSPANSSLRYVGIWYH-VSVKTVVWVANRDS  95

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsi--wntnssvtssnatmVLRNTSELIILKTD---  2245
             P+  ++G   ++ +G  +VLDG N ++   + NSS   +N+T VL +T  L++L +    
Sbjct  96    PVSGESGVMTVSNDGNLMVLDGNNGTVWSSSINSSSVPTNSTAVLMDTGNLVLLASAEAD  155

Query  2244  ----GWRPNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGID  2083
                 G   +N+ WQSF  PTDT+LPGMRV +++  GE++ F SW +S +PSPG FSMG+D
Sbjct  156   SASAGGDVSNSNWQSFDHPTDTYLPGMRVRVNSTDGENRAFRSWKSSDDPSPGNFSMGVD  215

Query  2082  PRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKS-S  1915
             PR  PQIVIW    R WRSGHW+G++F GVP M   +++GF L  I  + + Y  Y   +
Sbjct  216   PRLPPQIVIWGQSGREWRSGHWNGQIFTGVPNMTRSYLFGFRLWSIQADGSRYFTYTPLN  275

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             SS+L+MF++ WNG E Q  W+ +   W  +QEQPA +C +YN CG FA C+   S    C
Sbjct  276   SSNLLMFRILWNGTEEQLLWDGTSNAWTMLQEQPAKECDLYNKCGDFAICNEMDSP--KC  333

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              C+ GF+P   +QWN  NW+ GC R+T LQCQ N++       DGF ++  +KLPDFAD 
Sbjct  334   SCMEGFSPKSPDQWNRGNWSAGCARKTQLQCQDNSSR-----MDGFLKLDGVKLPDFADS  388

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
                +   ++C+ KC E+CSCNA+A  V  GI CMLW   L+D+ Q D+G G TL +RL +
Sbjct  389   VSAIIG-DECEAKCLENCSCNAFAFDV--GIGCMLWTENLIDVQQFDKG-GLTLQIRLAN  444

Query  1374  SELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA-----KKRDEIPRTE-LP  1213
             SEL  KS K + +  +  V   A ++ V +WLL   +  ++      +K  ++P  +   
Sbjct  445   SELRTKS-KISKLFIIITVLVGAFVLGVLVWLLWRFKDNLKGFSIFYRKNKKLPLLDNFV  503

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              + E S++ S    L  + K    +D+  F+FSSI AAT+ FS  NKLG GGFG VYKG 
Sbjct  504   KNEELSAELSGPDGLARDAKQVGGADITVFNFSSIEAATNFFSEENKLGLGGFGPVYKGK  563

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             L  GQEIAVKRLSR+S QG  EF NE+ +IAKLQHRNLVRLLG C++ ++KML+YEYMPN
Sbjct  564   LFGGQEIAVKRLSRKSSQGPDEFKNEVMLIAKLQHRNLVRLLGFCVQEEDKMLVYEYMPN  623

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLDSF+F+PAKR++L+W+KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMN
Sbjct  624   KSLDSFIFNPAKRAKLDWKKRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMN  683

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG
Sbjct  684   PKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  743

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             ++N  FRT +H  +I  AW    EGK M L+DP I  +C   +VLRCIQ+GLLCVQD AV
Sbjct  744   KKNLGFRTLEHPNLIVNAWHHLKEGKGMELIDPCIRDTCSTDKVLRCIQVGLLCVQDSAV  803

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              RP M +V+L LE+    LP P+ P  T S+  S+D  S +++ E+ S N +T+S + GR
Sbjct  804   DRPAMPSVMLLLESKTADLPFPKLPRST-SITGSMDTCSLSESQEIESLNGVTVSSVDGR  862



>ref|XP_010057706.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Eucalyptus grandis]
Length=860

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/842 (52%), Positives = 573/842 (68%), Gaps = 33/842 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I +GQ ++D GE ++S++ KF LGFFSP  +S RYVGIWY+  + ++VVWVANRE 
Sbjct  29    AANSISRGQSVRD-GETLISSSGKFELGFFSPANSSLRYVGIWYHFSV-KTVVWVANRES  86

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+  ++G F ++ +G  +VLDG  + V     NSS  ++N T VL+++  L++L      
Sbjct  87    PVSGESGVFTVSSDGNLMVLDGNNRTVWSSGNNSSAVATNLTAVLKDSGNLVLLAGTDAD  146

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW +S +PSPG +S+G+
Sbjct  147   SASADG-DISNSYWQSFKHPTDTYLPGMRVRVNSVAGENRAFMSWKSSNDPSPGNYSLGV  205

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYK-S  1918
             DPR  PQIVIW    R WRSGHW G++F GVP M  D  YGF L T   + ++Y  Y  S
Sbjct  206   DPRNPPQIVIWGQSGREWRSGHWIGQIFTGVPNMIGDIRYGFSLTTTEADGSMYFTYTPS  265

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + S L+MF++ WNG E Q  W+E+  +W  +Q QPA +C +YN CG FA C+    +   
Sbjct  266   NRSKLLMFRILWNGTEEQLGWDETSNEWTVLQSQPAKECDLYNRCGDFAICNEM--DHPK  323

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNN--TEGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF+P   +QWN+ NW+ GC R+T LQC+ N+  T G G   DGF ++  +KLPDF
Sbjct  324   CSCMKGFSPKSPDQWNSGNWSAGCARKTQLQCRDNSSITAGDGGGMDGFLKLGCVKLPDF  383

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             A+   +  S ++C+ KC+++CSCNAYA    GG SCMLW   L+D+    + S  T+ +R
Sbjct  384   AEY-VSASSRDECEVKCQKNCSCNAYA--FAGGTSCMLWSENLIDVQHFAQ-SRMTVRIR  439

Query  1383  LHSSELDNKS--SKTTiivavsvvaavavlvivsIWLLCS--RRARIRAKKRDEIPRTE-  1219
             L  SEL+ KS  S    I+   V A V  +++  +W      +   I   K   +P ++ 
Sbjct  440   LAKSELETKSKISNLFKIITFLVGALVLGVLVYLLWRFKDNLKGFSIFNWKNKRLPLSDD  499

Query  1218  LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYK  1039
             L  + E S++ S    L  + K    +D+  F FSSI AAT+ FS  NKLG GGFG VYK
Sbjct  500   LVRNDELSAELSGPDGLARDAKQVGGTDIPVFKFSSIEAATNFFSEENKLGLGGFGSVYK  559

Query  1038  GVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYM  859
             G L  GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLVRL G CI+G++KML+YEYM
Sbjct  560   GNLFGGQEIAVKRLSRKSSQGIEEFKNEVMLIAKLQHRNLVRLFGFCIKGEDKMLIYEYM  619

Query  858   PNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGE  679
             PN+SLD F+FDP KR +LNW+ RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD E
Sbjct  620   PNRSLDRFIFDPVKRMQLNWKTRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEE  679

Query  678   MNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIV  499
             MNPKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFG+LLLEI+
Sbjct  680   MNPKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGILLLEII  739

Query  498   SGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDL  319
             + ++N  FRT +HS +I YAW    EGK M L+DP +  +C   EVLRCIQ+GLLCVQD 
Sbjct  740   TSKKNFGFRTLEHSSLIVYAWHHLKEGKGMELIDPCMRDTCSTDEVLRCIQVGLLCVQDS  799

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIV  139
             A +RP M +V+L L+++ V LP P+ P  T S+  S    S  ++ E+ S N +T+S +V
Sbjct  800   APNRPAMPSVMLLLKSETVDLPFPKLPRST-SITGSTGTCSLFESQEIESLNGVTISSVV  858

Query  138   GR  133
             GR
Sbjct  859   GR  860



>emb|CCI61484.1| unnamed protein product [Arabidopsis halleri]
Length=850

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/842 (50%), Positives = 577/842 (69%), Gaps = 39/842 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD +++G+ ++D  + + +VS  + F LGFFSP  ++ RY+GIWY  I  ++VVWVANR
Sbjct  25    AADTLRRGESLRDGLNHKPLVSPKKTFELGFFSPGSSTRRYLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKT  2248
               PI D++G   I+ +G   + DGKN+++      ++++  ++N  + + +T   ++ +T
Sbjct  85    AIPISDQSGVLTISNDGNLELSDGKNITVWSSNIESSTNNNNNNRVVSILDTGNFVLSET  144

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D  R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +S+G+DP  
Sbjct  145   DTDR---VIWESFNHPTDTFLPQMRVRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSG  201

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+W+G K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S
Sbjct  202   APEIVLWKGNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  261

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
              SS L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI 
Sbjct  262   DSSMLLRFKVLYNGTEEELRWNETLKKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-  320

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C CI G+      Q +  NW+ GC RRTPL+C++N + G    +D F  +K +KLPDF  
Sbjct  321   CSCIHGYE-----QVSVGNWSRGCRRRTPLKCERNISVG----EDEFLTLKSVKLPDFEI  371

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
                ++  P DC+++C  +CSCNAY+  + GGI CM+W  +LVD+ Q + G GS+L +RL 
Sbjct  372   PAHDLVDPADCRERCLRNCSCNAYS--LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLA  428

Query  1377  SSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELP  1213
              SE+ +NK +K  +IVAV V   +  ++ + +W    ++    A         +   ++ 
Sbjct  429   DSEIGENKKTKIAVIVAVLVGVVLVGILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMN  488

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S E +S FS   D+ +EGKA  +S+L  F  ++IA AT+ F   N+LG+GGFG VYKGV
Sbjct  489   KSKETTSAFSGSVDIMIEGKAVNTSELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGV  548

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             L  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPN
Sbjct  549   LEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPN  608

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD F+FD  K++ ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMN
Sbjct  609   KSLDFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMN  668

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG
Sbjct  669   PKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISG  728

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             +RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A 
Sbjct  729   KRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAA  788

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVIV  139
              RPNM+AV+L LE+D  TL  PR PT+T++ R S+DV+    +++  + SSN IT +V++
Sbjct  789   ERPNMAAVLLMLESDTATLAAPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVL  848

Query  138   GR  133
             GR
Sbjct  849   GR  850



>gb|ADQ37393.1| unknown [Capsella rubella]
Length=847

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/842 (50%), Positives = 577/842 (69%), Gaps = 39/842 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD I++G+ ++D  + + +VS  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  22    AADTIRRGESLRDGVNHKPLVSPLKTFELGFFSPGASTSRYLGIWYGNIEDKAVVWVANR  81

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKT  2248
             E PI D++G   I+ +G  V+LDGKN+++      ++++  ++N  + +++T   ++ +T
Sbjct  82    ETPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSNNNNNNNRIVSIQDTGNFVLSET  141

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D  R    +W+SF+ PTDTFLP MRV +++  G++ +F SW +  +PSPG +S+G+DP  
Sbjct  142   DTDR---VVWESFNHPTDTFLPQMRVRVNSRTGDNPVFYSWRSETDPSPGNYSLGVDPSG  198

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGV---PMRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+WE  K R WRSG W+  +F G+    + T+++YGF L +   E  ++Y  Y  S
Sbjct  199   APEIVLWERNKTRKWRSGQWNSAIFTGIQNMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  258

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
               S L+ FKV +NG E + RW+E+ K+W K Q +P  +C  YN CG F  CD    NGI 
Sbjct  259   DPSMLLRFKVLYNGTEEELRWSETLKKWTKFQSEPDTECDQYNRCGNFGVCDMKGPNGI-  317

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C C+ G+ P      +  NW+ GC RRTPL+C++N + G     D F  +K +KLPDF  
Sbjct  318   CSCVHGYEPV-----SVGNWSRGCRRRTPLKCERNISVG----DDQFLTLKSVKLPDFEI  368

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              + ++  P DC+++C ++CSCNAY   V GGI CM+W  +LVD+ Q + G GS L +R+ 
Sbjct  369   PEHDLVDPSDCRERCLKNCSCNAYT--VIGGIGCMIWNQDLVDVQQFEAG-GSLLHIRVA  425

Query  1377  SSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR----ARIRAKKRDEIPRTELP  1213
              SE+ + K SK  +I+AV V   +  +  + +W    ++    A         +   +  
Sbjct  426   DSEIGEKKKSKIAVIIAVVVGVVLLGIFALLLWRFKRKKDVSGAYCGKNTDTSVVVAQTI  485

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S E +S FS   D+ +EGKA  +S+L  FS ++IA AT+ F   N+LG+GGFG VYKGV
Sbjct  486   KSKETTSAFSGSVDIMIEGKAVNTSELPVFSLNAIAKATNDFRKENELGRGGFGPVYKGV  545

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             L  G+EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPN
Sbjct  546   LEDGREIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPN  605

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD F+FD  K+  ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMN
Sbjct  606   KSLDFFLFDETKQELIDWQLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMN  665

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG
Sbjct  666   PKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  725

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             +RNTS R+ +H  +I YAW  +  G+   L+DP I ++C  +E LRCI + +LCVQD A 
Sbjct  726   KRNTSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRATCNKREALRCIHVAMLCVQDSAT  785

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVIV  139
              RPNM+AV+L LE+D  TL VPR PT+T++ R S+DV+    +++  + SSN IT +V++
Sbjct  786   ERPNMAAVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVL  845

Query  138   GR  133
             GR
Sbjct  846   GR  847



>gb|KHN33627.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Glycine soja]
Length=800

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/824 (51%), Positives = 547/824 (66%), Gaps = 55/824 (7%)
 Frame = -3

Query  2511  LGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITGNGTFVVLDGKnvs  2332
             +GFFS + +S+RYVGIWY+ I    V+WVANR++PI    GA  I+ +G  VVLDG    
Sbjct  1     MGFFSSDNSSSRYVGIWYDNIPGPEVIWVANRDKPINGTGGAITISNDGNLVVLDGAMNH  60

Query  2331  i---wntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLPGMRVDLS  2161
             +     +N +  + N++  L +   L++           +WQSF  PTDT++PGM+V + 
Sbjct  61    VWSSNVSNINSNNKNSSASLHDDGNLVLTCE-----KKVVWQSFENPTDTYMPGMKVPVG  115

Query  2160  A-GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVFLGVPMR  1984
                 S +FTSW ++ +PS G ++MG+DP   PQIV+WEGEKR WRSG+WDGR+F G+ + 
Sbjct  116   GLSTSHVFTSWKSATDPSKGNYTMGVDPEGLPQIVVWEGEKRRWRSGYWDGRMFQGLSIA  175

Query  1983  TDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPA  1810
               ++YGF L  +     Y  Y   + +D + F++ W+G E + RWNE  K W +IQ+ P 
Sbjct  176   ASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGWDGYEREFRWNEDEKSWSEIQKGPF  235

Query  1809  DQCGVYNHCGQFARCD----NSSSNGIN-CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQ  1645
              +C VYN CG FA CD    + SS+ +  C CI GF P   +QW   NW+GGCTR TPL+
Sbjct  236   HECDVYNKCGSFAACDLLTLSPSSDLVPVCTCIRGFEPKHRDQWEKGNWSGGCTRMTPLK  295

Query  1644  CQKNNTEGGGAE----KDGFREVKHIKLPDFA------DIDRNMRSPedckkkceedCSC  1495
              Q+ N    G +    +DGF + + +KLPDFA      D +R   S          + SC
Sbjct  296   AQRINVTSSGTQVSVGEDGFLDRRSMKLPDFARVVGTNDCERECLS----------NGSC  345

Query  1494  NAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvva  1315
              AYA     G+ CM+W  +LVD+  L+ G G+TL +RL  S+LD+   K   IV +S + 
Sbjct  346   TAYANV---GLGCMVWHGDLVDIQHLESG-GNTLHIRLAHSDLDD--VKKNRIVIISTIG  399

Query  1314  avavlvivsIWLLCSRRARIRA----------KKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
             A  + + + +WL+   + +++           K  D +P  +   S E S++FS   DL+
Sbjct  400   AGLICLGIFVWLVWRFKGKLKVLPTVSSVSCCKSSDALPVFDANKSREMSAEFSGSADLS  459

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
             +EG   +  +   F+FS I+ AT++FS  NKLGQGGFG VYKG LP G++IAVKRLSRRS
Sbjct  460   LEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGGFGPVYKGKLPGGEQIAVKRLSRRS  519

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+L YEYMPNKSLD F+FDP K+ +L
Sbjct  520   GQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKLLAYEYMPNKSLDCFLFDPVKQKQL  579

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
              WR+R  IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG+ARIFGGNQ
Sbjct  580   AWRRRVEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFGLARIFGGNQ  639

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI+SGRRNTSFR  D S +I 
Sbjct  640   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEILSGRRNTSFRHSDDSSLIG  699

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW  W+E K M LLDP I  S    + LRCI +G+LCVQD A HRPNMSAVVL+LE++ 
Sbjct  700   YAWHLWNEHKAMELLDPCIRDSSPRNKALRCIHIGMLCVQDSAAHRPNMSAVVLWLESEA  759

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              TLP+P  P  T SMRR+ D + +     L  SN +T++++VGR
Sbjct  760   TTLPIPTQPLIT-SMRRTEDREFYMDG--LDVSNDLTVTMVVGR  800



>ref|XP_004485683.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Cicer arietinum]
Length=836

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/827 (51%), Positives = 553/827 (67%), Gaps = 31/827 (4%)
 Frame = -3

Query  2577  IQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL  2401
             ++ G++I+D +GE +VS N  FV+GFF  E TS+RYVGIWY  I    ++WVANR++PI 
Sbjct  29    VKHGEFIRDKEGEVLVSENFNFVMGFFGFENTSSRYVGIWYYNIPGPKLIWVANRDKPIN  88

Query  2400  DKNGAFGITGNGTFVVLD-GKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
             + +G+F I+ NG  V+LD  K         +   +N+  VLR+   L++     +     
Sbjct  89    NNDGSFTISTNGNLVILDQNKKQIFSTNVHNKNMNNSKAVLRDDGNLVL-----YNGKMV  143

Query  2223  IWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA-SPQIVIWEG  2047
             IW+SF  P+DTF+PGM+V +   +S   TSW +S +PS G +SMG+DP    PQIV+WEG
Sbjct  144   IWESFENPSDTFVPGMKVPVKK-KSFFLTSWKSSTDPSLGNYSMGVDPEGLPPQIVVWEG  202

Query  2046  EKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSS-SSDLIMFKVDWNGKE  1870
             E+R WRSG+WDGR+F GV +  + ++GF L  +N + Y  Y +  ++  + F++ W+G E
Sbjct  203   ERRKWRSGYWDGRMFTGVDLLGNLLHGFTLNWDNGDRYFVYNNQMNNSKVRFQIGWDGYE  262

Query  1869  VQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWN  1690
              +  WNES K W + Q+ P ++C  YN+CG FA CD S S    C CI GF P D ++WN
Sbjct  263   REFNWNESEKVWSETQKGPQNECEFYNNCGGFAACDLSVSGSAICSCIKGFEPKDRDEWN  322

Query  1689  ARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI--DRNMRSPedckkk  1516
               N +GGC R T L+  + N  G   E DGF E+K +KLPDFA +   +N +S       
Sbjct  323   NGNRSGGCKRMTALKVDQKNGNGSFGE-DGFWELKCMKLPDFASVVDAKNCKS------Y  375

Query  1515  ceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTii  1336
             C  + SC AYA  +  GI CM+W  ELVD+     G G+TL +RL  S+L N      I+
Sbjct  376   CLGNASCIAYAEVI--GIGCMVWFGELVDVQHFGHG-GNTLHIRLAHSDLSNGGKSNKIV  432

Query  1335  vavsvvaavavlvivsIWLLCSRRARI------RAKKRDEIPRTELPTSGEFSSDFSAQC  1174
             V +S V A  + + + +W +   R ++      R KK D +P  +   S E S++FS   
Sbjct  433   VIISTVLAGLICLGIIVWGIWRYRRKLKVSSAPRCKKSDALPVFDATKSREMSTEFSGSI  492

Query  1173  DLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
             ++++E       +L FF+FS I+ AT++FS  NKLGQGGFG VYKG  P G+EIAVKRLS
Sbjct  493   EVSLERNQLTGPELPFFNFSCISLATNNFSEENKLGQGGFGPVYKGKFPSGEEIAVKRLS  552

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             + SGQG +EF NE+ +IAKLQHRNLVRLLGC I+G+EK+L+YE+MPNKSLD F+FD  K+
Sbjct  553   KLSGQGSEEFKNEMMLIAKLQHRNLVRLLGCSIQGEEKLLVYEFMPNKSLDCFLFDSIKQ  612

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
             ++L W +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG+ARIFG
Sbjct  613   TQLAWTRRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFGLARIFG  672

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSG  454
             GNQ E NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  D S 
Sbjct  673   GNQKEGNTTRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRHSDDSS  732

Query  453   IIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             +I YAW  W++ + + L+DP I       +VLRCI +G+LCVQD A HRPNMSAVVL LE
Sbjct  733   LIGYAWHLWNKRRAIELVDPCIRDCSPKNKVLRCIHIGMLCVQDSAAHRPNMSAVVLMLE  792

Query  273   TDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  TLP P  P  T SMR S D + +   + L  SN +T++++VGR
Sbjct  793   SEATTLPSPSQPLIT-SMRTSQDREFY--IDCLDVSNDLTVTMVVGR  836



>gb|KHG16273.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Gossypium arboreum]
Length=839

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/839 (51%), Positives = 570/839 (68%), Gaps = 46/839 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I+QG+ +KD G+ +VS++  F LGFFSPE +  RYVGIWY ++  ++VVWVANR++
Sbjct  27    GVDIIRQGETMKD-GDKLVSSDGVFELGFFSPENSRFRYVGIWY-KVDTEAVVWVANRDK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+++ NG   I  +G  VVLDG   S+W +            L NTS   + K      +
Sbjct  85    PMVNTNGVLRIGVDGNLVVLDGNGSSVWWSGVPSI-------LSNTSFARLQKNGNLELS  137

Query  2229  N----TIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
             N     IW SFH PTDTFLPGM+  V LS GE + F SW ++ +PS G +S+G      P
Sbjct  138   NDTREVIWDSFHHPTDTFLPGMKLPVSLSMGEVRCFRSWRSAIDPSYGNYSVGTIANGGP  197

Query  2067  QIVIWEGE-KRYWRSGHWDGRVFLGVPMRTD---FVYGFDLITENDN--LYLEYK-SSSS  1909
             QIVIW+   +R WRSG W+G  F G+   +D   F++GF L   +DN   Y  Y+ S+SS
Sbjct  198   QIVIWDQNGRRRWRSGQWNGVTFTGISNLSDTASFLHGFKLSEHDDNGTRYFTYEPSNSS  257

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L  F + ++G   Q RW+   K+W K+  QP ++C +YNHCG +A CD   S+   C C
Sbjct  258   ALSRFHIRYDGTVRQFRWDG--KKWTKLLLQPGNKCDLYNHCGNYATCDYFVSSS-TCNC  314

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDR  1549
             + GF P   +QW+  NW+GGC RRT L+CQ+        + DGF+ +K +KLPDF+++  
Sbjct  315   LEGFRPKFEDQWSKGNWSGGCERRTELECQR-------GKPDGFKRMKCMKLPDFSNL-V  366

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
              ++S +DC++ C  +CSC AYA     GI CM+W  +LVD+  +D+      F RL+ S+
Sbjct  367   PVKSRDDCRQSCLGNCSCTAYAYVY--GIKCMIWIGDLVDVQHIDQSGNLEFFYRLNHSD  424

Query  1368  LDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIR------AKKRDEIPRTELPTS  1207
             LD+K  K +  V V +    A  ++  +WLL   + +++       K +D +   E  +S
Sbjct  425   LDDKK-KISNGVIVIISLVGACFLVAFLWLLWRYKKKLKLSSMVCCKDKDAVVFNEFKSS  483

Query  1206  G-EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
               EFS+ FS   D+ ++G      +L  F+FS++AAAT++F   NKLGQGGFG VYKG L
Sbjct  484   STEFSAGFSGPSDILIDGDQVNRPELPIFNFSTVAAATNNFCEENKLGQGGFGAVYKGKL  543

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P GQEIAVKRLSR+SGQG++EF NE+ ++AKLQHRNLVRLLGC I+G+EKML+YEYMPNK
Sbjct  544   PGGQEIAVKRLSRQSGQGLEEFKNEIILLAKLQHRNLVRLLGCTIQGEEKMLIYEYMPNK  603

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD+F+F  AK++EL+WR R  IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNP
Sbjct  604   SLDNFLF--AKQAELDWRTRVGIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDAEMNP  661

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFS+KSDVYSFGVLLLEIVSGR
Sbjct  662   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIVSGR  721

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTSFR+ +++ +I YAW+ W++ K M ++DPSI  SC P+E L+ I +G+LCVQD A++
Sbjct  722   RNTSFRSSEYTSLIAYAWQLWNDDKAMYIIDPSIQESCCPKEALKRIHIGMLCVQDSAMY  781

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             RP M+ VVL LE++  TLP  R PTY++S RRS+D        E+ SSN +T+++I GR
Sbjct  782   RPTMATVVLMLESEAPTLPKVRQPTYSSS-RRSIDDQPIPNGQEIVSSNDVTITMIAGR  839



>ref|XP_010057704.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Eucalyptus grandis]
Length=869

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/842 (51%), Positives = 571/842 (68%), Gaps = 33/842 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I +GQ ++D GE ++S++ KF LGFFSP  +S RYVGIWY+  + ++VVWVANRE 
Sbjct  38    AANSISRGQSVRD-GETLISSSGKFELGFFSPANSSLRYVGIWYHFSV-KTVVWVANRES  95

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+  ++G F ++ +G  +VLDG  + V    +NSS  ++N T VL+++  L++L      
Sbjct  96    PVSGESGVFTVSSDGNLMVLDGNNRTVWSSGSNSSAVATNLTAVLKDSGNLVLLAGTDAD  155

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW +S +PSPG +SMG+
Sbjct  156   SASADG-DISNSYWQSFKHPTDTYLPGMRVRVNSVAGENRAFMSWKSSNDPSPGNYSMGV  214

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYK-S  1918
             D +  PQIVIW    R WRSGHW G++F GVP M  D  YGF L T   + ++Y  Y  S
Sbjct  215   DSQIPPQIVIWGQSGREWRSGHWIGQIFTGVPNMIGDIRYGFSLTTTEADGSMYFTYTPS  274

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + S L+MF++ WNG E Q  W+E+  +W  +Q QPA +C +YN CG FA C+    +   
Sbjct  275   NRSKLLMFRILWNGTEEQLGWDETSNEWTVLQSQPAKECDLYNRCGDFAICNEM--DHPK  332

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNN--TEGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF+P   +QWN+ NW+ GC R+T LQC+ N+  T G G   DGF E+  +KLPDF
Sbjct  333   CSCMKGFSPKSPDQWNSGNWSAGCARKTQLQCRDNSSFTAGDGGGMDGFLELHGVKLPDF  392

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             A+ + +  + ++C+ KC E+CSCNAYA      I CMLW   L+D+    +  G T+ +R
Sbjct  393   AE-NVSASNRDECEVKCRENCSCNAYA--FGRRIGCMLWSENLIDVQHFAQ-CGMTVQIR  448

Query  1383  LHSSELDNKS--SKTTiivavsvvaavavlvivsIWLLCS--RRARIRAKKRDEIPRTE-  1219
             L  +EL+ KS  S    I+   V A V  +++  +W      +   I   K   +P ++ 
Sbjct  449   LAKTELETKSKISNLFKIITFLVGALVLGVLVYLLWRFKDNLKGFSIFNWKNKRLPLSDD  508

Query  1218  LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYK  1039
             L  + E S++ S    L  + K    +D+  F FSSI AAT+ FS  NKLG GGFG VYK
Sbjct  509   LVRNDELSAELSGPDGLARDAKQVGGADIPVFKFSSIEAATNFFSEENKLGLGGFGPVYK  568

Query  1038  GVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYM  859
             G L  GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLVRL G CI+G++KML+YEYM
Sbjct  569   GKLFGGQEIAVKRLSRKSSQGIEEFKNEVMLIAKLQHRNLVRLFGFCIKGEDKMLIYEYM  628

Query  858   PNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGE  679
             PN+SLD F+FDP KR +LNW+ RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD E
Sbjct  629   PNRSLDRFIFDPVKRVQLNWKTRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEE  688

Query  678   MNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIV  499
             MNPKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFG+LLLEI+
Sbjct  689   MNPKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGILLLEII  748

Query  498   SGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDL  319
             + ++N  FRT +HS +I YAW    EGK M L+DP I  +C   EVLRCIQ+GLLCVQD 
Sbjct  749   TSKKNFGFRTLEHSSLIVYAWHHLKEGKGMELIDPCIRDTCSTDEVLRCIQVGLLCVQDS  808

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIV  139
             A +RP M +V+L L+++ V LP P+ P  T S+  S    S  ++ E+ S N +T+S +V
Sbjct  809   APNRPTMPSVMLLLKSETVDLPFPKLPRST-SITGSTGTCSLFESQEIESLNGVTISSVV  867

Query  138   GR  133
             GR
Sbjct  868   GR  869



>ref|XP_010057705.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Eucalyptus grandis]
Length=832

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/838 (51%), Positives = 556/838 (66%), Gaps = 62/838 (7%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I +GQ ++D GE ++S++ KF LGFFSP  +S RYVGIWY+  + ++VVWVANRE 
Sbjct  38    AANSISRGQSVRD-GETLISSSGKFELGFFSPANSSLRYVGIWYHFSV-KTVVWVANRES  95

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+  ++G F ++ +G  +VLDG  + V    +NSS  ++N T VL+++  L++L      
Sbjct  96    PVSGESGVFTVSSDGNLMVLDGNNRTVWSSGSNSSAVATNLTAVLKDSGNLVLLAGTDAD  155

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW +S +PSPG +SMG+
Sbjct  156   SASADG-DISNSYWQSFKHPTDTYLPGMRVRVNSVAGENRAFMSWKSSNDPSPGNYSMGV  214

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYK-S  1918
             D +  PQIVIW    R WRSGHW G++F GVP M  D  YGF L T   + ++Y  Y  S
Sbjct  215   DSQIPPQIVIWGQSGREWRSGHWIGQIFTGVPNMIGDIRYGFSLTTTEADGSMYFTYTPS  274

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + S L+MF++ WNG E Q  W+E+  +W  +Q QPA +C +YN CG FA C+    +   
Sbjct  275   NRSKLLMFRILWNGTEEQLGWDETSNEWTVLQSQPAKECDLYNRCGDFAICNEM--DHPK  332

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNN--TEGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF+P   +QWN+ NW+ GC R+T LQC+ N+  T G G   DGF E+  +KLPDF
Sbjct  333   CSCMKGFSPKSPDQWNSGNWSAGCARKTQLQCRDNSSFTAGDGGGMDGFLELHGVKLPDF  392

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             A+ + +  + ++C+ KC E+CSCNAYA      I CMLW   L+D+    +  G T+ +R
Sbjct  393   AE-NVSASNRDECEVKCRENCSCNAYA--FGRRIGCMLWSENLIDVQHFAQ-CGMTVQIR  448

Query  1383  LHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTE-LPTS  1207
             L  +EL                                    I   K   +P ++ L  +
Sbjct  449   LAKTELG---------------------------------FSIFNWKNKRLPLSDDLVRN  475

Query  1206  GEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLP  1027
              E S++ S    L  + K    +D+  F FSSI AAT+ FS  NKLG GGFG VYKG L 
Sbjct  476   DELSAELSGPDGLARDAKQVGGADIPVFKFSSIEAATNFFSEENKLGLGGFGPVYKGKLF  535

Query  1026  CGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKS  847
              GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLVRL G CI+G++KML+YEYMPN+S
Sbjct  536   GGQEIAVKRLSRKSSQGIEEFKNEVMLIAKLQHRNLVRLFGFCIKGEDKMLIYEYMPNRS  595

Query  846   LDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPK  667
             LD F+FDP KR +LNW+ RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPK
Sbjct  596   LDRFIFDPVKRVQLNWKTRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPK  655

Query  666   ISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRR  487
             ISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFG+LLLEI++ ++
Sbjct  656   ISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGILLLEIITSKK  715

Query  486   NTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHR  307
             N  FRT +HS +I YAW    EGK M L+DP I  +C   EVLRCIQ+GLLCVQD A +R
Sbjct  716   NFGFRTLEHSSLIVYAWHHLKEGKGMELIDPCIRDTCSTDEVLRCIQVGLLCVQDSAPNR  775

Query  306   PNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P M +V+L L+++ V LP P+ P  T S+  S    S  ++ E+ S N +T+S +VGR
Sbjct  776   PTMPSVMLLLKSETVDLPFPKLPRST-SITGSTGTCSLFESQEIESLNGVTISSVVGR  832



>gb|AGN12879.1| putative S-locus lectin protein kinase-like protein [Sisymbrium 
irio]
Length=848

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/840 (50%), Positives = 568/840 (68%), Gaps = 37/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGEN--IVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A D I++G++++D   +  +VS  + F LGFFSP  ++ RY+GIWY  I  ++VVWVANR
Sbjct  25    AEDTIRRGEFLRDGSSHKPLVSPQKTFELGFFSPGASTRRYLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGW  2239
             E PI D++G   I+ +G  V+L+G+NV++  + N S  ++N   V+ +T    +++    
Sbjct  85    ESPISDQSGVLMISNDGKLVLLNGQNVTVWSSDNDSSNNNNRVGVILDTGNFELIEVSSE  144

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
             R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG +++GIDP  +P+
Sbjct  145   R---VIWESFNHPTDTFLPQMRVRVNPQTGDNLAFVSWRSEDDPSPGNYTLGIDPSGAPE  201

Query  2064  IVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSS  1909
             IV+W   K R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S  S
Sbjct  202   IVLWGRNKTRKWRSGQWNSAIFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDPS  261

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L+ FKV +NG E + RWNE+ K+W K Q +P  +C  YN CG+F  CD   SNGI C C
Sbjct  262   VLLRFKVLYNGTEEELRWNETSKRWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-CSC  320

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDR  1549
             + G+ P      +  NW+ GC RRT L+C++N + G    +D F  +K +KLPDF   + 
Sbjct  321   VRGYEPV-----SVGNWSRGCRRRTQLKCERNVSAG----EDEFLTLKSVKLPDFETPEH  371

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
             N+  PEDCK +C  +CSC A+      GI CM+W  +LVD+ Q + G GS+L VRL  SE
Sbjct  372   NLAGPEDCKDRCLNNCSCTAFT--FVNGIGCMIWNQDLVDLQQFEAG-GSSLHVRLADSE  428

Query  1368  L-DNKSSKTTiivavsvvaavavlvivsIWLLCSRRA---RIRAKKRD-EIPRTELPTSG  1204
             + ++  SK  +IVAV V   +  +  + +W    ++A       K  D  +   ++  + 
Sbjct  429   IGESNKSKIVVIVAVLVGVLLLGIFALLLWRFKRKKAVSGTYCGKDTDTSVVVVDMTKAK  488

Query  1203  EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPC  1024
             + ++ FS   D+ +EGKA  +S+L  FS +SI  AT+ F   N+LG+GGFG VYKGVL  
Sbjct  489   DTTTAFSGSVDIMIEGKAVNTSELPVFSLNSIVKATNDFCKENELGRGGFGPVYKGVLED  548

Query  1023  GQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSL  844
             GQEIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSL
Sbjct  549   GQEIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSL  608

Query  843   DSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKI  664
             D F+FD  K+  ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNPKI
Sbjct  609   DFFIFDETKQELVDWKLRFEIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKI  668

Query  663   SDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN  484
             SDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+RN
Sbjct  669   SDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRN  728

Query  483   TSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             TS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +LCVQD A  RP
Sbjct  729   TSLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAERP  788

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMRR-SVDVDSWNQNNE--LPSSNSITMSVIVGR  133
             NM+ V+L LE+D  TL VPR PT+T S RR S+DV+    +++  + SSN IT +V++GR
Sbjct  789   NMATVLLMLESDTATLAVPRQPTFTTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVLGR  848



>ref|XP_010059466.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Eucalyptus grandis]
Length=876

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/807 (52%), Positives = 546/807 (68%), Gaps = 34/807 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              A+ + QGQ ++D GE +VS +  F LGFF  E +S RYVGIWY +I  ++ VWVANR+ 
Sbjct  38    TANSLSQGQLVRD-GETLVSRSGNFELGFFRTENSSLRYVGIWYRKISFKTYVWVANRDS  96

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+ D++G   I+ +G  +VLDG  + V     NS+   +N+T VL +   L++L      
Sbjct  97    PVSDESGVLTISSDGNLMVLDGDHRLVWSSGINSTSVPTNSTAVLTDAGNLVLLAKADAD  156

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N  WQSF  PTDTFLPGMRV +  +AGE+  F SWT+  +PSPG +SMG+
Sbjct  157   TASADG-HVSNAYWQSFEHPTDTFLPGMRVRVNSAAGENHAFRSWTSLKDPSPGNYSMGV  215

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRT-DFVYGFDLIT--ENDNLYLEYKSS  1915
             DPR  PQIVIW    + WRSGHW+G  F G+P  T +  YGF L T  E+ ++Y  Y  S
Sbjct  216   DPRLPPQIVIWGQSGQEWRSGHWNGLSFTGMPNVTGNIQYGFRLSTPEEDGSMYFTYTPS  275

Query  1914  S-SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + S+L+MF++ WNG   +  W+E+  +W  +QEQPA +C +YN CG FA C++  S    
Sbjct  276   NRSNLLMFRILWNGTGEELVWDETNNEWTVLQEQPAKECDLYNKCGDFAMCNDMGSP--K  333

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF P   +QW   NW+ GC R+T LQC+ N++   G G+  DGF ++  +KLPDF
Sbjct  334   CSCMEGFIPKSPDQWKRGNWSMGCARKTQLQCRDNSSISVGDGSRVDGFLKLDGVKLPDF  393

Query  1563  AD-IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFV  1387
             AD +   +R   +C+ KC E+CSC A+A  +  GI CM+W   L+D+    EG G TL +
Sbjct  394   ADSVSATIRD--ECEAKCLENCSCKAFAFDL--GIRCMMWSKNLIDVEHFAEG-GMTLQI  448

Query  1386  RLHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTS  1207
             RL +SE   KS K + +  +        +  ++++LL   +  ++    D+I ++E    
Sbjct  449   RLANSEPGTKS-KISNLRMIVTAFVGVFVSGITVFLLWRFKDNLKGFLFDDIVKSE----  503

Query  1206  GEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLP  1027
              E   D S    L  + +     D+  F FSSI AAT+ FS  NKLG GGFG VYKG L 
Sbjct  504   -ELCLDLSGPDGLASDARQVGGPDIPVFDFSSIEAATNVFSEENKLGLGGFGPVYKGKLL  562

Query  1026  CGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKS  847
              GQEIAVKRLSR+S QGV+EF NE+ VIA+LQHRNLVRLLG C++G++KML+YEYMPN+S
Sbjct  563   GGQEIAVKRLSRKSSQGVEEFKNEVMVIARLQHRNLVRLLGFCVQGEDKMLVYEYMPNRS  622

Query  846   LDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPK  667
             LD F+FDPAKR++LNW+KR  IIE IARG+LYLHRDSRLRIIHRDLKASNILLD EMNPK
Sbjct  623   LDYFIFDPAKRAQLNWKKRLEIIEGIARGILYLHRDSRLRIIHRDLKASNILLDEEMNPK  682

Query  666   ISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRR  487
             ISDFGMARIFGGN+NEA+TNRVVGTYGYM+PEYAMEG+FS KSDVYSFGVLLLEI+SG++
Sbjct  683   ISDFGMARIFGGNENEASTNRVVGTYGYMSPEYAMEGIFSFKSDVYSFGVLLLEIISGKK  742

Query  486   NTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHR  307
             N  FRT +HS +I +AW  W++GK M L+DP I   C   E LRCIQ+GL CVQD A  R
Sbjct  743   NIGFRTLEHSNLISHAWHHWNDGKTMELIDPCIRDMCSADEALRCIQVGLFCVQDSARDR  802

Query  306   PNMSAVVLFLETDNVTLPVPRPPTYTA  226
             P MS+VVL LE++   LP+P+PP  T+
Sbjct  803   PLMSSVVLLLESETAGLPLPKPPRLTS  829



>gb|KCW74912.1| hypothetical protein EUGRSUZ_E03659, partial [Eucalyptus grandis]
Length=837

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/805 (52%), Positives = 545/805 (68%), Gaps = 34/805 (4%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             + + QGQ ++D GE +VS +  F LGFF  E +S RYVGIWY +I  ++ VWVANR+ P+
Sbjct  1     NSLSQGQLVRD-GETLVSRSGNFELGFFRTENSSLRYVGIWYRKISFKTYVWVANRDSPV  59

Query  2403  LDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL--------  2254
              D++G   I+ +G  +VLDG  + V     NS+   +N+T VL +   L++L        
Sbjct  60    SDESGVLTISSDGNLMVLDGDHRLVWSSGINSTSVPTNSTAVLTDAGNLVLLAKADADTA  119

Query  2253  KTDGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDP  2080
               DG   +N  WQSF  PTDTFLPGMRV +  +AGE+  F SWT+  +PSPG +SMG+DP
Sbjct  120   SADG-HVSNAYWQSFEHPTDTFLPGMRVRVNSAAGENHAFRSWTSLKDPSPGNYSMGVDP  178

Query  2079  RASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRT-DFVYGFDLIT--ENDNLYLEYKSSS-  1912
             R  PQIVIW    + WRSGHW+G  F G+P  T +  YGF L T  E+ ++Y  Y  S+ 
Sbjct  179   RLPPQIVIWGQSGQEWRSGHWNGLSFTGMPNVTGNIQYGFRLSTPEEDGSMYFTYTPSNR  238

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S+L+MF++ WNG   +  W+E+  +W  +QEQPA +C +YN CG FA C++  S    C 
Sbjct  239   SNLLMFRILWNGTGEELVWDETNNEWTVLQEQPAKECDLYNKCGDFAMCNDMGSP--KCS  296

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDFAD  1558
             C+ GF P   +QW   NW+ GC R+T LQC+ N++   G G+  DGF ++  +KLPDFAD
Sbjct  297   CMEGFIPKSPDQWKRGNWSMGCARKTQLQCRDNSSISVGDGSRVDGFLKLDGVKLPDFAD  356

Query  1557  -IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRL  1381
              +   +R   +C+ KC E+CSC A+A  +  GI CM+W   L+D+    EG G TL +RL
Sbjct  357   SVSATIRD--ECEAKCLENCSCKAFAFDL--GIRCMMWSKNLIDVEHFAEG-GMTLQIRL  411

Query  1380  HSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGE  1201
              +SE   KS K + +  +        +  ++++LL   +  ++    D+I ++E     E
Sbjct  412   ANSEPGTKS-KISNLRMIVTAFVGVFVSGITVFLLWRFKDNLKGFLFDDIVKSE-----E  465

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                D S    L  + +     D+  F FSSI AAT+ FS  NKLG GGFG VYKG L  G
Sbjct  466   LCLDLSGPDGLASDARQVGGPDIPVFDFSSIEAATNVFSEENKLGLGGFGPVYKGKLLGG  525

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             QEIAVKRLSR+S QGV+EF NE+ VIA+LQHRNLVRLLG C++G++KML+YEYMPN+SLD
Sbjct  526   QEIAVKRLSRKSSQGVEEFKNEVMVIARLQHRNLVRLLGFCVQGEDKMLVYEYMPNRSLD  585

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
              F+FDPAKR++LNW+KR  IIE IARG+LYLHRDSRLRIIHRDLKASNILLD EMNPKIS
Sbjct  586   YFIFDPAKRAQLNWKKRLEIIEGIARGILYLHRDSRLRIIHRDLKASNILLDEEMNPKIS  645

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARIFGGN+NEA+TNRVVGTYGYM+PEYAMEG+FS KSDVYSFGVLLLEI+SG++N 
Sbjct  646   DFGMARIFGGNENEASTNRVVGTYGYMSPEYAMEGIFSFKSDVYSFGVLLLEIISGKKNI  705

Query  480   SFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
              FRT +HS +I +AW  W++GK M L+DP I   C   E LRCIQ+GL CVQD A  RP 
Sbjct  706   GFRTLEHSNLISHAWHHWNDGKTMELIDPCIRDMCSADEALRCIQVGLFCVQDSARDRPL  765

Query  300   MSAVVLFLETDNVTLPVPRPPTYTA  226
             MS+VVL LE++   LP+P+PP  T+
Sbjct  766   MSSVVLLLESETAGLPLPKPPRLTS  790



>ref|XP_010533859.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Tarenaya hassleriana]
Length=859

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/842 (49%), Positives = 557/842 (66%), Gaps = 33/842 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A++ I +   I+D GE++VS +++F LGFF  E +++RY+GIWY  I P++V+WVANRE+
Sbjct  28    ASNTITRDHQIRD-GESLVSQDDRFELGFFGQENSTSRYLGIWYKNIEPRTVIWVANREK  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+   NG   I  +G  V+  G N ++W++ + + S+    VL  T  L++  +D     
Sbjct  87    PVSGNNGVLRIAEDGNLVLQSGGNGTVWSSRARIESNRTIAVLYGTGNLVLSDSD---TT  143

Query  2229  NTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
              + WQSF  P DT+LPGMRV +  S GE++ F SW +  +PSPG++S+G+DP  +PQIVI
Sbjct  144   KSYWQSFDHPADTYLPGMRVRVNPSMGENRAFVSWNSENDPSPGKYSLGVDPNGAPQIVI  203

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEYK-SSSSDLIM  1897
             WEG+ R WRSG W+ ++F GVP     T+++YGF L +    N ++Y  Y  S+SSD + 
Sbjct  204   WEGQTRKWRSGQWNSQIFTGVPDMSSVTNYLYGFKLSSPPDSNGSVYFTYNPSNSSDFLR  263

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVG  1720
             F+V ++GKE Q RWNE  K W  IQ +P  +C  YN+CG  + C +    G   C C+ G
Sbjct  264   FRVRFDGKEEQFRWNEEAKNWSSIQSKPTVECERYNYCGNNSVCHDGKDAGTGKCSCLDG  323

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEG-----GGAEKDGFREVKHIKLPDFADI  1555
             F P  WNQW   +++GGC RR PL+CQK N +      GG  +DGF+ +K +KLPDF  +
Sbjct  324   FEPKVWNQWINGDFSGGCRRRVPLKCQKKNDDSESKIIGGHREDGFKGIKCVKLPDFGSV  383

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
               ++   E C+  C  +CSCNAYA     GI CM+W N+LVD+ +   G GS L +R+  
Sbjct  384   -ISLDDSETCRDMCLRNCSCNAYAN--VSGIGCMVWMNDLVDIQRFVNG-GSLLNIRMAG  439

Query  1374  SELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRA--------RIRAKKRDEIPRTE  1219
             SEL     + + +V V +    A L  +SIW++   +         R + KK  ++P +E
Sbjct  440   SEL-GTGKEISNLVIVILSVVAAFLAGLSIWMIWRFKKISMKGLSWRRKKKKEKDLPVSE  498

Query  1218  LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYK  1039
                  E S++ S      ++G    + DL  FSFSS+A+AT++FS  NKLG GGFG VYK
Sbjct  499   KSKKRECSTEPSGSLCEVLQGGEADAPDLPIFSFSSVASATNNFSEENKLGHGGFGTVYK  558

Query  1038  GVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYM  859
             G  P GQEIAVKRLS +S QG++EF NE+ +IA+LQHRNLVRLLGCCI+  EK+LLYEYM
Sbjct  559   GNFPGGQEIAVKRLSGKSKQGLEEFKNEILLIARLQHRNLVRLLGCCIQDGEKILLYEYM  618

Query  858   PNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGE  679
             PNKSLD F+FD  +R +L+W++R  I+E IARGLLYLHRDSRLRIIHRDLKASNILLD E
Sbjct  619   PNKSLDGFLFDETRREKLDWKQRVVIVEGIARGLLYLHRDSRLRIIHRDLKASNILLDNE  678

Query  678   MNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIV  499
             + PKISDFGMARIF  +Q+EANT RVVGTYGYM+PEYAM GLFS KSDVYSFGVL++EIV
Sbjct  679   LTPKISDFGMARIFSCHQDEANTIRVVGTYGYMSPEYAMGGLFSEKSDVYSFGVLIMEIV  738

Query  498   SGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDL  319
             SGRRN S R  +H  +I YAW  W +G+   ++DP++  SC   E LRCI + LLCVQD 
Sbjct  739   SGRRNVSLRQSEHGSLIGYAWHLWSQGRAKEMIDPTVRDSCDENEALRCIHVSLLCVQDN  798

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIV  139
             A  RPNM+AVVL LE+    L VPR PT+  S R S +++      ++ S N +T++ ++
Sbjct  799   AAQRPNMAAVVLMLESQTQRLAVPRQPTF-HSFRSSGEIEINLDGQDVASVNDVTLTSVL  857

Query  138   GR  133
             GR
Sbjct  858   GR  859



>ref|XP_008355977.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120, partial [Malus domestica]
Length=897

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/832 (51%), Positives = 550/832 (66%), Gaps = 33/832 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DGE ++S  + F LGFF P  +S RYVGI Y  I    V+WVAN E PI  + G   I  
Sbjct  73    DGETLISDGQXFELGFFXPGNSSFRYVGIRYYNISDPPVIWVANXENPISGEXGVLKIGS  132

Query  2370  NGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQ  2203
             +G  VVLDG   ++     +T ++ T++N T  L +   L++  +         WQSF  
Sbjct  133   DGNLVVLDGNGTAVWSTNASTATNTTATNTTATLSDEGSLVL--SGSGDAGEVYWQSFDH  190

Query  2202  PTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWR  2029
             P DTFLPGM+V++  + GE++  +SW +  +PS G +SMG+DPR SPQ VIWEG +R WR
Sbjct  191   PADTFLPGMKVEVNDAIGENRFLSSWKSESDPSAGGYSMGVDPRGSPQFVIWEGSERRWR  250

Query  2028  SGHWDGRVFLGVP-MRTDFVYGFDLITENDN--LYLEYK-SSSSDLIMFKVDWNGKEVQQ  1861
             SGHW+ ++F+G+P M T +  GF L  EN N   Y   K SS+S+ + F++ W+G E   
Sbjct  251   SGHWNKQIFIGMPTMPTXYESGFRLSDENANGSSYFTXKLSSTSEKLRFRIXWDGYEELL  310

Query  1860  RWNESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             RW E + QW  I+ QP   +QC  YN CG+F  C  S  +G  C C+ GF P D +QW  
Sbjct  311   RWVEEKNQWEVIESQPNKTNQCEFYNKCGKFGVCSASDDSGSICSCMHGFQPRDSDQWMK  370

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGA--EKDGFREVKHIKLPDFADIDRNMRSPedckkkc  1513
              NW+ GC R+T LQCQ+N+T G  A  EKDGF  ++  KLPDFAD+  N    E C+ KC
Sbjct  371   GNWSEGCLRKTLLQCQRNSTNGTAASDEKDGFVGIRGAKLPDFADL-VNAGPGEGCEXKC  429

Query  1512  eedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiiv  1333
               +CSC AYA     GI CM+W  +L+D+ Q   G G+TL +R+  S+L NK  K + +V
Sbjct  430   LXNCSCTAYA--FVEGIGCMMWTGDLIDVEQFTLG-GNTLQIRVAHSDLGNKK-KLSTVV  485

Query  1332  avsvvaavavlvivsIWLLCSRRARIRAK---------KRDEIPRTELPTSGEFSSDFSA  1180
                +  A A  V++ + LL   +A+++           +  + P  +   S EFS+D S 
Sbjct  486   IAVISVAGAXFVVIILLLLWWFKAKLKVLPISSSISWLRGSDTPMLDAGKSEEFSTDTSG  545

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               ++  +G     S+L  F+FS +AAAT++FS  NKLG+GGFG VYKG LP   +IAVKR
Sbjct  546   SVNVFAQGNQANGSELPLFNFSCVAAATNNFSEENKLGKGGFGTVYKGSLPGLPQIAVKR  605

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSRRS QG++EF NE+++IAKLQHRNLVRLLGCCIEG+EK+L+YEYMPNKSLD F+F PA
Sbjct  606   LSRRSTQGLEEFKNEISLIAKLQHRNLVRLLGCCIEGEEKILVYEYMPNKSLDFFLFHPA  665

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
              RS L+WRKRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +M PKISDFGMARI
Sbjct  666   NRSLLDWRKRFTIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMIPKISDFGMARI  725

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGGN+ E NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS R+ +H
Sbjct  726   FGGNEKEENTARVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSLRSTEH  785

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQ--EVLRCIQLGLLCVQDLAVHRPNMSAVV  286
               +I YAW  W+E +  +L+DPSI  +C     EVLRCI +GLLCVQD A  RP MSAVV
Sbjct  786   LSLIGYAWHLWNENRATDLIDPSIAETCSQNETEVLRCIHVGLLCVQDHAASRPTMSAVV  845

Query  285   LFLETDNVTLPVPRPPTYTASMRRS-VDVDSWNQNNELPSSNSITMSVIVGR  133
             L LE++   L +P  P +T+  R   VD     +  ++  SN +T++++ GR
Sbjct  846   LMLESEAANLQLPVEPIFTSIKRHXVVDTKFSTEGQDIAPSNDVTITMVEGR  897



>gb|KCW74922.1| hypothetical protein EUGRSUZ_E03669, partial [Eucalyptus grandis]
Length=860

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/831 (51%), Positives = 562/831 (68%), Gaps = 40/831 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I +GQ ++D GE ++S++ KF LGFFSP  +S RYVGIWY+  + ++VVWVANRE 
Sbjct  38    AANSISRGQSVRD-GETLISSSGKFELGFFSPANSSLRYVGIWYHFSV-KTVVWVANRES  95

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+  ++G F ++ +G  +VLDG  + V    +NSS  ++N T VL+++  L++L      
Sbjct  96    PVSGESGVFTVSSDGNLMVLDGNNRTVWSSGSNSSAVATNLTAVLKDSGNLVLLAGTDAD  155

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW +S +PSPG +SMG+
Sbjct  156   SASADG-DISNSYWQSFKHPTDTYLPGMRVRVNSVAGENRAFMSWKSSNDPSPGNYSMGV  214

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYKSS  1915
             D +  PQIVIW    R WRSGHW G++F GVP M  D  YGF L T   + ++Y  Y  S
Sbjct  215   DSQIPPQIVIWGQSGREWRSGHWIGQIFTGVPNMIGDIRYGFSLTTTEADGSMYFTYTPS  274

Query  1914  S-SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + S L+MF++ WNG E Q  W+E+  +W  +Q QPA +C +YN CG FA C+    +   
Sbjct  275   NRSKLLMFRILWNGTEEQLGWDETSNEWTVLQSQPAKECDLYNRCGDFAICNEM--DHPK  332

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNN--TEGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF+P   +QWN+ NW+ GC R+T LQC+ N+  T G G   DGF E+  +KLPDF
Sbjct  333   CSCMKGFSPKSPDQWNSGNWSAGCARKTQLQCRDNSSFTAGDGGGMDGFLELHGVKLPDF  392

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             A+ + +  + ++C+ KC E+CSCNAYA      I CMLW   L+D+    +  G T+ +R
Sbjct  393   AE-NVSASNRDECEVKCRENCSCNAYA--FGRRIGCMLWSENLIDVQHFAQ-CGMTVQIR  448

Query  1383  LHSSELDNKS--SKTTiivavsvvaavavlvivsIWLLCS--RRARIRAKKRDEIPRTE-  1219
             L  +EL+ KS  S    I+   V A V  +++  +W      +   I   K   +P ++ 
Sbjct  449   LAKTELETKSKISNLFKIITFLVGALVLGVLVYLLWRFKDNLKGFSIFNWKNKRLPLSDD  508

Query  1218  LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYK  1039
             L  + E S++ S    L  + K    +D+  F FSSI AAT+ FS  NKLG GGFG VYK
Sbjct  509   LVRNDELSAELSGPDGLARDAKQVGGADIPVFKFSSIEAATNFFSEENKLGLGGFGPVYK  568

Query  1038  GVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYM  859
             G L  GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLVRL G CI+G++KML+YEYM
Sbjct  569   GKLFGGQEIAVKRLSRKSSQGIEEFKNEVMLIAKLQHRNLVRLFGFCIKGEDKMLIYEYM  628

Query  858   PNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGE  679
             PN+SLD F+FDP KR +LNW+ RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD E
Sbjct  629   PNRSLDRFIFDPVKRVQLNWKTRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEE  688

Query  678   MNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIV  499
             MNPKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFG+LLLEI+
Sbjct  689   MNPKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGILLLEII  748

Query  498   SGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDL  319
             + ++N  FRT +HS +I YAW    EGK M L+DP I  +C   EVLRCIQ+GLLCVQD 
Sbjct  749   TSKKNFGFRTLEHSSLIVYAWHHLKEGKGMELIDPCIRDTCSTDEVLRCIQVGLLCVQDS  808

Query  318   AVHRPNMSAVVLFLETDNVTLPVPRPP--------TYTASMRRSVDVDSWN  190
             A +RP M +V+L L+++ V LP P+ P        T T S+  S +++S N
Sbjct  809   APNRPTMPSVMLLLKSETVDLPFPKLPRSTSITGSTGTCSLFESQEIESLN  859



>emb|CAN70165.1| hypothetical protein VITISV_024701 [Vitis vinifera]
Length=1102

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/756 (56%), Positives = 529/756 (70%), Gaps = 40/756 (5%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             + QGQ I+D GE + S+++ F LGFFSPE +++RYVGIWYN+I  Q+VVWVANR+ PI  
Sbjct  62    LTQGQSIRD-GETVNSSSQHFALGFFSPENSTSRYVGIWYNKIEGQTVVWVANRDSPISG  120

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG-WRPNNTI  2221
              +G   +   G  VV DG   SIW++ +S +SSN+T +L +T  L++  +D     +   
Sbjct  121   TDGVLSLDKTGNLVVFDGNGSSIWSSXASASSSNSTAILLDTGNLVLSSSDNVGDTDKAF  180

Query  2220  WQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEG  2047
             WQSF+  TDTFLPGM+V  D + GE+++FTSW    +PSPG ++MG+DPRA+PQIVIW+G
Sbjct  181   WQSFNSSTDTFLPGMKVLVDETMGENRVFTSWKTEVDPSPGNYTMGVDPRAAPQIVIWDG  240

Query  2046  EKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND-NLYLEYK-SSSSDLIMFKVDWNG  1876
               R WRSGHW+G +F G+P M   + YGF   T+ D   Y  Y  S+SSDL+ F++ WNG
Sbjct  241   SIRXWRSGHWNGLIFTGIPDMMAVYSYGFKYTTDEDXKSYFTYTXSNSSDLLRFQIRWNG  300

Query  1875  KEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQ  1696
              E Q RW+  +K+W   Q QP ++C  YN CG F  C  S  N  +C C+ GF+P   +Q
Sbjct  301   TEEQLRWDSDKKEWGVXQSQPDNECEEYNKCGAFGIC--SFENSASCSCLEGFHPRHVDQ  358

Query  1695  WNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkk  1516
             WN  NW+GGC RRT LQC ++ +  G  E DGF +V+ +KLPDFAD  R     ++C+K+
Sbjct  359   WNKGNWSGGCVRRTQLQCDRSTSANGTGEGDGFLKVEGVKLPDFAD--RVNLDNKECEKQ  416

Query  1515  ceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTii  1336
             C ++CSC AYA     GI CM+W  +LVD+    EG   TL +RL  SEL  K      +
Sbjct  417   CLQNCSCMAYAHVT--GIGCMMWGGDLVDIQHFAEGGRXTLHLRLAGSELGGKG--IAKL  472

Query  1335  vavsvvaavavlvivsIWLLCSRRARIRA-----KKRDEIPRTELPTSGEFSSDFSAQCD  1171
             V V +V   AV + +S WLL   RA++RA     ++++E+P   + +  EFS DFS   D
Sbjct  473   VIVIIVVVGAVFLSLSTWLLWRFRAKLRAFLNLGQRKNELPILYVSSGREFSKDFSGSVD  532

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
             L  EGK G+ S+L  F+F  +AAAT +FS  NKLGQGGFG VYKG+LP G+EIAVKRLSR
Sbjct  533   LVGEGKQGSGSELPLFNFKCVAAATGNFSDENKLGQGGFGPVYKGMLPGGEEIAVKRLSR  592

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
             RSGQG++EF NE+T+IAKLQHRNLVRLLGCCIEG+EKMLLYEYMPNKSLD F+FDPAK++
Sbjct  593   RSGQGLEEFKNEMTLIAKLQHRNLVRLLGCCIEGEEKMLLYEYMPNKSLDFFIFDPAKQA  652

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
             EL+WRKRF IIE IARGLLYLHRDSRLRIIHRD+KASNILLD EMNPKISDFGMARIFGG
Sbjct  653   ELDWRKRFTIIEGIARGLLYLHRDSRLRIIHRDMKASNILLDEEMNPKISDFGMARIFGG  712

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             +QNEANT RVVGT GYM+PEYAMEGLFSVKSDVYSFGVLLLEI                 
Sbjct  713   DQNEANTTRVVGTXGYMSPEYAMEGLFSVKSDVYSFGVLLLEI-----------------  755

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQL  343
                AW+ W+EGK M  +D SI  SC   EVLRCI++
Sbjct  756   ---AWQLWNEGKAMEFVDSSIRDSCSQDEVLRCIKV  788


 Score = 70.5 bits (171),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = -3

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNW  1678
             W+E +K+     E+P   C ++  CG +  C+   S    C C+ GF P   ++W+  NW
Sbjct  995   WDEDKKKRSTRWEEPRSLCDLHGACGPYGVCNTYKSP--ICRCLKGFVPKSSDEWSKGNW  1052

Query  1677  TGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
             TGGC R T L C KN ++    + DGF ++   KLPD  +  R+  +
Sbjct  1053  TGGCIRSTELLCDKNTSD--RRKNDGFWKLGGTKLPDLNEYLRHQHA  1097


 Score = 66.6 bits (161),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 82/150 (55%), Gaps = 9/150 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q +  + + + S+ + F LGFF+P  +   Y G+WY  I   ++VWVANRER
Sbjct  822   AIDAITPTQVLTQE-QTLTSSGQIFELGFFNPGNSGKNYAGVWYKNISVPTIVWVANRER  880

Query  2409  PI--LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             P+  LD +    I  +G  +++D    S+W+TN S  S+N+T VL +  + ++  +    
Sbjct  881   PLSALDSSAVLTIGSDGNLMLVDSMQNSVWSTNVSALSNNSTAVLLDDGDFVLKHS---I  937

Query  2235  PNNTIWQSFHQPTDTFLPGMRVD--LSAGE  2152
                 +W+SF+ P DT LP    D  LS G+
Sbjct  938   SGEFLWESFNHPCDT-LPTQHEDRILSRGQ  966



>emb|CAA73134.1| serine/threonine kinase [Brassica oleracea]
Length=850

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/850 (49%), Positives = 562/850 (66%), Gaps = 55/850 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGEN--IVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A D I++G +++D   +  +VS  + F LGFFSP  +  RY+GIWY  I  ++VVWVANR
Sbjct  25    AQDTIRRGGFLRDGSTHKPLVSPQKTFELGFFSPGSSPGRYLGIWYGNIEDKAVVWVANR  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDG  2242
             E PI D++G   I+ +G  V+L+G+N++    N  S+   +N    + +T    +++   
Sbjct  85    ENPISDRSGVLTISNDGNLVLLNGQNITVWSSNITSTNNDNNRVGSILDTGNFELIEVSS  144

Query  2241  WRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
              R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG FS+G+DP  +P
Sbjct  145   ER---VIWESFNHPTDTFLPHMRVRVNPQTGDNLAFVSWRSENDPSPGNFSLGVDPSGAP  201

Query  2067  QIVIW-EGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSS  1912
             +IV+W     R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S  
Sbjct  202   EIVLWGRNNTRRWRSGQWNSAIFTGIPNMALLTNYLYGFKLSSPPDETGSVYFTYVPSDP  261

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L+ FKV  NG E + RWNE+ K+W K Q  P  +C  YN CG F  CD    NGI C 
Sbjct  262   SVLLRFKVLHNGTEEELRWNETSKRWTKFQAAPESECDKYNRCGSFGICDMRGDNGI-CS  320

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADID  1552
             C+ G+ P         NW+ GC RRTPL+C++N +  G   +D F  +K +KLPDF   +
Sbjct  321   CVKGYEPVSLG-----NWSRGCRRRTPLRCERNVSNVG---EDEFLTLKSVKLPDFETPE  372

Query  1551  RNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
              ++  PEDCK +C ++CSC A+      GI CM+W  +LVD+ Q + G GS+L VRL  S
Sbjct  373   HSLADPEDCKDRCLKNCSCTAFT--FVNGIGCMIWNQDLVDLQQFEAG-GSSLHVRLADS  429

Query  1371  EL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRT---------  1222
             E+ ++K +K  +IVAV V   +  +  + +W         R K++ ++  T         
Sbjct  430   EIGESKKTKIVVIVAVLVGVLLLGIFALLLW---------RFKRKKDVSGTYCGHDADTS  480

Query  1221  ----ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGF  1054
                 ++  + + ++ F+   D+ +EGKA  +S+L  F    I  AT+ FS  N+LG+GGF
Sbjct  481   VVVVDMTKAKDTTTAFTGSVDIMIEGKAVNTSELPVFCLKVIVKATNDFSRENELGRGGF  540

Query  1053  GHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKML  874
             G VYKGVL  GQEIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML
Sbjct  541   GPVYKGVLEDGQEIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKML  600

Query  873   LYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNI  694
             +YEYMPNKSLD F+FD  K+  ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+
Sbjct  601   VYEYMPNKSLDFFIFDEMKQELVDWKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSNV  660

Query  693   LLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVL  514
             LLDGEMNPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVL
Sbjct  661   LLDGEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVL  720

Query  513   LLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLL  334
             LLEI+SG+RNTS R  +H  +I YAW  +  G+   L+DP I ++C  +E LRCI + +L
Sbjct  721   LLEIISGKRNTSLRASEHGSLIGYAWFLYTHGRSEELVDPKIRATCNKREALRCIHVAML  780

Query  333   CVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRR-SVDVDSWNQNNE--LPSSN  163
             CVQD A  RPNM+AV+L LE+D  TLPVPR PT+T S RR S+DV+    +++  + SSN
Sbjct  781   CVQDSAAERPNMAAVLLMLESDTATLPVPRQPTFTTSTRRNSMDVNFALDSSQQYIVSSN  840

Query  162   SITMSVIVGR  133
              IT +V++GR
Sbjct  841   EITSTVVLGR  850



>ref|XP_009134704.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Brassica rapa]
Length=851

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/840 (49%), Positives = 559/840 (67%), Gaps = 35/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGEN--IVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A D I++G++++D   +  +VS  + F LGFF+P  ++ RY+GIWY  I  ++VVWVANR
Sbjct  26    AQDTIRRGEFLRDGSTHKPLVSPQKTFELGFFTPGSSTGRYLGIWYGNIEDKAVVWVANR  85

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDG  2242
             E PI D++G   I+ +G  V+L+G+N++    N  S+   +N    +R+T    +++   
Sbjct  86    ENPISDQSGVLTISNDGNLVLLNGQNITVWSSNITSTNNDNNRVGSIRDTGNFELIEVTS  145

Query  2241  WRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
              R    IW+SF+ PTDTFLP MRV ++   G++  F SW +  +PSPG FS+G+DP  +P
Sbjct  146   ER---VIWESFNHPTDTFLPNMRVRVNPQTGDNLAFVSWRSDNDPSPGNFSLGVDPSGAP  202

Query  2067  QIVIW-EGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSS  1912
             +IV+W     R WRSG W+  +F G+P   + T+++YGF L +   E  ++Y  Y  S  
Sbjct  203   EIVLWGRNNTRRWRSGQWNSAIFTGIPNMALLTNYLYGFKLSSPPDETGSVYFTYVPSDP  262

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L+ FKV  NG E + RWNE+ K+W K Q  P  +C  YN CG F  C+    NGI C 
Sbjct  263   SVLLRFKVLHNGTEEELRWNETSKRWTKFQAAPESECDKYNRCGSFGICNMKGDNGI-CS  321

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADID  1552
             C+ G+ P      +  NW+ GC RRTPL+C++ N    G  +D F  +K +KLPDF   +
Sbjct  322   CVDGYAPV-----SVGNWSRGCRRRTPLKCERRNVSNVG--EDEFLTLKSVKLPDFETPE  374

Query  1551  RNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
              ++  PE+CK +C  +CSC A+      GI CM+W  +LVD+ Q + G GS+L VRL  S
Sbjct  375   HSLADPEECKDRCLNNCSCTAFT--FVNGIGCMIWNQDLVDLQQFEAG-GSSLHVRLADS  431

Query  1371  EL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRR---ARIRAKKRDEIPRTELPTSG  1204
             E+ ++K +K  +IVAV     +  +  + +W    ++           D     ++  + 
Sbjct  432   EIGESKKTKIVVIVAVLAGVVLLGIFALLLWRFKRKKDVSGTYCGHDADTSVVVDMTKTK  491

Query  1203  EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPC  1024
             + ++ F+   D+ +EGKA  +S+L  F  + I  AT+ FS  N+LG+GGFG VYKGVL  
Sbjct  492   DTTAAFTGSVDIMIEGKAVNTSELPVFCLNVIVKATNDFSRENELGRGGFGPVYKGVLED  551

Query  1023  GQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSL  844
             GQEIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSL
Sbjct  552   GQEIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSL  611

Query  843   DSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKI  664
             D F+FD  K+  ++ + RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDGEM PKI
Sbjct  612   DFFIFDETKQGLVDGKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEMIPKI  671

Query  663   SDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN  484
             SDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+RN
Sbjct  672   SDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRN  731

Query  483   TSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             TS R+ +H  +I YAW  +  G+   L+DP I ++C  +E LRCI + +LCVQD A  RP
Sbjct  732   TSLRSSEHGSLIGYAWFLYTHGRSEELVDPKIRATCNKREALRCIHVAMLCVQDSAAERP  791

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMRR-SVDVDSWNQNNE--LPSSNSITMSVIVGR  133
             NM+AV+L LE+D  TLPVPR PT+T S RR S+DV+    +++  + SSN IT +V++GR
Sbjct  792   NMAAVLLMLESDTATLPVPRQPTFTTSTRRNSMDVNFALDSSQQYIVSSNEITSTVVLGR  851



>ref|XP_006598304.1| PREDICTED: uncharacterized protein LOC100797331 [Glycine max]
Length=1803

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/848 (50%), Positives = 559/848 (66%), Gaps = 56/848 (7%)
 Frame = -3

Query  2580  KIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             +I QG  I+D + E +VS    F +GFFS + +S+RYVGIWY+ I    V+WVANR++PI
Sbjct  33    RITQGVTIRDKEHETLVSEELNFAMGFFSSDNSSSRYVGIWYDNIPGPEVIWVANRDKPI  92

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsi---wntnssvtssnatmVLRNTSELIILKTDGWRP  2233
                 GA  I+ +G  VVLDG    +     +N +  + N++  L +   L++        
Sbjct  93    NGTGGAITISNDGNLVVLDGAMNHVWSSNVSNINSNNKNSSASLHDDGNLVLTC-----E  147

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSA-GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                +WQSF  PTDT++PGM+V +     S +FTSW ++ +PS G ++MG+DP   PQIV+
Sbjct  148   KKVVWQSFENPTDTYMPGMKVPVGGLSTSHVFTSWKSATDPSKGNYTMGVDPEGLPQIVV  207

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN-LYLEYKS-SSSDLIMFKVDW  1882
             WEGEKR WRSG+WDGR+F G+ +   ++YGF L  +     Y  Y   + +D + F++ W
Sbjct  208   WEGEKRRWRSGYWDGRMFQGLSIAASYLYGFTLNGDGKGGRYFIYNPLNGTDKVRFQIGW  267

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCD----NSSSNGIN-CVCIVGF  1717
             +G E + RWNE  K W +IQ+ P  +C VYN CG FA CD    + SS+ +  C CI GF
Sbjct  268   DGYEREFRWNEDEKSWSEIQKGPFHECDVYNKCGSFAACDLLTLSPSSDLVPVCTCIRGF  327

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAE----KDGFREVKHIKLPDFA----  1561
              P   +QW   NW+GGCTR TPL+ Q+ N    G +    +DGF + + +KLPDFA    
Sbjct  328   EPKHRDQWEKGNWSGGCTRMTPLKAQRINVTSSGTQVSVGEDGFLDRRSMKLPDFARVVG  387

Query  1560  --DIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFV  1387
               D +R   S          + SC AYA     G+ CM+W  +LVD+  L+ G G+TL +
Sbjct  388   TNDCERECLS----------NGSCTAYANV---GLGCMVWHGDLVDIQHLESG-GNTLHI  433

Query  1386  RLHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA----------KKRD  1237
             RL  S+LD+   K   IV +S   A  + + + +WL+   + +++           K  D
Sbjct  434   RLAHSDLDD--VKKNRIVIISTTGAGLICLGIFVWLVWRFKGKLKVLPTVSSVSCCKSSD  491

Query  1236  EIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGG  1057
              +P  +   S E S++FS   DL++EG   +  +   F+FS I+ AT++FS  NKLGQGG
Sbjct  492   ALPVFDANKSREMSAEFSGSADLSLEGNQLSGPEFPVFNFSCISIATNNFSEENKLGQGG  551

Query  1056  FGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKM  877
             FG VYKG LP G++IAVKRLSRRSGQG++EF NE+ +IAKLQHRNLVRL+GC I+G+EK+
Sbjct  552   FGPVYKGKLPGGEQIAVKRLSRRSGQGLEEFKNEMMLIAKLQHRNLVRLMGCSIQGEEKL  611

Query  876   LLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASN  697
             L YEYMPNKSLD F+FDP K+ +L WR+R  IIE IARGLLYLHRDSRLRIIHRDLKASN
Sbjct  612   LAYEYMPNKSLDCFLFDPVKQKQLAWRRRVEIIEGIARGLLYLHRDSRLRIIHRDLKASN  671

Query  696   ILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV  517
             ILLD  MNPKISDFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV
Sbjct  672   ILLDENMNPKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV  731

Query  516   LLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGL  337
             LLLEI+SGRRNTSFR  D S +I YAW  W+E K M LLDP I  S    + LRCI +G+
Sbjct  732   LLLEILSGRRNTSFRHSDDSSLIGYAWHLWNEHKAMELLDPCIRDSSPRNKALRCIHIGM  791

Query  336   LCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSI  157
             LCVQD A HRPNMSAVVL+LE++  TLP+P  P  T SMRR+ D + +     L  SN +
Sbjct  792   LCVQDSAAHRPNMSAVVLWLESEATTLPIPTQPLIT-SMRRTEDREFYMDG--LDVSNDL  848

Query  156   TMSVIVGR  133
             T++++VGR
Sbjct  849   TVTMVVGR  856


 Score =   581 bits (1498),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 349/793 (44%), Positives = 477/793 (60%), Gaps = 39/793 (5%)
 Frame = -3

Query  2544  ENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIP-QSVVWVANRERPILDKNGAFGITGN  2368
             + +VS +  F LGFF P   S  Y+G WYN I   ++VVWVANR+ P+ + +G   I  N
Sbjct  997   QTLVSPSHIFALGFF-PGTNSTWYLGAWYNNITDDKTVVWVANRDNPLENSSGFLTIGEN  1055

Query  2367  GTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTF  2188
             G  V+ +    +   ++ +  ++N  + L +T  LI+ + +   P   +WQSF  PTDT 
Sbjct  1056  GNIVLRNPSKKNPVWSSDATKANNPVLQLLDTGNLILREANITDPTKYLWQSFDYPTDTL  1115

Query  2187  LPGMRV--DLSAGESKLFTSWTNSG-NPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             LPGM++  +L  G  K  TSW N+G +PS G +S  ID R  P+I + + +   +RSG W
Sbjct  1116  LPGMKMGWNLDTGAEKHLTSWKNTGSDPSSGDYSFKIDTRGIPEIFLSDDQNIAYRSGPW  1175

Query  2016  DGRVFLGVP-MRTDF-VYGFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQ-RWNES  1846
             +G  F GVP M+ D     FD   +   +Y  +   +  ++   V  +G E+++  W  S
Sbjct  1176  NGERFSGVPEMQPDTDSITFDFSYDKHGVYYSFSIGNRSILSRLVVTSGGELKRLTWVPS  1235

Query  1845  RKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGC  1666
              K W      P DQC  Y  CG +  CD+++S    C C+ GF P +   WN R+ + GC
Sbjct  1236  SKTWTTFWYAPKDQCDGYRACGPYGLCDSNASP--VCTCVGGFRPRNQQAWNLRDGSDGC  1293

Query  1665  TRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD----FADIDRNMRSPedckkkceedCS  1498
              R T L C            D F  VK++KLP+    FA+   N+R    C+  C  DCS
Sbjct  1294  ERNTDLDCGS----------DKFLHVKNVKLPETTYVFANGSMNLRE---CQDLCLRDCS  1340

Query  1497  CNAYA--PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN----KSSKTTii  1336
             C AYA      GG  C+ W  EL DM +L    G  L+VRL +S++D+       K    
Sbjct  1341  CTAYANIQITNGGSGCVTWSGELEDM-RLYPAGGQHLYVRLAASDVDDIVGGSHKKNHTG  1399

Query  1335  vavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSD---FSAQCDLT  1165
               V +  + AV+++  + +   +R           PR     S +  +    FS   + +
Sbjct  1400  EVVGITISAAVIILGLVVIFWKKRKLFSISNVKTAPRGSFRRSRDLLTSERMFSTNRENS  1459

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              E +     +L  F F++I  ATD+FS ANKLGQGGFG VY+G L  GQ+IAVKRLS+ S
Sbjct  1460  GE-RNMDDIELPMFDFNTITMATDNFSEANKLGQGGFGIVYRGRLMEGQDIAVKRLSKNS  1518

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QGV+EF NE+ +I +LQHRNLVRL GCCIE DEK+L+YEYM N+SLDS +FD AK+  L
Sbjct  1519  VQGVEEFKNEVKLIVRLQHRNLVRLFGCCIEMDEKLLVYEYMENRSLDSILFDKAKKPIL  1578

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W++RF+II  IARGLLYLH DSR RIIHRDLKASNILLD EMNPKISDFGMAR+FG NQ
Sbjct  1579  DWKRRFNIICGIARGLLYLHHDSRFRIIHRDLKASNILLDSEMNPKISDFGMARLFGTNQ  1638

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF-RTDDHSGII  448
              EANT RVVGTYGYM+PEYAM+G FSVKSDV+SFGVL+LEI++G++N  F  +++   ++
Sbjct  1639  TEANTLRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITGKKNRGFYYSNEDMNLL  1698

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
               AW QW +G  + L+D SI  SC   EVLRCI +GLLCVQ+ A  RP MS+V+L L ++
Sbjct  1699  GNAWRQWRDGSTLELIDSSIGDSCSQSEVLRCIHVGLLCVQERAEDRPTMSSVLLMLSSE  1758

Query  267   NVTLPVPRPPTYT  229
             +  +P PR P ++
Sbjct  1759  SAIMPQPRNPGFS  1771



>ref|XP_004169144.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Cucumis sativus]
Length=856

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/840 (49%), Positives = 568/840 (68%), Gaps = 34/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             AA+ I +G+ ++D   E +VS ++ + LGFFSP  +S RYVGIWY++I  QSV+WVANR+
Sbjct  30    AANSITKGRGLRDGSNETLVSLDDSYELGFFSPINSSLRYVGIWYHKIEEQSVIWVANRD  89

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             RP+ ++NG   I  +G  VVLDG N    +  ++ +     + L N   L++   D    
Sbjct  90    RPLRNRNGVLIIGDDGNLVVLDGNNSVWTSNITANSFEPRNLTLLNHGALVLSSGDDL--  147

Query  2232  NNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
             +   W SF  PTDTFLP M  +V+   GE ++F SW +  +P+ G + +G+DPR + QI+
Sbjct  148   SKVHWSSFEHPTDTFLPNMVVKVNPQMGEKRMFMSWKSETDPAVGNYCLGVDPRGAVQII  207

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEN-DNLYLEYKSSSS-DLIMFKV  1888
             +W G  R+WRSGHWD ++F G+P MR+  +YGF + +++ +N+ + +++ +  D + F++
Sbjct  208   VWNGNNRWWRSGHWDKQIFSGIPTMRSTSLYGFKITSDDGNNISVTFEALNDLDKLKFQI  267

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+GKE QQR NE+ ++W  I+  P++ C  YN CG F  C  +S   + C C  GF P 
Sbjct  268   QWDGKEAQQRLNETTRKWDTIRLLPSNDCDFYNFCGDFGVCSENSR--LKCSCPQGFIPK  325

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGG----AEKDGFREVKHIKLPDFADIDRNMR  1540
             +  +W+   W+ GC R+TPL  Q+  +   G    +E+DGF +V  +KLPDF      + 
Sbjct  326   NKERWDKGIWSDGCRRKTPLLEQRMKSSPNGTIEDSEQDGFVDVLFVKLPDFI---TGIF  382

Query  1539  SPedckkkceedCSCNAY--APPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
               E C+ +C  + SC AY  AP    GI C  W   L D+ +  EG+G+TL +R+  S+L
Sbjct  383   VVESCRDRCSSNSSCVAYSDAP----GIGCATWDGPLKDIQRF-EGAGNTLHLRIAHSDL  437

Query  1365  D--NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRTELPT  1210
                +  SK +  V V++    A  + +   LL   R + +A      + + E+P  +L  
Sbjct  438   TPVDSESKLSTGVIVAICFGGAAAIAIIALLLWKFRGKTKAATTSEPQNKTEVPMFDLSK  497

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E S++ S   +L +EG+  +  DL  F+F+ IAAATD+FS  NKLGQGGFG VYKG L
Sbjct  498   SKELSAELSGPYELGIEGENLSGPDLPMFNFNYIAAATDNFSEENKLGQGGFGPVYKGKL  557

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             PCGQEIAVKRLS RSGQG++EF NE+ +I KLQHRNLVRLLG CI+G++K+LLYEYMPNK
Sbjct  558   PCGQEIAVKRLSVRSGQGLEEFKNEIILIGKLQHRNLVRLLGYCIQGEDKLLLYEYMPNK  617

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FDP K++ L+W+KR  I+E IARGLLYLHRDSRL IIHRDLKASNILLD +MNP
Sbjct  618   SLDWFLFDPNKQALLDWKKRLSIVEGIARGLLYLHRDSRLLIIHRDLKASNILLDEDMNP  677

Query  669   KISDFGMARIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             KISDFGMARIFGGNQNEA NT RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE++ G
Sbjct  678   KISDFGMARIFGGNQNEATNTIRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLELICG  737

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RRNTSFR+ ++  +I YAW+ W++G+ + LLDPSI  S    EVL+CI + +LCVQD   
Sbjct  738   RRNTSFRSTEYLTLISYAWKLWNDGRAIELLDPSIRDSSPENEVLKCIHVAMLCVQDSPA  797

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +RP + ++VL LE+++ +LP PR PTYT S R S+D+D + + +++ SSN +T++++ GR
Sbjct  798   YRPTLQSLVLMLESESTSLPQPRQPTYT-STRASIDIDLFTEGHDIVSSNDVTVTMLDGR  856



>gb|ABD32350.1| Protein kinase; S-locus glycoprotein; Curculin-like (mannose-binding) 
lectin; Apple-like [Medicago truncatula]
Length=845

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/830 (51%), Positives = 544/830 (66%), Gaps = 33/830 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I Q Q IKD G  +VS   +F +GFFS   +S+RYVGIWY  +   + VWVANRE+
Sbjct  31    AANFITQNQTIKD-GSTLVSEGLRFEMGFFSFNNSSSRYVGIWYYNVT-SAYVWVANREK  88

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             PI ++ G   I  +G  VVLDG+N  +  +  S ++ +N+  VL N   LI+   +    
Sbjct  89    PIKNREGFITIKNDGNLVVLDGQNNEVWSSNASKISINNSQAVLHNNGNLILSDREN---  145

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAG----ESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
             N  IWQSF  PTDT+LPGM+  +S G    +   F SW +  +PS G ++M +D  ASPQ
Sbjct  146   NKEIWQSFEDPTDTYLPGMKAPVSGGNGIGKDATFCSWKSENDPSLGNYTMSVDSEASPQ  205

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT-ENDNLYLEYKS-SSSDLIMF  1894
             IVI EGEKR WRSG+WDGRVF GVP M   +++GF L T +    Y  Y++  +SD + F
Sbjct  206   IVIMEGEKRRWRSGYWDGRVFTGVPNMTGSYLFGFRLNTNDTGERYFVYEALENSDKVRF  265

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
             ++ ++G E Q RWNE  K+W  I  +P  +C  YN CG FA CD S S+   C CI GF 
Sbjct  266   QLGYDGYERQFRWNEEEKEWNVILSEPNKKCEFYNSCGSFAICDMSDSSL--CKCIKGFE  323

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             P D   WN+ NW+ GC R TPL+ ++          DGF   K +KLPDFA +   + S 
Sbjct  324   PRDVKSWNSGNWSKGCKRMTPLKSERGGNSS--GGDDGFLVQKGLKLPDFARLVSAVDSK  381

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             +      +   SC AY   +  GI CM+W  ELVD  +L E  G+TL +RL  S+L +  
Sbjct  382   DCEGNCLKNS-SCTAYVNAI--GIGCMVWHGELVDFQRL-ENQGNTLNIRLADSDLGD-G  436

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKK-------RDEIPRTELPTSGEFS  1195
              K T I  +  V A  + + + +WLLC  + +++            ++P ++   SG  S
Sbjct  437   KKKTKIGIILGVVAGIICLGIFVWLLCRFKGKLKVSSTSSTSNINGDVPVSKPTKSGNLS  496

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             + FS   DL ++G +  +++L  F+FSSI  AT++FS  NKLGQGGFG VYKG LP G++
Sbjct  497   AGFSGSIDLHLDGSSINNAELSLFNFSSIIIATNNFSEENKLGQGGFGPVYKGRLPGGEQ  556

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSR S QG+ EF NE+ +IAKLQHRNLVRLLGC I+G+EK+L+YEYMPNKSLD F
Sbjct  557   IAVKRLSRLSNQGLDEFKNEMMLIAKLQHRNLVRLLGCSIQGEEKLLVYEYMPNKSLDYF  616

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP K+++L+  +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDF
Sbjct  617   LFDPVKKTKLDSSRRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDF  676

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+A+IFGGNQNE NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGR+NTSF
Sbjct  677   GLAKIFGGNQNEGNTERVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRKNTSF  736

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R      +I YAW  W+E K M L+DPSI  S    + LRCI +G+LCVQD A HRPNMS
Sbjct  737   RDSYDPSLIGYAWRLWNEEKIMELVDPSISDSTKKSKALRCIHIGMLCVQDSASHRPNMS  796

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             +VVL LE++  TLP+P  P  T SMRR  D + +N     P   S+ ++V
Sbjct  797   SVVLMLESEATTLPLPVKPLLT-SMRRYDDTEEFNTE---PFDASVDLTV  842



>gb|KCW74925.1| hypothetical protein EUGRSUZ_E03671 [Eucalyptus grandis]
Length=788

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/795 (52%), Positives = 546/795 (69%), Gaps = 37/795 (5%)
 Frame = -3

Query  2439  SVVWVANRERPILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSE  2266
             +VVWVANR+ P+ D++G   ++G+G  VVLDG  + V     NSS   +N+T VL +T  
Sbjct  5     TVVWVANRDSPVSDESGVLTVSGDGNLVVLDGNNRTVWSSGINSSSVRTNSTAVLMDTGN  64

Query  2265  LIILKT----------DGWRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNS  2122
             L++L +          DG   +N+ WQSF  PTDT+LPGMRV ++  AGE++ F SW + 
Sbjct  65    LVLLASADAGSASAYGDG---SNSYWQSFEHPTDTYLPGMRVRVNPVAGENRAFRSWKSL  121

Query  2121  GNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--IT  1951
              +PS G F MGIDPR  PQIVIW    R WRSGHW+G +F GV  M  +F YGF L  I 
Sbjct  122   DDPSSGDFFMGIDPRLPPQIVIWGQSGREWRSGHWNGVIFTGVQNMTGNFQYGFKLSDID  181

Query  1950  ENDNLYLEYKSS-SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQF  1774
              + N+Y  Y SS SS+ +MF++ WNGKE Q  W+E+  +W  +QEQPA +C +YN CG F
Sbjct  182   ADGNMYFTYTSSNSSNHLMFRILWNGKEEQLGWDETSNEWTVLQEQPAKECDLYNKCGNF  241

Query  1773  ARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDG  1600
             A C+   S    C C+  F+P   +QWN  NW+ GC R+T LQC+ N++   G G+  DG
Sbjct  242   AICNEMDSP--KCSCMKEFSPKSPDQWNRGNWSAGCARKTQLQCRDNSSISVGDGSRMDG  299

Query  1599  FREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQ  1420
             F ++  +KLPDFAD   +  S E+C+ KC  +CSC+AYA  +  GI C+LW  +L D+  
Sbjct  300   FLKLDGVKLPDFAD-STSATSTEECEAKCLANCSCDAYAFAI--GIKCLLWSEDLTDVQL  356

Query  1419  LDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA---  1249
              DEG G TL +RL +SEL  KS K + +  + +V   A ++ V++WLL   +  ++    
Sbjct  357   FDEG-GLTLQIRLANSELGTKS-KISNLFIIIIVLVGAFVLGVAVWLLRRFKDNLKGFSF  414

Query  1248  --KKRDEIPRT-ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLA  1078
               +K  E+P + +   +GE S++ S    L  + K    +D+  F+FS+I AAT+ FS  
Sbjct  415   FHRKNKELPLSHDFVENGELSAELSRPNGLARDDKQVGGADIPVFNFSTIEAATNFFSEE  474

Query  1077  NKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCC  898
             NKLG GGFG VYKG L  GQEIAVKRLSR+S QG++EF NE+ +IAKLQHRNLV LLG C
Sbjct  475   NKLGLGGFGPVYKGKLFGGQEIAVKRLSRKSSQGLEEFKNEVMLIAKLQHRNLVGLLGFC  534

Query  897   IEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIH  718
             ++G++KML+YEYMPNKSLD F+FD   R +L+W+KRF IIE IARGLLYLHRDSRLRIIH
Sbjct  535   VQGEDKMLVYEYMPNKSLDCFIFDSVMRVQLDWKKRFEIIEGIARGLLYLHRDSRLRIIH  594

Query  717   RDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKS  538
             RDLK SNILLD EMNPKISDFGMARIFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKS
Sbjct  595   RDLKVSNILLDKEMNPKISDFGMARIFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKS  654

Query  537   DVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVL  358
             DVYSFG+LLLEI++G++N  F T +HS +I +AW +W+EGK + L+DP I  SC   EVL
Sbjct  655   DVYSFGILLLEIITGKKNLGFHTPEHSNLISHAWHRWNEGKGIELIDPCIRDSCSTDEVL  714

Query  357   RCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE  178
             RCIQ+GLLCVQD  VHRP M  VVL L ++ V LP+P+ P  + S+  S+D  S  ++ E
Sbjct  715   RCIQIGLLCVQDSTVHRPAMPTVVLLLGSETVDLPIPKLPM-SISITGSMDTYSLFESQE  773

Query  177   LPSSNSITMSVIVGR  133
             + SSN IT+S + GR
Sbjct  774   IESSNGITVSSVDGR  788



>ref|XP_006282832.1| hypothetical protein CARUB_v10006676mg [Capsella rubella]
 gb|EOA15730.1| hypothetical protein CARUB_v10006676mg [Capsella rubella]
Length=801

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/838 (49%), Positives = 562/838 (67%), Gaps = 77/838 (9%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD I++G+ ++D  + + +VS  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  22    AADTIRRGESLRDGVNHKPLVSPLKTFELGFFSPGASTSRYLGIWYGNIEDKAVVWVANR  81

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKT  2248
             E PI D++G   I+ +G  V+LDGKN+++      ++++  ++N  + +++T   ++ +T
Sbjct  82    ETPISDQSGVLTISNDGNLVLLDGKNITVWSSNIESSNNNNNNNRIVSIQDTGNFVLSET  141

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
             D  R    +W+SF+ PTDTFLP MRV +++  G++ +F SW +  +PSPG +S+G+DP  
Sbjct  142   DTDR---VVWESFNHPTDTFLPQMRVRVNSRTGDNPVFYSWRSETDPSPGNYSLGVDPSG  198

Query  2073  SPQIVIWEGEK-RYWRSGHWDGRVFLGV---PMRTDFVYGFDLIT---ENDNLYLEY-KS  1918
             +P+IV+WE  K R WRSG W+  +F G+    + T+++YGF L +   E  ++Y  Y  S
Sbjct  199   APEIVLWERNKTRKWRSGQWNSAIFTGIQNMSLLTNYLYGFKLSSPPDETGSVYFTYVPS  258

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
               S L+ FKV +NG E + RW+E+ K+W K Q +P  +C  YN CG F  CD    NGI 
Sbjct  259   DPSMLLRFKVLYNGTEEELRWSETLKKWTKFQSEPDTECDQYNRCGNFGVCDMKGPNGI-  317

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C C+ G+ P      +  NW+ GC RRTPL+C++N + G     D F  +K +KLPDF  
Sbjct  318   CSCVHGYEPV-----SVGNWSRGCRRRTPLKCERNISVG----DDQFLTLKSVKLPDFEI  368

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
              + ++  P DC+++C ++CSCNAY   V GGI CM+W  +LVD+ Q + G GS L +R+ 
Sbjct  369   PEHDLVDPSDCRERCLKNCSCNAYT--VIGGIGCMIWNQDLVDVQQFEAG-GSLLHIRVA  425

Query  1377  SSEL-DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGE  1201
              SE+ + K SK  +I+AV V   +  +  + +W         R K++ E+P         
Sbjct  426   DSEIGEKKKSKIAVIIAVVVGVVLLGIFALLLW---------RFKRKKELP---------  467

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                                      FS ++IA AT+ F   N+LG+GGFG VYKGVL  G
Sbjct  468   ------------------------VFSLNAIAKATNDFRKENELGRGGFGPVYKGVLEDG  503

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             +EIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSLD
Sbjct  504   REIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLD  563

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
              F+FD  K+  ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNPKIS
Sbjct  564   FFLFDETKQELIDWQLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKIS  623

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+RNT
Sbjct  624   DFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRNT  683

Query  480   SFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             S R+ +H  +I YAW  +  G+   L+DP I ++C  +E LRCI + +LCVQD A  RPN
Sbjct  684   SLRSSEHGSLIGYAWYLYTHGRSEELVDPKIRATCNKREALRCIHVAMLCVQDSATERPN  743

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE--LPSSNSITMSVIVGR  133
             M+AV+L LE+D  TL VPR PT+T++ R S+DV+    +++  + SSN IT +V++GR
Sbjct  744   MAAVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSQQYIVSSNEITSTVVLGR  801



>gb|KCW74915.1| hypothetical protein EUGRSUZ_E03662 [Eucalyptus grandis]
Length=849

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/806 (52%), Positives = 538/806 (67%), Gaps = 32/806 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              A+ + QGQ ++D GE +VS +  F LGFF  E +S RYVGIWY +I  ++ VWVANR+ 
Sbjct  11    TANSLSQGQLVRD-GETLVSRSGNFELGFFRTENSSLRYVGIWYRKISFKTYVWVANRDS  69

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+ D++G   I+ +G  +VLDG  + V     NS+   +N+T VL +   L++L      
Sbjct  70    PVSDESGVLTISSDGNLMVLDGDHRLVWSSGINSTSVPTNSTAVLTDAGNLVLLAKADAD  129

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N  WQSF  PTDTFLPGMRV +  +AGE+  F SW +  +PSPG +SMG+
Sbjct  130   TASADG-HVSNAYWQSFEHPTDTFLPGMRVRVNSAAGENHAFRSWRSLNDPSPGNYSMGV  188

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFV-YGFDLIT--ENDNLYLEYKS-  1918
             DP+  PQIVIW    R WRSGHW+G +F G+P  T+ + YGF L    E+ ++Y  Y   
Sbjct  189   DPQLPPQIVIWGQSGREWRSGHWNGLLFTGMPNMTENIRYGFRLSAPEEDGSMYFTYTPL  248

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + SDL+MF++ WNG   +  W+E+  +   +Q+QPA +C +YN CG FA C++  S    
Sbjct  249   NRSDLLMFRILWNGMGEELGWDETNNESTVLQKQPAKECDLYNKCGDFAICNDMGSP--K  306

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF P   +QW   NW+ GCT +T LQC  N++   G G   D F ++  +KLPDF
Sbjct  307   CSCMEGFIPKSPDQWKRGNWSMGCTWKTRLQCGNNSSISVGNGGRMDHFLKLVGVKLPDF  366

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             AD   +  S ++C+ KC E+CSC AYA      I CM+W   L+D+    EG G TL +R
Sbjct  367   ADY-FSATSGDECEVKCLENCSCKAYA--FVRSIGCMMWNKNLIDVQHFAEG-GMTLQIR  422

Query  1383  LHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG  1204
             L +SE   KS K + +  +      A +  ++++LL   +  ++    D+I ++E     
Sbjct  423   LANSEPGTKS-KISNLRMIVTAFVGAFVSGITVFLLWRFKDNLKGFLFDDIVKSE-----  476

Query  1203  EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPC  1024
             E   D S    L  + K      +  F FSSI AAT+ FS  NKLG GGFG VYKG L  
Sbjct  477   EQYLDLSRPDGLASDAKQVGGPRIPVFDFSSIEAATNVFSEENKLGLGGFGPVYKGKLLG  536

Query  1023  GQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSL  844
             GQEIAVKRLSR+S QGV+EF NE+ VIA+LQHRNLVRLLG CI+G++KML+YEYMPN+SL
Sbjct  537   GQEIAVKRLSRKSSQGVEEFKNEVMVIARLQHRNLVRLLGFCIQGEDKMLVYEYMPNRSL  596

Query  843   DSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKI  664
             D F+FDPAKR++LNW+KR  IIE IARG+LYLHRDSRLRIIHRDLK SNILLD EMNPKI
Sbjct  597   DYFIFDPAKRAQLNWKKRLEIIEGIARGILYLHRDSRLRIIHRDLKVSNILLDEEMNPKI  656

Query  663   SDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN  484
             SDFGMARIFGGN+NEA+TNRVVGTYGYM+PEYAMEGLFS KSDVYSFGVLLLEI+SG +N
Sbjct  657   SDFGMARIFGGNENEASTNRVVGTYGYMSPEYAMEGLFSFKSDVYSFGVLLLEIISGEKN  716

Query  483   TSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
               FRT +HS +I +AW  W+EGK M L+DP I   C   E LRCIQ+GLLCVQD A  RP
Sbjct  717   IGFRTPEHSNLISHAWHHWNEGKAMELIDPCIRDMCYVDEALRCIQVGLLCVQDSARDRP  776

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTA  226
              MS+VVL LE++   LP+P+PP  T+
Sbjct  777   LMSSVVLLLESETAGLPLPKPPRLTS  802



>ref|XP_010418128.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 isoform X1 [Camelina sativa]
Length=840

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/831 (50%), Positives = 556/831 (67%), Gaps = 30/831 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G+++VS ++ F +GFFSP+ ++ RYVGIWY  I PQ+VVWVANRE+
Sbjct  28    TSNSITRNQTIRD-GDSLVSNDKSFEVGFFSPKNSTLRYVGIWYKNIEPQTVVWVANREK  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD NGA  I  +G  VV++G+NV++W+T++ + S+N    L NT +L+ L +D  R N
Sbjct  87    PLLDHNGALKIADDGNLVVVNGQNVTVWSTSAKLESNNTVAALLNTGDLV-LSSDSDR-N  144

Query  2229  NTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                W+SF  PTDTFLP M  RVD S GE++ F  W +  +PSPGR+SMGIDP  +P+IVI
Sbjct  145   KWYWESFDNPTDTFLPSMKVRVDPSLGENRGFVPWESENDPSPGRYSMGIDPIRAPEIVI  204

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMF  1894
             WEGEKR WRSG W+  +F G+P     T+++ GF L   + +  +Y  Y + +SSD + F
Sbjct  205   WEGEKRKWRSGPWNSAIFTGIPDMYRVTNYIRGFKLSPPDRDGIVYFTYVTINSSDFLRF  264

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGF  1717
             ++ ++G + Q RWN+  K W  +Q++P  +C  YN CG ++ CD+S   +   C CI GF
Sbjct  265   RIRFDGVQEQFRWNKDAKNWTLLQKKPDTECENYNRCGNYSVCDDSKEFDSGKCSCIDGF  324

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
              P  W+QWN  N++GGC RR PL C ++     G ++DGF+ +K +KLPDF  +     +
Sbjct  325   EPVYWDQWNNMNFSGGCKRRVPLNCSQSLV---GDKRDGFKVLKGMKLPDFGSV-VPFNN  380

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
                CK  C  DCSCNAYA  V  GI CM+W  +L D+     G G+ + +RL  SEL + 
Sbjct  381   SVTCKDVCVRDCSCNAYAVVV--GIGCMIWTRDLTDIESFKLG-GNYINIRLAGSELGDG  437

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG--EFSSDFS  1183
               K+ I + +  V    +L +   W+L  R      KK+D      LP S   + S +F 
Sbjct  438   KEKSKIWIIIVSVIGAFLLGLCI-WILWKRFKAFLWKKKD------LPVSDTRDNSVNFK  490

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
             +     + G    + DL  FSF S+A+AT  F+  NKLGQGGFG VYKG    G+EIAVK
Sbjct  491   SSPINVLVGDQVDTPDLPVFSFDSVASATGDFAEENKLGQGGFGTVYKGNFSEGREIAVK  550

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS +S QG++EF NE+ +IAKLQHRNLVRLLGCCIE DEKMLLYEY+PNKSLD F+FD 
Sbjct  551   RLSGKSKQGLEEFKNEILLIAKLQHRNLVRLLGCCIEDDEKMLLYEYLPNKSLDRFLFDE  610

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             +KR  L+WRKR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMAR
Sbjct  611   SKRGSLDWRKRWEIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMAR  670

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IF   Q++ANT RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  +
Sbjct  671   IFNYRQDQANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNISFRGSE  730

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             H  +I YAW  W +GK   ++DP++  S    E +RCI +G+LC QD  +HRPNM +V+L
Sbjct  731   HGSLIGYAWYLWSQGKTKEMIDPTVEDSRDVAEAMRCIHVGMLCTQDSVIHRPNMGSVLL  790

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQN-NELPSSNSITMSVIVGR  133
              LE+    LP PR PT+  S   S ++D  N +  ++ + N +T + IVGR
Sbjct  791   MLESRTGQLPRPRQPTF-HSFLYSGEIDELNLDGQDVATVNDVTFTTIVGR  840



>ref|XP_010059467.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Eucalyptus grandis]
Length=876

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/806 (52%), Positives = 538/806 (67%), Gaps = 32/806 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              A+ + QGQ ++D GE +VS +  F LGFF  E +S RYVGIWY +I  ++ VWVANR+ 
Sbjct  38    TANSLSQGQLVRD-GETLVSRSGNFELGFFRTENSSLRYVGIWYRKISFKTYVWVANRDS  96

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+ D++G   I+ +G  +VLDG  + V     NS+   +N+T VL +   L++L      
Sbjct  97    PVSDESGVLTISSDGNLMVLDGDHRLVWSSGINSTSVPTNSTAVLTDAGNLVLLAKADAD  156

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N  WQSF  PTDTFLPGMRV +  +AGE+  F SW +  +PSPG +SMG+
Sbjct  157   TASADG-HVSNAYWQSFEHPTDTFLPGMRVRVNSAAGENHAFRSWRSLNDPSPGNYSMGV  215

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFV-YGFDLIT--ENDNLYLEYKS-  1918
             DP+  PQIVIW    R WRSGHW+G +F G+P  T+ + YGF L    E+ ++Y  Y   
Sbjct  216   DPQLPPQIVIWGQSGREWRSGHWNGLLFTGMPNMTENIRYGFRLSAPEEDGSMYFTYTPL  275

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + SDL+MF++ WNG   +  W+E+  +   +Q+QPA +C +YN CG FA C++  S    
Sbjct  276   NRSDLLMFRILWNGMGEELGWDETNNESTVLQKQPAKECDLYNKCGDFAICNDMGSP--K  333

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF P   +QW   NW+ GCT +T LQC  N++   G G   D F ++  +KLPDF
Sbjct  334   CSCMEGFIPKSPDQWKRGNWSMGCTWKTRLQCGNNSSISVGNGGRMDHFLKLVGVKLPDF  393

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             AD   +  S ++C+ KC E+CSC AYA      I CM+W   L+D+    EG G TL +R
Sbjct  394   ADY-FSATSGDECEVKCLENCSCKAYA--FVRSIGCMMWNKNLIDVQHFAEG-GMTLQIR  449

Query  1383  LHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG  1204
             L +SE   KS K + +  +      A +  ++++LL   +  ++    D+I ++E     
Sbjct  450   LANSEPGTKS-KISNLRMIVTAFVGAFVSGITVFLLWRFKDNLKGFLFDDIVKSE-----  503

Query  1203  EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPC  1024
             E   D S    L  + K      +  F FSSI AAT+ FS  NKLG GGFG VYKG L  
Sbjct  504   EQYLDLSRPDGLASDAKQVGGPRIPVFDFSSIEAATNVFSEENKLGLGGFGPVYKGKLLG  563

Query  1023  GQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSL  844
             GQEIAVKRLSR+S QGV+EF NE+ VIA+LQHRNLVRLLG CI+G++KML+YEYMPN+SL
Sbjct  564   GQEIAVKRLSRKSSQGVEEFKNEVMVIARLQHRNLVRLLGFCIQGEDKMLVYEYMPNRSL  623

Query  843   DSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKI  664
             D F+FDPAKR++LNW+KR  IIE IARG+LYLHRDSRLRIIHRDLK SNILLD EMNPKI
Sbjct  624   DYFIFDPAKRAQLNWKKRLEIIEGIARGILYLHRDSRLRIIHRDLKVSNILLDEEMNPKI  683

Query  663   SDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN  484
             SDFGMARIFGGN+NEA+TNRVVGTYGYM+PEYAMEGLFS KSDVYSFGVLLLEI+SG +N
Sbjct  684   SDFGMARIFGGNENEASTNRVVGTYGYMSPEYAMEGLFSFKSDVYSFGVLLLEIISGEKN  743

Query  483   TSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
               FRT +HS +I +AW  W+EGK M L+DP I   C   E LRCIQ+GLLCVQD A  RP
Sbjct  744   IGFRTPEHSNLISHAWHHWNEGKAMELIDPCIRDMCYVDEALRCIQVGLLCVQDSARDRP  803

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTA  226
              MS+VVL LE++   LP+P+PP  T+
Sbjct  804   LMSSVVLLLESETAGLPLPKPPRLTS  829



>gb|AES63666.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=842

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/834 (50%), Positives = 550/834 (66%), Gaps = 46/834 (6%)
 Frame = -3

Query  2577  IQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL  2401
             I+ G++I+D +GE +VS    FV+GFF  E +S+RYVGIWY  I    V+WVANR +PI 
Sbjct  36    IKHGEFIRDKEGEVLVSDGYNFVMGFFGFENSSSRYVGIWYYNIPGPEVIWVANRNKPIN  95

Query  2400  DKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG----WRP  2233
                G+F ++ NG  V+LDG    +W+TN S+  +N     +N SE  +L+ DG       
Sbjct  96    GNGGSFTVSTNGNLVILDGNKNQLWSTNVSIIQTN-----KNNSE-AVLRDDGNLVLSNE  149

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVI  2056
                +W+SF  P+DT++PGM+V ++ G+S  FTSW +S +PS G  +MG+DP   P QIV+
Sbjct  150   KVVLWESFENPSDTYVPGMKVPVN-GKSFFFTSWKSSTDPSLGNHTMGVDPAGLPTQIVV  208

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDL---------ITENDNLYLEYKSSSSDL  1903
             WEG++R WRSG+WDGR+F GV M   F++GF L            NDN   E K + +  
Sbjct  209   WEGDRRTWRSGYWDGRIFTGVDMTGSFLHGFILNYDSNGDRSFVYNDN---ELKENDNSS  265

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
             + F++ W+G E +  W E+ K+W +IQ+ P + C VYN+CG FA C+ S S    C C+ 
Sbjct  266   VRFQIGWDGIEREFLWKENEKRWTEIQKGPHNVCEVYNYCGDFAACELSVSGSAICNCLK  325

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
             GF   D      RN + GC R T L+  + N   G   +DGF     +KLPDFA +    
Sbjct  326   GFELKD-----KRNLSSGCRRMTALKGDQRN---GSFGEDGFLVRGSMKLPDFARV----  373

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
                +DCK  C ++ SC AYA  +  GI CM+W  +LVD++    G G+ L +RL  S+L 
Sbjct  374   VDTKDCKGNCLQNGSCTAYAEVI--GIGCMVWYGDLVDILHFQHGEGNALHIRLAYSDLG  431

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRAR-IRA---KKRDEIPRTELPTSGEFS  1195
             +      I++ + + +   ++ I  I LL  R  R ++A   K  D +P  +   S E S
Sbjct  432   DGGKNEKIMMVIILTSLAGLICIGIIVLLVWRYKRQLKASCSKNSDVLPVFDAHKSREMS  491

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             ++     +L +EG   +  +L FF+FS +++AT++FS  NKLGQGGFG VYKG LP G+E
Sbjct  492   AEIPGSVELGLEGNQLSKVELPFFNFSCMSSATNNFSEENKLGQGGFGPVYKGKLPSGEE  551

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSRRSGQG+ EF NE+ + A+LQHRNLV+L+GC IEGDEK+L+YE+M NKSLD F
Sbjct  552   IAVKRLSRRSGQGLDEFKNEMRLFAQLQHRNLVKLMGCSIEGDEKLLVYEFMLNKSLDRF  611

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP K+++L+W +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDF
Sbjct  612   LFDPIKKTQLDWARRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDF  671

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+ARIFGGNQNE N  +VVGTYGYM+PEYAMEGL SVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  672   GLARIFGGNQNEENATKVVGTYGYMSPEYAMEGLVSVKSDVYSFGVLLLEIVSGRRNTSF  731

Query  474   RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
             R  D S +I YAW  W+E + M LLDP I  S    + LRCIQ+G+LCVQD A HRPNMS
Sbjct  732   RHSDDSSLIGYAWNLWNERRAMELLDPCIRDSSPTNKALRCIQIGMLCVQDSASHRPNMS  791

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              VVL LE++  TLP+P  P  T SMRRS D + +     L  SN +T++++ GR
Sbjct  792   KVVLLLESEATTLPIPTQPLIT-SMRRSEDREFYMDG--LDCSNDLTVTMVAGR  842



>ref|XP_010665844.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Beta vulgaris subsp. vulgaris]
Length=854

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/830 (48%), Positives = 545/830 (66%), Gaps = 20/830 (2%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I QGQ ++D G+ ++S    F  GFFS   +S RYVGIWY  I   SVVWVANR  
Sbjct  34    ALNTITQGQVLRD-GDTLISNGGSFEFGFFSLPNSSLRYVGIWYTNISVDSVVWVANRIS  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI  +NG+  +  +G   V D     IW++N++V S+N T +L +   L I  ++    +
Sbjct  93    PISSQNGSITLENDGNLTVSDESGSIIWSSNTTVISNNYTALLHDDGNLEIRGSNVLPVS  152

Query  2229  NTIWQSFHQPTDTFLPGMRVDL---SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              T W+SF+ PTDT+LPGMRV +   S  + K+FTSW +  + S G +SMG+DPR +PQ V
Sbjct  153   FTCWESFNHPTDTYLPGMRVPVNPNSGEDQKIFTSWKSINDLSIGNYSMGVDPRTAPQFV  212

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFV-YGFDLITENDN--LYLEYKSSS-SDLIMFK  1891
             +WEG  R+WRSG+W+G +F GV   + F  YGF L   + +  +Y  Y   + ++   F+
Sbjct  213   VWEGMNRHWRSGYWNGLIFTGVSTMSAFYNYGFKLSNADSSGTMYFTYSPQNRANKFKFR  272

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             V W+G E    + +  ++W  IQE+PA  C V+N CG    CD ++ N I C C  GF P
Sbjct  273   VTWDGYEKSLIFVDGGEEWGLIQEEPATDCDVFNKCGANGYCD-TTVNPI-CGCFKGFLP  330

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
                +QW   NW+GGC R  P+QC  NN    G  +D F EV H+KLPDFAD    +   E
Sbjct  331   KYPDQWRNGNWSGGCVREIPVQCDNNNNSLMG--EDDFLEVDHVKLPDFAD----LLGVE  384

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
             + + + +   +C+  A     GI CM W  EL D+ Q  E +G+TL +R+ SS L+    
Sbjct  385   EEECEKQCLQNCSCMAYTYVTGIGCMTWSGELTDIQQFTEAAGNTLNIRVASSVLEGNKG  444

Query  1350  KTT---iivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
             K +   I   V     +  ++++ +W L  +     +K+ ++  R EL     +S+D S 
Sbjct  445   KLSGPKIAAIVISAVVLLGVILLCLWKLGGKVTGSLSKRGNDAMRMELRKGQGYSTDVSG  504

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               ++  EG    + D+  F+++ +A+AT+ FS+ NKLGQGGFG VYKG LP GQEIAVK+
Sbjct  505   SQEMIGEGDLENAKDVPLFNYNLVASATNFFSMENKLGQGGFGPVYKGTLPGGQEIAVKK  564

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSR+SGQG++EF NE+ +IA LQHRNLVR+LG C+ G+EKMLLYEYMPNKSLD F+FDP 
Sbjct  565   LSRKSGQGMEEFKNEIMLIATLQHRNLVRILGFCVHGEEKMLLYEYMPNKSLDGFIFDPI  624

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             K+ +L+W+KRF IIE IARGLLYLHRD+R  IIHRDLKASNILLD +MNPKISDFGMARI
Sbjct  625   KKEQLDWKKRFTIIEGIARGLLYLHRDARCTIIHRDLKASNILLDKKMNPKISDFGMARI  684

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGG+Q++ +TNRVVGTYGYM+PEYAMEG FS +SDV+SFGVLLLE+++G+R T FR   H
Sbjct  685   FGGDQDQDSTNRVVGTYGYMSPEYAMEGFFSERSDVFSFGVLLLEVITGQRTTRFRLSQH  744

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
               ++EYAW+ W EG+ M L+DPSI SS    EV RC+ + LLCVQD AV+RP MS VVL+
Sbjct  745   MNLVEYAWKLWSEGRAMELVDPSIGSSYPTNEVTRCLHIALLCVQDSAVYRPTMSQVVLW  804

Query  279   LETDNVTLPVPRPPTYTASMRRS-VDVDSWNQNNELPSSNSITMSVIVGR  133
             LETD++ L  P+ PT   S  R+ VD+D  N    + SSN++T++++VGR
Sbjct  805   LETDSLALSNPKEPTLAYSSARAFVDIDFQNNGQGVESSNNVTVTMLVGR  854



>ref|XP_004504969.1| PREDICTED: uncharacterized protein LOC101504189 [Cicer arietinum]
Length=1717

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/835 (51%), Positives = 560/835 (67%), Gaps = 31/835 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             AA+ I+Q + IKD G  +VS   KF +GFFS + +S+RYVGIWY+ I   + VWVANRE+
Sbjct  34    AANSIKQNESIKD-GSTLVSEGLKFEMGFFSFDNSSSRYVGIWYHNIPTSAYVWVANREK  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI ++ G+  I  +G  VVLD  N  +W++N S+ + N+++VLRN   L++   +     
Sbjct  93    PIRNREGSITIKNDGNLVVLDDNNSEVWSSNISIQTKNSSVVLRNDGNLVLSDAE---VG  149

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAG------ESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
               IWQSF +PTDT+LPGM+V  S G      ++  F SW ++ +PS G ++M +D  ASP
Sbjct  150   KEIWQSFEEPTDTYLPGMKVPASGGNGIEKNQNPTFWSWKSTKDPSFGNYTMSVDSDASP  209

Query  2067  QIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDN-LYLEYKS-SSSDLIM  1897
             QIV++EGEKR WRSG+WDGRVF GVP M   +++GF L T +    Y  Y++ ++SD I 
Sbjct  210   QIVVFEGEKRRWRSGYWDGRVFTGVPNMTGSYLFGFRLNTNDKGGRYFVYEALNNSDKIR  269

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E Q RWNE  K+W  +Q +P+ +C  YN CG FA CD S S    C CI GF
Sbjct  270   FQIGWDGYERQLRWNEDEKEWNVLQTEPSKKCEFYNSCGGFAVCDVSHSQV--CRCIQGF  327

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
              P+D N W   NW+ GC R TPL+ +  +   G   +DGF   + +KLPDFA +  N   
Sbjct  328   EPTDMNSWKNGNWSKGCKRMTPLKAETGSNSSG---EDGFLVQRDLKLPDFAHL-VNAVD  383

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
               +C+  C ++ SC AYA  +  GI CM+W  EL D+  L E  G+ L +RL  S+L + 
Sbjct  384   TNECENNCLKNSSCTAYANAI--GIGCMIWFGELADVQSL-ENYGNALNIRLADSDLGD-  439

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKR-------DEIPRTELPTSGEF  1198
               K T I  +  V    + + +  WL+   + + +           D+ P +E   S + 
Sbjct  440   GKKKTKIWIILAVGVGLICLGIFAWLIWRFKRKFKVSSTTCSNTNGDDQPISEPIRSKDL  499

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S++FS   DL++ G   + ++L  FSFSSI  AT++FS  NKLGQGGFG VYKG LP G+
Sbjct  500   SAEFSGSVDLSLVGNPLSGAELSLFSFSSIVIATNNFSEENKLGQGGFGPVYKGKLPEGE  559

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             +IAVKRLS++S QG +EF NE+ +IAKLQH NLVRLLGC I+G+EK+L+YEYMPNKSLD 
Sbjct  560   QIAVKRLSKQSSQGSEEFKNEMMLIAKLQHVNLVRLLGCSIQGEEKLLVYEYMPNKSLDF  619

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             F+FDP K+++L+W +RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISD
Sbjct  620   FLFDPVKQTKLDWTRRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISD  679

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FG+ARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFS+KSDVYSFGVLLLEIVSGR+NTS
Sbjct  680   FGLARIFGGNQNEANTARVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIVSGRKNTS  739

Query  477   FRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
             FR      +I YAW  W E + M L+DP I  S    + +RCI +G+LCVQD A HRPNM
Sbjct  740   FRHSYDPSLIGYAWRLWSEERVMELVDPLIRDSSPKSKAMRCIHIGMLCVQDSATHRPNM  799

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             S+V+L LE+++ TLP+P  P  T SMRR  D + ++   +     +++ SV+ GR
Sbjct  800   SSVLLMLESESTTLPLPSQPLVT-SMRRYTDTEEFHTQQDSSYDITVSDSVVTGR  853


 Score =   555 bits (1429),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 341/848 (40%), Positives = 494/848 (58%), Gaps = 51/848 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D +   Q +K + E ++S N  F L FFS    +  Y+GI Y     ++VVWVANR  
Sbjct  892   ASDTLTTTQSLKTN-ETLLSPNGIFQLSFFSFNNFT-WYLGIRYTIDHKKTVVWVANRNT  949

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTDGW  2239
             PI + N    +T  G  +++D    +         + T +N  + L ++  L++ +++  
Sbjct  950   PIQNFNAFLKLTDAGKLIIIDQSQKTIWASNQRTKNATFNNPILQLLDSGNLVVKESNEN  1009

Query  2238  RPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSW-TNSGNPSPGRFSMGIDPRASP  2068
              P   IWQSF  PTDT LPGM++  +          SW     +PS G  S  +D    P
Sbjct  1010  DPTKFIWQSFDYPTDTLLPGMKLGWNFDTNTETFINSWKVTDQDPSFGDISFKMDYHGLP  1069

Query  2067  QIVIWEGEKRYWRSGHWDGRVFLGVPMR---TDFVYGFDLITENDNLYLEYKSSSSDLI-  1900
             +I + +  +R +RSG W+G+ F GVP     TD +  F+ +     ++  +   +  L  
Sbjct  1070  EIFLLDKGRRIYRSGPWNGKRFSGVPEMQPVTDSI-KFNFVENEHEVFYTFSIGNESLFS  1128

Query  1899  MFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
                V+  GK  +  W +S + W      P DQC  Y  CG +  CD ++S    C C+ G
Sbjct  1129  RLSVNSLGKLQRLTWIQSGQLWSTFWYAPKDQCDNYRECGPYGICDTNASPV--CQCVKG  1186

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI--DRN  1546
             F P +   WN R+ + GC R   L C            D F ++ ++KLP+ + +  +R+
Sbjct  1187  FRPKNHQAWNLRDGSDGCVRNNELDCGS----------DRFLKLVNVKLPETSSVFVNRS  1236

Query  1545  MRSPedckkkceedCSCNAYA--PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
             M S  +C + C+ +CSC  YA    V GG  C++W +EL+D+ +L    G  LFVRL +S
Sbjct  1237  M-SVFECGEFCKRNCSCTGYANIEIVDGGSGCVMWLDELIDI-RLYPSGGQDLFVRLSAS  1294

Query  1371  ELDNKSSKTTiivavsvvaavavlvivsIWLLCS-----RRARIRA-------KKRDEIP  1228
             +++   ++ +     +    + V     I+L+       R+ +++        K+   + 
Sbjct  1295  DVEEDEARESSDHKTAKAIGIMVGGAAIIFLIIGICFLWRKKKLQCLFKMKSEKRAASLE  1354

Query  1227  RTE--LPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGF  1054
             R++  L T G F+S+     +  ++       +L FF F++I  AT++FS  NKLGQGGF
Sbjct  1355  RSQDLLMTEGVFTSNREQSGENNLD-----DLELPFFDFNTITLATNNFSEENKLGQGGF  1409

Query  1053  GHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKML  874
             G VYKG L  GQEIAVKRLS+ SGQGV EF NE+ +I KLQHRNLVRLLGC I+ DEKML
Sbjct  1410  GIVYKGRLIEGQEIAVKRLSKNSGQGVDEFKNEVKLIVKLQHRNLVRLLGCSIQIDEKML  1469

Query  873   LYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNI  694
             +YEY+ N+SLD+ +F+  KR+ L+W++RF II  IARGLLYLH+DSR RIIHRDLKASNI
Sbjct  1470  VYEYLENRSLDAILFNKTKRALLDWQRRFKIICGIARGLLYLHQDSRFRIIHRDLKASNI  1529

Query  693   LLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVL  514
             LLD EMNPKISDFGMARIFG +Q EANT RVVGTYGYM+PEYAM+G+FSVKSDV+SFGVL
Sbjct  1530  LLDKEMNPKISDFGMARIFGTDQTEANTVRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVL  1589

Query  513   LLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGL  337
             ++EI+SG++N  F + +    ++ + W  W EGK + L+D SI +S    EVLRCIQ+GL
Sbjct  1590  VMEIISGKKNRGFYSANKELNLLGHGWNLWTEGKALELIDSSIDNSYSQSEVLRCIQVGL  1649

Query  336   LCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSI  157
             LCVQ+ A  RP MS+VVL L ++  T+  P+ P +           S ++  E  + N +
Sbjct  1650  LCVQERAEDRPTMSSVVLMLSSETATITQPKNPGFCLGSNPIETDSSSSKQEESCTVNQV  1709

Query  156   TMSVIVGR  133
             T++++ GR
Sbjct  1710  TVTMLDGR  1717



>ref|XP_003608275.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=1055

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/826 (51%), Positives = 541/826 (65%), Gaps = 33/826 (4%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I Q Q IKD G  +VS   +F +GFFS   +S+RYVGIWY  +   + VWVANRE+PI +
Sbjct  245   ITQNQTIKD-GSTLVSEGLRFEMGFFSFNNSSSRYVGIWYYNV-TSAYVWVANREKPIKN  302

Query  2397  KNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRPNNTI  2221
             + G   I  +G  VVLDG+N  +  +  S ++ +N+  VL N   LI+   +    N  I
Sbjct  303   REGFITIKNDGNLVVLDGQNNEVWSSNASKISINNSQAVLHNNGNLILSDREN---NKEI  359

Query  2220  WQSFHQPTDTFLPGMRVDLSAG----ESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             WQSF  PTDT+LPGM+  +S G    +   F SW +  +PS G ++M +D  ASPQIVI 
Sbjct  360   WQSFEDPTDTYLPGMKAPVSGGNGIGKDATFCSWKSENDPSLGNYTMSVDSEASPQIVIM  419

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT-ENDNLYLEYKS-SSSDLIMFKVDW  1882
             EGEKR WRSG+WDGRVF GVP M   +++GF L T +    Y  Y++  +SD + F++ +
Sbjct  420   EGEKRRWRSGYWDGRVFTGVPNMTGSYLFGFRLNTNDTGERYFVYEALENSDKVRFQLGY  479

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G E Q RWNE  K+W  I  +P  +C  YN CG FA CD S S+   C CI GF P D 
Sbjct  480   DGYERQFRWNEEEKEWNVILSEPNKKCEFYNSCGSFAICDMSDSSL--CKCIKGFEPRDV  537

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
               WN+ NW+ GC R TPL+ ++          DGF   K +KLPDFA +   + S +   
Sbjct  538   KSWNSGNWSKGCKRMTPLKSERGGNSS--GGDDGFLVQKGLKLPDFARLVSAVDSKDCEG  595

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTT  1342
                +   SC AY   +  GI CM+W  ELVD  +L E  G+TL +RL  S+L +   K T
Sbjct  596   NCLKNS-SCTAYVNAI--GIGCMVWHGELVDFQRL-ENQGNTLNIRLADSDLGD-GKKKT  650

Query  1341  iivavsvvaavavlvivsIWLLCSRRARIRAKK-------RDEIPRTELPTSGEFSSDFS  1183
              I  +  V A  + + + +WLLC  + +++            ++P ++   SG  S+ FS
Sbjct  651   KIGIILGVVAGIICLGIFVWLLCRFKGKLKVSSTSSTSNINGDVPVSKPTKSGNLSAGFS  710

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
                DL ++G +  +++L  F+FSSI  AT++FS  NKLGQGGFG VYKG LP G++IAVK
Sbjct  711   GSIDLHLDGSSINNAELSLFNFSSIIIATNNFSEENKLGQGGFGPVYKGRLPGGEQIAVK  770

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLSR S QG+ EF NE+ +IAKLQHRNLVRLLGC I+G+EK+L+YEYMPNKSLD F+FDP
Sbjct  771   RLSRLSNQGLDEFKNEMMLIAKLQHRNLVRLLGCSIQGEEKLLVYEYMPNKSLDYFLFDP  830

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
              K+++L+  +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG+A+
Sbjct  831   VKKTKLDSSRRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFGLAK  890

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IFGGNQNE NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGR+NTSFR   
Sbjct  891   IFGGNQNEGNTERVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRKNTSFRDSY  950

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
                +I YAW  W+E K M L+DPSI  S    + LRCI +G+LCVQD A HRPNMS+VVL
Sbjct  951   DPSLIGYAWRLWNEEKIMELVDPSISDSTKKSKALRCIHIGMLCVQDSASHRPNMSSVVL  1010

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
              LE++  TLP+P  P  T SMRR  D + +N     P   S+ ++V
Sbjct  1011  MLESEATTLPLPVKPLLT-SMRRYDDTEEFNTE---PFDASVDLTV  1052


 Score =   165 bits (417),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 140/267 (52%), Gaps = 61/267 (23%)
 Frame = -3

Query  1077  NKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCC  898
             N LGQGGFG VYK                +  QG++EF NE+ VI+KLQHRNLVRLLGCC
Sbjct  23    NMLGQGGFGPVYK---------------LKDFQGMEEFLNEVEVISKLQHRNLVRLLGCC  67

Query  897   IEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIH  718
             IE +EK+L+ EYMP K L                               +    RL +I+
Sbjct  68    IEVEEKILVDEYMPKKKL-------------------------------VFLSLRLVLIN  96

Query  717   RDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKS  538
                  + +L          DFG A++FG ++    T R+VGTY Y++PEYAM+G+ S + 
Sbjct  97    FYFGTAKLL----------DFGTAKLFGDSEVNGKTRRIVGTYRYISPEYAMQGIVSEQC  146

Query  537   DVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEV  361
             DV+SFGVLLLEIV GRRNTS   D  S  +I  AW  W+     +L+DP ++     +++
Sbjct  147   DVFSFGVLLLEIVFGRRNTSLFEDTESLTLIGSAWRLWNSDNITSLVDPQMYDPRFYKDI  206

Query  360   LRCIQLGLLCVQDLAVHRPNMSAVVLF  280
              RC+ + +    D  V++      +LF
Sbjct  207   FRCLAVHM----DFCVYKNIFIEELLF  229



>gb|AES90472.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=1068

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/829 (51%), Positives = 543/829 (66%), Gaps = 33/829 (4%)
 Frame = -3

Query  2586  ADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             A+ I Q Q IKD G  +VS   +F +GFFS   +S+RYVGIWY  +   + VWVANRE+P
Sbjct  255   ANFITQNQTIKD-GSTLVSEGLRFEMGFFSFNNSSSRYVGIWYYNV-TSAYVWVANREKP  312

Query  2406  ILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             I ++ G   I  +G  VVLDG+N  +  +  S ++ +N+  VL N   LI+   +    N
Sbjct  313   IKNREGFITIKNDGNLVVLDGQNNEVWSSNASKISINNSQAVLHNNGNLILSDREN---N  369

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAG----ESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
               IWQSF  PTDT+LPGM+  +S G    +   F SW +  +PS G ++M +D  ASPQI
Sbjct  370   KEIWQSFEDPTDTYLPGMKAPVSGGNGIGKDATFCSWKSENDPSLGNYTMSVDSEASPQI  429

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT-ENDNLYLEYKS-SSSDLIMFK  1891
             VI EGEKR WRSG+WDGRVF GVP M   +++GF L T +    Y  Y++  +SD + F+
Sbjct  430   VIMEGEKRRWRSGYWDGRVFTGVPNMTGSYLFGFRLNTNDTGERYFVYEALENSDKVRFQ  489

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             + ++G E Q RWNE  K+W  I  +P  +C  YN CG FA CD S S+   C CI GF P
Sbjct  490   LGYDGYERQFRWNEEEKEWNVILSEPNKKCEFYNSCGSFAICDMSDSSL--CKCIKGFEP  547

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
              D   WN+ NW+ GC R TPL+ ++          DGF   K +KLPDFA +   + S +
Sbjct  548   RDVKSWNSGNWSKGCKRMTPLKSERGGNSS--GGDDGFLVQKGLKLPDFARLVSAVDSKD  605

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
                   +   SC AY   +  GI CM+W  ELVD  +L E  G+TL +RL  S+L +   
Sbjct  606   CEGNCLKNS-SCTAYVNAI--GIGCMVWHGELVDFQRL-ENQGNTLNIRLADSDLGD-GK  660

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKK-------RDEIPRTELPTSGEFSS  1192
             K T I  +  V A  + + + +WLLC  + +++            ++P ++   SG  S+
Sbjct  661   KKTKIGIILGVVAGIICLGIFVWLLCRFKGKLKVSSTSSTSNINGDVPVSKPTKSGNLSA  720

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
              FS   DL ++G +  +++L  F+FSSI  AT++FS  NKLGQGGFG VYKG LP G++I
Sbjct  721   GFSGSIDLHLDGSSINNAELSLFNFSSIIIATNNFSEENKLGQGGFGPVYKGRLPGGEQI  780

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR S QG+ EF NE+ +IAKLQHRNLVRLLGC I+G+EK+L+YEYMPNKSLD F+
Sbjct  781   AVKRLSRLSNQGLDEFKNEMMLIAKLQHRNLVRLLGCSIQGEEKLLVYEYMPNKSLDYFL  840

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP K+++L+  +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG
Sbjct  841   FDPVKKTKLDSSRRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFG  900

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +A+IFGGNQNE NT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGR+NTSFR
Sbjct  901   LAKIFGGNQNEGNTERVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRKNTSFR  960

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
                   +I YAW  W+E K M L+DPSI  S    + LRCI +G+LCVQD A HRPNMS+
Sbjct  961   DSYDPSLIGYAWRLWNEEKIMELVDPSISDSTKKSKALRCIHIGMLCVQDSASHRPNMSS  1020

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             VVL LE++  TLP+P  P  T SMRR  D + +N     P   S+ ++V
Sbjct  1021  VVLMLESEATTLPLPVKPLLT-SMRRYDDTEEFNTE---PFDASVDLTV  1065


 Score =   164 bits (416),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/267 (38%), Positives = 140/267 (52%), Gaps = 61/267 (23%)
 Frame = -3

Query  1077  NKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCC  898
             N LGQGGFG VYK                +  QG++EF NE+ VI+KLQHRNLVRLLGCC
Sbjct  23    NMLGQGGFGPVYK---------------LKDFQGMEEFLNEVEVISKLQHRNLVRLLGCC  67

Query  897   IEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIH  718
             IE +EK+L+ EYMP K L                               +    RL +I+
Sbjct  68    IEVEEKILVDEYMPKKKL-------------------------------VFLSLRLVLIN  96

Query  717   RDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKS  538
                  + +L          DFG A++FG ++    T R+VGTY Y++PEYAM+G+ S + 
Sbjct  97    FYFGTAKLL----------DFGTAKLFGDSEVNGKTRRIVGTYRYISPEYAMQGIVSEQC  146

Query  537   DVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEV  361
             DV+SFGVLLLEIV GRRNTS   D  S  +I  AW  W+     +L+DP ++     +++
Sbjct  147   DVFSFGVLLLEIVFGRRNTSLFEDTESLTLIGSAWRLWNSDNITSLVDPQMYDPRFYKDI  206

Query  360   LRCIQLGLLCVQDLAVHRPNMSAVVLF  280
              RC+ + +    D  V++      +LF
Sbjct  207   FRCLAVHM----DFCVYKNIFIEELLF  229



>ref|XP_010418129.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 isoform X2 [Camelina sativa]
Length=836

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/831 (50%), Positives = 553/831 (67%), Gaps = 34/831 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G+++VS ++ F +GFFSP+ ++ RYVGIWY  I PQ+VVWVANRE+
Sbjct  28    TSNSITRNQTIRD-GDSLVSNDKSFEVGFFSPKNSTLRYVGIWYKNIEPQTVVWVANREK  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD NGA  I  +G  VV++G+NV++W+T++ + S+N    L NT +L+ L +D  R N
Sbjct  87    PLLDHNGALKIADDGNLVVVNGQNVTVWSTSAKLESNNTVAALLNTGDLV-LSSDSDR-N  144

Query  2229  NTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                W+SF  PTDTFLP M  RVD S GE++ F  W +  +PSPGR+SMGIDP  +P+IVI
Sbjct  145   KWYWESFDNPTDTFLPSMKVRVDPSLGENRGFVPWESENDPSPGRYSMGIDPIRAPEIVI  204

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMF  1894
             WEGEKR WRSG W+  +F G+P     T+++ GF L   + +  +Y  Y + +SSD + F
Sbjct  205   WEGEKRKWRSGPWNSAIFTGIPDMYRVTNYIRGFKLSPPDRDGIVYFTYVTINSSDFLRF  264

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGF  1717
             ++ ++G + Q RWN+  K W  +Q++P  +C  YN CG ++ CD+S   +   C CI GF
Sbjct  265   RIRFDGVQEQFRWNKDAKNWTLLQKKPDTECENYNRCGNYSVCDDSKEFDSGKCSCIDGF  324

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
              P  W+QWN  N++GGC RR PL C ++     G ++DGF+ +K +KLPDF  +     +
Sbjct  325   EPVYWDQWNNMNFSGGCKRRVPLNCSQSLV---GDKRDGFKVLKGMKLPDFGSV-VPFNN  380

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
                CK  C  DCSCNAYA  V  GI CM+W  +L D+     G G+ + +RL        
Sbjct  381   SVTCKDVCVRDCSCNAYAVVV--GIGCMIWTRDLTDIESFKLG-GNYINIRLAGD-----  432

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG--EFSSDFS  1183
               + + I  + V    A L+ + IW+L  R      KK+D      LP S   + S +F 
Sbjct  433   GKEKSKIWIIIVSVIGAFLLGLCIWILWKRFKAFLWKKKD------LPVSDTRDNSVNFK  486

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
             +     + G    + DL  FSF S+A+AT  F+  NKLGQGGFG VYKG    G+EIAVK
Sbjct  487   SSPINVLVGDQVDTPDLPVFSFDSVASATGDFAEENKLGQGGFGTVYKGNFSEGREIAVK  546

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS +S QG++EF NE+ +IAKLQHRNLVRLLGCCIE DEKMLLYEY+PNKSLD F+FD 
Sbjct  547   RLSGKSKQGLEEFKNEILLIAKLQHRNLVRLLGCCIEDDEKMLLYEYLPNKSLDRFLFDE  606

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             +KR  L+WRKR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMAR
Sbjct  607   SKRGSLDWRKRWEIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMAR  666

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IF   Q++ANT RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  +
Sbjct  667   IFNYRQDQANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNISFRGSE  726

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             H  +I YAW  W +GK   ++DP++  S    E +RCI +G+LC QD  +HRPNM +V+L
Sbjct  727   HGSLIGYAWYLWSQGKTKEMIDPTVEDSRDVAEAMRCIHVGMLCTQDSVIHRPNMGSVLL  786

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQN-NELPSSNSITMSVIVGR  133
              LE+    LP PR PT+  S   S ++D  N +  ++ + N +T + IVGR
Sbjct  787   MLESRTGQLPRPRQPTF-HSFLYSGEIDELNLDGQDVATVNDVTFTTIVGR  836



>gb|KHN07687.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Glycine soja]
Length=849

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/839 (49%), Positives = 556/839 (66%), Gaps = 38/839 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDD--GENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD I     I+D+  G+ +VS +  F +GFFS + +S RYVGIWY+EI  ++ +WVANR
Sbjct  29    AADSITGDTVIRDNDGGDTLVSKDLTFEMGFFSFDNSS-RYVGIWYHEIPVKTFIWVANR  87

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             E+PI  + G   I  +G  VVLDG+   +W+TN S+  +N   VLR+   L++ + D   
Sbjct  88    EKPIKGREGLIQIKTDGNLVVLDGERNEVWSTNMSIPRNNTKAVLRDDGNLVLSEHD---  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS-PQIV  2059
                 +WQSF  P DTF+PGM + +SAG S +F SW ++ +PSPG +SM +D   S  QI+
Sbjct  145   --KDVWQSFEDPVDTFVPGMALPVSAGTS-MFRSWKSATDPSPGNYSMKVDSDGSTKQIL  201

Query  2058  IWEGEKRY-WRSGHWDGRVFLGVPMRT-DFVYGFDLITEND-NLYLEYKSSSSDLIMFKV  1888
             I EGEKR  WR+G+WDGRVF GV   T   ++GF + T  +   Y  YK +S + + F++
Sbjct  202   ILEGEKRRRWRTGYWDGRVFTGVSDVTGSSLFGFGVTTNVEGEEYFTYKWNSPEKVRFQI  261

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+G E +  W+E  KQW + Q +P + C  YN CG FA CD    N   C C+ GF P 
Sbjct  262   TWDGFEKKFVWDEDGKQWNRTQFEPFNDCEHYNFCGSFAVCD--MGNSPVCSCMQGFQPV  319

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKN---NTEGGGAE----KDGFREVKHIKLPDFADIDR  1549
              W +WN RNW+ GC R+TPL+ +     N+   GAE    +DGF E +  KLPDFA ++ 
Sbjct  320   HWEEWNNRNWSRGCGRKTPLKAETERAANSSSSGAEVSVGEDGFLEQRCTKLPDFARLE-  378

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
             N     DC+  C ++ SC AY+  +  GI CM+W  ELVD+       GS L +RL  ++
Sbjct  379   NFVGDADCQSYCLQNSSCTAYSYTI--GIGCMIWYGELVDVQHTKNNLGSLLNIRLADAD  436

Query  1368  LDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA-------KKRDEIPRTELPT  1210
             L  +  K T I  +  V    + + + I+L+   + + +A           EIP  +L  
Sbjct  437   L-GEGEKKTKIWIILAVVVGLICLGIVIFLIWRFKRKPKAISSASGYNNNSEIPVFDLTR  495

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S   S       +L +EG   + ++L  F+FS I AAT++FS  NKLGQGGFG VYKG  
Sbjct  496   STGLSE---ISGELGLEGNQLSGAELPLFNFSYILAATNNFSDENKLGQGGFGPVYKGKF  552

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P G+E+AVKRLSR+S QG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+YEY+PNK
Sbjct  553   PGGEEVAVKRLSRKSSQGLEEFKNEMVLIAKLQHRNLVRLLGCCIQGEEKILVYEYLPNK  612

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FDP K+++L+W +RF IIE IARGLLYLH+DSRLRIIHRDLKASNILLD  MNP
Sbjct  613   SLDCFLFDPVKQTQLDWARRFEIIEGIARGLLYLHQDSRLRIIHRDLKASNILLDESMNP  672

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFG+ARIFGGNQNEANTNRVVGTYGYM+PEYAMEGLFS+KSDVYSFGVLLLEI+SGR
Sbjct  673   KISDFGLARIFGGNQNEANTNRVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIMSGR  732

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             +NTSFR  + S +I YAW  W E + M L+DPS+  S    + LR I +G+LCVQD A  
Sbjct  733   KNTSFRDTEDSSLIGYAWHLWSEQRVMELVDPSVRDSIPESKALRFIHIGMLCVQDSASR  792

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             RPNMS+V+L L ++ + LP+P+ P  T SMR+  D +S+++   L  SN +T++++ GR
Sbjct  793   RPNMSSVLLMLGSEAIALPLPKQPLLTTSMRKLDDGESYSEG--LDVSNDVTVTMVTGR  849



>ref|XP_003528424.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Glycine max]
Length=849

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/839 (49%), Positives = 556/839 (66%), Gaps = 38/839 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDD--GENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD I     I+D+  G+ +VS +  F +GFFS + +S RYVGIWY+EI  ++ +WVANR
Sbjct  29    AADSITGDTVIRDNDGGDTLVSKDLTFEMGFFSFDNSS-RYVGIWYHEIPVKTFIWVANR  87

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             E+PI  + G   I  +G  VVLDG+   +W+TN S+  +N   VLR+   L++ + D   
Sbjct  88    EKPIKGREGLIQIKTDGNLVVLDGERNEVWSTNMSIPRNNTKAVLRDDGNLVLSEHD---  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS-PQIV  2059
                 +WQSF  P DTF+PGM + +SAG S +F SW ++ +PSPG +SM +D   S  QI+
Sbjct  145   --KDVWQSFEDPVDTFVPGMALPVSAGTS-MFRSWKSATDPSPGNYSMKVDSDGSTKQIL  201

Query  2058  IWEGEKRY-WRSGHWDGRVFLGVPMRT-DFVYGFDLITEND-NLYLEYKSSSSDLIMFKV  1888
             I EGEKR  WR+G+WDGRVF GV   T   ++GF + T  +   Y  YK +S + + F++
Sbjct  202   ILEGEKRRRWRTGYWDGRVFTGVSDVTGSSLFGFGVTTNVEGEEYFTYKWNSPEKVRFQI  261

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+G E +  W+E  KQW + Q +P + C  YN CG FA CD    N   C C+ GF P 
Sbjct  262   TWDGFEKKFVWDEDGKQWNRTQFEPFNDCEHYNFCGSFAVCD--MGNSPVCSCMQGFQPV  319

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKN---NTEGGGAE----KDGFREVKHIKLPDFADIDR  1549
              W +WN RNW+ GC R+TPL+ +     N+   GAE    +DGF E +  KLPDFA ++ 
Sbjct  320   HWEEWNNRNWSRGCGRKTPLKAETERAANSSSSGAEVSVGEDGFLEQRCTKLPDFARLE-  378

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
             N     DC+  C ++ SC AY+  +  GI CM+W  ELVD+       GS L +RL  ++
Sbjct  379   NFVGYADCQSYCLQNSSCTAYSYTI--GIGCMIWYGELVDVQHTKNNLGSLLNIRLADAD  436

Query  1368  LDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA-------KKRDEIPRTELPT  1210
             L  +  K T I  +  V    + + + I+L+   + + +A           EIP  +L  
Sbjct  437   L-GEGEKKTKIWIILAVVVGLICLGIVIFLIWRFKRKPKAISSASGYNNNSEIPVFDLTR  495

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S   S       +L +EG   + ++L  F+FS I AAT++FS  NKLGQGGFG VYKG  
Sbjct  496   STGLSE---ISGELGLEGNQLSGAELPLFNFSYILAATNNFSDENKLGQGGFGPVYKGKF  552

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P G+E+AVKRLSR+S QG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+YEY+PNK
Sbjct  553   PGGEEVAVKRLSRKSSQGLEEFKNEMVLIAKLQHRNLVRLLGCCIQGEEKILVYEYLPNK  612

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FDP K+++L+W +RF IIE IARGLLYLH+DSRLRIIHRDLKASNILLD  MNP
Sbjct  613   SLDCFLFDPVKQTQLDWARRFEIIEGIARGLLYLHQDSRLRIIHRDLKASNILLDESMNP  672

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFG+ARIFGGNQNEANTNRVVGTYGYM+PEYAMEGLFS+KSDVYSFGVLLLEI+SGR
Sbjct  673   KISDFGLARIFGGNQNEANTNRVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIMSGR  732

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             +NTSFR  + S +I YAW  W E + M L+DPS+  S    + LR I +G+LCVQD A  
Sbjct  733   KNTSFRDTEDSSLIGYAWHLWSEQRVMELVDPSVRDSIPESKALRFIHIGMLCVQDSASR  792

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             RPNMS+V+L L ++ + LP+P+ P  T SMR+  D +S+++   L  SN +T++++ GR
Sbjct  793   RPNMSSVLLMLGSEAIALPLPKQPLLTTSMRKLDDGESYSEG--LDVSNDVTVTMVTGR  849



>ref|XP_008439931.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Cucumis melo]
Length=857

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/844 (48%), Positives = 559/844 (66%), Gaps = 41/844 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             +A+ I +G+ ++D   E ++S NE + LGFFSP  +S RYVGIWY++I  QSV+WVANR+
Sbjct  30    SANSITRGRGLRDGSNETLISPNESYELGFFSPINSSLRYVGIWYHKIEEQSVIWVANRD  89

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWR  2236
              P+ +++G   I  +G  VV DG N S+  +  ++ +     + L N   L++  + G  
Sbjct  90    SPLRNRDGVLIIGDDGNLVVQDGNNFSVWTSNVTANSFEPRNLTLHNHGNLVL--SSGDD  147

Query  2235  PNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              +   W SF  PTDTFLP M  RV+   GE ++F SW +  NP+ G + +G+DPR + QI
Sbjct  148   SSKVHWSSFEHPTDTFLPNMVVRVNPQMGEKRMFMSWKSETNPAVGNYCLGVDPRGAVQI  207

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEN-DNLYLEYKSSSS-DLIMFK  1891
             ++W G  R+WRSGHWD ++F G+P MR+  +YGF +  E+ +N+ + +++ +  D + F+
Sbjct  208   IVWNGNNRWWRSGHWDKQIFSGIPTMRSTSLYGFKITPEDGNNISVTFQALNDLDKLKFQ  267

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             + W+GKE QQR NE+ ++W  I+  P++ C  YN CG F  C   S     C C  GF P
Sbjct  268   IQWDGKEAQQRLNETTRKWDTIRLLPSNDCDFYNFCGDFGICSEKSRP--KCSCPQGFIP  325

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGG----AEKDGFREVKHIKLPDFADIDRNM  1543
              +  +W+   W+ GC R+TPL  Q+  +   G     E+DGF ++  +KLPDF      +
Sbjct  326   QNKERWDRGIWSDGCRRKTPLLEQRMKSNPNGTIEDGEQDGFVDLLFVKLPDFI---TGI  382

Query  1542  RSPedckkkceedCSCNAY--APPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
                E C+  C  + SC AY  AP    GI C  W   L D+ +  EG+G+TL +RL  S+
Sbjct  383   FVVESCRDSCSSNSSCVAYSDAP----GIGCATWDGPLKDIQRF-EGAGNTLHLRLAHSD  437

Query  1368  L-----DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRT  1222
             L     + K S   I+      AA   ++ + +W     R + +A      + + E+P  
Sbjct  438   LTPVDSEGKLSTGVIVAICFGGAAAVAIIALLLWKF---RGKTKAASTSEPQNKTEVPMF  494

Query  1221  ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVY  1042
             +L  S E S++ S   +L +EG+  +  DL  F+F+ IAAATD+FS  NKLGQGGFG VY
Sbjct  495   DLSKSKELSAELSGPYELGIEGEQLSGPDLPMFNFNCIAAATDNFSEENKLGQGGFGPVY  554

Query  1041  KGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEY  862
             KG LP GQEIAVKRLS RSGQG++EF NE+ +I KLQHRNLVRLLG  I+G++K+LLYEY
Sbjct  555   KGKLPSGQEIAVKRLSVRSGQGLEEFKNEIILIGKLQHRNLVRLLGYSIQGEDKLLLYEY  614

Query  861   MPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDG  682
             MPNKSLD F+FDP K++ L+W+KR  IIE IARGLLYLHRDSRL IIHRDLKASNILLD 
Sbjct  615   MPNKSLDWFLFDPNKQALLDWKKRLSIIEGIARGLLYLHRDSRLLIIHRDLKASNILLDE  674

Query  681   EMNPKISDFGMARIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  505
             +MNPKISDFGMARIFGGNQNEA NT RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE
Sbjct  675   DMNPKISDFGMARIFGGNQNEATNTIRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  734

Query  504   IVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQ  325
             ++ GRRNTSFR+ ++  +I YAW+ W+EG+ + LLDPSI  S    EVL+CI + +LCVQ
Sbjct  735   LICGRRNTSFRSTEYLTLISYAWKLWNEGRAIELLDPSIRDSSPENEVLKCIHVAMLCVQ  794

Query  324   DLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
             D   +RP + ++VL LE+++ +L  PR PTYT S R S+D D + + +++ SSN +T+++
Sbjct  795   DSPAYRPTLQSLVLMLESESSSLQQPRQPTYT-STRASIDTDLFTEGHDIVSSNDVTVTM  853

Query  144   IVGR  133
             + GR
Sbjct  854   LDGR  857



>ref|XP_010473368.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Camelina sativa]
Length=840

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/831 (50%), Positives = 550/831 (66%), Gaps = 30/831 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G++++S +E F +GFFSP+ ++ RYVGIWY  I PQ+VVWVANRE+
Sbjct  28    TSNSITRNQMIRD-GDSLISEDESFEVGFFSPKNSTLRYVGIWYKNIEPQTVVWVANREK  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD NGA  I  +G  VV++G+NV++W+T++   S+N    L  T +L+ L +D  R N
Sbjct  87    PLLDHNGALKIADDGNLVVVNGQNVTVWSTSAKPESNNTVAALLKTGDLV-LSSDSDR-N  144

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                W+SF  PTDTFLP MRV  D S GE++ F  W +  +PSPGR+SMGIDP  +P+IVI
Sbjct  145   KWYWESFDNPTDTFLPSMRVRVDPSLGENRGFVPWESESDPSPGRYSMGIDPNGAPEIVI  204

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMF  1894
             WEGEKR WRSG W+  +F G+P     T+++ GF L   + +  +Y  Y + +SSD + F
Sbjct  205   WEGEKRKWRSGPWNSAIFTGIPDTYRVTNYIRGFKLSPPDRDGIVYFTYVTINSSDFLRF  264

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGF  1717
             ++ ++G + Q RWN+  K W  +Q++P  +C  YN CG ++ CD+S   +   C C+ GF
Sbjct  265   QIRFDGVQEQFRWNKDAKNWTLLQKKPDKECENYNRCGNYSVCDDSKEFDSGKCSCMDGF  324

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
              P   +QWN  N++GGC RR PL C ++       ++DGF+ +K +KLPDF  +   + +
Sbjct  325   EPVYQDQWNNMNFSGGCKRRVPLNCSQSLV---ADKRDGFKVLKGMKLPDFGSV-VPLNN  380

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
                CK  C  DCSCNAYA  V GGI CM+W  +L+D+ +   G G+ + +RL  SEL   
Sbjct  381   SVTCKDVCVRDCSCNAYA--VVGGIGCMIWTRDLMDIERFRLG-GNYIIIRLAGSELGGG  437

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG--EFSSDFS  1183
               K+ I + +  V    +L +   W+   R      +K+D      LP S   + S  F 
Sbjct  438   KEKSKIWIIIVSVIGAFLLGLCI-WISWKRLKAFLWRKKD------LPVSDTRDNSVTFK  490

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
             +     + G    + DL  FSF S+A+AT  F+  NKLGQGGFG VYKG    G+EIAVK
Sbjct  491   SSPISVLVGDQVDTPDLPIFSFDSVASATGDFAEQNKLGQGGFGTVYKGNFSEGREIAVK  550

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS +S QG++EF NE+ +IAKLQHRNLVRLLGCCIE +EKMLLYEYMPNKSLD F+FD 
Sbjct  551   RLSGKSKQGLEEFKNEILLIAKLQHRNLVRLLGCCIEDNEKMLLYEYMPNKSLDRFLFDE  610

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             +KR  L+WRKR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMAR
Sbjct  611   SKRGSLDWRKRWEIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMAR  670

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IF   Q+ ANT RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  +
Sbjct  671   IFNYRQDHANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNVSFRGSE  730

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             H  +I YAW  W +GK   ++DP++  S    E +RCI +G+LC QD   HRPNM +V+L
Sbjct  731   HGSLIGYAWYLWSQGKTKEMIDPTVEDSRDVAEAMRCIHVGMLCTQDSVTHRPNMGSVLL  790

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQN-NELPSSNSITMSVIVGR  133
              LE+    LP  R PT+  S   S ++D  N +  ++ + N +T + IVGR
Sbjct  791   MLESRTGQLPRRRQPTF-HSFLYSGEIDELNLDGQDVATVNDVTFTTIVGR  840



>ref|XP_010907389.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=840

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/829 (49%), Positives = 541/829 (65%), Gaps = 25/829 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D + +GQ I D GE ++SA+E F LGFFSP  + NRYVGIWY      +V+WVANRE 
Sbjct  27    AKDTLTRGQAISD-GETLISASEIFELGFFSPGSSKNRYVGIWYYNFSTDTVLWVANRET  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   +  +G  VVL+G    IW++N+S +S+ + + L ++  L++  T      
Sbjct  86    PVPDHSGTLAVGQDGNLVVLNGTQSVIWSSNASTSSNESVVQLTDSGNLVLNNT-----G  140

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             + +WQSF  PTDT+LPGM+V  DL    ++LFTSW +  +P+ G FSMG+DP+ S QI I
Sbjct  141   SIVWQSFDHPTDTYLPGMKVGLDLQTNVNQLFTSWKSKDDPAVGNFSMGVDPKRSTQIFI  200

Query  2055  WEGEKRYWRSGHWDGRVFLGV-PMRTDFVYGFDL--ITENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG W+G+VF+G+  M   ++YGF L    +   +Y  Y + +S    + + 
Sbjct  201   WEGTKPRWRSGRWNGQVFIGIQKMVPTYIYGFKLSNFEQEQKMYFYYNAFNSSH-RYVLT  259

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             W+G E    WN ++  W +   QP  +C  YN CG +  C  +  N   C C+ GF P+ 
Sbjct  260   WDGIEEHLIWNGTKLDWYEFWAQPITECEFYNKCGDYGGC--TDENTPICSCLKGFVPAV  317

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
              ++WN+ NWT GC RRTPLQC++N+T G  AE DGF +++ +KLPD +D   ++     C
Sbjct  318   DSEWNSGNWTNGCVRRTPLQCERNSTNGENAEADGFWKLQGVKLPDMSDWYSDVVDENGC  377

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             +  C  +CSC AYA     GI+C++W  +LVD+     G G+ +++RL  SELD K  K 
Sbjct  378   RTTCLSNCSCKAYAYVT--GINCLIWGVDLVDIHVFSSG-GNDMYLRLAGSELDKKK-KL  433

Query  1344  TiivavsvvaavavlvivsIWLL--CSRRAR--IRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
                V   ++      V+  I+LL  C RR R   + +K   +   +  +  E S +FS  
Sbjct  434   AGYVIAIIIVLTVAFVLGCIYLLWKCKRRIREVFKRRKSQGVGIVDQSSRREASVEFSGA  493

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
               +  EGK G   +L   SF SI  AT  FS  N LG+GGFG VYKG LP GQEIAVKRL
Sbjct  494   TRIADEGKDGECQELPLLSFDSILGATGDFSALNLLGEGGFGPVYKGKLPGGQEIAVKRL  553

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             SR SGQG++EF NE+ +IAKLQHRNLV+LLGCCIE +EK+L+YEYM N+SLD+F+FD  K
Sbjct  554   SRSSGQGMEEFKNEVILIAKLQHRNLVKLLGCCIEREEKILIYEYMRNRSLDAFLFDSRK  613

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +  L+W+ R++IIE IARGLLYLHRDSRLR+IHRDLKASNILLD EMNPKISDFGMARIF
Sbjct  614   KGLLDWKMRYNIIEGIARGLLYLHRDSRLRVIHRDLKASNILLDEEMNPKISDFGMARIF  673

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             G + NE NT RVVGTYGYM+PEYAM G+FSVKSDVYSFGVLLLEIVSG++N+++   + S
Sbjct  674   GNDDNETNTKRVVGTYGYMSPEYAMNGVFSVKSDVYSFGVLLLEIVSGKKNSTYHHPEFS  733

Query  456   -GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
               ++ YAW+ W+E   M  +DPSI  SC   EV RCI +GLLCVQD A  RP MS+VV+ 
Sbjct  734   LNLLGYAWKTWNEDNVMEFVDPSIRDSCSQSEVWRCINVGLLCVQDRANDRPTMSSVVIM  793

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LE      P PR PT+ A  R S + +S   + +  S+N +T++++ GR
Sbjct  794   LERGTAANPPPRQPTFAAE-RTSSETESSTVDPKANSAN-LTITLLSGR  840



>ref|XP_008439932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Cucumis melo]
Length=852

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/839 (48%), Positives = 555/839 (66%), Gaps = 41/839 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             +A+ I +G+ ++D   E ++S NE + LGFFSP  +S RYVGIWY++I  QSV+WVANR+
Sbjct  30    SANSITRGRGLRDGSNETLISPNESYELGFFSPINSSLRYVGIWYHKIEEQSVIWVANRD  89

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWR  2236
              P+ +++G   I  +G  VV DG N S+  +  ++ +     + L N   L++  + G  
Sbjct  90    SPLRNRDGVLIIGDDGNLVVQDGNNFSVWTSNVTANSFEPRNLTLHNHGNLVL--SSGDD  147

Query  2235  PNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
              +   W SF  PTDTFLP M  RV+   GE ++F SW +  NP+ G + +G+DPR + QI
Sbjct  148   SSKVHWSSFEHPTDTFLPNMVVRVNPQMGEKRMFMSWKSETNPAVGNYCLGVDPRGAVQI  207

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEN-DNLYLEYKSSSS-DLIMFK  1891
             ++W G  R+WRSGHWD ++F G+P MR+  +YGF +  E+ +N+ + +++ +  D + F+
Sbjct  208   IVWNGNNRWWRSGHWDKQIFSGIPTMRSTSLYGFKITPEDGNNISVTFQALNDLDKLKFQ  267

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             + W+GKE QQR NE+ ++W  I+  P++ C  YN CG F  C   S     C C  GF P
Sbjct  268   IQWDGKEAQQRLNETTRKWDTIRLLPSNDCDFYNFCGDFGICSEKSRP--KCSCPQGFIP  325

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGG----AEKDGFREVKHIKLPDFADIDRNM  1543
              +  +W+   W+ GC R+TPL  Q+  +   G     E+DGF ++  +KLPDF      +
Sbjct  326   QNKERWDRGIWSDGCRRKTPLLEQRMKSNPNGTIEDGEQDGFVDLLFVKLPDFI---TGI  382

Query  1542  RSPedckkkceedCSCNAY--APPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
                E C+  C  + SC AY  AP    GI C  W   L D+ +  EG+G+TL +RL  S+
Sbjct  383   FVVESCRDSCSSNSSCVAYSDAP----GIGCATWDGPLKDIQRF-EGAGNTLHLRLAHSD  437

Query  1368  L-----DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRT  1222
             L     + K S   I+      AA   ++ + +W     R + +A      + + E+P  
Sbjct  438   LTPVDSEGKLSTGVIVAICFGGAAAVAIIALLLWKF---RGKTKAASTSEPQNKTEVPMF  494

Query  1221  ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVY  1042
             +L  S E S++ S   +L +EG+  +  DL  F+F+ IAAATD+FS  NKLGQGGFG VY
Sbjct  495   DLSKSKELSAELSGPYELGIEGEQLSGPDLPMFNFNCIAAATDNFSEENKLGQGGFGPVY  554

Query  1041  KGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEY  862
             KG LP GQEIAVKRLS RSGQG++EF NE+ +I KLQHRNLVRLLG  I+G++K+LLYEY
Sbjct  555   KGKLPSGQEIAVKRLSVRSGQGLEEFKNEIILIGKLQHRNLVRLLGYSIQGEDKLLLYEY  614

Query  861   MPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDG  682
             MPNKSLD F+FDP K++ L+W+KR  IIE IARGLLYLHRDSRL IIHRDLKASNILLD 
Sbjct  615   MPNKSLDWFLFDPNKQALLDWKKRLSIIEGIARGLLYLHRDSRLLIIHRDLKASNILLDE  674

Query  681   EMNPKISDFGMARIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  505
             +MNPKISDFGMARIFGGNQNEA NT RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE
Sbjct  675   DMNPKISDFGMARIFGGNQNEATNTIRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  734

Query  504   IVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQ  325
             ++ GRRNTSFR+ ++  +I YAW+ W+EG+ + LLDPSI  S    EVL+CI + +LCVQ
Sbjct  735   LICGRRNTSFRSTEYLTLISYAWKLWNEGRAIELLDPSIRDSSPENEVLKCIHVAMLCVQ  794

Query  324   DLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMS  148
             D   +RP + ++VL LE+++ +L  PR PTYT S R S+D D + + +++ SSN +T+S
Sbjct  795   DSPAYRPTLQSLVLMLESESSSLQQPRQPTYT-STRASIDTDLFTEGHDIVSSNDVTVS  852



>ref|XP_010529374.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Tarenaya hassleriana]
Length=865

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/840 (49%), Positives = 552/840 (66%), Gaps = 36/840 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A ++I +G+ ++D  D E +VS ++ F LGFFS   +++RY+GI Y  I  ++VVW+ANR
Sbjct  41    AGNRITRGESLRDGDDHEPLVSPDKIFELGFFSLGTSTSRYLGIRYGNIEDKAVVWIANR  100

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGW  2239
              +PI DK+G   +  +G  V+ DG N  +  +     +SSN   VLR++   ++ +T   
Sbjct  101   AKPISDKSGVLTLGNDGNLVLSDGNNSVVWSSGTKIESSSNTEAVLRDSGNFLLSETG--  158

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
               +   WQSF  PTDTFLP MRV ++   GE++ F SW +S +PSPG F+MG+DP  +P+
Sbjct  159   -KSKVYWQSFDHPTDTFLPEMRVKVNQRMGENRAFVSWKSSDDPSPGNFTMGVDPSGAPE  217

Query  2064  IVIWEGE-KRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSS  1909
             IV+WEG   R WRSG W+  +F G+P     T+++YGF L +   EN ++   Y  S  S
Sbjct  218   IVVWEGNGTRKWRSGQWNSAIFTGIPNMAASTNYLYGFKLSSPPDENGSVDFTYVPSDRS  277

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L+ F+V  NG E + RW+   K+W   Q +P  +C  YN CG F  C+    N   C C
Sbjct  278   VLLRFRVLPNGTEQELRWDADIKKWTIFQSEPDFECDEYNRCGNFGICN--MKNAEICSC  335

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGG---AEKDGFREVKHIKLPDFAD  1558
             I G+ P      +  +W+ GC RRT L+CQ   T        +KD F  +K +KLPDF  
Sbjct  336   IKGYEPV-----SPGDWSKGCRRRTELKCQSQRTNASTVLEGQKDEFFTLKTVKLPDFER  390

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
             +  +  S + CK+KC EDCSCNAY      GI CM+W   LVD+ Q   G G++L +RL 
Sbjct  391   VLASTDS-DKCKEKCLEDCSCNAYV--FANGIGCMVWNGSLVDVQQFTNG-GASLHIRLD  446

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK---KRDEIPRTELPTS  1207
              SEL      + +I+   VV  + +  I+       RR    A    + +++   ++  S
Sbjct  447   GSELGTNHVSSLVIIIPVVVGVILLGGILLFLCRFRRRKATSASACCQNNDVSAVDVTRS  506

Query  1206  -GEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
              G  ++  S   D+ +EGK   +S+L  FS S+++AAT +F   N+LG+GGFG VYKGVL
Sbjct  507   KGSSAAAISGSIDIVIEGKPVNTSELPVFSLSTVSAATYNFCRENELGRGGFGPVYKGVL  566

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               GQEIAVKRLS +SGQG +EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  567   QDGQEIAVKRLSGKSGQGDEEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  626

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+F+ +KR+ L+W+ RF I+E IARGLLYLHRDSRLRIIHRD+KASN+LLD EMNP
Sbjct  627   SLDFFLFNESKRALLDWKLRFSIVEGIARGLLYLHRDSRLRIIHRDMKASNVLLDAEMNP  686

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  687   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  746

Query  489   RNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             RNTSFR+ +H  +I YAW  W  G+   L+DPSI  SC   E LRCI + +LCVQD AV 
Sbjct  747   RNTSFRSSEHGSLINYAWNLWSHGRAEELVDPSIRESCSKPEALRCIHVAMLCVQDSAVE  806

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVD-SWNQNNELPSSNSITMSVIVGR  133
             RPNM++V+L LE++   L +PR PT+ AS R S+DV+   + +  + SSN IT ++++GR
Sbjct  807   RPNMASVLLMLESETAALALPRQPTF-ASRRSSIDVNFVLDSSQYVVSSNEITSTLVLGR  865



>ref|NP_176355.1| putative G-type lectin S-receptor-like serine/threonine-protein 
kinase [Arabidopsis thaliana]
 sp|Q9SY89.1|Y1661_ARATH RecName: Full=Putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD25549.1|AC005850_6 Putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEE33862.1| putative G-type lectin S-receptor-like serine/threonine-protein 
kinase [Arabidopsis thaliana]
Length=842

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/818 (50%), Positives = 547/818 (67%), Gaps = 27/818 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             +G++++S +E F LGFF+P+ ++ RYVGIWY  I PQ+VVWVANRE+P+LD  GA  I  
Sbjct  40    EGDSLISEDESFELGFFTPKNSTLRYVGIWYKNIEPQTVVWVANREKPLLDHKGALKIAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  V+++G+N +IW+TN    S+N   VL  T +L++      R     W+SF+ PTDT
Sbjct  100   DGNLVIVNGQNETIWSTNVEPESNNTVAVLFKTGDLVLCSDSDRR--KWYWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  S GE++ F  W +  +PSPG++SMGIDP  + +IVIWEGEKR WRSG W
Sbjct  158   FLPGMRVRVNPSLGENRAFIPWKSESDPSPGKYSMGIDPVGALEIVIWEGEKRKWRSGPW  217

Query  2016  DGRVFLGVP--MR-TDFVYGFDLITEND---NLYLEYKSS-SSDLIMFKVDWNGKEVQQR  1858
             +  +F G+P  +R T+++YGF L +  D   ++Y  Y +S SSD + F +  +G E Q R
Sbjct  218   NSAIFTGIPDMLRFTNYIYGFKLSSPPDRDGSVYFTYVASDSSDFLRFWIRPDGVEEQFR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARN  1681
             WN+  + W  +Q +P+ +C  YN CG ++ CD+S   +   C CI GF P   +QWN R+
Sbjct  278   WNKDIRNWNLLQWKPSTECEKYNRCGNYSVCDDSKEFDSGKCSCIDGFEPVHQDQWNNRD  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C ++   G   ++DGF  +K IK+PDF  +  +  S E CK  C  DC
Sbjct  338   FSGGCQRRVPLNCNQSLVAG---QEDGFTVLKGIKVPDFGSVVLHNNS-ETCKDVCARDC  393

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
             SC AYA  V  GI CM+W  +L+DM   + G G+++ +RL  S+L      +T+ + V  
Sbjct  394   SCKAYALVV--GIGCMIWTRDLIDMEHFERG-GNSINIRLAGSKLGGGKENSTLWIIVFS  450

Query  1320  vaavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
             V    +L +   W+L   +  ++A   K+ +I  +++  +     D+S+     + G   
Sbjct  451   VIGAFLLGLCI-WILWKFKKSLKAFLWKKKDITVSDIIEN----RDYSSSPIKVLVGDQV  505

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
              + DL  FSF S+A+AT  F+  NKLGQGGFG VYKG    G+EIAVKRLS +S QG++E
Sbjct  506   DTPDLPIFSFDSVASATGDFAEENKLGQGGFGTVYKGNFSEGREIAVKRLSGKSKQGLEE  565

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ +IAKLQHRNLVRLLGCCIE +EKMLLYEYMPNKSLD F+FD +K+  L+WRKR+
Sbjct  566   FKNEILLIAKLQHRNLVRLLGCCIEDNEKMLLYEYMPNKSLDRFLFDESKQGSLDWRKRW  625

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
              +I  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q+ ANT 
Sbjct  626   EVIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMARIFNYRQDHANTI  685

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  DH  +I YAW  W
Sbjct  686   RVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNVSFRGTDHGSLIGYAWHLW  745

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              +GK   ++DP +  +    E +RCI +G+LC QD  +HRPNM +V+L LE+    LP P
Sbjct  746   SQGKTKEMIDPIVKDTRDVTEAMRCIHVGMLCTQDSVIHRPNMGSVLLMLESQTSQLPPP  805

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             R PT+  S   S D++     +++ S N +T + IVGR
Sbjct  806   RQPTF-HSFLNSGDIELNFDGHDVASVNDVTFTTIVGR  842



>ref|XP_006391988.1| hypothetical protein EUTSA_v10023270mg [Eutrema salsugineum]
 gb|ESQ29274.1| hypothetical protein EUTSA_v10023270mg [Eutrema salsugineum]
Length=843

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/818 (49%), Positives = 549/818 (67%), Gaps = 26/818 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG++++S +E F LGFFSP+ ++ RYVGIWY  I P++VVWVANR++P+L+ NGA  +  
Sbjct  40    DGDSLISEDESFELGFFSPKNSTLRYVGIWYKNIEPRTVVWVANRDKPLLNHNGALKLAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DG+N ++W+TN+   S+N   VL  T +L+ L +D  R +N  W+SF+ PTDT
Sbjct  100   DGMLVVVDGQNDTVWSTNAKPESNNTVAVLLETGDLV-LSSDSDR-SNYYWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  S GE++ FT W +  +PS GR+S+GIDP  + +IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPSQGENRAFTPWKSENDPSRGRYSLGIDPIGALEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             +  +F G+P     T+++YGF L +    +  +Y  Y  S+SSDL+ F++ ++G   Q R
Sbjct  218   NAAIFTGIPDMFRVTNYIYGFKLSSPPERDGTVYFTYVPSNSSDLLRFQIRFDGVVEQFR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARN  1681
             WN++ K W  +Q +P+ +C  YN CG ++ CD+S   +   C CI GF P + NQW+ R 
Sbjct  278   WNKNDKIWTSLQLKPSTECQSYNRCGNYSVCDDSKDFDSGKCSCIDGFEPVNRNQWDDRV  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C ++        +DGF+ +K +K+PDF  +  +  S E CK  C  DC
Sbjct  338   FSGGCRRRVPLNCNQSMV---ADTRDGFKVLKRMKVPDFGSVVSHNNS-ETCKDVCLRDC  393

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
             SC AYA  V  GI CM+W  +L+DM + + G G  + +RL  S+L  +  +   +  +  
Sbjct  394   SCKAYA--VVFGIGCMIWTRDLIDMERFEHG-GEFINIRLAKSDL-GRGKEKMKLWIIIF  449

Query  1320  vaavavlvivsIWLLCSRRARIRA--KKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
                 A L+ + IW+L   + R +A   K+ + P +++  + + S   S+     + G   
Sbjct  450   SVIGAFLLGLCIWILWKFKNRFKAFLGKKKDFPVSDIRENRDNSDKSSSSPIQVIVGNQV  509

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
              + DL  FSF+S+A AT  F+  NK+GQGGFG VYKG  P   EIAVKRLS +S QG++E
Sbjct  510   DTPDLPIFSFNSVALATGDFAEENKIGQGGFGTVYKGNFPVDGEIAVKRLSGKSKQGLEE  569

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ +IAKLQHRNLVRLLGCCI+ +EK+LLYEYMPNKSLD F+FD +KR  L+WRKR+
Sbjct  570   FKNEILLIAKLQHRNLVRLLGCCIDNNEKILLYEYMPNKSLDRFLFDESKRGSLDWRKRW  629

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
              II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q++ANT 
Sbjct  630   EIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMARIFNYRQDQANTI  689

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL++EIVSG +N SFR  +H  +I +AW  W
Sbjct  690   RVVGTYGYMAPEYAMEGMFSEKSDVYSFGVLIMEIVSGSKNVSFRGSEHGSLIGFAWHLW  749

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              +GK   L+DP++  S    E +RCI +G+LC QD  ++RPNM +V+L LE+    LP P
Sbjct  750   SQGKTKELIDPTVKDSRDINEAMRCIHVGMLCTQDSVIYRPNMGSVLLMLESRTSHLPRP  809

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             R PT+ + +     +D      ++ S N +T++ IVGR
Sbjct  810   RQPTFHSFLNSGEILDG----QDVASVNDVTLTTIVGR  843



>ref|XP_007213623.1| hypothetical protein PRUPE_ppa002243mg [Prunus persica]
 gb|EMJ14822.1| hypothetical protein PRUPE_ppa002243mg [Prunus persica]
Length=697

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/706 (54%), Positives = 493/706 (70%), Gaps = 35/706 (5%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVFL  1999
             + V+ + GE++  TSW +  +PSPG +SMG+DPR SPQIVIWEG  R WRSGHW+ ++F+
Sbjct  3     VEVNSAIGENRFLTSWKSENDPSPGAYSMGVDPRGSPQIVIWEGSNRRWRSGHWNKQLFI  62

Query  1998  GVP-MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMFKVDWNGKEVQQRWNESRKQWI  1831
             GVP M T + YGF L  EN N  +Y  Y   + SD + F++ W+G E Q RW   + QW 
Sbjct  63    GVPNMPTTYSYGFKLSDENGNGSMYFTYTPWNVSDKLRFQIRWDGYEEQLRWVGDKNQWE  122

Query  1830  KIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRR  1657
              IQ QP  ++ C +YN CG+F  C  S  +G  C C+ GF P+DW+QW  RNW+ GC+R+
Sbjct  123   VIQSQPNKSNDCELYNRCGKFGVCSASHGSGSECSCMHGFQPTDWDQWIRRNWSDGCSRK  182

Query  1656  TPLQCQKNNTEGG--GAEKDGFREVKHIKLPDFADI-----DRNMRSPedckkkceedCS  1498
             T LQC +N T G     E+DGF  ++  KLPDFAD+     D N          C ++CS
Sbjct  183   TLLQCHRNRTIGTEENDEEDGFVGLRCAKLPDFADLVVPGSDENCEE------ICLKNCS  236

Query  1497  CNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvv  1318
             C AYA     GI CM+W  +L+D+ +  +G G+TL +RL  S+L  K  K + +V + + 
Sbjct  237   CTAYA--FVQGIGCMIWTEDLLDVQKFTKG-GNTLNIRLAHSDLGGKK-KLSTLVIIVIS  292

Query  1317  aavavlvivsIWLLCSRRARIRAK---------KRDEIPRTELPTSGEFSSDFSAQCDLT  1165
              A A+ +++ + LL   +A+++           +  + P  +   S EFS+D S   DL 
Sbjct  293   VAGALFLVIFMLLLWRFKAKLKVLPTTSSISWLRNKDPPMLDASKSNEFSTDVSGSIDLF  352

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              EG     S+L  F+F+ +AAAT++FS  NKLG+GGFG VYKG LP  QE+A+KRLSRRS
Sbjct  353   AEGNQVNGSELPLFNFACVAAATNNFSEENKLGKGGFGTVYKGNLPGLQEVAIKRLSRRS  412

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG++EF NE+++IAKLQHRNLVRLLGCCI+G+EKMLLYEYMPNKSLD F+FDP+K++ L
Sbjct  413   GQGLEEFKNEISLIAKLQHRNLVRLLGCCIQGEEKMLLYEYMPNKSLDFFLFDPSKQALL  472

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR+RF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +M PKISDFGMARIFGGNQ
Sbjct  473   DWRRRFAIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDADMIPKISDFGMARIFGGNQ  532

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             NEANTNRVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS R+ +H  +I 
Sbjct  533   NEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSLRSSEHLSLIG  592

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQ--EVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             +AW  W+E + ++L+DPSI  +C     E+LRCIQ+GLLCVQD A+ RP M +VVL LE+
Sbjct  593   FAWHLWNENRAVDLIDPSIAETCSQNQAELLRCIQVGLLCVQDSAISRPTMPSVVLMLES  652

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +   L VP  P +T S+RR VD        +L SSN +T++++ GR
Sbjct  653   ETANLQVPIQPIFT-SIRRYVDTKFSTDGQDLASSNDVTITMVDGR  697



>gb|KHN45742.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
B120 [Glycine soja]
Length=795

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/808 (51%), Positives = 540/808 (67%), Gaps = 33/808 (4%)
 Frame = -3

Query  2511  LGFFSPEGT-SNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGI-TGNGTFVVLDGKn  2338
             +GFF  +   S+RYVGIWY+EI  ++ +WVANRE+PI  + G+  I   NG  +VLDG+N
Sbjct  1     MGFFGLDNNNSSRYVGIWYHEIPVKTFIWVANREKPIKGREGSILIQKSNGNLIVLDGEN  60

Query  2337  vsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLPGMRVDLSA  2158
               +W+TN SV  +N   VLR+   L++ + D       +WQSF  P DTF+PGM + +SA
Sbjct  61    NEVWSTNMSVPRNNTKAVLRDDGNLVLSEHD-----KDVWQSFEDPVDTFVPGMALPVSA  115

Query  2157  GESKLFTSWTNSGNPSPGRFSMGIDPRAS-PQIVIWEGEKR-YWRSGHWDGRVFLGVPMR  1984
             G + +F SW +  +PSPG +SM +D   S  QI+I EGEKR  WRSG+WDGRVF GV   
Sbjct  116   G-TNIFRSWKSETDPSPGNYSMKVDSEGSTKQILILEGEKRRKWRSGYWDGRVFTGVSDV  174

Query  1983  T-DFVYGFDLITEND-NLYLEYKSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPA  1810
             T   ++GF +IT+     Y  YK +S + + F++ W+G E +   +   KQW + Q +P 
Sbjct  175   TGSSLFGFTVITDTKGEEYFTYKWNSPEKVRFQITWDGFEKKFVLDADGKQWNRTQFEPF  234

Query  1809  DQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKN-  1633
             D C  YN CG FA CD  + N   C C+ GF P  W +WN RNWT GC RRTPL+ +   
Sbjct  235   DDCEKYNFCGSFAVCD--TGNSPFCSCMEGFEPMHWEEWNNRNWTRGCGRRTPLKAEAER  292

Query  1632  --NTEGGGAEK------DGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPP  1477
               N    GA++      DGF E +  K PDFA ++ N     DC++ C ++ SC AY+  
Sbjct  293   SANNSSSGADREVSVGEDGFLEQRCTKFPDFARLE-NFVGDADCQRYCLQNTSCTAYSYT  351

Query  1476  VPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN--KSSKTTiivavsvvaavav  1303
             +  GI CM+W  ELVD+       GS L +RL  ++L +  K++K  II+AV V      
Sbjct  352   I--GIGCMIWYGELVDVQHSQNNLGSLLHIRLADADLGDGGKNTKIWIILAVVVGLICIG  409

Query  1302  lvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFF  1123
             +V++ +W    +          EIP  +L  S + S       +L +EG   + ++L  F
Sbjct  410   IVVLLVWRFKRKPKASGFNNNSEIPAFDLTRSTDLSE---ISGELGLEGNQLSGAELPLF  466

Query  1122  SFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVI  943
              FS I AAT++FS  NKLGQGGFG VYKG +P G+++AVKRLSR+S QG++EF NE+ +I
Sbjct  467   HFSCILAATNNFSDENKLGQGGFGPVYKGKIPGGEDVAVKRLSRKSSQGLEEFKNEMVLI  526

Query  942   AKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIAR  763
             AKLQHRNLVRLLGCCI+G+EK+L+YEY+PNKSLD F+FDP K+++L+W KRF IIE IAR
Sbjct  527   AKLQHRNLVRLLGCCIQGEEKILVYEYLPNKSLDCFLFDPVKQTQLDWAKRFEIIEGIAR  586

Query  762   GLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGY  583
             GLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG+ARIFGGNQNEANTNRVVGTYGY
Sbjct  587   GLLYLHRDSRLRIIHRDLKASNILLDESMNPKISDFGLARIFGGNQNEANTNRVVGTYGY  646

Query  582   MAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNL  403
             M+PEYAMEGLFS+KSDVYSFGVLLLEI+SGR+NTSFR  D S +I YAW  W E + M L
Sbjct  647   MSPEYAMEGLFSIKSDVYSFGVLLLEIMSGRKNTSFRDTDDSSLIGYAWHLWSEQRVMEL  706

Query  402   LDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTAS  223
             +DPS+  S    + LR IQ+G+LCVQD A  RPNMS+V+L L +++  LP+P+ P  T S
Sbjct  707   VDPSLGDSIPKTKALRFIQIGMLCVQDSASRRPNMSSVLLMLGSESTALPLPKQPLLTTS  766

Query  222   MRRSVDVDSWNQNNELPSSNSITMSVIV  139
             MR   D +S+++   L  SN +T+S++ 
Sbjct  767   MRILDDGESYSEG--LDVSNDLTVSMVT  792



>ref|XP_002888080.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64339.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=845

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/817 (49%), Positives = 543/817 (66%), Gaps = 22/817 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+++VS +E F LGFFSP+ ++ RYVGIWY  I P++VVWVANRE+P+LD  GA  I  
Sbjct  40    DGDSLVSEDESFELGFFSPKDSTFRYVGIWYKNIEPRTVVWVANREKPLLDHKGALKIAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV++G+N +IW+TN+   S+N   VL  T +L++  +D  R     W+SF+ PTDT
Sbjct  100   DGNLVVVNGQNDTIWSTNAKPESNNTVAVLLKTGDLVLF-SDSDR-GKWYWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  S GE++ FT W +  +PSPG++SMGIDP  + +IVIWEGEKR WRSG W
Sbjct  158   FLPGMRVRVNPSHGENRAFTPWKSENDPSPGKYSMGIDPVGALEIVIWEGEKRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLI--TENDNLYLEYKSS-SSDLIMFKVDWNGKEVQQRW  1855
             +  +F G+P     T+++YGF L     + ++Y  Y +S SSD + F + ++G E Q RW
Sbjct  218   NSAIFTGIPDMFRFTNYIYGFKLSPPDRDGSVYFTYVASDSSDFLRFWIRFDGVEEQYRW  277

Query  1854  NESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARNW  1678
             N+  K W  +Q +P+ +C  YN CG ++ CD+S   +   C CI GF P   +QWN +++
Sbjct  278   NKDAKNWTLLQWKPSTECEKYNRCGNYSVCDDSKEFDSGKCSCIDGFEPVHQDQWNNKDF  337

Query  1677  TGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCS  1498
             +GGC RR  L C ++       ++DGF+ +K IK+PDF  +  +  S            S
Sbjct  338   SGGCKRRVQLNCNQSVV---ADQEDGFKVLKGIKVPDFGSVVLHNNSETCKDVCARNC-S  393

Query  1497  CNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvv  1318
             C AYA  V  GI CM+W ++L+DM     G G+ + +RL  SEL     K+ + + +  V
Sbjct  394   CKAYA--VVLGIGCMIWTHDLIDMEHFKRG-GNFINIRLAGSELGGGKEKSKLWIIIFSV  450

Query  1317  aavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGA  1144
                 +L +   W+L   +  ++A   K+ ++P +++  S ++S   S+     + G    
Sbjct  451   IGAFLLGLCI-WILWKFKKSLKAFFWKKKDLPVSDIRESSDYSVKSSSSPIKLLVGDQVD  509

Query  1143  SSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEF  964
             + DL  FS+ S+A AT  F+  NKLG GGFG VYKG    G+EIAVKRLS +S QG++EF
Sbjct  510   TPDLPIFSYDSVALATGDFAEENKLGHGGFGTVYKGNFSEGREIAVKRLSGKSKQGLEEF  569

Query  963   TNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFH  784
              NE+ +IAKLQHRNLVRLLGCCIE +EKMLLYEY+PNKSLD F+FD +KR  L+WRKR+ 
Sbjct  570   KNEILLIAKLQHRNLVRLLGCCIEDNEKMLLYEYLPNKSLDRFLFDESKRGSLDWRKRWE  629

Query  783   IIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNR  604
             II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q++ANT R
Sbjct  630   IIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMARIFNYRQDQANTIR  689

Query  603   VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWD  424
             VVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  +H  +I YAW  W 
Sbjct  690   VVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNLSFRGSEHGSLIGYAWHLWS  749

Query  423   EGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPR  244
             +GK   L+DP++  +    E +RCI +G+LC QD  +HRPN+ +V+L LE+    LP PR
Sbjct  750   QGKTKELIDPTVKDTRDVTEAMRCIHVGMLCTQDSVIHRPNIGSVLLMLESRTSELPRPR  809

Query  243   PPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              PT+  S   S +++     +++ S N +T + IVGR
Sbjct  810   QPTF-HSFLNSGEIELNLDGHDVASVNDVTFTTIVGR  845



>ref|XP_009124660.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Brassica rapa]
Length=837

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/818 (49%), Positives = 544/818 (67%), Gaps = 32/818 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S  E F LGFFSP+ ++ RYVGIWY  I PQ++VWVANRERP+ D NGA  +  
Sbjct  40    DGDALISEEEVFELGFFSPKDSTLRYVGIWYKNIEPQTIVWVANRERPLSDHNGALKLAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DG+N ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVDGQNNTVWSTNVPPKLNNTVAVLLETGDLV-LSSDSDR-DTRFWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  ++GE++ FT W +  NPSPGR+S+GIDP   P+IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPTSGENRAFTPWMSETNPSPGRYSLGIDPIGPPEIVIWEGEMRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             D  +F G+P     T+F+YGF L +    + ++Y  Y  S SSDL+ F++ ++G   Q R
Sbjct  218   DSVIFTGIPDMFRVTNFIYGFKLSSPPERDGSVYFTYVPSDSSDLLRFQITFDGVIEQFR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVGFNPSDWNQWNARN  1681
             WN+  + W  +  +P+ +C  YN CG ++ CD S   G   C CI GF P + N W+  +
Sbjct  278   WNKDARNWTLLLLKPSTECEKYNRCGNYSVCDESKEFGSGKCSCIDGFEPVNQNLWDDGD  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C ++  E      D F E++ +KLPDF     ++R+ E CK  C  DC
Sbjct  338   FSGGCKRRVPLNCSQSLRE------DEFMELRGMKLPDFGSF-VSLRNSETCKDVCVRDC  390

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
              CNAYA     GI CM+W  +L+DM +   G G ++ +RL  SEL  K  + + +  + +
Sbjct  391   LCNAYA--FVRGIGCMIWTRDLIDMERFQHG-GQSINIRLAESELGGK--ENSKLWVIIL  445

Query  1320  vaavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
                 A L+++ IW L   + R++A   ++  +P      + ++S   S+     +EG   
Sbjct  446   SVIGAFLLVLCIWTLWKFKKRVKAILWRKKHLP--VFKENKDYSVKSSSSTSQVLEGGLV  503

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
              + D   FSF+S+A AT +F+  NKLGQGGFG VYKG  P   EIAVKRLS +S QG++E
Sbjct  504   DTPDFPIFSFNSVALATGNFAEENKLGQGGFGTVYKGNFPGDTEIAVKRLSGKSKQGLEE  563

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ +IAKLQHRNLVRL+GCCIE +EK+LLYEYMPNKSLDSF+FD +KR  L+W+KR+
Sbjct  564   FKNEILLIAKLQHRNLVRLVGCCIENNEKILLYEYMPNKSLDSFIFDESKRGSLDWKKRW  623

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
              II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q++ANT 
Sbjct  624   EIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEMNPKISDFGMARIFKYRQDQANTI  683

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSG +N SFR  +H  +I YAW  W
Sbjct  684   RVVGTYGYMAPEYAMEGMFSDKSDVYSFGVLILEIVSGSKNFSFRGSEHGSLIGYAWNLW  743

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
             ++GK   L+DP++  +    E +RC+ +G+LC QD  ++RPN+ +V+L LE+    LP P
Sbjct  744   NQGKTKELIDPTVKDTQDVNEAMRCVHVGMLCTQDSVINRPNIGSVLLMLESRMSNLPRP  803

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             R PT+ + +     V    +  ++ + N IT++ +VGR
Sbjct  804   RQPTFHSFLNSGEIV----EGQDVATVNDITLTTVVGR  837



>ref|XP_006300732.1| hypothetical protein CARUB_v10019792mg [Capsella rubella]
 gb|EOA33630.1| hypothetical protein CARUB_v10019792mg [Capsella rubella]
Length=841

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/828 (48%), Positives = 547/828 (66%), Gaps = 24/828 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G++++S +E F +GFFSP+ ++ RYVGIWY  I PQ+VVWVANRE+
Sbjct  29    TSNSISRNQTIRD-GDSLISEDESFEVGFFSPKNSTLRYVGIWYKNIEPQTVVWVANREK  87

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD +G   I  +G  VV++G+NV++W+T+    S+N   VL  T +L+ L +D  R  
Sbjct  88    PLLDHSGVLKIADDGNLVVVNGQNVTVWSTSVKPESNNTVAVLLGTGDLV-LSSDSDR-R  145

Query  2229  NTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                W+SF+ PTDTFLPGM  RV+ S  E++ F  W +  +PSPGR+SMGIDP   P+IVI
Sbjct  146   RWCWESFNNPTDTFLPGMMVRVNPSLRENRSFIPWKSENDPSPGRYSMGIDPTGVPEIVI  205

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT--ENDNLYLEYKSSSSDLIMFK  1891
             WEGEKR WRSG W+  +F G+P     T++  GF L +   +  ++  Y ++SSD + F+
Sbjct  206   WEGEKRKWRSGPWNSVIFTGIPDMYRVTNYAKGFKLSSPDRDGTMFFTYSTNSSDFLRFR  265

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVGFN  1714
               ++G + Q RWN+  K W  +Q++P  +C  YN CG ++ CD+S   G   C CI GF 
Sbjct  266   FRFDGVQEQFRWNKDAKNWTLLQKKPNTECEKYNRCGNYSVCDDSKEFGSGKCSCIDGFE  325

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFA-DIDRNMRS  1537
             P   +QW   N++GGC RR PL C ++     G + DGFR ++ +KLPDF   +  N  S
Sbjct  326   PVYQDQWKNMNFSGGCKRRVPLNCSESLD---GDKIDGFRVLRGVKLPDFGLVVSLNNES  382

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
                CK +C + CSCNAYA  V  GI CM+W  +L+D+ + + G G  + +RL  SEL   
Sbjct  383   ---CKDECMKKCSCNAYAVVV--GIGCMIWTRDLIDIERFEFG-GLPINIRLAGSELGGG  436

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
               K+ + + +       +  + + W+L         KK+D +P ++   + + S+ FS+ 
Sbjct  437   KEKSKLWIVIVSAICAFLFGLCT-WILWRSLKAFLLKKKD-LPVSDTRGNRDNSAKFSSS  494

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
                 + G    + DL  FSF S+A+AT  F+  NKLG GGFG VYKG    G+EIAVKRL
Sbjct  495   PINDLVGDQVDTPDLTVFSFDSVASATGGFAEENKLGHGGFGTVYKGNFSDGREIAVKRL  554

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             S +S QG++EF NE+ +IAKLQHRNLVRL GCCIE +EKMLLYEYMPNKSLD F+FD ++
Sbjct  555   SGKSKQGLEEFKNEILLIAKLQHRNLVRLQGCCIEDNEKMLLYEYMPNKSLDRFLFDESR  614

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             R  L+W+KR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF
Sbjct  615   REILDWKKRWEIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMARIF  674

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
                Q++ NT RVVGTYGYMAPEYAMEG FS KSDVYSFGVL+LEIVSGR+N SFR  +H 
Sbjct  675   NYRQDQDNTIRVVGTYGYMAPEYAMEGTFSEKSDVYSFGVLILEIVSGRKNVSFRGSEHG  734

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              +I YAW  W +GK   ++DP++  S   +E +RCI +G+LC QD  +HRPNM +++L L
Sbjct  735   SLIGYAWYLWSQGKTKEMIDPTVKDSRDVEEAMRCIHVGMLCTQDSVIHRPNMGSMLLML  794

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             E+    LP PR PT+ + M  S +++      ++ + N +T + IVGR
Sbjct  795   ESRTGQLPRPRQPTFHSFM-HSGEIELNLDGQDVATVNDVTFTTIVGR  841



>emb|CDY48826.1| BnaC01g43340D [Brassica napus]
Length=837

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/818 (49%), Positives = 542/818 (66%), Gaps = 32/818 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S +E F LGFFSP+ ++ RYVGIWY  I PQ++VWVANRERP+ D NG   +  
Sbjct  40    DGDTLISEDEVFELGFFSPKDSTLRYVGIWYKNIEPQTIVWVANRERPLSDHNGTLKLAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DG+N ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVDGQNNTVWSTNVPPKLNNTVAVLLETGDLV-LSSDSDR-DTRFWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  ++GE++ FT W +  +PSPGR+S+GIDP   P+IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPTSGENRAFTPWMSETDPSPGRYSLGIDPIGPPEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             D  +F G+P     T+++YGF L +    + ++Y  Y  S SSDL+ F++  +G   Q R
Sbjct  218   DSVIFTGIPDMSRVTNYIYGFKLSSPPERDGSVYFTYVPSDSSDLLRFQITLDGVIEQFR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVGFNPSDWNQWNARN  1681
             WN+  K W  +  +P+ +C  YN CG ++ CD S   G   C CI GF P + N W+  +
Sbjct  278   WNKDGKNWTLLLLKPSTECEKYNRCGNYSVCDESKEFGSGKCSCIDGFEPVNQNLWDDGD  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C ++  E      D F E++ +KLPDF     ++RS E CK  C  DC
Sbjct  338   FSGGCKRRVPLNCSQSLRE------DEFMELRGMKLPDFGSF-VSLRSSETCKDVCVRDC  390

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
              CNAYA     GI CM+W  +L+DM +   G G ++ +RL  SEL  K  + + +  + +
Sbjct  391   LCNAYA--FVRGIGCMIWTRDLIDMERFQHG-GQSINIRLAESELGGK--ENSKLWIIIL  445

Query  1320  vaavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
                 A L+++ IW+L   + R++A   +   +P  E   + ++S   S+     + G   
Sbjct  446   SVIGAFLLVLCIWILWKIKKRVKAILWRNKHLPVFE--ENKDYSVKSSSSTSQVLVGGLV  503

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
              + D   FSF+S+A AT +F+  NKLGQGGFG VYKG  P   EIAVKRLS +S QG++E
Sbjct  504   DTPDFPIFSFNSVALATGNFAEENKLGQGGFGTVYKGNFPGDTEIAVKRLSGKSKQGLEE  563

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ +IAKLQHRNLVRL+GCCIE +EK+LLYEYMPNKSLDSF+FD  KR  L+W+KR+
Sbjct  564   FKNEILLIAKLQHRNLVRLVGCCIENNEKILLYEYMPNKSLDSFLFDEGKRGSLDWKKRW  623

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
              II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q++ANT 
Sbjct  624   DIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEMNPKISDFGMARIFNYRQDQANTI  683

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSG +N SFR  +H  +I YAW  W
Sbjct  684   RVVGTYGYMAPEYAMEGMFSDKSDVYSFGVLILEIVSGSKNFSFRGSEHGSLIGYAWNLW  743

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              +GK   L+DP++  +    E +RC+ +G+LC QD  ++RPN+ +V+L LE+    LP P
Sbjct  744   SQGKTKELIDPTVKDTQDVNEAMRCVHVGMLCTQDSVIYRPNIGSVLLMLESRMSNLPRP  803

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             R PT+ + +     V    +  ++P+ N IT++ +VGR
Sbjct  804   RQPTFHSFLNSGEIV----EGQDVPTVNDITLTTVVGR  837



>ref|XP_009124659.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Brassica rapa]
Length=830

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/821 (49%), Positives = 540/821 (66%), Gaps = 45/821 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S  E F LGFFSP+ ++ RYVGIWY  I PQ++VWVANRERP+ D+NGA  +  
Sbjct  40    DGDTLISEEEVFELGFFSPKDSTLRYVGIWYKNIEPQTIVWVANRERPLSDQNGAIKLAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DGKN ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVDGKNNTVWSTNVPPKLNNTVAVLLKTGDLV-LSSDSDR-DTRFWESFNNPTDT  157

Query  2190  FLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV  +LS+GE++ F  W +  +PS G++SMGIDP  + +IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNLSSGENQAFIPWRSETDPSQGKYSMGIDPFGAIEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLITEND---NLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             +  +F GVP     T++++GF L +  D   +++L Y  S+  DL  F++ ++G   Q R
Sbjct  218   NSAIFTGVPDMFHFTNYIHGFKLSSPPDPDGSVFLTYVPSNKDDLSRFRIRFDGIVQQLR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARN  1681
             WN   + W  +Q +P+ +C  YN CG ++ C++S   +   C CI GF P+  NQWN RN
Sbjct  278   WNRDARNWTSLQVKPSKECEKYNRCGNYSVCNDSKDFDSSKCSCIYGFEPAYQNQWNNRN  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C          + DGFR +K +K+PDF  +  ++     CK  C  DC
Sbjct  338   FSGGCIRRVPLNCSD--------KVDGFRVLKGMKVPDFGSV-VSLNQSGTCKDVCMRDC  388

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL--DNKSSKTTiivav  1327
             SC AY   V  GI CM+W  +L+DM   + G G+++ +RL +SE+    + SK  II+  
Sbjct  389   SCMAYE--VVPGIGCMIWTRDLIDMEHFEHG-GNSINIRLAASEIGGTKEISKFWIIIFS  445

Query  1326  svvaavavlvivsIWLLCSRRARIRA---KKRDEIPRTELPTSGEFSSDFSAQCDLTVEG  1156
             ++ A +  L  + IW+L   R R++    K RD   +   P+   F      Q D     
Sbjct  446   TIGALMFGLCCLCIWILWRFRKRVKDFLWKNRDSSVK---PSRSRFQVLVGDQVD-----  497

Query  1155  KAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQG  976
                 + D   FSF+S+A+AT  FS  NKLG+GGFG VYKG  P G+EIAVKRLS +S QG
Sbjct  498   ----TPDFPTFSFNSVASATGDFSEENKLGKGGFGTVYKGNFPGGREIAVKRLSGKSKQG  553

Query  975   VQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWR  796
             ++EF NE+++IAKLQHRNLVRLLGCCIE DEK+LLYEYMPN SLD F+FD  K+  L WR
Sbjct  554   LEEFRNEISLIAKLQHRNLVRLLGCCIENDEKILLYEYMPNNSLDHFLFDETKQRNLEWR  613

Query  795   KRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEA  616
             KR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD E+NPKISDFGMARIF   Q++A
Sbjct  614   KRWDIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEINPKISDFGMARIFNYRQDQA  673

Query  615   NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAW  436
             NT RVVGTYGYMAPEYAMEG FS KSDVYSFGVL++EIVSGR+N SFR  +H  +I YAW
Sbjct  674   NTIRVVGTYGYMAPEYAMEGSFSEKSDVYSFGVLIMEIVSGRKNISFRGSEHGSLIGYAW  733

Query  435   EQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTL  256
               W +G    L+DP++ ++    E +RCI +G+LC QD  ++RPNM +V+L LE+    L
Sbjct  734   HLWSQGNTKELIDPTMMANPDVNEAIRCIHVGMLCTQDSVIYRPNMGSVLLMLESQTSHL  793

Query  255   PVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P PR PT+ + +     V+  N    + + N IT++ +VGR
Sbjct  794   PRPRQPTFHSFLNFGEIVEGQN----VATVNDITLTTVVGR  830



>emb|CDY49030.1| BnaA01g22760D [Brassica napus]
Length=830

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/821 (49%), Positives = 536/821 (65%), Gaps = 45/821 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S  E F LGFFSP+ ++ RYVGIWY  I PQ++VWVANRERP+ D+NGA  +  
Sbjct  40    DGDTLISEEEVFELGFFSPKDSTLRYVGIWYKNIQPQTIVWVANRERPLSDQNGAIKLAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DGKN ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVDGKNNTVWSTNVPPKLNNTVAVLLKTGDLV-LSSDSDR-DTRFWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  S+GE+  F  W +  +PSPGR+SMGIDP  + +IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPSSGENHAFIPWKSETDPSPGRYSMGIDPFGAIEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLITEND---NLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             +  +F GVP     T++++GF L +  D   +++L Y  S+  DL  F++ ++G   Q R
Sbjct  218   NSAIFTGVPDMFHFTNYIHGFKLSSPPDPDGSVFLTYVPSNKDDLSRFRIRFDGIVEQLR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARN  1681
             WN   + W  +Q +P+ +C  YN CG ++ C++S   +   C CI GF P+  NQWN  N
Sbjct  278   WNRDARNWTSLQVKPSKECEKYNRCGNYSVCNDSKDFDSSKCSCIYGFEPAYQNQWNNGN  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C          + DGFR +K +K+PDF  +  ++     CK  C  DC
Sbjct  338   FSGGCIRRVPLNCSD--------KVDGFRVLKGMKVPDFGSV-VSLNQSGTCKDVCMRDC  388

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL--DNKSSKTTiivav  1327
             SC AY   V  GI CM+W  +L+DM   + G G+++ +RL +SE+    + SK  II+  
Sbjct  389   SCKAYE--VVPGIGCMIWTRDLIDMEHFEHG-GNSINIRLAASEIGGTKEISKFWIIIFS  445

Query  1326  svvaavavlvivsIWLLCSRRARIRA---KKRDEIPRTELPTSGEFSSDFSAQCDLTVEG  1156
             ++ A +  L  + IW+L   R R++    K RD   +   P+   F      Q D     
Sbjct  446   TIGALMFGLCCLCIWILWRFRKRVKDFLWKNRDSSVK---PSRSRFQVLVGDQVD-----  497

Query  1155  KAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQG  976
                 + D   FSF+S+A+AT  FS  NKLGQGGFG VYKG  P G+EIAVKRLS +S QG
Sbjct  498   ----TPDFPTFSFNSVASATGDFSEENKLGQGGFGTVYKGNFPGGREIAVKRLSGKSKQG  553

Query  975   VQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWR  796
             ++EF NE+++IAKLQHRNLVRLLGCCIE DEK+LLYEYMPN SLD F+FD  K+  L WR
Sbjct  554   LEEFRNEISLIAKLQHRNLVRLLGCCIENDEKILLYEYMPNNSLDHFLFDETKQRNLEWR  613

Query  795   KRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEA  616
             KR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD E+NPKISDFGMARIF   Q++A
Sbjct  614   KRWDIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEINPKISDFGMARIFNYRQDQA  673

Query  615   NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAW  436
             NT RVVGTYGYMAPEYAMEG FS KSDVYSFGVL++EIVSGR+N SFR  +H  +I YAW
Sbjct  674   NTIRVVGTYGYMAPEYAMEGSFSEKSDVYSFGVLIMEIVSGRKNISFRGSEHGSLIGYAW  733

Query  435   EQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTL  256
               W + K   L+D ++  +    E +RCI +G+LC QD  ++RPNM +V+L LE+    L
Sbjct  734   HLWSQEKTKELIDLTMMDNSDVNEAIRCIHVGMLCTQDSVIYRPNMGSVLLMLESQTSHL  793

Query  255   PVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P PR PT+ + +     V+  N    + + N IT++ +VGR
Sbjct  794   PRPRRPTFHSFLNFGEIVEGQN----VATVNDITLTTVVGR  830



>gb|KCW74920.1| hypothetical protein EUGRSUZ_E03667 [Eucalyptus grandis]
Length=759

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/770 (52%), Positives = 526/770 (68%), Gaps = 34/770 (4%)
 Frame = -3

Query  2379  ITGNGTFVVLDGKnvsi--wntnssvtssnatmVLRNTSELIILKTD-------GWRPNN  2227
             ++ +G  +VLDG N ++   + NSS   +N+T VL +T  L++L +        G   +N
Sbjct  3     VSNDGNLMVLDGNNGTVWSSSINSSSVPTNSTAVLMDTGNLVLLASAEADSASAGGDVSN  62

Query  2226  TIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             + WQSF  PTDT+LPGMRV +++  GE++ F SW +S +PSPG FSMG+DPR  PQIVIW
Sbjct  63    SNWQSFDHPTDTYLPGMRVRVNSTDGENRAFRSWKSSDDPSPGNFSMGVDPRLPPQIVIW  122

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKS-SSSDLIMFKVD  1885
                 R WRSGHW+G++F GVP M   +++GF L  I  + + Y  Y   +SS+L+MF++ 
Sbjct  123   GQSGREWRSGHWNGQIFTGVPNMTRSYLFGFRLWSIQADGSRYFTYTPLNSSNLLMFRIL  182

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             WNG E Q  W+ +   W  +QEQPA +C +YN CG FA C+   S    C C+ GF+P  
Sbjct  183   WNGTEEQLLWDGTSNAWTMLQEQPAKECDLYNKCGDFAICNEMDSP--KCSCMEGFSPKS  240

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
              +QWN  NW+ GC R+T LQCQ N++       DGF ++  +KLPDFAD    +   ++C
Sbjct  241   PDQWNRGNWSAGCARKTQLQCQDNSSR-----MDGFLKLDGVKLPDFADSVSAIIG-DEC  294

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             + KC E+CSCNA+A  V  GI CMLW   L+D+ Q D+G G TL +RL +SEL  KS K 
Sbjct  295   EAKCLENCSCNAFAFDV--GIGCMLWTENLIDVQQFDKG-GLTLQIRLANSELRTKS-KI  350

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRA-----KKRDEIPRTE-LPTSGEFSSDFS  1183
             + +  +  V   A ++ V +WLL   +  ++      +K  ++P  +    + E S++ S
Sbjct  351   SKLFIIITVLVGAFVLGVLVWLLWRFKDNLKGFSIFYRKNKKLPLLDNFVKNEELSAELS  410

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
                 L  + K    +D+  F+FSSI AAT+ FS  NKLG GGFG VYKG L  GQEIAVK
Sbjct  411   GPDGLARDAKQVGGADITVFNFSSIEAATNFFSEENKLGLGGFGPVYKGKLFGGQEIAVK  470

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLSR+S QG  EF NE+ +IAKLQHRNLVRLLG C++ ++KML+YEYMPNKSLDSF+F+P
Sbjct  471   RLSRKSSQGPDEFKNEVMLIAKLQHRNLVRLLGFCVQEEDKMLVYEYMPNKSLDSFIFNP  530

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             AKR++L+W+KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMAR
Sbjct  531   AKRAKLDWKKRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMAR  590

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IFG N+NEA+TNRVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG++N  FRT +
Sbjct  591   IFGTNENEASTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKKNLGFRTLE  650

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             H  +I  AW    EGK M L+DP I  +C   +VLRCIQ+GLLCVQD AV RP M +V+L
Sbjct  651   HPNLIVNAWHHLKEGKGMELIDPCIRDTCSTDKVLRCIQVGLLCVQDSAVDRPAMPSVML  710

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              LE+    LP P+ P  T S+  S+D  S +++ E+ S N +T+S + GR
Sbjct  711   LLESKTADLPFPKLPRST-SITGSMDTCSLSESQEIESLNGVTVSSVDGR  759



>emb|CDY49029.1| BnaA01g22750D [Brassica napus]
Length=837

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/818 (49%), Positives = 540/818 (66%), Gaps = 32/818 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S  E F LGFFSP+ ++ RYVGIWY  I PQ++VWVANRERP+ D NGA  +  
Sbjct  40    DGDALISEEEVFELGFFSPKDSTLRYVGIWYKNIEPQTIVWVANRERPLSDHNGALKLVD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV+DG+N ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVDGQNNTVWSTNVPPKLNNTVAVLLETGDLV-LSSDSDR-DTRFWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  ++GE++ FT W +  +PSPGR+S+GIDP   P+IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPTSGENRAFTPWMSETDPSPGRYSLGIDPIGPPEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             D  +F G+P     T+++ GF L      + ++Y  Y  S SSDL+ F++ ++    Q R
Sbjct  218   DSVIFTGIPDMFRVTNYIRGFKLSAPPERDGSVYFTYVPSDSSDLLRFQITFDSVIEQFR  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVGFNPSDWNQWNARN  1681
             WN+  K W  +  +P+ +C  YN CG ++ CD S   G   C CI GF P + N W+  +
Sbjct  278   WNKDAKNWTLLLLKPSTECEKYNRCGNYSVCDESKEFGSGKCSCIDGFEPVNQNLWDDGD  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR PL C ++  E      D F E++ +KLPDF     ++R+ E CK  C  DC
Sbjct  338   FSGGCKRRVPLNCSQSLRE------DEFMELRGMKLPDFGSF-VSLRNSETCKDVCVRDC  390

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
              CNAYA     GI CM+W  +L+DM +   G G ++ +RL  SEL  K  + + +  + +
Sbjct  391   LCNAYA--FVRGIGCMIWTRDLIDMERFQHG-GQSINIRLAESELGGK--ENSKLWIIIL  445

Query  1320  vaavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
                 A L+++ IW L   + R+RA   ++  +P  E   + ++S   S+     + G   
Sbjct  446   SVIGAFLLVLCIWTLWKFKKRVRAILWRKKHLPVFE--ENKDYSVKSSSSTSQVLVGGLV  503

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
              + D   FSF+S+A AT +F+  NKLGQGGFG VYKG  P   EIAVKRLS +S QG++E
Sbjct  504   DTPDFPIFSFNSVALATGNFAEENKLGQGGFGTVYKGNFPGDTEIAVKRLSGKSKQGLEE  563

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ +IAKLQHRNLVRL+GCCIE +EK+LLYEYMPNKSLDSF+FD +KR  L+W+KR+
Sbjct  564   FKNEILLIAKLQHRNLVRLVGCCIENNEKILLYEYMPNKSLDSFLFDESKRGSLDWKKRW  623

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
              II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARIF   Q++ANT 
Sbjct  624   DIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEMNPKISDFGMARIFNYRQDQANTI  683

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSG +N SFR  +H  +I YAW  W
Sbjct  684   RVVGTYGYMAPEYAMEGMFSDKSDVYSFGVLILEIVSGSKNFSFRGSEHGSLIGYAWNLW  743

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              +GK   L+DP++  +    E +RCI +G+LC QD  ++RPN+ +V+L LE+    LP P
Sbjct  744   SQGKTKELIDPTVKDTQDVNEAMRCIHVGMLCTQDSVIYRPNIGSVLLMLESRMSNLPRP  803

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             R PT+ + +     V    +  ++ + N IT++ +VGR
Sbjct  804   RQPTFHSFLNSGEIV----EGQDVATVNDITLTTVVGR  837



>ref|XP_004134964.1| PREDICTED: uncharacterized protein LOC101207147 [Cucumis sativus]
Length=2802

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/837 (49%), Positives = 566/837 (68%), Gaps = 34/837 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             AAD I +G+ ++D   E +VS ++ + LGFFSP  +S RYVGIWY++I  QSV+WVANR+
Sbjct  30    AADSITKGRGLRDGSNETLVSLDDSYELGFFSPINSSLRYVGIWYHKIEEQSVIWVANRD  89

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             RP+ ++NG   I  +G  VVLDG N    +  ++ +     + L N   L++   D    
Sbjct  90    RPLRNRNGVLIIGDDGNLVVLDGNNSVWTSNITANSFEPRNLTLLNHGALVLSSGDDL--  147

Query  2232  NNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
             +   W SF  PTDTFLP M  +V+   GE ++F SW +  +P+ G + +G+DPR + QI+
Sbjct  148   SKVHWSSFEHPTDTFLPNMVVKVNPQMGEKRMFMSWKSETDPAVGNYCLGVDPRGAVQII  207

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEN-DNLYLEYKSSSS-DLIMFKV  1888
             +W G  R+WRSGHWD ++F G+P MR+  +YGF + +++ +N+ + +++ +  D + F++
Sbjct  208   VWNGNNRWWRSGHWDKQIFSGIPTMRSTSLYGFKITSDDGNNISVTFEALNDLDKLKFQI  267

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              W+GKE QQR NE+ ++W  I+  P++ C  YN CG F  C  +S   + C C  GF P 
Sbjct  268   QWDGKEAQQRLNETTRKWDTIRLLPSNDCDFYNFCGDFGVCSENSR--LKCSCPQGFIPK  325

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGG----AEKDGFREVKHIKLPDFADIDRNMR  1540
             +  +W+   W+ GC R+TPL  Q+  +   G    +E+DGF +V  +KLPDF      + 
Sbjct  326   NKERWDKGIWSDGCRRKTPLLEQRMKSSPNGTIEDSEQDGFVDVLFVKLPDFI---TGIF  382

Query  1539  SPedckkkceedCSCNAY--APPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
               E C+ +C  + SC AY  AP    GI C  W   L D+ +  EG+G+TL +R+  S+L
Sbjct  383   VVESCRDRCSSNSSCVAYSDAP----GIGCATWDGPLKDIQRF-EGAGNTLHLRIAHSDL  437

Query  1365  D--NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA------KKRDEIPRTELPT  1210
                +  SK +  V V++    A  + +   LL   R + +A      + + E+P  +L  
Sbjct  438   TPVDSESKLSTGVIVAICFGGAAAIAIIALLLWKFRGKTKAATTSEPQNKTEVPMFDLSK  497

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S E S++ S   +L +EG+  +  DL  F+F+ IAAATD+FS  NKLGQGGFG VYKG L
Sbjct  498   SKELSAELSGPYELGIEGENLSGPDLPMFNFNCIAAATDNFSEENKLGQGGFGPVYKGKL  557

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             PCGQEIAVKRLS RSGQG++EF NE+ +I KLQHRNLVRLLG CI+G++K+LLYEYMPNK
Sbjct  558   PCGQEIAVKRLSVRSGQGLEEFKNEIILIGKLQHRNLVRLLGYCIQGEDKLLLYEYMPNK  617

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+FDP K++ L+W+KR  I+E IARGLLYLHRDSRL IIHRDLKASNILLD +MNP
Sbjct  618   SLDWFLFDPNKQALLDWKKRLSIVEGIARGLLYLHRDSRLLIIHRDLKASNILLDEDMNP  677

Query  669   KISDFGMARIFGGNQNEA-NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             KISDFGMARIFGGNQNEA NT RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE++ G
Sbjct  678   KISDFGMARIFGGNQNEATNTIRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLELICG  737

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RRNTSFR+ ++  +I YAW+ W++G+ + LLDPSI  S    EVL+CI + +LCVQD   
Sbjct  738   RRNTSFRSTEYLTLISYAWKLWNDGRAIELLDPSIRDSSPENEVLKCIHVAMLCVQDSPA  797

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVI  142
             +RP + ++VL LE+++ +LP PR PTYT S R S+D+D + + +++ SSN +T++++
Sbjct  798   YRPTLQSLVLMLESESTSLPQPRQPTYT-STRASIDIDLFTEGHDIVSSNDVTVTML  853


 Score =   387 bits (993),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 236/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTN  958
             D+ +F+FS++ AAT++FS  NKLG+GGFG VYKG L  G+E+AVKRLS +S QG +EF N
Sbjct  2467  DMHYFNFSTLKAATNNFSDVNKLGEGGFGPVYKGKLMGGEEVAVKRLSTKSSQGHEEFKN  2526

Query  957   ELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHII  778
             E  VI KLQH+NLVRLLGCC+EG EK+L+YEYM N SLD+F+FDP K  +L++ KR +I+
Sbjct  2527  EAKVIWKLQHKNLVRLLGCCVEGGEKLLVYEYMANTSLDAFLFDPLKCKQLDFLKRENIV  2586

Query  777   EEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVV  598
               IARG+LYLH DSRL+IIHRDLKASN+LLD EMNPKISDFG ARIFGG Q +A+TNR+V
Sbjct  2587  NGIARGILYLHEDSRLKIIHRDLKASNVLLDDEMNPKISDFGTARIFGGKQIDASTNRIV  2646

Query  597   GTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDE  421
             GTYGYMAPEYAMEG+FSVKSDVYSFGVL+LE++SG++N  F   D +  ++ YAWE W E
Sbjct  2647  GTYGYMAPEYAMEGVFSVKSDVYSFGVLMLEVMSGKKNIGFLNMDRAQNLLSYAWELWSE  2706

Query  420   GKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRP  241
             G+   ++D ++   C   E ++ I +GLLCVQ+    RP MS VVL L + ++ LP P  
Sbjct  2707  GRAEEMIDKNLSGECPESEAVKWIHIGLLCVQEDPNIRPTMSMVVLMLGSKSIQLPQPSK  2766

Query  240   PTYTAS  223
             P +  S
Sbjct  2767  PPFLTS  2772



>ref|XP_011008149.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Populus euphratica]
Length=735

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/715 (55%), Positives = 494/715 (69%), Gaps = 20/715 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + + +GQ IKD GE + S +E F LGFFSP  +++RYVG+ Y++I  Q+V+WVANR++
Sbjct  27    ATNTLTKGQSIKD-GEILTSVDENFELGFFSPGNSTSRYVGVRYSKIQDQAVIWVANRDK  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW-RP  2233
             PI   +G   I  +G  +V++G   S+W++N+S  SSN  ++L  T  LI+   D     
Sbjct  86    PISGTDGVVKIGEDGNLLVVNGNGSSVWSSNASFVSSNTALMLDTTGNLILSSNDSIGDT  145

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +   WQSF+ PTDT+LP M+V + + E   FTSW ++ +PSPG F+MG+DPR +PQIV+W
Sbjct  146   DKAYWQSFNNPTDTYLPDMKVLIGSAEIYAFTSWKSTSDPSPGNFTMGVDPRGAPQIVVW  205

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFV---YGFDLITEND-NLYLEYKSSS-SDLIMFKV  1888
             E  +R WRSGHW+G +F GVP    F    YGF +  END  LY  Y  S  S+L+ F++
Sbjct  206   EQSRRRWRSGHWNGLIFSGVPSMAAFTTYRYGFKITRENDGKLYFTYNPSDPSELMKFQI  265

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
              WNG E Q+RWN+S K W  +Q QP+++C  YNHCG F  C  S S   NC C+ GF P 
Sbjct  266   TWNGFEEQKRWNKSAKAWQVMQSQPSEECEKYNHCGNFGVCTPSGSP--NCRCLEGFQPR  323

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +QW   NW+GGC RR+PLQCQ N + GG   +DGF+ V+  KLPDFAD+ +   S +D
Sbjct  324   HPDQWRLGNWSGGCERRSPLQCQMNTSNGG---EDGFKAVRCAKLPDFADVYQ--LSSDD  378

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             CKKKC+ +CSC AYA     GI CM+W  +L D+ Q    SG+TL++RL  SELD+    
Sbjct  379   CKKKCQNNCSCKAYAHVT--GIRCMIWNGDLTDV-QNHIQSGNTLYMRLAYSELDHSRLP  435

Query  1347  T---TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
             T    +IV   +V     + ++ +     +          E+   +L  S E+++D S  
Sbjct  436   TYVIVLIVLAGLVFVAISIWLLWMLKKKLKATSASMSTNHELQVHDLSRSKEYTTDLSGP  495

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
              DL +EG      DL  F+F+ +A AT++FS  NKLGQGGFG VYKG LP G+EIAVKRL
Sbjct  496   GDLVLEGSQVNGPDLPMFNFNFVAVATNNFSEENKLGQGGFGLVYKGKLPGGEEIAVKRL  555

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             S+ SGQG+ EF NE+ +IAKLQHRNLVRLLGC I+GDEKML+YEYMPNKSLD F+FDP K
Sbjct  556   SKISGQGLLEFKNEIILIAKLQHRNLVRLLGCSIQGDEKMLIYEYMPNKSLDYFLFDPEK  615

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +  L W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFGMARIF
Sbjct  616   QGLLEWNKRFEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEGMNPKISDFGMARIF  675

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             G NQNE NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR
Sbjct  676   GANQNEINTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  730



>ref|XP_007159234.1| hypothetical protein PHAVU_002G220500g [Phaseolus vulgaris]
 gb|ESW31228.1| hypothetical protein PHAVU_002G220500g [Phaseolus vulgaris]
Length=838

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/840 (49%), Positives = 546/840 (65%), Gaps = 49/840 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDG--ENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSV---VWV  2425
             AA+ +     IKD+   +N+VS N  F +GFF  + +S RYVGIWY++  P S    +WV
Sbjct  27    AANSLTGETEIKDNNGVDNLVSENLTFEMGFFGFDNSS-RYVGIWYHKF-PSSASAFIWV  84

Query  2424  ANRERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTD  2245
             ANRE+PI  + G+  I G+G  VVLDG+N  +W+TN S++ +    VLR+   L++  ++
Sbjct  85    ANREKPINGRGGSIKIKGDGNLVVLDGENNEVWSTNKSLSRNITKAVLRDDGNLVL--SE  142

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP-  2068
                    +WQSF  PTDTF+PGM +  SAG   LF SW ++ NP+PG +SMG+D   S  
Sbjct  143   ESEHEKDVWQSFENPTDTFVPGMSLPASAGVG-LFRSWKSATNPAPGNYSMGVDSTGSTL  201

Query  2067  QIVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFK  1891
             QI+I +GEK+ WRSG+WDGRVF+GV  M    ++GF L  +N      Y  +  + + F+
Sbjct  202   QILIMDGEKKRWRSGYWDGRVFVGVSNMTGSSLFGFKLNGDN----FTYTWNGPEKVRFQ  257

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             + W+G E +   +E ++QW   Q +P ++C  YN CG FA CD S ++   C C+ GF  
Sbjct  258   ITWDGFEKKFVSDEDQQQWNNTQHEPYNKCETYNFCGNFALCDISKAD--VCSCMQGFQG  315

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAE----KDGFREVKHIKLPDFADIDRNM  1543
              +WN  N    +GGC RRT L+ ++N++   G E    +D F   +  KLPDFA ++   
Sbjct  316   GEWNGGN----SGGCKRRTLLKAERNSS---GTEVSVGEDDFYVQRCTKLPDFARLE---  365

Query  1542  RSPedckkkc---eedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSS  1372
              SP D         ++ SC AY+  +  GI CM+W  +LVD+   +   G+ L +RL  S
Sbjct  366   -SPSDDGDCQRFCLQNSSCTAYSYTI--GIGCMIWYVDLVDIQHTENSIGNVLNIRLADS  422

Query  1371  ELDN-KSSKTTiivavsvvaavavlvivsIWLLCSRRARIR------AKKRDEIPRTELP  1213
             E +     K T I  + V   V ++ +    LL  R  R R      A    + P  +L 
Sbjct  423   EFEAVDGEKKTKIWIIIVPVVVGLICLGIFVLLVWRFKRKRKVSSASANNNGDFPVIDLT  482

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S + S++FS   +L +EG    +++L  F+FS IAAATD+FS  NKLGQGGFG VY G 
Sbjct  483   RSTDLSAEFSGSTELGLEGN---NAELPLFTFSFIAAATDNFSQKNKLGQGGFGPVYWGN  539

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             LP G+E+AVKRLSR+S QG++EF NE+ +IAKLQHRNLVRLLGC I+G+EK+L+YEY+PN
Sbjct  540   LPGGEEVAVKRLSRKSSQGLEEFKNEMMLIAKLQHRNLVRLLGCSIQGEEKILVYEYLPN  599

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD F+FDP K+++L+W KRF IIE IARGLLYLH+DSRLRIIHRDLKASNILLD  MN
Sbjct  600   KSLDCFLFDPVKQTQLDWTKRFEIIEGIARGLLYLHQDSRLRIIHRDLKASNILLDENMN  659

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFG+ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI+SG
Sbjct  660   PKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIMSG  719

Query  492   RRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RRNTSFR  D S +I YAW  W E + M LLD SI  S    + LR I + +LCVQD A 
Sbjct  720   RRNTSFRNTDDSSLIGYAWHLWSEQRVMELLDSSIGDSTPKSKALRYIHIAMLCVQDSAS  779

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              RPNM++V+L L ++  TLP+P+ P  T S  +  D D  + +  L  SN +T +++ GR
Sbjct  780   RRPNMASVLLMLASEATTLPLPKQPLRTISTSKLDDQDQ-SYSEGLDVSNDLTATMVTGR  838



>gb|AES63664.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=838

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/835 (47%), Positives = 545/835 (65%), Gaps = 41/835 (5%)
 Frame = -3

Query  2586  ADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              D I+QG +I+D DGE + S    FV+GFF  + +S+RYVGIWY  I    V+WVANR  
Sbjct  28    GDPIKQGDFIRDEDGEVLFSDGHNFVMGFFGFQDSSSRYVGIWYYNIPGPEVIWVANRNT  87

Query  2409  PILDKNGAFGITGNGTFVVLD---GKnvsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             PI    G+F IT NG  V+LD    +  S   ++     +N    +R+   L+ L  D  
Sbjct  88    PINGNGGSFTITENGNLVILDENKNQLWSTNVSSVRNNMNNTEAFVRDDGNLV-LSND--  144

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA-SPQI  2062
               N  +W+SF  P+DT++PGM+V ++ G+S  FTSW +S +PS G  ++G+DP    PQ+
Sbjct  145   --NVVLWESFKHPSDTYVPGMKVPVN-GKSFFFTSWKSSTDPSLGNHTLGVDPNGLPPQV  201

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSS----SSDLIM  1897
             V+ +GE++ WRSG+WDGR+F GV M   F++GF L  +N+ + Y  Y  +    +  L+ 
Sbjct  202   VVRDGERKIWRSGYWDGRIFTGVDMTGSFLHGFVLNYDNNGDRYFVYNDNEWKLNGSLVR  261

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E +  WNE+ K+WI+IQ+ P ++C +YN+CG FA C+ S      C C+ GF
Sbjct  262   FQIGWDGYERELVWNENEKRWIEIQKGPHNECELYNYCGSFAACELSVLGSAICSCLQGF  321

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
                    W+  N +GGCTR T L   K N   G   +DGF E  ++KLPDFA +      
Sbjct  322   E-----LWDEGNLSGGCTRITAL---KGNQSNGSFGEDGFLERTYMKLPDFAHV----VV  369

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
               DC+  C E+ SC AYA  +  GI CMLW  +LVD+ Q + G G+TL +RL  S+L + 
Sbjct  370   TNDCEGNCLENTSCTAYAEVI--GIGCMLWYGDLVDVQQFERGDGNTLHIRLAHSDLGHG  427

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSR-RARIRAKKRDEIPRTELP------TSGEF  1198
                  I++ + +     ++ +  + LL  R + +++         +E+P       S E 
Sbjct  428   GKNNKIMIVIILTVIAGLICLGILVLLVWRYKTKLKVYLASCCKNSEVPPVVDARKSRET  487

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S++ S   +L++E     S++L FF+FS ++ AT++FS  NKLG G FG VYKG LP G+
Sbjct  488   SAEISESVELSLESNR-LSAELPFFNFSCMSEATNNFSEENKLGHGRFGPVYKGKLPTGE  546

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             EIAVKRLSRRSG G+ EF NE+ + AKL+HRNLV+L+GC IEGDEK+L+YE+MPNKSLD 
Sbjct  547   EIAVKRLSRRSGHGLDEFQNEMRLFAKLEHRNLVKLMGCSIEGDEKLLVYEFMPNKSLDH  606

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             F+FDP K+++L+W +R+ IIE IARGLLYLHRDSRLRIIHR+LK SNILLD  MNPKISD
Sbjct  607   FLFDPIKQTQLDWARRYEIIEGIARGLLYLHRDSRLRIIHRNLKPSNILLDENMNPKISD  666

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             F +A+IFGGNQNEA+T RVVG++GYM+ EYAM+GLFSVKSDVYSFGVLLLEIVSGR+NTS
Sbjct  667   FCLAQIFGGNQNEASTTRVVGSHGYMSHEYAMQGLFSVKSDVYSFGVLLLEIVSGRKNTS  726

Query  477   FRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
             F   ++S +I YAW  W++ + M ++D  I       E LRCIQ+G+LCVQD A HRPNM
Sbjct  727   FGDSEYSSLIGYAWHLWNDQRAMEIVDACIHDLSPNTEALRCIQIGMLCVQDSASHRPNM  786

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             S +V  LE++  TLP+P  P  T S++RSVD + +    ++  SN + ++ + GR
Sbjct  787   SDIVSMLESEATTLPLPTQPLDT-SIKRSVDRECYKDGVDI--SNDLAVTTVEGR  838



>ref|XP_003593413.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=839

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/835 (47%), Positives = 545/835 (65%), Gaps = 41/835 (5%)
 Frame = -3

Query  2586  ADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              D I+QG +I+D DGE + S    FV+GFF  + +S+RYVGIWY  I    V+WVANR  
Sbjct  29    GDPIKQGDFIRDEDGEVLFSDGHNFVMGFFGFQDSSSRYVGIWYYNIPGPEVIWVANRNT  88

Query  2409  PILDKNGAFGITGNGTFVVLD---GKnvsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             PI    G+F IT NG  V+LD    +  S   ++     +N    +R+   L+ L  D  
Sbjct  89    PINGNGGSFTITENGNLVILDENKNQLWSTNVSSVRNNMNNTEAFVRDDGNLV-LSND--  145

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA-SPQI  2062
               N  +W+SF  P+DT++PGM+V ++ G+S  FTSW +S +PS G  ++G+DP    PQ+
Sbjct  146   --NVVLWESFKHPSDTYVPGMKVPVN-GKSFFFTSWKSSTDPSLGNHTLGVDPNGLPPQV  202

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSS----SSDLIM  1897
             V+ +GE++ WRSG+WDGR+F GV M   F++GF L  +N+ + Y  Y  +    +  L+ 
Sbjct  203   VVRDGERKIWRSGYWDGRIFTGVDMTGSFLHGFVLNYDNNGDRYFVYNDNEWKLNGSLVR  262

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
             F++ W+G E +  WNE+ K+WI+IQ+ P ++C +YN+CG FA C+ S      C C+ GF
Sbjct  263   FQIGWDGYERELVWNENEKRWIEIQKGPHNECELYNYCGSFAACELSVLGSAICSCLQGF  322

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
                    W+  N +GGCTR T L   K N   G   +DGF E  ++KLPDFA +      
Sbjct  323   E-----LWDEGNLSGGCTRITAL---KGNQSNGSFGEDGFLERTYMKLPDFAHV----VV  370

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
               DC+  C E+ SC AYA  +  GI CMLW  +LVD+ Q + G G+TL +RL  S+L + 
Sbjct  371   TNDCEGNCLENTSCTAYAEVI--GIGCMLWYGDLVDVQQFERGDGNTLHIRLAHSDLGHG  428

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSR-RARIRAKKRDEIPRTELP------TSGEF  1198
                  I++ + +     ++ +  + LL  R + +++         +E+P       S E 
Sbjct  429   GKNNKIMIVIILTVIAGLICLGILVLLVWRYKTKLKVYLASCCKNSEVPPVVDARKSRET  488

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S++ S   +L++E     S++L FF+FS ++ AT++FS  NKLG G FG VYKG LP G+
Sbjct  489   SAEISESVELSLESNR-LSAELPFFNFSCMSEATNNFSEENKLGHGRFGPVYKGKLPTGE  547

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             EIAVKRLSRRSG G+ EF NE+ + AKL+HRNLV+L+GC IEGDEK+L+YE+MPNKSLD 
Sbjct  548   EIAVKRLSRRSGHGLDEFQNEMRLFAKLEHRNLVKLMGCSIEGDEKLLVYEFMPNKSLDH  607

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             F+FDP K+++L+W +R+ IIE IARGLLYLHRDSRLRIIHR+LK SNILLD  MNPKISD
Sbjct  608   FLFDPIKQTQLDWARRYEIIEGIARGLLYLHRDSRLRIIHRNLKPSNILLDENMNPKISD  667

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             F +A+IFGGNQNEA+T RVVG++GYM+ EYAM+GLFSVKSDVYSFGVLLLEIVSGR+NTS
Sbjct  668   FCLAQIFGGNQNEASTTRVVGSHGYMSHEYAMQGLFSVKSDVYSFGVLLLEIVSGRKNTS  727

Query  477   FRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
             F   ++S +I YAW  W++ + M ++D  I       E LRCIQ+G+LCVQD A HRPNM
Sbjct  728   FGDSEYSSLIGYAWHLWNDQRAMEIVDACIHDLSPNTEALRCIQIGMLCVQDSASHRPNM  787

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             S +V  LE++  TLP+P  P  T S++RSVD + +    ++  SN + ++ + GR
Sbjct  788   SDIVSMLESEATTLPLPTQPLDT-SIKRSVDRECYKDGVDI--SNDLAVTTVEGR  839



>gb|KEH29518.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=828

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/830 (47%), Positives = 532/830 (64%), Gaps = 43/830 (5%)
 Frame = -3

Query  2577  IQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL  2401
             I+QG  ++D +G+ + S    F +GFF    +S+RYVGIWY  I    ++WVANR  PI 
Sbjct  27    IKQGDIVRDQEGDVLFSDGFNFAMGFFGFGNSSSRYVGIWYYNIPGPQIIWVANRNTPIN  86

Query  2400  DKNGAFGITGNGTFVVLD---GKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
                G+F +  NG  V+LD    +  S   + S   + N   VLR+   L++        N
Sbjct  87    GNRGSFTVAENGNLVILDENKNQIWSTNVSISQNNTDNYEAVLRDDGNLVLAN-----EN  141

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRA-SPQIVIW  2053
               +W+SF  P DT++PGM+V ++ G+S  FTSW +S +PS G   MGID     PQ+ +W
Sbjct  142   AVLWESFENPCDTYVPGMKVPVN-GKSFFFTSWKSSTDPSIGNHKMGIDTVGLPPQVFVW  200

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDL---------ITENDNLYLEYKSSSSDLI  1900
             EGE++ WRSG+WDGRVF GV  ++ F++GF L            NDN   E+K + +  +
Sbjct  201   EGERKKWRSGYWDGRVFTGVDAKSSFLHGFILNYDSNGDRYFVYNDN---EWKLNGNSSV  257

Query  1899  MFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
              F++ W+G E +  WNE+ K W   Q+ P +QC  YN+CG FA CD S S    C C+ G
Sbjct  258   RFQIGWDGYERELIWNETEKYWSVNQKGPHNQCEFYNYCGDFASCDTSDSGWAICSCLQG  317

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             F   D       N + GCTR+T L   K +    G ++DGF E   +KLPDFA +     
Sbjct  318   FELKD-----KENLSSGCTRKTAL---KGDQTSDGFDEDGFFERTSMKLPDFARV----V  365

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
               +DC+  C E+ SC AYA     GI CM+W  +LVD+  L    G++L++RL  S+L +
Sbjct  366   DTKDCEGNCLENASCTAYAEVT--GIGCMVWHGDLVDVQHLGRDEGNSLYIRLAQSDLGH  423

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
                    ++ +   A   ++ +    LL  R   ++A K   I    +  + E SS+FS 
Sbjct  424   GGKMNRTMIVIISTAVTGLICLGIFVLLVWRC--MKASKYKNIQILPVVYARETSSEFSG  481

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               +L+++    + ++L FFSF+ ++AAT++FS ANKLGQGGFG VYKG LP G+EIAVKR
Sbjct  482   SLELSLKSNQLSGAELPFFSFTCMSAATNNFSQANKLGQGGFGPVYKGKLPTGEEIAVKR  541

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSR  GQG+ EF NE+ + AKLQHRNLVRL+GC IEGDEK+L+YE+MPNKSLD F+FDP 
Sbjct  542   LSRPFGQGLDEFKNEMRLFAKLQHRNLVRLMGCSIEGDEKLLVYEFMPNKSLDYFLFDPI  601

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             K+++LNW +R+ IIE IARGLLYLHRDSRLRIIHRDLK SNILLD  MNPKISDFG+ARI
Sbjct  602   KKAQLNWARRYEIIEGIARGLLYLHRDSRLRIIHRDLKPSNILLDENMNPKISDFGLARI  661

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGGNQNE+NT RVVGTYGYM+PEYAM+G+ S K+DVYSFGVLLLEIVSG +NTSFR  D 
Sbjct  662   FGGNQNESNTTRVVGTYGYMSPEYAMQGVLSAKADVYSFGVLLLEIVSGHKNTSFRHSDD  721

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVL-RCIQLGLLCVQDLAVHRPNMSAVVL  283
             S +I YAW  W+  +   L+D  I       +V+ RCIQ+G+LCVQDLA  RP MS +VL
Sbjct  722   SSLIGYAWHLWNTKRSKELVDACISDLTPNNDVINRCIQIGMLCVQDLASRRPKMSEIVL  781

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              LE+ ++TLP+P  P  T S++R+V+ +S    N +  SN +T++++ GR
Sbjct  782   MLESKSITLPLPMQPLIT-SIKRNVNRES--PKNAVDDSNDLTITMVEGR  828



>ref|XP_010928165.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=836

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/826 (47%), Positives = 538/826 (65%), Gaps = 24/826 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D +   Q I  + + + SA + F LGFFSP  +  RYVGIWY  + P+SVVWV NRE 
Sbjct  28    ATDTLTPDQSISGE-QTLKSAGDIFELGFFSPGNSKYRYVGIWYQSVSPRSVVWVGNREA  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ + +G F I  +G  +VLDG    IW++NSS  S+N+T  L ++  L++    G    
Sbjct  87    PLKNSSGNFTIGSDGNLLVLDGGGSIIWSSNSSAASNNSTAQLLDSGNLVLQLGHG----  142

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               +W+SF+ PTDTFLPGM++  D   GE ++FTSW +  +PS G +S+ +DP  S Q+ +
Sbjct  143   TVLWESFNHPTDTFLPGMKLSLDTKTGERQIFTSWKSPDDPSAGNYSLSLDPLGSAQVFM  202

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN--LYLEYKSSSSDLIMFKVDW  1882
             WEG    WRSG W+G+VF G  MR  ++YGF  + + +   +Y  +   +S L+ F + W
Sbjct  203   WEGTVPRWRSGQWNGQVFTGTTMRFLYIYGFKFVNDLNQGIMYFTFTQFNSSLLRFVLQW  262

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G E         ++W  +  +P ++C +Y  CG +  C+N  +    C C+ GF P   
Sbjct  263   DGVENSTILVGETQEWETVWAEPTNECEIYGKCGIYGVCNNGDTP--ICSCLKGFEPRSS  320

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
              +W+  NW+GGC RRT L CQ N +       DGF  V  +K+PD +     + +   C+
Sbjct  321   EEWSKGNWSGGCVRRTLLDCQLNRS------GDGFFRVAGVKVPDRSQWASTVLTEAACE  374

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTT  1342
               C  +CSC AY+     GI CM+W ++L+D+ Q  EG  + L+V+L  SEL   S +  
Sbjct  375   AACLNNCSCKAYS--FVSGIGCMIWAHDLIDIYQYPEGD-NDLYVKLPGSELGTDSKRWK  431

Query  1341  iivavsvvaavavlvivsIWLLCSRRAR--IRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             IIV VS +    ++  + +    ++R +  ++  ++       + +  E   DFS   + 
Sbjct  432   IIVTVSTLGGFFLITCIFLGWKYNKRIKDWLKMGRKKHDLLHNMLSKREARPDFSGPSEY  491

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
               E + G  ++L   +F  I+ ATD+FS +NKLG+GGFGHVYKG+LP GQEIAVKRLSR 
Sbjct  492   GEEVQEGKGAELPLHTFECISIATDNFSESNKLGEGGFGHVYKGMLPGGQEIAVKRLSRS  551

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ +IAKLQHRNLVRLLG CI+G+EK+L+YEYMPN SLD+F+F P K++ 
Sbjct  552   SGQGLEEFKNEVILIAKLQHRNLVRLLGYCIQGEEKILIYEYMPNGSLDAFLFRPVKQAL  611

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+W  RF IIE IARGLLYLHRDSRLRI+HRDLKASNILLD +MNPKISDFGMARIFGG+
Sbjct  612   LDWITRFKIIEGIARGLLYLHRDSRLRIVHRDLKASNILLDEDMNPKISDFGMARIFGGD  671

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF-RTDDHSGI  451
             QN+ANTNRVVGT GYM+PEYAMEGLFSVKSDVYSFG+L+LEIV+GRRN SF  T++   I
Sbjct  672   QNQANTNRVVGTLGYMSPEYAMEGLFSVKSDVYSFGILVLEIVTGRRNNSFHHTENSQNI  731

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + YAW+ W+E K + L+DPSI SSC  ++V+RCI +GLLCVQD A  RP++  ++L + +
Sbjct  732   VGYAWQLWNEDKAVELIDPSIRSSCSIRQVIRCIHIGLLCVQDRANDRPDIPTIILMMAS  791

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               +TLP+P+ PTYT       + DS     E  S++ +T++++ GR
Sbjct  792   QAITLPMPKQPTYTFEGSPH-ESDSMANKYESFSTSDVTITMLHGR  836



>ref|XP_010268928.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Nelumbo nucifera]
Length=852

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/819 (47%), Positives = 525/819 (64%), Gaps = 28/819 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E +VS N  F LGFFSPE ++NRYVGIWYN +   +VVWVANRE+P+ D +G   I  
Sbjct  49    DPETMVSPNSIFKLGFFSPENSTNRYVGIWYNNMSELTVVWVANREKPLTDSSGTVMIAN  108

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTI-----WQSFH  2206
             NG  VVLDG+   IW+T++S  S N++  L ++  L++ +      NNT+     WQSF 
Sbjct  109   NGNLVVLDGQKTVIWSTSASNISQNSSAQLLDSGNLVLQQGISNDGNNTVSGGILWQSFL  168

Query  2205  QPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYW  2032
              P+DTFLP M++  ++  GE +L T+W +  NPS G FS  + P   PQ+ IW G   YW
Sbjct  169   HPSDTFLPNMKLGTNVKTGEKQLLTAWKDQSNPSIGTFSAAVVPLNIPQVFIWNGSSPYW  228

Query  2031  RSGHWDGRVFLGVP-MRTDFVYGFDLITEND--NLYLEYKSSSSDLIM-FKVDWNGKEVQ  1864
             RSG W+ R+FLGVP M++ ++ GF+L +++     YL +   S  L   F +D  GK V+
Sbjct  229   RSGPWNNRIFLGVPDMQSVYLDGFNLDSDSKVGRAYLSFSFVSDPLFARFVMDPEGKLVE  288

Query  1863  QRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNAR  1684
              RW+E    W      P  +C +Y +CG F  C N+  + I C C  GF P    +W   
Sbjct  289   YRWDEENNNWFIKWSAPNTECDIYGNCGPFGSC-NALDSPI-CSCSEGFTPKSTEEWGKG  346

Query  1683  NWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceed  1504
             NW+GGC RRT LQC+++N+ G   + DGF +V  +K+PDFAD        + C+++C  +
Sbjct  347   NWSGGCVRRTQLQCERSNSTGEVGKADGFLKVNMMKVPDFADWSA-AADIKQCEEQCLSN  405

Query  1503  CSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavs  1324
             CSC AYA  +   I CM W   L+DM +   G G  L++RL  SE   K SK  II  V 
Sbjct  406   CSCTAYAFDI--NIGCMYWSGSLIDMQKFSSG-GVDLYIRLAYSEFGRKDSKVIIITTVV  462

Query  1323  vvaavavlvivsIWLLCSR-RARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
             +  A+  ++    W+  ++ R R + KK  ++        GE S+D S    L       
Sbjct  463   IGTAIIGVITYFSWMWTAKLRGRKKMKKNMDL--------GEVSTDLSDVGMLEDGIMTS  514

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
                +L  F    +A AT+ F  ANKLG+GGFG VYKG L  GQEIAVK+LS+ SGQGV+E
Sbjct  515   KRRELPAFELEDLAKATNYFDTANKLGEGGFGIVYKGTLLDGQEIAVKKLSKSSGQGVEE  574

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ VI++LQHRNLVRLLGCCI G+EKML+YEYM NKSLD+ +FDP KR+ L+W+KRF
Sbjct  575   FKNEVMVISQLQHRNLVRLLGCCIHGEEKMLIYEYMANKSLDAILFDPTKRTLLDWKKRF  634

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
             HIIE I RGLLYLHRDSRL+IIHRDLKASN+LLD E+NPKISDFGMARIFGG+Q+EANT 
Sbjct  635   HIIEGIGRGLLYLHRDSRLKIIHRDLKASNVLLDEELNPKISDFGMARIFGGSQDEANTK  694

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH-SGIIEYAWEQ  430
             RVVGTYGYM+PEYAMEG FS KSDV+SFG+LLLEIVSGR+N SF  ++  S ++ + W+ 
Sbjct  695   RVVGTYGYMSPEYAMEGRFSEKSDVFSFGILLLEIVSGRKNNSFFQEEAPSNLLGHVWKL  754

Query  429   WDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPV  250
             W EG  + ++DP++    +  EV+ CI +GLLCVQ+ A  RP MS+V+  L  +  TLP 
Sbjct  755   WSEGTILEMIDPALLEPSIQVEVMTCIHVGLLCVQEFAKDRPTMSSVMSMLSCEIATLPT  814

Query  249   PRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P+ P +      S D +S ++N+ + S N +++++   R
Sbjct  815   PKQPGFIQRQITS-DTESSSRNHNIFSVNDVSITICQAR  852



>gb|KFK40685.1| hypothetical protein AALP_AA2G028000 [Arabis alpina]
Length=832

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/832 (48%), Positives = 544/832 (65%), Gaps = 40/832 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G+ +++  E F LGFFSP+ ++ RYVGIWY  I P+++VWVANRE 
Sbjct  28    TSNSITRNQTIRD-GDTLINEQEIFELGFFSPKDSTLRYVGIWYKNIEPRTIVWVANRET  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD NGA  I  +G  VV++G+NV +W+TN    S+N    L  T +L++  +D  R +
Sbjct  87    PLLDNNGALKIADDGNLVVVNGQNVIVWSTNVRPKSNNIVAALLETGDLVLF-SDSDR-S  144

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N  W+SF+ PTDTFLPGM+V ++   GE++    W +  +PSPGR+++G+DP  + +IV+
Sbjct  145   NLYWESFNHPTDTFLPGMKVRVNPLIGENRALVPWKSYNDPSPGRYALGVDPIGALEIVV  204

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITEND---NLYLEY-KSSSSDLIM  1897
             WEG+   WRSG W+  +F GVP     T++++GF L +  D   ++Y  Y  S+SSDL+ 
Sbjct  205   WEGQTSKWRSGPWNSAIFTGVPDMFRVTNYIHGFKLSSPPDRDGSVYFTYVPSNSSDLLR  264

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVG  1720
             F + ++G   Q RWN   K W  +Q +P  QC  YN CG ++ CD+S   +   C CI G
Sbjct  265   FWIRFDGLVEQFRWNTDGKNWTLVQMKPGTQCERYNRCGNYSLCDDSKDFDSGKCSCIDG  324

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             F+P D NQW   N++GGC RR  L C K+N    G   DGF+ +K +KLPDF  +  ++ 
Sbjct  325   FDPVDQNQWGNGNFSGGCKRRVSLNCGKSNVTDKG---DGFKVLKGMKLPDFGSV-VSLN  380

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
             + E C+  C  DC CNAY      GI CM+W  +L+DM   ++G G+ + +RL  SEL  
Sbjct  381   NSETCRDVCVRDCLCNAYEHV--RGIGCMIWTGDLIDMEHFEQG-GNYINIRLAGSELGV  437

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRA---KKRDEIPRTELPTSGEFSSD  1189
             K  + + +  + V    A L+ + IW+L   + R++A    K+D      LP S      
Sbjct  438   K--EKSKLWIILVSVIGAFLLGLCIWMLWKFKKRLKAFLWMKKD------LPVS------  483

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
                  +  + G    + DL  FSF+S+A+AT  F+  NKLGQGGFG VYKG    G+EIA
Sbjct  484   -HINENRVLVGDQIDTPDLPIFSFNSVASATGDFAEENKLGQGGFGTVYKGNFS-GREIA  541

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLS +S QG++EF NE+ +IAKLQHRNLVRLLGCCIE +EKMLLYEYMPNKSLD F+F
Sbjct  542   VKRLSGKSKQGLEEFKNEILLIAKLQHRNLVRLLGCCIEDNEKMLLYEYMPNKSLDRFLF  601

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             D  +R  L+WRKR+ II  I RGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGM
Sbjct  602   DENRRGSLDWRKRWEIIGGITRGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGM  661

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIF   Q+ ANT RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSG +N SFR 
Sbjct  662   ARIFNYRQDHANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGSKNFSFRG  721

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
              +H  +I YAW  W +GK   L+DP++  +    E +RCI +G+LC QD  +HRPN+ +V
Sbjct  722   SEHGSLIGYAWHLWSQGKTRELIDPTVKDTEDINEAMRCIHVGMLCTQDSVIHRPNIGSV  781

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +L LE+    LP PR PT+  S   S +++      ++ S N IT++ I+GR
Sbjct  782   LLMLESPTSPLPRPRQPTF-HSFLNSGEIELNLDGQDVASVNDITLTTIIGR  832



>ref|XP_009123577.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Brassica rapa]
Length=843

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/819 (49%), Positives = 542/819 (66%), Gaps = 28/819 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG++++S  E F LGFFSP+ ++ RYVGIW+  I P+++VWVANRE P+ D NGA  I  
Sbjct  40    DGDSLISEGEIFELGFFSPKNSTLRYVGIWFKNIEPRTIVWVANRETPLSDHNGALKIAD  99

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  VV++G+N ++W+TN     +N   VL  T +L+ L +D  R +   W+SF+ PTDT
Sbjct  100   DGNLVVVNGQNNTVWSTNVHPKLNNNVAVLLETGDLV-LYSDSDR-DTKYWESFNNPTDT  157

Query  2190  FLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV +  S GE++ F  W +  +PSPGR+SMGIDP  + +IVIWEGE R WRSG W
Sbjct  158   FLPGMRVRVNPSMGENRAFIPWKSESDPSPGRYSMGIDPFGAIEIVIWEGETRKWRSGPW  217

Query  2016  DGRVFLGVP---MRTDFVYGFDLITEND---NLYLEY-KSSSSDLIMFKVDWNGKEVQQR  1858
             +  +F GVP     T++++GF L +  D   +++  Y  S+  DL+ F++ ++G   Q  
Sbjct  218   NSAIFTGVPDMFRVTNYIHGFKLSSPPDPDGSVFFTYVPSNKDDLLRFRIRFDGIVEQLM  277

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS-NGINCVCIVGFNPSDWNQWNARN  1681
             WN   + W  +Q +P+ +C  YN CG ++ C++S   +   C CI GF P+  NQWN  N
Sbjct  278   WNRDARNWTSLQVKPSKECEKYNRCGNYSVCNDSKDFDSGKCSCIFGFEPAYRNQWNKGN  337

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RR  L C ++       ++DGFR +K +K+PDF  +  ++ + E CK  C  DC
Sbjct  338   FSGGCKRRVSLNCSQSLF---AKKEDGFRVLKGMKVPDFGSV-VSINNSETCKDVCLRDC  393

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
             SCNAY   V  GI CM+W  +LVDM   + G G+ + +RL +SE+  K  +  II+   V
Sbjct  394   SCNAYE--VVPGIGCMIWTRDLVDMEHFEYG-GNNVNIRLAASEIGGKK-EIWIILFSIV  449

Query  1320  vaavavlvivsIWLLCSRRARIRAK--KRDEIPRTELPTSGEFS-SDFSAQCDLTVEGKA  1150
              A +  L  + IW+L   R  ++     +++    ++  + ++S    S+  ++ VE + 
Sbjct  450   GAFMLGLCCLCIWVLWKFRKNVKDIFCNKEDNALLDIRKNRDYSVKSLSSLNEVLVEDQV  509

Query  1149  GASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQ  970
               + DL  FSF+S+A+AT  FS  NKLGQGGFG VYKG    G+E+AVKRLS +S QG++
Sbjct  510   D-TPDLPTFSFNSVASATGDFSEENKLGQGGFGTVYKGKFSGGREMAVKRLSGKSKQGLE  568

Query  969   EFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKR  790
             EF NE+ +IAKLQHRNLVRLLGCCIE DEK+L+YEYMPN SLD F+FD +KR  L WRKR
Sbjct  569   EFKNEILLIAKLQHRNLVRLLGCCIENDEKILIYEYMPNNSLDRFLFDESKRMSLEWRKR  628

Query  789   FHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANT  610
             + II  IARGLLYLHRDSRL+IIHRDLKASNILLD EM PKISDFGMARIF   Q++ANT
Sbjct  629   WDIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDKEMKPKISDFGMARIFNYRQDQANT  688

Query  609   NRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQ  430
              RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSG +N SFR  +H  +I YAW  
Sbjct  689   IRVVGTYGYMAPEYAMEGMFSEKSDVYSFGVLILEIVSGSKNVSFRGSEHRSLIGYAWSL  748

Query  429   WDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPV  250
             W +GK   L+DP+I       E +RCI +G+LC QD  +HRPNM +V+L LE+    LP 
Sbjct  749   WSQGKTKELIDPTIKEIRDVNEAIRCIHVGMLCTQDSVIHRPNMGSVLLMLESQTSHLPR  808

Query  249   PRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             PR PT+ + +     V    +  E+ + N IT++ +VGR
Sbjct  809   PRQPTFHSFLNFGEIV----EGKEVATVNDITLTTVVGR  843



>ref|XP_010240981.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Nelumbo nucifera]
 ref|XP_010240982.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Nelumbo nucifera]
Length=847

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/830 (49%), Positives = 528/830 (64%), Gaps = 27/830 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             + D I   Q+IKD  E+IVSA  +F LGFFSP  +++RYVGIWYN I   +VVWVANR+ 
Sbjct  34    SIDIISHTQYIKDP-ESIVSAGSQFRLGFFSPTNSTDRYVGIWYNNIPEFTVVWVANRQE  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I  NG  VVL+G+   IW+TN S T+ ++   L N+  LI+   +    N
Sbjct  93    PLNDSSGTVMIDSNGNLVVLNGRKKVIWSTNVSNTAKSSIAQLSNSGNLILKNGNN---N  149

Query  2229  NTIWQSFHQPTDTFLPGMRVD--LSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
              T+W+SF  P+DTFLP MR+   L  GE +L TSW +   P  GR+S  I P   PQI I
Sbjct  150   ETVWESFLHPSDTFLPTMRLGTALKTGEKQLLTSWEDDSLPLIGRYSASIVPLDIPQIFI  209

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYKS-SSSDLIMFKV  1888
             W G   +WRSG W+ R+F+GVP M + ++ GF+L    +  + YL +   S  D + F +
Sbjct  210   WNGSSPHWRSGPWNNRIFIGVPDMHSVYLDGFNLEANPKEGSAYLTFSYVSKPDFMRFVL  269

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             +  GK V+ RWN+ +  W      P  +C VY  CG F  C N++ + I C C+ GF P 
Sbjct  270   NSQGKLVEYRWNKRKNDWFVHWSVPNTECDVYGKCGPFGSC-NAADSPI-CSCLKGFTPK  327

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
                +W+  NW+ GC RRT LQCQ+N++ G   + DGF  +K +K+PDFAD      +  +
Sbjct  328   STEEWSMGNWSSGCERRTQLQCQRNSSNGEKEKADGFLALKMMKVPDFADWSA---ADHE  384

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL----DN  1360
              + K +   +C+  A      I CM W   L+D+ +   G G  L++RL  SEL    ++
Sbjct  385   KQCKEQCLNNCSCIAYAFDDNIGCMSWSRNLIDLQKFSNG-GVDLYIRLAHSELGAGRND  443

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
               + TT +V V VV     ++ V I+ L    A  R KK+ +  R  L   GE S + S 
Sbjct  444   PKAITTTVVLVVVVVIGTTIMAVFIYFLLRWMATQRGKKKKK--RVLL---GEASKELSD  498

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
                L    K G S DL FF    +A AT++F  ANKLG GGFG VYKG L  GQEIAVK+
Sbjct  499   IDMLEDRIKQGKSIDLPFFYLEELAIATNNFDAANKLGVGGFGSVYKGKLWGGQEIAVKK  558

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS+ SGQG++EF NE+ +I+KLQHRNLVRLLGCC  G+EKML+YEYM NKSLD+ +FDPA
Sbjct  559   LSKSSGQGLEEFKNEVVLISKLQHRNLVRLLGCCTHGEEKMLIYEYMANKSLDALLFDPA  618

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             KR+ L+W+KRFHIIE + RGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMARI
Sbjct  619   KRTLLDWKKRFHIIEGVGRGLLYLHRDSRLKIIHRDLKASNILLDKEMNPKISDFGMARI  678

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD-D  463
             FGG+Q+E NT RVVGTYGYM+PEYAMEG FS KSDV+S+GVLLLEIVSGRRN+SF    D
Sbjct  679   FGGSQDEENTKRVVGTYGYMSPEYAMEGRFSEKSDVFSYGVLLLEIVSGRRNSSFYLHPD  738

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
              S ++ +AW+ W+E K   L+DP +       E+LRCI +GLLCVQ+ A  RP MS +V 
Sbjct  739   PSNLLGHAWKLWNEEKIWELIDPILGERSSQVEILRCIHVGLLCVQEFAKDRPTMSNIVS  798

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              L  +  TLP P+ P +    + S D DS   N  + S NSI++++  GR
Sbjct  799   MLSCEISTLPAPKQPGFIER-QISSDGDSSQNNRSVCSLNSISITMTEGR  847



>ref|XP_009385294.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Musa acuminata subsp. malaccensis]
Length=837

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/823 (47%), Positives = 531/823 (65%), Gaps = 25/823 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D ++   +I +DGE ++SA E F LGFFSP  +  RY+GIWY      +V+WVANRE 
Sbjct  26    AKDTLELDGYI-EDGETLISAGEIFELGFFSPGSSKYRYIGIWYYNFSTDTVLWVANREA  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   + G+G  VVL+G    +W++N S++S+ +T+ L +   L++  T      
Sbjct  85    PVHDTSGRLAVGGDGNLVVLNGSRSVLWSSNVSLSSNASTVQLLDDGNLVLNNT-----G  139

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                WQSF  PTDT+LPGM+V  DL+   ++  TSW +S +P+PG +SMG+DP  S QI +
Sbjct  140   RVAWQSFENPTDTYLPGMKVGLDLTTNVNQYITSWKSSDDPAPGNYSMGVDPNRSTQIFV  199

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG W+G+VF+G+  M   ++YGF L        +Y  Y + +S    + + 
Sbjct  200   WEGTKPRWRSGRWNGQVFIGIQNMVPTYIYGFKLSNFELEKKMYFYYNAFNSSH-RYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             W G E    W +  K W     QP   C +YN CG +  C  +  N   C C+ G+ P+ 
Sbjct  259   WEGIEKHLTWKDDTKFWSTFWAQPITDCELYNKCGNYGSC--TDENTPICSCLKGYVPAV  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGA-EKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +W++ NWT GC RRTPLQC++N++ G G+ + DGF +++ +KLPD +D    +   + 
Sbjct  317   EAEWSSGNWTSGCVRRTPLQCERNSSGGAGSVQTDGFWKMEGVKLPDLSDWASGVVDEDG  376

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C  +CSC AYA     GI C++W  +LVD+     G G+ +++RL +SE+  K  K
Sbjct  377   CRAACLGNCSCQAYAYVT--GIGCLVWGVDLVDIHIFSSG-GNDMYLRLAASEIQTKKKK  433

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE--IPRTELPTSGEFSSDFSAQC  1174
             +  ++ + V+A V  L  + ++  C +R R   ++R    I   E    G+  ++     
Sbjct  434   S-FVILIVVLAVVLSLGCIYLFFKCKKRIRAFYRRRGGGGIVSVEPNRDGD-RAEGGVSF  491

Query  1173  DLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
              +  E K     +L  FSF SI A+T +F+LAN LG+GGFG VYKG LP GQE+A+KRLS
Sbjct  492   RIPDESKDQKCQELPLFSFDSIVASTSNFALANLLGEGGFGPVYKGTLPGGQEVALKRLS  551

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             R SGQG  EF NE+ ++AKLQHRNLVRLLGCCI G+E++L+YEYMPN+SL++F+FDP K+
Sbjct  552   RSSGQGETEFKNEVILMAKLQHRNLVRLLGCCIHGEERILVYEYMPNRSLNAFLFDPRKK  611

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
               L W+ R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDFGMARIFG
Sbjct  612   GLLGWKTRYDIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFG  671

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-  457
              + NE NT RVVGTYGYM+PEYAM+G+FSVKSDVYSFGVLLLEIVSGR+N+SF   D S 
Sbjct  672   SDDNETNTKRVVGTYGYMSPEYAMQGVFSVKSDVYSFGVLLLEIVSGRKNSSFAHQDSSL  731

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              ++  AW+ W+E   M  +DP+I  SC P++V RC+ +GLLCVQD    RP MS+VV+ L
Sbjct  732   NLLGSAWKLWNEDNVMEFVDPAIRDSCSPRQVSRCVNVGLLCVQDRPNDRPTMSSVVIML  791

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPS-SNSITM  151
             E      P P+ PT++A  R   D +S      + S SNSIT+
Sbjct  792   EGGTAAYPQPKQPTFSAE-RNPSDTESSTFGLRVASASNSITL  833



>ref|XP_010928191.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=838

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/830 (48%), Positives = 545/830 (66%), Gaps = 28/830 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I+ GQ + +DG+ ++SA EKF LGFFSP  +SNRYVGIWY+     +VVWVANRER
Sbjct  26    AIDTIKPGQPL-EDGKTLISAGEKFELGFFSPGKSSNRYVGIWYHNFSINTVVWVANRER  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G+  I  +G  VVLDG    +W++N+S  ++N+ + L +   L++  +      
Sbjct  85    PVRDHSGSLAIGYDGNLVVLDGTKSIVWSSNTSTATNNSLVQLMDDGNLVLNNS-----G  139

Query  2229  NTIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +  WQSF  PTDT++PGM+  +DL    ++  TSWT+  +P+PG FS+G+DP AS QI +
Sbjct  140   SVAWQSFDNPTDTYMPGMKAGLDLRTHVNQKLTSWTSEDDPAPGNFSLGMDPSASTQIFV  199

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT--ENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG W+G+VF+GV  M   +VYGF LI   +   +Y  Y   +S    + + 
Sbjct  200   WEGTKPRWRSGRWNGQVFIGVQNMLPTYVYGFRLINIEQEQKMYFYYNEFNSSH-RYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             W+G      W      W +   QP  +C +YN CG++  C + ++    C C+ GF P+ 
Sbjct  259   WDGIGRHLIWRNDTNDWYQFWAQPVTECEIYNKCGKYGSCTDGATP--ICSCLRGFVPAS  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQK-NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
                W+  NW+ GC RRTPL C + NN+E  G   DGF ++  +KLPD +D  ++    E 
Sbjct  317   SEDWSDGNWSSGCVRRTPLGCGRGNNSEEAGG--DGFWKLGGVKLPDISDWKQDAVDIEG  374

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+++C  +CSC AYA     GI C++W  +L+D+     G G+ L++RL  SELD KS+K
Sbjct  375   CEERCLGNCSCTAYA--YVSGIGCLIWGVDLLDIHLFSSG-GNDLYLRLAGSELDKKSNK  431

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTS--GEFSSDFSAQC  1174
             T II+ V V   +++  I  +W  C  R +   K+R    R  + ++   E  +D+SA  
Sbjct  432   TFIIIIVPVAVILSLGCIYLLWR-CKNRIKELFKQRLAGERGLMYSTRGQERLTDYSASI  490

Query  1173  DLTV--EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
                +  EG  G   +L  +SF S+ AAT SFS +N +G+GGFG VYKG+LP GQEIAVKR
Sbjct  491   GKRIGDEGSDGKCPELSLWSFDSVVAATKSFSDSNFIGEGGFGPVYKGILPEGQEIAVKR  550

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSR S QG+ E  NE+ +IAKLQHRNLVRLLGCCI+ +EK+L+YEYMPN SLD+F+FDP 
Sbjct  551   LSRSSMQGLDELKNEVMLIAKLQHRNLVRLLGCCIQEEEKILIYEYMPNSSLDAFLFDPI  610

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             K   L+W+ R +IIE IARGLLYLHRDSRLR+IHRDLKASNILLD EMNPKISDFGMARI
Sbjct  611   KTGLLDWKTRHNIIEGIARGLLYLHRDSRLRVIHRDLKASNILLDEEMNPKISDFGMARI  670

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FG + NE NT RVVGT+GYM+PEYAM+GLFSVKSDVYSFGVLLLEIVSG++N+++R  + 
Sbjct  671   FGNDDNETNTKRVVGTFGYMSPEYAMQGLFSVKSDVYSFGVLLLEIVSGKKNSTYRHPEL  730

Query  459   S-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             +  +I  AW+ W+E + M  +DP I  SC  ++V RC+ +GLLCVQD    RP M++VV+
Sbjct  731   AMNLIASAWKLWNEDRVMEFVDPIIRDSCSRRQVSRCVNVGLLCVQDRPNDRPTMASVVI  790

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              L ++  + P PR P +T     S + DS   +  + S+N+ ++++I GR
Sbjct  791   MLGSETSSHPPPRQPIFTVESGYS-ETDSSTVDLNIMSANA-SITIIDGR  838



>gb|AID21611.1| At4g21390p-like protein [Arabidopsis halleri]
Length=686

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/699 (53%), Positives = 483/699 (69%), Gaps = 32/699 (5%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEK-RYWRSGHWDGRVF  2002
             +RV+   G++  F SW +  +PSPG +S+G+DP  +P+IV+W+G K R WRSG W+  +F
Sbjct  3     VRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAPEIVLWKGNKTRKWRSGQWNSAIF  62

Query  2001  LGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNESR  1843
              G+P   + T+++YGF L +   E  ++Y  Y  S SS L+ FKV +NG E + RWNE+ 
Sbjct  63    TGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDSSMLLRFKVLYNGTEEELRWNETL  122

Query  1842  KQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCT  1663
             K+W K Q +P  +C  YN CG+F  CD   SNGI C CI G+      Q +  NW+ GC 
Sbjct  123   KKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-CSCIHGYE-----QVSVGNWSRGCR  176

Query  1662  RRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYA  1483
             RRTPL+C++N + G    +D F  +K +KLPDF     ++  P DCK++C  +CSCNAY+
Sbjct  177   RRTPLKCERNISVG----EDEFLTLKSVKLPDFEIPAHDLVDPADCKERCLRNCSCNAYS  232

Query  1482  PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-DNKSSKTTiivavsvvaava  1306
               + GGI CM+W  +LVD+ Q + G GS+L +RL  SE+ +NK +K  +IVAV V   + 
Sbjct  233   --LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLADSEIGENKKTKIAVIVAVLVGVVLV  289

Query  1305  vlvivsIWLLCSRR----ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASS  1138
              ++ + +W    ++    A         +   ++  S E +S FS   D+ +EGKA  +S
Sbjct  290   GILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMNKSKETTSAFSGSVDIMIEGKAVNTS  349

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTN  958
             +L  F  ++IA AT+ F   N+LG+GGFG VYKGVL  G+EIAVKRLS +SGQGV EF N
Sbjct  350   ELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKN  409

Query  957   ELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHII  778
             E+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSLD F+FD  K+  ++W+ RF II
Sbjct  410   EIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQGLIDWKLRFSII  469

Query  777   EEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVV  598
             E IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNPKISDFGMARIFGGNQNEANT RVV
Sbjct  470   EGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVV  529

Query  597   GTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEG  418
             GTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+RNTS R+ +H  +I YAW  +  G
Sbjct  530   GTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRNTSLRSSEHGSLIGYAWYLYTHG  589

Query  417   KPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPP  238
             +   L+DP I  +C  +E LRCI + +LCVQD A  RPNM+AV+L LE+D  TL  PR P
Sbjct  590   RSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAERPNMAAVLLMLESDTATLAAPRQP  649

Query  237   TYTASMRRSVDV----DSWNQNNELPSSNSITMSVIVGR  133
             T+T++ R S+DV    DS  Q   + SSN IT +V++GR
Sbjct  650   TFTSTRRNSIDVNFALDSSQQ--YIVSSNEITSTVVLGR  686



>gb|AID21597.1| At4g21390p-like protein [Arabidopsis halleri]
Length=686

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/699 (53%), Positives = 484/699 (69%), Gaps = 32/699 (5%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEK-RYWRSGHWDGRVF  2002
             +RV+   G++  F SW +  +PSPG +S+G+DP  +P+IV+W+G K R WRSG W+  +F
Sbjct  3     VRVNPQTGDNHAFVSWRSETDPSPGNYSLGVDPSGAPEIVLWKGNKTRKWRSGQWNSAIF  62

Query  2001  LGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNESR  1843
              G+P   + T+++YGF L +   E  ++Y  Y  S SS L+ FKV +NG E + RWNE+ 
Sbjct  63    TGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSDSSMLLRFKVLYNGTEEELRWNETL  122

Query  1842  KQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCT  1663
             K+W K Q +P  +C  YN CG+F  CD   SNGI C CI G+      Q +  NW+ GC 
Sbjct  123   KKWTKFQSEPDSECDQYNRCGKFGICDMKGSNGI-CSCIHGYE-----QVSVGNWSRGCR  176

Query  1662  RRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYA  1483
             RRTPL+C++N + G    +D F  +K +KLPDF     ++  P DC+++C  +CSCNAY+
Sbjct  177   RRTPLKCERNISVG----EDEFLTLKSVKLPDFEIPAHDLVDPADCRERCLRNCSCNAYS  232

Query  1482  PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-DNKSSKTTiivavsvvaava  1306
               + GGI CM+W  +LVD+ Q + G GS+L +RL  SE+ +NK +K  +IVAV V   + 
Sbjct  233   --LVGGIGCMIWNQDLVDLQQFEAG-GSSLHIRLADSEIGENKKTKIAVIVAVLVGVVLV  289

Query  1305  vlvivsIWLLCSRR----ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASS  1138
              ++ + +W    ++    A         +   ++  S E +S FS   D+ +EGKA  +S
Sbjct  290   GILALLLWRFKRKKDVSGAYCGKNTDTSVVVADMNKSKETTSAFSGSVDIMIEGKAVNTS  349

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTN  958
             +L  F  ++IA AT+ F   N+LG+GGFG VYKGVL  G+EIAVKRLS +SGQGV EF N
Sbjct  350   ELPVFCLNAIAVATNDFCKDNELGRGGFGPVYKGVLEDGREIAVKRLSGKSGQGVDEFKN  409

Query  957   ELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHII  778
             E+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSLD F+FD  K++ ++W+ RF II
Sbjct  410   EIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFLFDETKQALIDWKLRFSII  469

Query  777   EEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVV  598
             E IARGLLYLHRDSRLRIIHRDLK SN+LLD EMNPKISDFGMARIFGGNQNEANT RVV
Sbjct  470   EGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEANTVRVV  529

Query  597   GTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEG  418
             GTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+RNTS R+ +H  +I YAW  +  G
Sbjct  530   GTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRNTSLRSSEHGSLIGYAWYLYTHG  589

Query  417   KPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPP  238
             +   L+DP I  +C  +E LRCI + +LCVQD A  RPNM+AV+L LE+D  TL  PR P
Sbjct  590   RSEELVDPKIRVTCNKREALRCIHVAMLCVQDSAAERPNMAAVLLMLESDTATLAAPRQP  649

Query  237   TYTASMRRSVDV----DSWNQNNELPSSNSITMSVIVGR  133
             T+T++ R S+DV    DS  Q   + SSN IT +V++GR
Sbjct  650   TFTSTRRNSIDVNFALDSSQQ--YIVSSNEITSTVVLGR  686



>ref|XP_009398187.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Musa acuminata subsp. malaccensis]
Length=846

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/836 (46%), Positives = 538/836 (64%), Gaps = 32/836 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D I  GQ +    + +++    F LGFF+P  + N YVGIWY ++  Q+VVWVANR+ 
Sbjct  26    ASDTISIGQSLSGS-QTMIAKEGNFELGFFTPGNSGNYYVGIWYKKLPGQTVVWVANRDN  84

Query  2409  PILDKNGA-FGITGNGTFVVLDGKnv-----siwntnssvtssnatmVLRNTSELIILKT  2248
             P+ + +GA   ++ +G  VVL+   V     +   + S+ + S+ T+ L +T  L++   
Sbjct  85    PVSNASGAELRLSDDGNLVVLNSFKVPVWSSNSTISTSNASLSSTTLQLLDTGNLVLQDG  144

Query  2247  DGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
              G     T+WQSF  PT TFLPGM++ L  + G++ LFTSW +  +PS G +++G+DP  
Sbjct  145   GG----GTLWQSFDHPTHTFLPGMKLSLNTTTGKALLFTSWKSPDDPSAGNYTLGLDPNG  200

Query  2073  SPQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN--LYLEYKSSSSDLI  1900
             S QI IW+     WRSG W+G  F+G  MR+ ++YGFD  T+      Y  Y   ++ L+
Sbjct  201   SAQIFIWDRGVPRWRSGQWNGHRFIGTVMRSLYIYGFDYETDESQGIAYYTYTPHNASLV  260

Query  1899  MFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
              F ++W+G E      +  +QW  +  QP +QC VY  CG +  C +  +    C C+ G
Sbjct  261   RFVMEWDGMERTFMQVQETRQWEIVWGQPINQCEVYGMCGVYGTCSDDGTT-TTCSCLRG  319

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             F P    +W+  NWT GC R+TPL CQ N++    + +DGF  +   KLPD +D    + 
Sbjct  320   FEPRSSTEWSDGNWTSGCARKTPLLCQLNSS----SNEDGFFTLPGAKLPDHSDWASTIG  375

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLD-EGSGSTLFVRLHSSELD  1363
             S   C++ C  +CSC AYA      I C+LW ++L+D+ Q +    G  L V+L +S+LD
Sbjct  376   SESGCQEACSSNCSCRAYAYAA-SDIGCLLWGHDLIDIYQFEFPQDGYDLHVKLAASDLD  434

Query  1362  NKSSKTTiivavsvvaavavlvivs----IWLLCSRRARIRAKKRDEIPRTELPTSGEFS  1195
               S KT   V V+V  A+ +L+ +     +W     RA++  KK+ +   T L  SGE  
Sbjct  435   AASDKTKSRVIVAVGCALGLLLAIIICFFLWWKYGSRAKVSWKKKRQQENTVLHPSGEVV  494

Query  1194  SDFSA-QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S+FS+   + T EGKA        F+F  IA AT  FS +NKLG+GGFGHVYKG LP GQ
Sbjct  495   SEFSSIYGEETQEGKASEP----LFTFDCIATATGYFSDSNKLGEGGFGHVYKGTLPGGQ  550

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             E+AVKRLSR SGQG++EF NE+ +IAKLQHRNLV+LLGCCI+G+EK+L+YEY+PNKSLD+
Sbjct  551   EVAVKRLSRSSGQGLEEFKNEVILIAKLQHRNLVKLLGCCIQGEEKILIYEYLPNKSLDA  610

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
              +FD +K+  L+W+KRF+IIE IARGLLYLHRDSRLRI+HRDLKASNILLD  MNPKISD
Sbjct  611   IIFDTSKKELLDWKKRFNIIEGIARGLLYLHRDSRLRIVHRDLKASNILLDENMNPKISD  670

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FGMARIFG ++N+ NTNRVVGT+GYM+PEYAMEGLFSV+SDVYSFG+L+LEI++ RRN+S
Sbjct  671   FGMARIFGADENQGNTNRVVGTFGYMSPEYAMEGLFSVRSDVYSFGILVLEILTARRNSS  730

Query  477   F-RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             F R ++   I+ YAW+ W+E + + L+DP+I S+ +  + LRC+ + LLCVQD A  RP+
Sbjct  731   FHRMENAVNIVGYAWQLWNEDRAVELIDPTIRSASMMSQALRCVHIALLCVQDRASDRPD  790

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + AV+  + + +  LP+PR P + A     V         E  S+  +T++++ GR
Sbjct  791   IDAVIRMMGSGSGPLPMPRQPMFVAVGSTDVTETKIANKYESFSTYDVTITMVQGR  846



>gb|KFK28718.1| hypothetical protein AALP_AA7G038000 [Arabis alpina]
Length=764

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/852 (46%), Positives = 532/852 (62%), Gaps = 122/852 (14%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A + I++G++++D  + + ++S  + F LGFFSP  +++RY+GIWY  I  ++VVWVANR
Sbjct  2     ATNTIKRGEFLRDGLNHKPLISPLKTFELGFFSPGVSTHRYLGIWYGNIEDKAVVWVANR  61

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi---wntnssvtssnatmVLRNTSELIILKTD  2245
               P+ DK+G   I   G  V+ DG N+++    +T SS  + N    + +T    + +TD
Sbjct  62    ANPLSDKSGVLTINNEGNLVLQDGNNITVWSSSSTESSSNNKNRVGAIHDTGNFELSETD  121

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
               R    +W+SF+ PTDTFLP MRV +++  G++  F SW +  +PSPG +++G+DP  +
Sbjct  122   TKR---VLWESFNHPTDTFLPQMRVRVNSKTGDNLAFVSWRSENDPSPGNYTLGVDPTGA  178

Query  2070  PQIVIWEGEK-RYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEYKSSS  1912
             P+IV+WE  K R WRSG W+  VF G+P   + T+++YGF L +   E  ++Y  Y  S 
Sbjct  179   PEIVLWERNKTRKWRSGQWNSAVFTGIPNMSLLTNYLYGFKLSSPPDETGSVYFTYVPSD  238

Query  1911  SDLIM-FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
               +++ FKV +NG E + RWNES K+W K Q +P                          
Sbjct  239   PTMLLRFKVLYNGTEEELRWNESVKKWTKFQSEPD-------------------------  273

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
                             RNW+ GC R+TPL+C++N + G    +D F  +K +KLPDF   
Sbjct  274   ----------------RNWSRGCRRKTPLKCERNVSVG----EDEFLTLKFVKLPDFETP  313

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
             + N+  P                              + LVD+ Q  E +GS+L +R+ +
Sbjct  314   EHNLVVP-----------------------------EDYLVDLQQF-EAAGSSLHIRVAN  343

Query  1374  SELD-NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRT--------  1222
             SE++  K SK  +IV V V   +  +  + +W         R K++ ++  T        
Sbjct  344   SEIEEKKKSKIAVIVGVLVGVILLGIFALLLW---------RFKRKKDVSGTYCCKNTDT  394

Query  1221  -----ELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGG  1057
                  ++  + E S+ FS   D+ +EGKA  +S+L  FS S I AATD F   N+LG+GG
Sbjct  395   SVVVVDVSKAKETSTPFSGSVDIMIEGKAVNTSELPVFSLSDIVAATDDFCRENELGRGG  454

Query  1056  FGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKM  877
             FG VYKGVL  GQEIAVKRLS +SGQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKM
Sbjct  455   FGPVYKGVLEDGQEIAVKRLSGKSGQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKM  514

Query  876   LLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASN  697
             L+YEYMPNKSLD F+FD  K+  ++W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN
Sbjct  515   LVYEYMPNKSLDFFIFDEMKQDMVDWKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSN  574

Query  696   ILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV  517
             +LLD EMNPKISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGV
Sbjct  575   VLLDAEMNPKISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGV  634

Query  516   LLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGL  337
             LLLEIVSG+RNTS R+ +H  +I YAW  +  G+   L+DP I  +C  +E LRCI + +
Sbjct  635   LLLEIVSGKRNTSLRSTEHGSLIGYAWFLYTHGRSEELVDPKIRITCNKREALRCIHVAM  694

Query  336   LCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDV----DSWNQNNELPS  169
             LCVQD A  RPNM++V+L LE+D  TL VPR PT+T++ R S+DV    DS +Q   L S
Sbjct  695   LCVQDSAAERPNMASVLLMLESDTATLAVPRQPTFTSTRRNSIDVNFALDSSHQ--YLVS  752

Query  168   SNSITMSVIVGR  133
             SN IT +V++GR
Sbjct  753   SNEITSTVVLGR  764



>ref|XP_008803875.1| PREDICTED: uncharacterized protein LOC103717326 [Phoenix dactylifera]
Length=2211

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/798 (51%), Positives = 523/798 (66%), Gaps = 26/798 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A   +  GQ I D GE ++SA E F LGFFSP  + NRYVGIWY      +V+WVANRE 
Sbjct  28    AKHTLTLGQSISD-GETLISAGEIFELGFFSPGSSKNRYVGIWYYNFSTDTVLWVANREI  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I  NG  VVL+G    IW++N+S++S+ +T+ L +T  L++L + G    
Sbjct  87    PVPDHSGTLAIAENGNLVVLNGTKSVIWSSNASMSSNESTVQLMDTGNLVLLNSSG----  142

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +T WQSF  PTDT+LPGM+V  DL    ++LF SW +  +P+ G FSMGIDPR S QI +
Sbjct  143   STAWQSFDHPTDTYLPGMKVGLDLWTNVNQLFFSWKSKDDPAKGNFSMGIDPRRSTQIFL  202

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG W+G+VF+G+  M   +VYGF L    +   +Y  Y   +S    + + 
Sbjct  203   WEGTKPRWRSGRWNGQVFIGIQNMVATYVYGFKLSNFQQEQKMYFYYNEFNSSH-RYVLT  261

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             W+G E    WN ++  W +   QP  +C  YN CG    C  +  N   C C+ GF P+ 
Sbjct  262   WDGIEEHLIWNGTKLDWYQFWAQPITECEFYNKCGNCGSC--TDGNTPICSCLKGFVPAV  319

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RRTPLQC++N+T G  AE DGF +++ +KLPD +D D ++     C
Sbjct  320   DREWNGGNWTSGCVRRTPLQCERNSTSGEKAEADGFWKLQGVKLPDLSDWDSDVADENGC  379

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             +  C  +CSC AYA     GI C++W  +LVD+     G G+ +++RL  SELD K  K 
Sbjct  380   QTSCLSNCSCKAYAYVT--GIGCLMWGVDLVDIHVFSSG-GNDMYLRLAGSELD-KHKKI  435

Query  1344  TiivavsvvaavavlvivsIWLL--CSRRAR--IRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
                  V ++    V V+  I++L  C RR R   + +K   + R +  +    S++FS  
Sbjct  436   PGYAIVIIIVLTVVFVLGCIYVLWKCRRRIREYFKGRKSQGVGRVDQSSGRGASTEFS--  493

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
               +  E K G   +L   SF SI  AT +FS  N LG+GGFG VYKG LP GQEIAVKRL
Sbjct  494   --VAEERKDGERQELPLLSFDSILGATGNFSSLNLLGEGGFGPVYKGNLPGGQEIAVKRL  551

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             SR SGQG++EF NE+ +IAKLQHRNLVRLLGCCIEG+EK+L+YEYM N+SLD+F+FD  K
Sbjct  552   SRSSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIEGEEKILIYEYMRNRSLDAFLFDSRK  611

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +  L+W+ R++IIE IARGLLYLHRDSRLR+IHRDLKASNILLD EMNPKISDFGMARIF
Sbjct  612   KGLLDWKTRYNIIEGIARGLLYLHRDSRLRVIHRDLKASNILLDEEMNPKISDFGMARIF  671

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             G + NE NT RVVGTYGYM+PEYAM+G+FSVKSDVYSFGVLLLEIVSGR+N+++   + S
Sbjct  672   GNDDNETNTKRVVGTYGYMSPEYAMQGVFSVKSDVYSFGVLLLEIVSGRKNSTYHHPELS  731

Query  456   -GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
               ++ YAW+ W+E   M  +DPSI  SC   EV RCI +GLLCVQD A  RP MS+VV+ 
Sbjct  732   LNLLGYAWKSWNEDNVMEFVDPSIRDSCSLSEVSRCINVGLLCVQDRANDRPTMSSVVIM  791

Query  279   LETDNVTLPVPRPPTYTA  226
             LE      P PR PT+ A
Sbjct  792   LERGTTANPQPRQPTFAA  809


 Score =   568 bits (1465),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 348/793 (44%), Positives = 476/793 (60%), Gaps = 42/793 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFS-PEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             D++  G+ I  + E++VS    F LGF    +  +N Y+ I Y  I  +++VWVANRE+P
Sbjct  1279  DRLSPGESISLN-ESLVSDGGAFALGFAHLGDSPANLYLVIRYYNIAQETIVWVANREKP  1337

Query  2406  ILDKNGAFGITGNGTFVVL--DGKn--vsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             I D +    I+ +   +V+  +G+    S  ++     +S    VL+N   L++    G 
Sbjct  1338  IDDSSATLKISNDSNLLVMGSNGRIFWSSNVSSTGPSKNSTMVAVLKNNGNLVL----GE  1393

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                  +WQSF  P D FLPGM+++LS    E+   TSW ++ +PSPG FS G DP    Q
Sbjct  1394  GSRTILWQSFDHPADIFLPGMKLELSYKTHEANRLTSWKDAQDPSPGNFSFGADPNTFLQ  1453

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPM-RTDFVYGFDLITENDNLYLEYKSSS--SDLIMF  1894
                W+G + YWRS  W GR+F G  +  + ++    +    D +Y+   S S  S   M+
Sbjct  1454  FFTWQGSEPYWRSTVWTGRLFSGAQVTNSSYISYLAITAPEDEVYIISFSLSDESSNAMY  1513

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
             K+D  G+     W+     W     QP   C  Y HCG F  CD++ S    C C+ GF 
Sbjct  1514  KLDHTGQLQFLGWDYGLNNWSIAAAQPHSMCVRYGHCGPFGCCDSTESVP-TCKCLEGFE  1572

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             P   + WN  N++GGC RRT L+C      G G   D F  +  ++LPD     RN +S 
Sbjct  1573  PKFPSDWNGGNFSGGCVRRTALEC------GNG---DRFLILGDMRLPDKFLFLRN-KSA  1622

Query  1533  edckkkceedCSCNAYA----PPVPGGIS-CMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
              +C+ +C  +CSCNAYA        G +S C++W  EL+D  ++    G  L++R+  SE
Sbjct  1623  GECEAECLANCSCNAYAYSNLITESGNVSRCLVWMGELIDA-EMGAIGGENLYLRVVGSE  1681

Query  1368  LD----NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRT----ELP  1213
             LD      S +   I+ +    + A+L I   +L    R +I+   +D   +     +L 
Sbjct  1682  LDFSQPTGSKRNRRIIIIVAPISGAILSIALSYLAWKFRDKIKGIWKDGKNKGRLLGDLN  1741

Query  1212  TSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGV  1033
              S +F  D S       EGK G   ++   +F SIA AT++FS ++KLG+GGFG VY+G 
Sbjct  1742  LSTQFPKDLSGSSGFG-EGKPGHGPEIPLINFESIAVATNNFSDSHKLGRGGFGKVYRGK  1800

Query  1032  LPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPN  853
             LP GQEIAVKRLSR SGQG++EF NE+ +IA+LQHRNLVRLLGCC++G+EK+L+YEYMPN
Sbjct  1801  LPRGQEIAVKRLSRNSGQGLKEFKNEVLLIARLQHRNLVRLLGCCMQGEEKLLIYEYMPN  1860

Query  852   KSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMN  673
             KSLD+F+FDPAK+  L+W KRF+II+ IARGLLYLH+DSRLRIIHRDLKASN+LLD + N
Sbjct  1861  KSLDAFLFDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRLRIIHRDLKASNVLLDQDKN  1920

Query  672   PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSG  493
             PKISDFG+ARIFGGNQNE NTNRVVGTYGYM+PEYAM GLFSVKSDV+SFGVL+LEIVS 
Sbjct  1921  PKISDFGVARIFGGNQNEVNTNRVVGTYGYMSPEYAMGGLFSVKSDVHSFGVLILEIVSS  1980

Query  492   RRNTSFRTD-DHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLA  316
              RN+SF    D   ++ YAW+ W EGK M+L DPS+   C     L  I  G   ++   
Sbjct  1981  SRNSSFDLAMDSPSLLAYAWKLWKEGKAMDLADPSLVELCSDNYWLLGINCGNKRLRRTI  2040

Query  315   VHRPNMSAVVLFL  277
             V   ++S  +L +
Sbjct  2041  VIVASVSGAILLI  2053


 Score =   185 bits (470),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 193/377 (51%), Gaps = 26/377 (7%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFS-PEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             D++  G+ I  + E++VS    F LGF    +  +N Y+ I Y  I  +++VWVANRE+P
Sbjct  872   DRLSPGESISLN-ESLVSDGGAFALGFAHLGDSPANLYLVIRYYNIAQETIVWVANREKP  930

Query  2406  ILDKNGAFGITGNGTFVVL--DGKn--vsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             I D +    I+ +   +V+  +G+    S  ++     +S    VL+N   L++    G 
Sbjct  931   IDDSSATLKISNDSNLLVMGSNGRIFWSSNVSSTGPSKNSTMVAVLKNNGNLVL----GE  986

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                  +WQSF  P D FLPGM+++LS    E+   TSW ++ +PSPG FS G DP    Q
Sbjct  987   GSRTILWQSFDHPADIFLPGMKLELSYKTHEANRLTSWKDAQDPSPGNFSFGADPNTFLQ  1046

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPM-RTDFVYGFDLITENDNLYLEYKSSS--SDLIMF  1894
                W+G + YWRS  W GR+F G  +  + ++    +    D +Y+   S S  S   M+
Sbjct  1047  FFTWQGSEPYWRSTVWTGRLFSGAQVTNSSYISYLAITAPEDEVYIISFSLSDESSNAMY  1106

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
             K+D  G+     W+     W     QP   C  Y HCG F  CD++ S    C C+ GF 
Sbjct  1107  KLDHTGQLQFLGWDYGLNNWSIAAAQPHSMCVRYGHCGPFGCCDSTESVP-TCKCLEGFE  1165

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             P   + WN  N++GGC RRT L+C      G G   D F  +  ++LPD     RN +S 
Sbjct  1166  PKFPSDWNGGNFSGGCVRRTALEC------GNG---DRFLILGDMRLPDKFLFLRN-KSA  1215

Query  1533  edckkkceedCSCNAYA  1483
              +C+ +C  +CSCNAYA
Sbjct  1216  GECEAECLANCSCNAYA  1232


 Score =   162 bits (409),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = -3

Query  1266  RARIRAKKRDEIPR----TELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAA  1099
             R +I+  ++D   +     +L +  EF  D S       EG  G   +L   +F SIA A
Sbjct  2063  RDKIKGIRKDGKNKGSLLDDLSSGTEFPKDLSGSSGFG-EG-PGHIPELPLINFESIAVA  2120

Query  1098  TDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNL  919
             T++FS  +KLGQGGFG VYKG LP GQEIAVKRLSR SGQG++EF NE+ +IA+LQHRNL
Sbjct  2121  TNNFSDLHKLGQGGFGKVYKGKLPRGQEIAVKRLSRNSGQGLKEFKNEVLLIARLQHRNL  2180

Query  918   VRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             VRLLGCC++G+EK+L+YEYMPNKSLD+F+FD
Sbjct  2181  VRLLGCCMQGEEKLLIYEYMPNKSLDAFLFD  2211



>ref|XP_009402802.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Musa acuminata subsp. malaccensis]
Length=826

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/825 (46%), Positives = 532/825 (64%), Gaps = 28/825 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D ++ GQ I +DGE ++SA E F LGFFSP  + NRYVGIWY+     +V+WVANR+ 
Sbjct  24    AKDCLEVGQSI-NDGERLISAGEIFELGFFSPGSSKNRYVGIWYHSFSTDTVLWVANRDA  82

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I  +G  VVL      +W++N S+ S+ +T+ L +T  L++  +      
Sbjct  83    PVADASGRLAIGSDGNLVVLQDGCTIVWSSNVSLKSNQSTVQLLDTGNLVLNNS-----G  137

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +  WQSF  PTDT+LPGM+V  DL    +++F SW +  +P  G +SMG+DP+ S QI +
Sbjct  138   DVAWQSFDNPTDTYLPGMKVGLDLDTNVNQVFRSWKSKDDPGVGSYSMGMDPKRSTQIFV  197

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLIT-ENDNLYLEYKSSSSDLIMFKVDW  1882
             WEG K  WRSG W+G+VF+G+  M   ++YGF L   E++     Y + S++   + + W
Sbjct  198   WEGTKPRWRSGRWNGQVFIGIQNMVPTYIYGFKLSNLEDEQKMYYYFTVSNNSQRWVLTW  257

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G E    W    K W     QP+  C +YN CG +  C  +  N   C C+ G+ P+  
Sbjct  258   DGIEEHTIWKGDTKFWHSDWAQPSTACELYNRCGSYGSC--TDENTSTCSCLKGYVPAVE  315

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
             ++WN  NWT GC RRT LQC++N+++GG  E DGF +++ +KLPD +D   ++   + C+
Sbjct  316   DEWNRSNWTRGCVRRTRLQCERNSSDGGSVEADGFWKMERVKLPDLSDWYSDIGDEDGCR  375

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTT  1342
               C  +CSC AYA    GGI C++W  +LVD+  +    G+ +++RL  SEL+ ++  + 
Sbjct  376   ATCSMNCSCKAYA--FVGGIGCLVWGVDLVDI-HVFSSDGNDMYLRLAGSELETETKTSG  432

Query  1341  iivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTV  1162
              ++A+ V A V     + +   C +R R+   +R    +  LP +     D        +
Sbjct  433   HVIAILVSALVLAFGCIYLAWKCKKRLRVFIIRRR--GQRILPVNPNRDEDL-------I  483

Query  1161  EGKAGAS-SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
             EG       +L   SF SI A+T  FS  N +G+GGFG VYKG LP GQE+AVKRLSR S
Sbjct  484   EGAEDQQCQELPSISFESITASTSGFSNENLIGEGGFGPVYKGTLPGGQEVAVKRLSRGS  543

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG  EF NEL +IA+LQHRNLVRLLGCCI G+EK+L+YEYMPN+SL++F+FDP K+  L
Sbjct  544   GQGHTEFKNELILIARLQHRNLVRLLGCCIHGEEKILVYEYMPNRSLNTFLFDPQKKGLL  603

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W+ R++IIE IARGLLYLHRDSRLRIIHRDLKA+NILLD +MNPKISDFGMARIFG + 
Sbjct  604   DWKTRYNIIEGIARGLLYLHRDSRLRIIHRDLKAANILLDKDMNPKISDFGMARIFGSDD  663

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GII  448
             NE+NT RVVGTYGYM+PEYAM+G+FS+KSDVYSFGVLLLEIVSGR+N+ F   + S  ++
Sbjct  664   NESNTKRVVGTYGYMSPEYAMQGIFSIKSDVYSFGVLLLEIVSGRKNSIFTHQESSVSLL  723

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAW  W+    M  +DP+I  SC  ++   C+ +GLLCVQ+ A  RP+MS+V++ LE+ 
Sbjct  724   GYAWRLWNADNVMEFVDPAIRDSCSQKQASTCVNVGLLCVQNHANDRPSMSSVIIMLESG  783

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
                   PR PT+TA  R   D +S   +  L S+N+ +++++ GR
Sbjct  784   TDANSQPRQPTFTAE-RSPHDTESSPYDLRLLSANN-SITLVTGR  826



>emb|CDY62912.1| BnaC01g41150D [Brassica napus]
Length=688

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/707 (51%), Positives = 477/707 (67%), Gaps = 46/707 (7%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW-EGEKRYWRSGHWDGRVF  2002
             +RV+   G++  F SW +  +PSPG FS+G+DP  +P+IV+W     R WRSG W+  +F
Sbjct  3     VRVNPQTGDNLAFVSWRSENDPSPGNFSLGVDPSGAPEIVLWGRNNTRRWRSGQWNSAIF  62

Query  2001  LGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNESR  1843
              G+P   + T+++YGF L +   E  ++Y  Y  S  S L+ FKV  NG E + RWNE+ 
Sbjct  63    TGIPNMALLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLHNGTEEELRWNETS  122

Query  1842  KQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCT  1663
             K+W K Q  P  +C  YN CG F  CD   SNGI C C+ G+ P         +W+ GC 
Sbjct  123   KRWTKFQAAPESECDKYNRCGSFGICDMKGSNGI-CSCVDGYEPVSLG-----SWSRGCR  176

Query  1662  RRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYA  1483
             RRTPL+C++N +  G   +D F  +K +KLPDF   + ++  PEDCK +C ++CSC A+ 
Sbjct  177   RRTPLRCERNVSNVG---EDEFLTLKSVKLPDFETPEHSLADPEDCKDRCLKNCSCTAFT  233

Query  1482  PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-DNKSSKTTiivavsvvaava  1306
                  GI CM+W  +LVD+ Q + G GS+L VRL  SE+ ++K +K  +IVAV V   + 
Sbjct  234   --FVNGIGCMIWNQDLVDLQQFEAG-GSSLHVRLADSEIGESKKTKIVVIVAVLVGVLLL  290

Query  1305  vlvivsIWLLCSRRARIRAKKRDEIPRT-------------ELPTSGEFSSDFSAQCDLT  1165
              +  + +W         R K++ ++  T             ++  + + ++ F+   D+ 
Sbjct  291   GIFALLLW---------RFKRKKDVSGTYCGHDADTSVVVVDMTKAKDTTTAFTGSVDIM  341

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
             +EGKA  +S+L  F    I  AT+ FS  N+LG+GGFG VYKGVL  GQEIAVKRLS +S
Sbjct  342   IEGKAVNTSELPVFCLKVIVKATNDFSRENELGRGGFGPVYKGVLEDGQEIAVKRLSGKS  401

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSLD F+FD  K+  +
Sbjct  402   GQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFIFDEMKQELV  461

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W+ RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDGEMNPKISDFGMARIFGGNQ
Sbjct  462   DWKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEMNPKISDFGMARIFGGNQ  521

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             NEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+RNTS R  +H  +I 
Sbjct  522   NEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRNTSLRASEHGSLIG  581

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW  +  G+   L+DP I ++C  +E LRCI + +LCVQD A  RPNM+AV+L LE+D 
Sbjct  582   YAWFLYTHGRSEELVDPKIRATCNKREALRCIHVAMLCVQDSAAERPNMAAVLLMLESDT  641

Query  264   VTLPVPRPPTYTASMRR-SVDVDSWNQNNE--LPSSNSITMSVIVGR  133
              TLPVPR PT+T S RR S+DV+    +++  + SSN IT +V++GR
Sbjct  642   ATLPVPRQPTFTTSTRRNSMDVNFALDSSQQYIVSSNEITSTVVLGR  688



>ref|XP_004295380.1| PREDICTED: uncharacterized protein LOC101310880 [Fragaria vesca 
subsp. vesca]
Length=3881

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/825 (49%), Positives = 544/825 (66%), Gaps = 56/825 (7%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++S  + F LGFFSP  +S RYVGIWY ++   ++VWVANRE P+ DK G   I  
Sbjct  615   DGQTLISNGQTFELGFFSPGNSSFRYVGIWYYKLSDPAIVWVANRESPVSDKTGVLTIGS  674

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  V+L+G +  IW++N S    N + VLR+T  L++   +    N + W+SF  PTDT
Sbjct  675   DGNLVILEGNSTEIWSSNVSSLPKNTSAVLRDTGNLVLSTNE---TNESYWESFDNPTDT  731

Query  2190  FLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FLPGMRV ++A  GE++ F SW ++ +P+PG +  G+DPRA+PQ++IW G +R WRSGHW
Sbjct  732   FLPGMRVKVNAKEGENRAFRSWKSANDPAPGDYFSGVDPRAAPQLMIWNGSERRWRSGHW  791

Query  2016  DGRVFLGVP-MRTDFVYGFDLIT---ENDNLYLEYKS-SSSDLIMFKVDWNGKEVQQRWN  1852
             +  +F+G+P M T +  GF L     +N + YL Y   + SD + F++ W+G E Q  W 
Sbjct  792   NKLIFIGLPDMPTRYAAGFSLTDRADQNGSTYLSYTPWNVSDRLRFQIRWDGYEEQSIWV  851

Query  1851  ESRKQWIKIQEQP--ADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNW  1678
             +   +W+ +  QP  +  C +YN CG F  C  S+S+  +C C+ GF   +W      NW
Sbjct  852   DELNKWVDLMSQPNKSSGCELYNKCGNFGLC--SASDDASCECMQGFERKNWG-----NW  904

Query  1677  TGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCS  1498
             + GC R+TPL+CQ+N+T     E DGF  VK  K+PDFAD+         C++ C  +CS
Sbjct  905   SEGCERKTPLKCQRNSTNVEDGE-DGFVAVKCTKVPDFADLVVVTGPQISCEQSCLNNCS  963

Query  1497  CNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvv  1318
             C AYA     G+ CM+W  ELVD+ Q  +G G+TL++R+  ++L   S K + +V   + 
Sbjct  964   CTAYADV--SGLGCMIWTTELVDVQQFSKG-GNTLYIRVAHADLGG-SKKLSTLVISLIS  1019

Query  1317  aavavlvivsIWLLCSRRARIRAK--------KRDEIPRTELPTSGEFSSDFSAQCDLTV  1162
              AVA+ V + I+L+   + +++          +  E P  +   S EFS++ S   D TV
Sbjct  1020  VAVAIFVAILIFLVWRFKGKLKVLPTTSISWLRIGETPTYDAGKSKEFSTEMSGSVDPTV  1079

Query  1161  EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSG  982
             +G      DL  F+F+S+AAATD FSL NKLG GGFG VYKGVLP  +E+AVKRLS+ S 
Sbjct  1080  DGNQANGPDLPSFNFNSVAAATDHFSLVNKLGNGGFGTVYKGVLPGLEEVAVKRLSQVSC  1139

Query  981   QGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELN  802
             QG++EF NE+ +IAKLQHRNLVRL+GCCIEG+EKMLLYEYMPNKSLD F+FD  K++ L+
Sbjct  1140  QGLEEFKNEINLIAKLQHRNLVRLVGCCIEGEEKMLLYEYMPNKSLDFFLFDATKQALLD  1199

Query  801   WRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQN  622
             W KRF IIE IARGLLYLHRDSRLRIIHRDLKASNILLD +M PKISDFGMARIFGGNQ+
Sbjct  1200  WSKRFMIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEDMIPKISDFGMARIFGGNQH  1259

Query  621   EANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEY  442
             EANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI                    
Sbjct  1260  EANTMRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEI--------------------  1299

Query  441   AWEQWDEGKPMNLLDPSIFSSCVPQ-EVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             AW  W+   P +L+DPSI  +C  + E++RCI +GLLCVQD A  RP MSAVVL LE++ 
Sbjct  1300  AWNLWNANTPEDLIDPSIAETCNNRSELVRCIHVGLLCVQDSADSRPTMSAVVLMLESET  1359

Query  264   VTLPVPRPPTYTASMRRSVDV--DSWNQNNELPSSNSITMSVIVG  136
               LP+PR P +T S+++ VD    +  +  +L S N +T++V+ G
Sbjct  1360  ANLPLPREPMFT-SIKKYVDTTFSTEEETPDLASVNHVTITVVDG  1403


 Score =   560 bits (1443),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 334/833 (40%), Positives = 471/833 (57%), Gaps = 50/833 (6%)
 Frame = -3

Query  2547  GENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNG--AFGIT  2374
             G+ +VS    F LGFFS   +S +YVG+W+  I P+  VWVANRERP+   +G  +  I+
Sbjct  3071  GQTLVSPGRIFELGFFSFSDSSKQYVGLWHKNIYPRKQVWVANRERPLAVSDGLASLIIS  3130

Query  2373  GNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW--------RPNNTIW  2218
              NG   ++DGK  S+W++N +   S +     NTS ++ L  D            +  +W
Sbjct  3131  RNGNLEIVDGKQNSVWSSNVTSQVSTS-----NTSSVVALLLDSGNFVVKNDVEADGVVW  3185

Query  2217  QSFHQPTDTFLPG--MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW---  2053
             QSF  P DT LP   +  D  +G+  + TSW +  +PS GRF +G+      Q+ +W   
Sbjct  3186  QSFDHPGDTMLPTQLLGFDSKSGKRNVLTSWKSENDPSVGRFWVGLSAETPSQVFVWVNN  3245

Query  2052  -EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKV-DW  1882
                   YWRSG WD   F+G+P M + +  GF L   +DN+    K  S D +++   + 
Sbjct  3246  GSDSAPYWRSGPWDKSRFIGIPEMNSQYRSGFTL---DDNVERGTKYLSWDRLLYPTYEE  3302

Query  1881  NGKEVQQRWNESRK--QWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
                E   ++  S +   W    E P   C +Y  CG F  C  S S    C C+ GF P 
Sbjct  3303  ISSEGITKYMASVEGSNWTLGVEAPKHPCDIYGACGSFGVCKASESP--ICKCLKGFVPK  3360

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGA----EKDGFREVKHIKLPDFADIDRNMR  1540
                +W   NWTGGC R++ + CQ+  T    A    E DGF ++  +K+PD  +   +  
Sbjct  3361  SDQEWRKGNWTGGCVRKSKMFCQRQMTNRSVAAREKEDDGFLKMARLKVPDLHEFYASFV  3420

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-D  1363
             S      K     +C+  A      I C++W  +L+D+ Q   G G  +F+R+  +E+ +
Sbjct  3421  SDTSENCKIRCLNNCSCLAYAFVNSIGCLVWSKDLIDIQQFSSG-GVDVFIRVARAEMGE  3479

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFS  1183
              +  K  + +    + ++   ++V  + +   R   R K      + EL      S D  
Sbjct  3480  GRPIKLIVSLTAICLISILGAIVVGFYRM---RGHQRGKTTGNAGKYELADKIRTSRD--  3534

Query  1182  AQCDLTVEGKAGASS--DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
                  T+    G     +L+ + F SI  ATD+FSL NKLGQGGFG VYKG LP G+EIA
Sbjct  3535  -----TLREYIGKDDPYELLIYDFDSILVATDNFSLTNKLGQGGFGPVYKGKLPEGKEIA  3589

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLS  SGQG +EF NE  +I+ LQH+NLVR++GCC++GDEK+L+YE+MPNKSLD+F+F
Sbjct  3590  VKRLSSSSGQGKEEFKNETLLISNLQHKNLVRIMGCCVKGDEKLLVYEFMPNKSLDTFLF  3649

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP +R+ L+W  RF+II+ +ARGLLYLH DS L++IHRDLK SNILLD +MN KISDFG+
Sbjct  3650  DPMRRAVLDWPCRFNIIQGVARGLLYLHHDSCLKVIHRDLKVSNILLDEKMNAKISDFGL  3709

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF-R  472
             ARI     +  NT RVVGT GYM+PEYAM G+FS K DVYSFGVL+LEI+SG++NTSF  
Sbjct  3710  ARIVQETPDLENTKRVVGTIGYMSPEYAMGGIFSEKLDVYSFGVLVLEIISGKKNTSFCL  3769

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              D   G + YAW  W+EGK + L+D  +  S    EV+RC+ +GLLCVQD A  RP M  
Sbjct  3770  HDQQQGFLAYAWNLWNEGKGLALVDEVLAGSYSSSEVMRCVHIGLLCVQDNAADRPTMLD  3829

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             VV F+ + N+  P P+ P +T     +  +    Q     S+N  +++ I GR
Sbjct  3830  VV-FMLSSNIDGPQPKEPVFTVVYSTTPVIRPQPQYQSTFSTNDTSITAIEGR  3881


 Score =   374 bits (960),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 235/628 (37%), Positives = 337/628 (54%), Gaps = 74/628 (12%)
 Frame = -3

Query  2223  IWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPR--ASPQIVI  2056
             +WQSF  PTDT +PGM+  V+   G+  + TSW +  +P  G  +  + P     PQ  +
Sbjct  1     MWQSFDHPTDTLIPGMKLGVNWKTGQEWVLTSWKSQDDPGTGDCTFRLYPNQIGFPQFFM  60

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWNG  1876
             ++G  +YWR            P  T  V          N    Y S ++D I   +  + 
Sbjct  61    YKGLSKYWRVD----------PGPTPLVV--------SNQEETYASLNADAITRAIVTDS  102

Query  1875  KEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQ  1696
              E +  W++ + QW +    P  +C  Y  CG  ++C   + N   C C+ G  P   + 
Sbjct  103   VEKRFTWDDDKLQWHEDYSAPKSRCDFYGRCGANSKCSPDNVNLFECECLPGCEPKSISD  162

Query  1695  WNARNWTGGCT--RRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD--FADIDRNMRSPed  1528
             WN +N +GGC   R    +C          + DGF +V+ +K PD   A + ++  S ++
Sbjct  163   WNQKNGSGGCVSNRVGLFKC---------GDGDGFVKVERVKYPDTSIAALSKSGMSAKE  213

Query  1527  ckkkceedCSCNAYAPPVPGGI-SCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
             C+ +C  +C+C AY      G+  C  W ++L+D++   E  G  L+VR++++ L     
Sbjct  214   CQHECLGNCTCTAYLSIKNEGLDGCFTWYDDLMDILGYTE-LGPDLYVRVNATVLAAYVG  272

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K+   +    + A+ +L  V   +L         KK      T+    GE   +      
Sbjct  273   KSQGFLERKGMLAIPILSAVLALVLTIMLGCWWRKKNHN---TKAILQGEALDETQRH--  327

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
                        DL FF   +I AATD FS  N+LG GGFG VYKG LP  Q +AVKRLS+
Sbjct  328   ----------PDLQFFDLDTIIAATDHFSRVNELGHGGFGSVYKGKLPNEQNVAVKRLSK  377

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG +EF NE+ +IA+LQHRNLV+LLGCCI+G+E++L+ EYMPNKSLDSF+ D  +RS
Sbjct  378   TSGQGTEEFKNEVALIARLQHRNLVKLLGCCIKGEERILVLEYMPNKSLDSFLSDHTRRS  437

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+W +RF II  IARG+LYLH+DSRLRIIHRDLK SN+LLD EMNPKISDFGMARI  G
Sbjct  438   FLDWARRFEIINGIARGILYLHQDSRLRIIHRDLKPSNVLLDAEMNPKISDFGMARIIHG  497

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-G  454
             NQ +  T+R+ GTY                     FG+++LEIVSG++N     +D S  
Sbjct  498   NQLQDKTSRIAGTY---------------------FGIIMLEIVSGQKNNGSDLEDPSMN  536

Query  453   IIEYAWEQWDEGKPMNLLDPSIFSSCVP  370
              I + WE W EG+ ++++D ++     P
Sbjct  537   FIGHVWELWKEGRALDIVDSTLNGEASP  564


 Score =   187 bits (476),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 199/430 (46%), Gaps = 60/430 (14%)
 Frame = -3

Query  2547  GENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT--  2374
             G+ +VS    F LGFFS   +S +YVG+W+  I P+  VWVANRERP+   +G  G+   
Sbjct  1424  GQTLVSPGRIFELGFFSFNDSSKQYVGLWHKNIYPRKQVWVANRERPLAVSDGLAGLRLG  1483

Query  2373  GNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG--------WRPNNTIW  2218
              N    ++DGK  S+W++N +   S +     NTS ++ L  D            +  +W
Sbjct  1484  RNRNLELVDGKQNSVWSSNVTSQVSTS-----NTSSVVALLLDSGNFVVKNDVEADGVVW  1538

Query  2217  QSFHQPTDTFLPG--MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW---  2053
             QSF  P DT LP   +  D  +G+  + TSW +  +PS GRF +G+      Q+ +W   
Sbjct  1539  QSFDHPGDTMLPTQLLGFDSKSGKRNVLTSWKSENDPSVGRFWVGLSAETPSQVFVWVNN  1598

Query  2052  -EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDN-------------LYLEYKS  1918
                   YWRSG WD   F+G+P M + +  GF L   +DN             LY  Y+ 
Sbjct  1599  GTDSAPYWRSGPWDKSRFIGIPEMNSQYRSGFTL---DDNVEQGRKYLSWGRLLYPTYEE  1655

Query  1917  SSSDLI---MFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSN  1747
              SS+ I   M  V+ +              W      P   C +Y  CG F  C  S S 
Sbjct  1656  ISSEGITKFMASVEVS-------------NWTLGVAAPKHPCDIYGACGSFGVCKASESP  1702

Query  1746  GINCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGA---EKDGFREVKHIK  1576
                C C+ GF P    +W+  NWTG C R++ + CQ+       A   E DGF ++  +K
Sbjct  1703  --ICKCLKGFVPKSDQEWSKGNWTGRCVRKSKMFCQRQTNRSVAAREKEDDGFLKMVRLK  1760

Query  1575  LPDFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGST  1396
             +PD  +   +  S      K     +C+  A      I C++W  +L+D+ Q   G G  
Sbjct  1761  VPDLHEFYASFVSDTSENCKIRCLNNCSCLAYAFVNSIGCLVWSKDLIDIQQFSSG-GVD  1819

Query  1395  LFVRLHSSEL  1366
             +F+R+  +EL
Sbjct  1820  VFIRVARAEL  1829



>emb|CDX79056.1| BnaA01g11230D [Brassica napus]
Length=689

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/707 (51%), Positives = 474/707 (67%), Gaps = 45/707 (6%)
 Frame = -3

Query  2178  MRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW-EGEKRYWRSGHWDGRVF  2002
             +RV+   G++  F SW +  +PSPG FS+G+DP  +P+IV+W     R WRSG W+  +F
Sbjct  3     VRVNPQTGDNLAFVSWRSDNDPSPGNFSLGVDPSGAPEIVLWGRNNTRRWRSGQWNSAIF  62

Query  2001  LGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNESR  1843
              G+P   + T+++YGF L +   E  ++Y  Y  S  S L+ FKV  NG E + RWNE+ 
Sbjct  63    TGIPNMALLTNYLYGFKLSSPPDETGSVYFTYVPSDPSVLLRFKVLHNGTEEELRWNETS  122

Query  1842  KQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCT  1663
             K+W K Q  P  +C  YN CG F  C+    NGI C C+ G+ P      +  NW+ GC 
Sbjct  123   KRWTKFQAAPESECDKYNRCGSFGICNMKGDNGI-CSCVDGYEPV-----SVGNWSRGCR  176

Query  1662  RRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYA  1483
             RRTPL+C++ N    G  +D F  +K +KLPDF   + ++  PE+CK +C  +CSC A+ 
Sbjct  177   RRTPLKCERRNVSNVG--EDEFLTLKSVKLPDFETPEHSLADPEECKDRCLNNCSCTAFT  234

Query  1482  PPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-DNKSSKTTiivavsvvaava  1306
                  GI CM+W  +LVD+ Q + G GS+L VRL  SE+ ++K +K  +IVAV     + 
Sbjct  235   --FVNGIGCMIWNQDLVDLQQFEAG-GSSLHVRLADSEIGESKKTKIVVIVAVLAGVVLL  291

Query  1305  vlvivsIWLLCSRRARIRAKKRDEIPRT-------------ELPTSGEFSSDFSAQCDLT  1165
              +  + +W         R K++ ++  T             ++  + + ++ F+   D+ 
Sbjct  292   GIFALLLW---------RFKRKKDVSGTYCGHDADTSVVVVDMTKAKDTTAAFTGSVDIM  342

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
             +EGKA  +S+L  F  + I  AT+ FS  N+LG+GGFG VYKGVL  GQEIAVKRLS +S
Sbjct  343   IEGKAVNTSELPVFCLNVIVKATNDFSRENELGRGGFGPVYKGVLEDGQEIAVKRLSGKS  402

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQGV EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNKSLD F+FD  K+  +
Sbjct  403   GQGVDEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNKSLDFFIFDETKQGLV  462

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             + + RF IIE IARGLLYLHRDSRLRIIHRDLK SN+LLDGEM PKISDFGMARIFGGNQ
Sbjct  463   DGKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEMIPKISDFGMARIFGGNQ  522

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             NEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEI+SG+RNTS R+ +H  +I 
Sbjct  523   NEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRNTSLRSSEHGSLIG  582

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW  +  G+   L+DP I ++C  +E LRCI + +LCVQD A  RPNM+AV+L LE+D 
Sbjct  583   YAWFLYTHGRSEELVDPKIRATCNKREALRCIHVAMLCVQDSAAERPNMAAVLLMLESDT  642

Query  264   VTLPVPRPPTYTASMRR-SVDVDSWNQNNE--LPSSNSITMSVIVGR  133
              TLPVPR PT+T S RR S+DV+    +++  + SSN IT +V++GR
Sbjct  643   ATLPVPRQPTFTTSTRRNSMDVNFALDSSQQYIVSSNEITSTVVLGR  689



>ref|XP_002304960.2| hypothetical protein POPTR_0004s02640g [Populus trichocarpa]
 gb|EEE85471.2| hypothetical protein POPTR_0004s02640g [Populus trichocarpa]
Length=831

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/828 (46%), Positives = 514/828 (62%), Gaps = 32/828 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q+IKD  E IVSA   F LGFFSP  ++NRYVGIWYN++   + VWVANR  
Sbjct  27    AVDIITSSQFIKDP-EAIVSARNIFKLGFFSPVNSTNRYVGIWYNDMPTVTTVWVANRNE  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I  +G  VVL+G+   +W++N      ++   L +   L++L   G    
Sbjct  86    PLNDSSGVLKIFQDGNLVVLNGQQEILWSSNVLAGVKDSRAQLTDEGNLVLL---GKNNG  142

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N IW+SF QP +T LP MRV  +A  GES + TSW +  +PS GRFS+ +DP   P++ +
Sbjct  143   NVIWESFQQPCNTLLPNMRVSANARTGESTVLTSWISPSDPSVGRFSVSMDPLRIPEVFV  202

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKV  1888
             W  +  YWRSG W+G++F+G+P M + ++ GF+L    D   +L   Y +  +   + + 
Sbjct  203   WNYKSPYWRSGPWNGQIFIGIPEMNSVYLDGFNLAKTADGAVSLSFTYVNQPNSNFVLRS  262

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             D  GK +++ W    + W  I  +P  +C +Y  CG F  C+  + N   C C+ GF P 
Sbjct  263   D--GKLIERAWKVENQDWFNIWNRPETECDIYGKCGAFGSCN--AVNSPICSCLRGFVPK  318

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             + ++WN  NWT GC RRTPL+C +         KDGF +++ IK+PDF++   ++ S  +
Sbjct  319   NPDEWNKGNWTSGCLRRTPLECTETQNIREVNPKDGFLKLEMIKVPDFSEWS-SLYSELE  377

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS-  1351
             C+ +C  +CSC AY+     GI CMLW   L+D+ +   G G+ L++RL  SELD K S 
Sbjct  378   CRNECLSNCSCIAYS--YYKGIGCMLWTRSLIDIQKFSVG-GADLYLRLAYSELDTKKSV  434

Query  1350  KTTiivavsvvaavavlvivsIW-LLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQC  1174
             K  I + V        +     W  +     R R  K   + ++E P     SS +    
Sbjct  435   KIVISITVIFGTIAFSICAFLSWRWMVKHGERKRKSKEISLSKSEEPCR---SSSYGNMI  491

Query  1173  DLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
                  GK         FS   +  AT+SF ++ KLG+GGFG VY+G LP GQEIAVKRLS
Sbjct  492   R-NSGGKVKLQELPAVFSLQELENATNSFEISKKLGEGGFGPVYRGKLPDGQEIAVKRLS  550

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             R S QG++EF NE++VI+KLQHRNLV+LL  C+EG+EKML+YEYMPNKSLD+F+FDPAK+
Sbjct  551   RASQQGLEEFMNEVSVISKLQHRNLVKLLAYCVEGEEKMLVYEYMPNKSLDAFLFDPAKQ  610

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
               L+W+KRF+IIE + RGLLYLHRDSRLRIIHRDLKASNILLD E+N KISDFGMAR FG
Sbjct  611   ELLDWKKRFNIIEGVCRGLLYLHRDSRLRIIHRDLKASNILLDQELNAKISDFGMARTFG  670

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-  457
             G++++A+T RVVGTYGYMAPEYAMEG FS KSDVYSFGVLLLEI+SGRRN+SF  ++   
Sbjct  671   GSEDQADTTRVVGTYGYMAPEYAMEGRFSEKSDVYSFGVLLLEIISGRRNSSFYDNEKDL  730

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
               + +AW+ W EGK   L D  +   C   E+ R I +GLLCVQ+ A  RP +  ++  L
Sbjct  731   SFLGFAWKLWTEGKLSALADRVLSDPCFQDEIYRSIHVGLLCVQEFARDRPAVPTIISML  790

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              ++ V LP P+ P          D+DS  Q ++   SN IT++VI GR
Sbjct  791   HSEIVDLPAPKKPAL------GFDMDSL-QRSQTICSNDITITVIGGR  831



>ref|XP_006387750.1| hypothetical protein POPTR_0608s00200g, partial [Populus trichocarpa]
 gb|ERP46664.1| hypothetical protein POPTR_0608s00200g, partial [Populus trichocarpa]
Length=835

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/824 (46%), Positives = 525/824 (64%), Gaps = 38/824 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q++KD  + IVSA  KF LGFFSP  ++NRYVGIW++   P + VWVANR +
Sbjct  45    ARDTITSSQYVKDP-DAIVSAGNKFKLGFFSPVNSTNRYVGIWFSSFTPITRVWVANRNK  103

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+G+G  VVL+G+  ++W++N S   SN++  L +   L++         
Sbjct  104   PLNDSSGVMTISGDGNLVVLNGQKETLWSSNVSNGVSNSSARLMDDGNLVLRDIGS---G  160

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N +W+SF +P+DT +  MR+   +  GE  L +SW +  +PS G FS+GIDP   PQ  I
Sbjct  161   NRLWESFQEPSDTMITNMRLTAKVRTGEKTLLSSWRSPSDPSIGTFSVGIDPVRIPQCFI  220

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIM--FKVD  1885
             W      +R+G W+G+VF+G+P M +  + GFD+  + +  +    +S+++  +  F + 
Sbjct  221   WNHSHPIYRTGPWNGQVFIGIPGMNSVNINGFDIEQDGNGTFTLILNSANESYIGSFVLS  280

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             ++G   +  W+  +++W+ +   P D+C VY  CG F  C N+  + I C C+ GF P D
Sbjct  281   YDGNFNELYWDYGKEEWVYVGRLPNDECDVYGKCGSFGIC-NAKYSPI-CSCMKGFEPKD  338

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
              ++WN+RNWT GC RR P+QC++    G   ++DGF +++ +K+PDFAD    + S + C
Sbjct  339   ADEWNSRNWTSGCVRRRPMQCERIQYGGEPGKEDGFLKLRTVKVPDFADRSLAV-SEQTC  397

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             ++ C  +CSC AYA     GI CMLW   L D+ +   G G+ L+VRL  SELDN+   T
Sbjct  398   RENCMNNCSCIAYAYYT--GIRCMLWWENLTDIRKFPSG-GADLYVRLAYSELDNR---T  451

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
             T +  +  +  V   +I +I + C  R     ++R +     L        D +      
Sbjct  452   TSMKVIIGLTVVVGAIISAICVFCMWRRIAHYRERKKRSMKILLDESMMQDDLN------  505

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
                     + L   S   + AAT++F +ANKLGQGGFG VYKG LP GQEIAVKRLSR S
Sbjct  506   -------QAKLPLLSLPKLVAATNNFDIANKLGQGGFGPVYKGRLPDGQEIAVKRLSRAS  558

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPNKSLD+F+FDP ++  L
Sbjct  559   GQGLEEFMNEVVVISKLQHRNLVRLLGCCVEGEEKMLVYEYMPNKSLDAFLFDPLRKQLL  618

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W KRF I++ I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFGMARIFGGN+
Sbjct  619   DWNKRFDIVDGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGMARIFGGNE  678

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             ++ANT RVVGTYGYM+PEYA++G FS KSDV+SFGVLLLEI SGR+NTSF         E
Sbjct  679   DQANTIRVVGTYGYMSPEYAIQGRFSEKSDVFSFGVLLLEIASGRKNTSFYD------CE  732

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
              AW+ W+EG    ++DP I +     EV RCI +GLLCVQ+LA  RP +S V+  L ++ 
Sbjct  733   QAWKSWNEGNIGAIVDPVISNPSFEVEVFRCINIGLLCVQELARDRPTISTVISMLNSEI  792

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V LP P+   + A     +D +S  QN +  S N+++++ +  R
Sbjct  793   VDLPAPKQSAF-AERFSYLDKESSEQNKQRYSINNVSITALEAR  835



>gb|EAZ04277.1| hypothetical protein OsI_26419 [Oryza sativa Indica Group]
Length=860

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/848 (46%), Positives = 531/848 (63%), Gaps = 44/848 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEG--TSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD + QGQ +  + + +VSAN  F +GFF+P G      Y+G+ Y     Q+V+WVANR
Sbjct  28    AADTLSQGQSLGAN-DMLVSANGTFKVGFFTPAGGDPGKVYLGVMYATSNVQTVMWVANR  86

Query  2415  ERPILDKNGAFG--ITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG  2242
             + P+    GA    +TG+G  +V +G  V+     S+   S  T+ +R+   L+I  +D 
Sbjct  87    DAPVRTAAGAASATVTGSGELLVKEGDRVAWRTNASAAGRSKHTLTIRDDGNLVISGSDA  146

Query  2241  WRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
                 +  W+SFH PTDTF+PGM + L  + G+  L+TSW +  +P+ G F++G+D  AS 
Sbjct  147   -AGTDVEWESFHHPTDTFVPGMEIALRQTNGDRTLYTSWRSDADPATGDFTLGLD--ASA  203

Query  2067  QIVIWEGE----KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSS  1912
             Q+ IW  +      YWRSG W    F+G+P R  +VYGF L  +      ++ + +   +
Sbjct  204   QLYIWRSQGGKNSTYWRSGQWASGNFVGIPWRALYVYGFKLNGDPPPIAGDMSIAFTPFN  263

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L  F +  NG E       S   W  +  QP   C  YN CG  A C    +  I C 
Sbjct  264   SSLYRFVLRPNGVETCYMLLGS-GDWELVWSQPTIPCHRYNLCGDNAECTADDNEPI-CT  321

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQC--QKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C  GF P    ++N  NWT GC R  PL C  ++NNT  GG   DGF  ++ +KLPDFA 
Sbjct  322   CFTGFEPKSPQEYNNGNWTQGCVRSVPLTCSSERNNTTAGGG--DGFTVIRGVKLPDFAV  379

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLD---EGSGSTLFV  1387
                 +     C+K C  +CSC AY+       SC+ W  ELVD+ Q     EG+   L+V
Sbjct  380   WGSLVGDANSCEKACLGNCSCGAYSYSTG---SCLTWGQELVDIFQFQTGTEGAKYDLYV  436

Query  1386  RLHSSELDNKSS--KTTiivavsvvaavavlvivsIWLLCSRRARIR---AKKRDEIP--  1228
             ++ SS LD  S   KT ++V V VV  V +   + +W  C RR + +    +K+ ++P  
Sbjct  437   KVPSSLLDKSSGRWKTVVVVVVVVVVVVLLASGLLMWK-CRRRIKEKLGIGRKKAQLPLL  495

Query  1227  RTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGH  1048
             R       +FS    ++ + + EGK   + +L  F+F ++A ATD+FS++NKLG+GGFGH
Sbjct  496   RPARDAKQDFSGPAQSEHEKSEEGK---NCELPLFAFETLATATDNFSISNKLGEGGFGH  552

Query  1047  VYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLY  868
             VYKG LP G+EIAVKRLSR SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+Y
Sbjct  553   VYKGRLPGGEEIAVKRLSRSSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKILVY  612

Query  867   EYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILL  688
             EYMPNKSLD+F+FDP +R  L+WR RF IIE +ARGLLYLHRDSRLR++HRDLKASNILL
Sbjct  613   EYMPNKSLDAFLFDPERRELLDWRTRFQIIEGVARGLLYLHRDSRLRVVHRDLKASNILL  672

Query  687   DGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLL  508
             D +MNPKISDFGMARIFGG+QN+ NTNRVVGT GYM+PEYAMEGLFSV+SDVYSFG+L+L
Sbjct  673   DRDMNPKISDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAMEGLFSVRSDVYSFGILIL  732

Query  507   EIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLC  331
             EI++G++N+SF   + S  I+ YAW+ W+  +   L+DP+I  +C  +E LRC+ + LLC
Sbjct  733   EIITGQKNSSFHHMEGSLNIVGYAWQLWNGDRGQELIDPAIRGTCPAKEALRCVHMALLC  792

Query  330   VQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDS--WNQNNELPSSNSI  157
             VQD A  RP++  VVL L +D+  LP PRPPT+T     S       +    E  S+N +
Sbjct  793   VQDHAHDRPDIPYVVLTLGSDSSVLPTPRPPTFTLQCTSSSSGRDMYYRDKEESYSANDL  852

Query  156   TMSVIVGR  133
             T++++ GR
Sbjct  853   TVTMLQGR  860



>gb|KCW72107.1| hypothetical protein EUGRSUZ_E00547 [Eucalyptus grandis]
Length=817

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/832 (46%), Positives = 527/832 (63%), Gaps = 52/832 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I   ++I+D G +I S+   + +GFFSP G++NRYVGIWYN +   SV+WVANR+ 
Sbjct  25    GGDVITASEYIQDPG-SITSSGGLYRMGFFSPNGSANRYVGIWYNNVPRYSVLWVANRKN  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PILD +G   I+G+G  VV++GK   +W++N S + +NA   L ++  L++LK       
Sbjct  84    PILDSSGVMTISGDGNLVVMNGKRELVWSSNVSNSVTNAKAQLLDSGNLVLLKQSSNSSA  143

Query  2229  N---TIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
             N    +W+SF   TD+FL  M++  ++   E +  TSW +  +PS G FS  +DPR  P+
Sbjct  144   NDAENLWESFQHMTDSFLEKMKLSTNSRTNEKQALTSWKSPSDPSIGSFSASLDPRNIPE  203

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKV  1888
             + IW G   YWRSG W+G +F GVP M++ +  GF      +  Y+ Y       ++ K 
Sbjct  204   LFIWNGSSLYWRSGPWNGNIFTGVPEMQSVYSNGFA-----EASYMSY-------LLLKS  251

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               NG  VQ  W++S   W  +       C VY  CG F  C N+  + I C C+ GF P 
Sbjct  252   --NGDLVQPYWDQSSSSWGIVWSSRLSDCDVYGQCGPFGIC-NAKKSPI-CSCLKGFEPK  307

Query  1707  DWNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPD----FADIDRNM  1543
             ++ +W+  NW+ GC R++ LQC    N      +KDGF +++ +K+P     F+ ++ + 
Sbjct  308   NFEEWSRGNWSSGCIRKSLLQCNGTTNGSSTAGKKDGFLKLEIMKVPSSGIFFSTLEEDC  367

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
                      C  +CSC AYA     G+ C+ W  EL+D+ +   G G+TL+VRL  SEL+
Sbjct  368   PG------NCSMNCSCVAYA--YDSGVGCVFWIGELIDLQKFSIG-GTTLYVRLAHSELE  418

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFS  1183
              K       +  + V    ++VI+ IW      AR +AKK+ +    +  +SGE  S   
Sbjct  419   KKGH--LREIIATTVIIGTLVVIIIIWF-----ARRKAKKQVKQSMEKHLSSGEAPSVVM  471

Query  1182  AQCDLT-VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
                +L+ VE +     + V +    +AAAT +F  ANKLG+GGFG VYKG LP GQEIA+
Sbjct  472   LGENLSRVEFQ-----EFVKYKIEELAAATGNFCEANKLGRGGFGPVYKGRLPNGQEIAI  526

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLSR SGQG QEF NE+ VI K+QHRNLVRLLGCC EGDEKML+YE+MPNKSLD+F+FD
Sbjct  527   KRLSRASGQGQQEFMNEMEVICKVQHRNLVRLLGCCAEGDEKMLIYEFMPNKSLDTFIFD  586

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
             P K+  L+WR RF+I++ I RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA
Sbjct  587   PLKQVHLDWRTRFNIVDGICRGLLYLHRDSRLRIIHRDLKASNILLDKELNPKISDFGMA  646

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD  466
             RIFGGN+N+ANT RVVGTYGYMAPEYAMEG FS KSDV+SFG+LLLEIVSGRRNTSF  +
Sbjct  647   RIFGGNENQANTRRVVGTYGYMAPEYAMEGRFSEKSDVFSFGILLLEIVSGRRNTSFHYE  706

Query  465   DHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
             D    ++  AW+ W+E   + L+DP++ ++    ++ RCI +GLLC Q+ A  RP++S V
Sbjct  707   DQCLSLLGLAWKLWNEEDVLALVDPTMPATPFEVQLSRCINVGLLCTQERAKDRPSISTV  766

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +  + ++ V LP P+ P +TA  + + D DS  Q+ +  S+N +T++V+ GR
Sbjct  767   ISMINSEIVDLPRPKQPAFTAR-KITQDTDSSGQSQKTCSANDVTLTVLQGR  817



>ref|XP_010646877.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Vitis vinifera]
Length=826

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/824 (44%), Positives = 521/824 (63%), Gaps = 26/824 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I    +IKD  E IVS+   F LGFFS +G+SNRYVGIWYN     +++WVAN++R
Sbjct  24    AIDTITSTHFIKDP-ETIVSSGRVFKLGFFSLDGSSNRYVGIWYNTTSLLTIIWVANKDR  82

Query  2409  PILDKNGAFGITGNGTFVVLDG-KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D +G   I+ +G   VL+G K +   +  S+  + N++  L+++  L++   +G   
Sbjct  83    PLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAAVNSSAQLQDSGNLVLRDKNG---  139

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGES--KLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               ++W+S   P+ +F+P M++  +      K+ TSW +S +PS G F+ G++P   PQ+ 
Sbjct  140   -VSVWESLQNPSHSFVPQMKISTNTRTRVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSSDLIM-FKVD  1885
             IW G + YWRSG WDG++  GV ++   + G +++ + +  +Y+ +    S     + + 
Sbjct  199   IWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTVYVTFAHPESGFFYAYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G  V+   ++  + W ++     ++C +Y  CG F  C NS  + I C C+ G+ P  
Sbjct  259   PEGILVETSRDKRNEDWERVWTTKENECEIYGKCGPFGHC-NSRDSPI-CSCLKGYEPKH  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWTGGC R+TPLQC++       A+ DGF ++ ++K+PDFA+    +      
Sbjct  317   TQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKVPDFAEQSYALED----  372

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
               + +   +C+  A     GI CM W  +L+D+ +L   +G+ LF+R+  SEL     + 
Sbjct  373   DCRQQCLRNCSCIAYSYYTGIGCMWWSGDLIDIQKLS-STGANLFIRVAHSELKQDRKRD  431

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
               ++ +  V    + + +  + L    AR RAKK  +I        G+FS D S   D  
Sbjct  432   ARVIVIVTVIIGTIAIALCTYFLRRWIARQRAKK-GKIEELLSFNRGKFS-DPSVPGDGV  489

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              + K     +L    F+ +A AT++F  ANKLGQGGFG VY+G L  GQ+IAVKRLSR S
Sbjct  490   NQVKL---EELPLIDFNKLATATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRAS  546

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QG++EF NE+ VI+KLQHRNLVRL+GCCIEGDEKML+YE+MPNKSLD+ +FDP KR  L
Sbjct  547   TQGLEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPVKRQIL  606

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR RF IIE I RGLLYLHRDSRLRIIHRDLKASNILLD ++NPKISDFGMARIFG NQ
Sbjct  607   DWRTRFKIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEDLNPKISDFGMARIFGSNQ  666

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             ++ANT RVVGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+N+SF  +++  ++ 
Sbjct  667   DQANTKRVVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEYFTLLG  726

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W E     L+D SI  +C  +E+LRCI +GLLCVQ+LA  RP++S VV  + ++ 
Sbjct  727   YAWKLWKEDNMKTLIDGSILEACFQEEILRCIHVGLLCVQELAKDRPSVSTVVGMICSEI  786

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               LP P+ P +T  MR  +D++S ++   L   N +++++I GR
Sbjct  787   AHLPPPKQPAFT-EMRSGIDIESSDKKCSL---NKVSITMIEGR  826



>ref|XP_010430168.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610 [Camelina sativa]
Length=744

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/728 (52%), Positives = 491/728 (67%), Gaps = 29/728 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              ++ I + Q I+D G+++VS +  F +GFFSP+ ++ RYVGIWY  I PQ+VVWVANRE+
Sbjct  28    TSNSITRNQTIRD-GDSLVSNDGSFEVGFFSPKNSTLRYVGIWYKNIEPQTVVWVANREK  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+LD NGA  I  +G  VV++G+NV++W+T++   S+N    L  T +L+ L +D  R N
Sbjct  87    PLLDHNGALKIADDGNLVVVNGQNVTVWSTSAKPESNNTVAALLRTGDLV-LSSDSDR-N  144

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
                W+SF  PTDTFLP MRV  D S GE+  F  W +  +PSPGR+SMGIDP  +P+IVI
Sbjct  145   KWYWESFDNPTDTFLPSMRVRVDPSLGENHGFVPWKSENDPSPGRYSMGIDPNGAPEIVI  204

Query  2055  WEGEKRYWRSGHWDGRVFLGVP---MRTDFVYGFDLITENDN--LYLEYKS-SSSDLIMF  1894
             WEGEKR WRSG W+  +F G+P     T+++ GF L   + +  +Y  Y + +SSD + F
Sbjct  205   WEGEKRKWRSGPWNSAIFTGIPDMHRVTNYIRGFKLSPPDRDGIVYFTYVTINSSDFLRF  264

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI-NCVCIVGF  1717
             ++ ++G + Q RWN+  K W  +Q++P  +C  YN CG ++ CD+S   G   C CI GF
Sbjct  265   RIRFDGVQEQFRWNKDAKNWTLLQKKPDTECENYNRCGNYSVCDDSKEFGSGKCSCIDGF  324

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
              P   +QWN  N++GGC RR  L C +N       ++DGF+ +K +KLPDF  +   + S
Sbjct  325   EPVYQDQWNNMNFSGGCKRRVALNCSQNLV---ADKRDGFKVLKRMKLPDFGSV-VPLNS  380

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
                CK  C  DCSCNAYA  V GGI CM+W  EL+D+ +   G G+ + +RL  SEL  K
Sbjct  381   LVTCKDVCVRDCSCNAYA--VVGGIGCMIWTRELIDIERFKLG-GNYINIRLAGSELGGK  437

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG--EFSSDFS  1183
                   I+ VSV+ A  + + +  W+ C R      KK+D      LP S   + S +F 
Sbjct  438   EKPKIWIIIVSVIGAFLLGLCI--WISCKRLKAFLWKKKD------LPVSDTRDNSVNFK  489

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
             +     + G    + DL  FSF S+A+AT  F+  NKLGQGGFG VYKG    G+EIAVK
Sbjct  490   SSPINVLVGDQVDTPDLPVFSFDSVASATGDFAEENKLGQGGFGTVYKGNFSEGREIAVK  549

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS +S QG++EF NE+ +IAKLQHRNLVRLLGCCIE +EKMLLYEYMPNKSLD F+FD 
Sbjct  550   RLSGKSKQGLEEFKNEILLIAKLQHRNLVRLLGCCIEDNEKMLLYEYMPNKSLDRFLFDE  609

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
             +KR  L+WRKR+ II  IARGLLYLHRDSRL+IIHRDLKASNILLD EMNPKISDFGMAR
Sbjct  610   SKRGSLDWRKRWEIIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKISDFGMAR  669

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             IF   Q++ANT RVVGTYGYMAPEYAMEG+FS KSDVYSFGVL+LEIVSGR+N SFR  +
Sbjct  670   IFNYRQDQANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKNISFRGSE  729

Query  462   HSGIIEYA  439
             H  +I Y 
Sbjct  730   HGSLIGYV  737



>ref|XP_006851221.1| hypothetical protein AMTR_s00043p00231180 [Amborella trichopoda]
 gb|ERN12802.1| hypothetical protein AMTR_s00043p00231180 [Amborella trichopoda]
Length=842

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/836 (46%), Positives = 519/836 (62%), Gaps = 32/836 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             + D I  G+ I    + IVS    F LG+F+P  ++N Y GIWY +I  ++ VWVANRE 
Sbjct  22    SKDTISPGE-ILTKNQTIVSERGAFELGYFTPGASNNWYFGIWYKKIPKKTYVWVANREN  80

Query  2409  PILD-KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR-  2236
             P+   + G+  +  +G  V+LD    S+W+TN++   + +  VL ++  L+ L+ +G   
Sbjct  81    PLRSGRTGSLRMGVDGNLVLLDELGRSLWSTNTAGAMNTSVAVLLDSGNLV-LRQNGSNN  139

Query  2235  -PNNTIWQSFHQPTDTFLPGMRVDLSAGES--KLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                N +WQSF  PTDT LPG +V L+   S  +L T W N+ NP+PG F+ G+DP  S Q
Sbjct  140   GSENVLWQSFDHPTDTMLPGAKVGLNRKTSLNQLLTPWKNAENPAPGTFAFGLDPNGSEQ  199

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIM-FK  1891
               +W+    YWRSG W+G  F G P ++ + +Y F  +  +D +Y  Y  S   ++  F 
Sbjct  200   FFVWQNGVPYWRSGPWNGEGFSGAPEVKENNMYKFSFVDNDDEVYFTYDLSDESIVARFV  259

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G     RW E+++ W      P ++C VY  CG +  C    S    C C+ GF P
Sbjct  260   IDTTGLLKHYRWIETKQDWNLSFSLPKNKCEVYCICGVYGTCSEDGSP--ICSCLQGFEP  317

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD--FADIDRNMRS  1537
                 QW   +W+GGC R+T L C +N  EG   EKDGF  +K +KLPD  F+    + +S
Sbjct  318   KLPEQWELGDWSGGCMRKTELTCGENE-EG---EKDGFLRMKGMKLPDVFFSQPLLSNQS  373

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL---  1366
              E+C+  C  +C C+AYA     G  C +W  EL+D+  + +  G  LF+RL +SE    
Sbjct  374   TENCEAACLNNCLCSAYAFSDRKG--CWIWVGELLDLRNVFD-DGQDLFIRLAASEFHAI  430

Query  1365  ----DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEF  1198
                   + S T + + V + A + +      W+    +  ++ +  +E    +L  SG  
Sbjct  431   GNRTKGRLSHTLLSIIVVMAALILLTFACFAWMWRRAQKSVKMEPIEEFLALDLGHSGST  490

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             ++  +A  +  V+GK GA  +L  F+  S+  AT +F   +KLG+GGFG VYKG LP GQ
Sbjct  491   ATLQNAN-EHGVDGKEGACLELPSFNLGSLLIATKNFCETSKLGEGGFGPVYKGRLPDGQ  549

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             EIAVKRL+R SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+GDEK+L+YEYMPNKSLDS
Sbjct  550   EIAVKRLARSSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGDEKILVYEYMPNKSLDS  609

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             F+FDP KR++L+W KRF II  +ARGLLYLH+DSRLRIIHRDLKASNILLDGEMN KISD
Sbjct  610   FLFDPTKRTQLDWGKRFDIIIGVARGLLYLHQDSRLRIIHRDLKASNILLDGEMNAKISD  669

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FGMARIF  NQ +ANTNRVVGTYGYMAPEYAM GLFSVKSDVYSFGVLLLEIVSGR+N  
Sbjct  670   FGMARIFSINQAQANTNRVVGTYGYMAPEYAMHGLFSVKSDVYSFGVLLLEIVSGRKNNV  729

Query  477   FRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             F   +H+  ++ Y W+ W EGK + L+DPS+  SC   EVLRC+ + LLCVQ+ A  RPN
Sbjct  730   FYDAEHTLNLLGYTWQLWQEGKVLELMDPSLSESCQRSEVLRCMHVALLCVQEDATARPN  789

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             M +V   L  +  TLP P  P +   M  +    S N  +E  S N++TM++ + R
Sbjct  790   MCSVSFMLVNETATLPAPTQPAFPYGMSTT---KSENLGSESFSLNNVTMTIFMAR  842



>gb|KCW72108.1| hypothetical protein EUGRSUZ_E00547 [Eucalyptus grandis]
Length=818

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/833 (46%), Positives = 524/833 (63%), Gaps = 53/833 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I   ++I+D G +I S+   + +GFFSP G++NRYVGIWYN +   SV+WVANR+ 
Sbjct  25    GGDVITASEYIQDPG-SITSSGGLYRMGFFSPNGSANRYVGIWYNNVPRYSVLWVANRKN  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PILD +G   I+G+G  VV++GK   +W++N S + +NA   L ++  L++LK       
Sbjct  84    PILDSSGVMTISGDGNLVVMNGKRELVWSSNVSNSVTNAKAQLLDSGNLVLLKQSSNSSA  143

Query  2229  N---TIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
             N    +W+SF   TD+FL  M++  ++   E +  TSW +  +PS G FS  +DPR  P+
Sbjct  144   NDAENLWESFQHMTDSFLEKMKLSTNSRTNEKQALTSWKSPSDPSIGSFSASLDPRNIPE  203

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKV  1888
             + IW G   YWRSG W+G +F GVP M++ +  GF      +  Y+ Y       ++ K 
Sbjct  204   LFIWNGSSLYWRSGPWNGNIFTGVPEMQSVYSNGFA-----EASYMSY-------LLLKS  251

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               NG  VQ  W++S   W  +       C VY  CG F  C+   S    C C+ GF P 
Sbjct  252   --NGDLVQPYWDQSSSSWGIVWSSRLSDCDVYGQCGPFGICNAKKSP--ICSCLKGFEPK  307

Query  1707  DWNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPD----FADIDRNM  1543
             ++ +W+  NW+ GC R++ LQC    N      +KDGF +++ +K+P     F+ ++ + 
Sbjct  308   NFEEWSRGNWSSGCIRKSLLQCNGTTNGSSTAGKKDGFLKLEIMKVPSSGIFFSTLEEDC  367

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
                      C  +CSC AYA     G+ C+ W  EL+D+ +   G G+TL+VRL  SEL+
Sbjct  368   PG------NCSMNCSCVAYA--YDSGVGCVFWIGELIDLQKFSIG-GTTLYVRLAHSELE  418

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELP-TSGEFSSDF  1186
              K       +  + V    ++VI+ IW      AR +AKK+      E   +SGE  S  
Sbjct  419   KKGH--LREIIATTVIIGTLVVIIIIWF-----ARRKAKKQAVKQSMEKHLSSGEAPSVV  471

Query  1185  SAQCDLT-VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
                 +L+ VE +     + V +    +AAAT +F  ANKLG+GGFG VYKG LP GQEIA
Sbjct  472   MLGENLSRVEFQ-----EFVKYKIEELAAATGNFCEANKLGRGGFGPVYKGRLPNGQEIA  526

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             +KRLSR SGQG QEF NE+ VI K+QHRNLVRLLGCC EGDEKML+YE+MPNKSLD+F+F
Sbjct  527   IKRLSRASGQGQQEFMNEMEVICKVQHRNLVRLLGCCAEGDEKMLIYEFMPNKSLDTFIF  586

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K+  L+WR RF+I++ I RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGM
Sbjct  587   DPLKQVHLDWRTRFNIVDGICRGLLYLHRDSRLRIIHRDLKASNILLDKELNPKISDFGM  646

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGGN+N+ANT RVVGTYGYMAPEYAMEG FS KSDV+SFG+LLLEIVSGRRNTSF  
Sbjct  647   ARIFGGNENQANTRRVVGTYGYMAPEYAMEGRFSEKSDVFSFGILLLEIVSGRRNTSFHY  706

Query  468   DDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
             +D    ++  AW+ W+E   + L+DP++ ++    ++ RCI +GLLC Q+ A  RP++S 
Sbjct  707   EDQCLSLLGLAWKLWNEEDVLALVDPTMPATPFEVQLSRCINVGLLCTQERAKDRPSIST  766

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  + ++ V LP P+ P +TA  + + D DS  Q+ +  S+N +T++V+ GR
Sbjct  767   VISMINSEIVDLPRPKQPAFTAR-KITQDTDSSGQSQKTCSANDVTLTVLQGR  818



>ref|XP_011004258.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Populus euphratica]
Length=831

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/828 (45%), Positives = 507/828 (61%), Gaps = 32/828 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q+IKD  E IVSA+  F LGFFSP  ++NRYVGIWYN +   ++VWVANR +
Sbjct  27    AVDIITSSQFIKDP-EAIVSASNIFKLGFFSPVNSTNRYVGIWYNAMPTVNLVWVANRNK  85

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I  +G  VVL+G+   +W++N  V   ++   L +   L++L   G    
Sbjct  86    PLNDSSGVLKIFQDGNLVVLNGQQEILWSSNVLVGVKDSRAQLTDEGNLVLL---GKNNG  142

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N +W+SF QP +T LP MR+  +A  GES + TSW +  +PS GRFS+ +DP   P++ +
Sbjct  143   NVLWESFQQPCNTLLPNMRLSANARTGESTVLTSWISPSDPSVGRFSVSMDPLRIPEVFV  202

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKV  1888
             W  +  YWRSG W+G++F+G+P M++ ++ GF+L    D   +L   Y +  +   + + 
Sbjct  203   WNYKSPYWRSGPWNGQIFIGIPEMKSVYLDGFNLAKTADGAVSLSFTYVNQPTSNFVLRS  262

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             D  G  +++ W    + W+ I  +P  +C +Y  CG F  C+  + N   C C+ GF P 
Sbjct  263   D--GSLIERSWKVENQDWLYIWNRPETECDIYGKCGAFGSCN--AMNSPICSCLRGFAPK  318

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             + ++WN  NWT GC RRTPL+C +          DGF +++ IK+PDFA+   ++ S  +
Sbjct  319   NPDEWNKGNWTSGCVRRTPLECTETQNIREVNPADGFLKLEMIKVPDFAEWS-SLYSELE  377

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS-  1351
             C+ +C  + SC A++     GI CMLW   L+D+ +   G G+ L++RL  SELD K S 
Sbjct  378   CRNECLSNRSCIAFS--YYKGIGCMLWTRSLIDIQKFSVG-GADLYLRLAYSELDKKKSV  434

Query  1350  KTTiivavsvvaavavlvivsIW-LLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQC  1174
             K  I + V              W  +     R R  K   + ++E P       +     
Sbjct  435   KIVISITVIFGTIAFSTCAFLSWRWMVKHGERKRKSKEISLSKSEEPCRPPSDGNMIRNS  494

Query  1173  DLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
                  GK         FS   +  AT+SF ++NKLG+GGFG VY+G LP GQEIAVKRLS
Sbjct  495   G----GKVKLQELPAVFSLQELENATNSFEISNKLGEGGFGPVYRGKLPDGQEIAVKRLS  550

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             R S QG++EF NE++VI+KLQHRNLV+LL  C+EG+EKML+YEYMPNKSLD+F+FD AK 
Sbjct  551   RASQQGLEEFMNEVSVISKLQHRNLVKLLAYCVEGEEKMLVYEYMPNKSLDAFLFDSAKH  610

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
               L+W+KRF+IIE + RGLLYLHRDSRLRIIHRDLKASNILLD E+N KISDFGMAR FG
Sbjct  611   ELLDWKKRFNIIEGVCRGLLYLHRDSRLRIIHRDLKASNILLDQELNAKISDFGMARSFG  670

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-  457
             G++++A T RVVGTYGYMAPEYAMEG FS KSDVYSFGVLLLEI+SGRRN+SF  ++   
Sbjct  671   GSEDQAKTTRVVGTYGYMAPEYAMEGRFSEKSDVYSFGVLLLEIISGRRNSSFYDNEKDL  730

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
               + +AW+ W EGK   L D  +   C   E+ R I +GLLCVQ+ A  RP +  ++  L
Sbjct  731   SFLGFAWKLWTEGKLSALADRVLSDPCFQDEIYRSIHVGLLCVQEFARDRPAVPTIISML  790

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              ++ V LP P+ P     M        W Q      SN IT++VI GR
Sbjct  791   HSEIVDLPAPKKPALGFDMGSL----QWRQT---ICSNDITITVIGGR  831



>ref|XP_010646878.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X2 [Vitis vinifera]
Length=813

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/829 (44%), Positives = 518/829 (62%), Gaps = 49/829 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I    +IKD  E IVS+   F LGFFS +G+SNRYVGIWYN     +++WVAN++R
Sbjct  24    AIDTITSTHFIKDP-ETIVSSGRVFKLGFFSLDGSSNRYVGIWYNTTSLLTIIWVANKDR  82

Query  2409  PILDKNGAFGITGNGTFVVLDG-KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D +G   I+ +G   VL+G K +   +  S+  + N++  L+++  L++   +G   
Sbjct  83    PLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAAVNSSAQLQDSGNLVLRDKNG---  139

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGES--KLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               ++W+S   P+ +F+P M++  +      K+ TSW +S +PS G F+ G++P   PQ+ 
Sbjct  140   -VSVWESLQNPSHSFVPQMKISTNTRTRVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSSDLIM-FKVD  1885
             IW G + YWRSG WDG++  GV ++   + G +++ + +  +Y+ +    S     + + 
Sbjct  199   IWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTVYVTFAHPESGFFYAYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G  V+   ++  + W ++     ++C +Y  CG F  C NS  + I C C+ G+ P  
Sbjct  259   PEGILVETSRDKRNEDWERVWTTKENECEIYGKCGPFGHC-NSRDSPI-CSCLKGYEPKH  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWTGGC R+TPLQC++       A+ DGF ++ ++K+PDFA+    +      
Sbjct  317   TQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKVPDFAEQSYALED----  372

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
               + +   +C+  A     GI CM W  +L+D+ +L   +G+ LF+R+  SEL      T
Sbjct  373   DCRQQCLRNCSCIAYSYYTGIGCMWWSGDLIDIQKLSS-TGANLFIRVAHSELKQVIIGT  431

Query  1344  TiivavsvvaavavlvivsIWLLCS---RR--ARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
               I                   LC+   RR  AR RAKK  +I        G+FS D S 
Sbjct  432   IAIA------------------LCTYFLRRWIARQRAKK-GKIEELLSFNRGKFS-DPSV  471

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
               D   + K     +L    F+ +A AT++F  ANKLGQGGFG VY+G L  GQ+IAVKR
Sbjct  472   PGDGVNQVKL---EELPLIDFNKLATATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKR  528

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSR S QG++EF NE+ VI+KLQHRNLVRL+GCCIEGDEKML+YE+MPNKSLD+ +FDP 
Sbjct  529   LSRASTQGLEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPV  588

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             KR  L+WR RF IIE I RGLLYLHRDSRLRIIHRDLKASNILLD ++NPKISDFGMARI
Sbjct  589   KRQILDWRTRFKIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEDLNPKISDFGMARI  648

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FG NQ++ANT RVVGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+N+SF  +++
Sbjct  649   FGSNQDQANTKRVVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEY  708

Query  459   SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
               ++ YAW+ W E     L+D SI  +C  +E+LRCI +GLLCVQ+LA  RP++S VV  
Sbjct  709   FTLLGYAWKLWKEDNMKTLIDGSILEACFQEEILRCIHVGLLCVQELAKDRPSVSTVVGM  768

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + ++   LP P+ P +T  MR  +D++S ++   L   N +++++I GR
Sbjct  769   ICSEIAHLPPPKQPAFT-EMRSGIDIESSDKKCSL---NKVSITMIEGR  813



>ref|XP_008776768.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Phoenix dactylifera]
Length=1504

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/823 (47%), Positives = 537/823 (65%), Gaps = 25/823 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D ++ GQ ++D GE ++SA E F LGFF P  +SNRYVGIWY   I  +V+WVANRE 
Sbjct  26    ATDTLKPGQSLQD-GETLISAGEMFELGFFRPGKSSNRYVGIWYRFSI-NTVLWVANRES  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI D +G+  I  +G  VVLDG   SIW++N+S+ S+++ + L ++  L ++     R  
Sbjct  84    PITDNSGSVAIGHDGNLVVLDGTKSSIWSSNTSMASNDSLVRLTDSGNLELID----RSG  139

Query  2229  NTIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +  WQSF  PT+T++PGM+  +DL    ++  TSWT+  +P+PG FS+G+DP  S QI +
Sbjct  140   SVAWQSFDHPTNTYMPGMKAGLDLRTHVNQKLTSWTSEDDPAPGNFSLGMDPSESTQIYM  199

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG WD + F+G+  M   +VYGF L    +   +Y  Y + ++    + + 
Sbjct  200   WEGTKPRWRSGRWDQQTFIGIQNMVPTYVYGFRLSNFQQEQKMYFYYNALNNS-PRYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             W+G      W    K W +   QP   C +YN CG++  C + ++    C C+ GF P+ 
Sbjct  259   WDGIMKHMIWRNDTKDWYQYWAQPVTDCEIYNTCGKYGSCTDGATP--ICSCLKGFVPAS  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +W+  NW+ GCTRRTPL C + N+ G  A  DGF  +  + LPD +D +  +     C
Sbjct  317   SEEWSKGNWSSGCTRRTPLGCGRGNSSGE-AGGDGFWRLGGVNLPDISDWNDGV-DINGC  374

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             +++C  +CSC AYA     GI C++W  +L+D+     G G+ L++RL  SELD K++KT
Sbjct  375   EERCLRNCSCTAYA--FVTGIGCLIWGVDLLDIHIFSSG-GNDLYLRLAGSELDKKNNKT  431

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTS--GEFSSDFSAQCD  1171
              II+ V+V   +++  I  +W  C  R +   K+R    R  + ++   E  +D+S    
Sbjct  432   FIIIIVTVTVVLSLGCIYLLWK-CKNRIKELFKQRLVGGRGLMDSTRGQERLTDYSDSTG  490

Query  1170  LTV--EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
               +  EG  G   +L  +SF S+ AAT SFS +N +G+GGFG V+KG+LP GQEIAVKRL
Sbjct  491   NRIGEEGSDGKCPELSLWSFDSVVAATKSFSSSNFIGEGGFGPVFKGILPEGQEIAVKRL  550

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             SR S QG+ E  NE+ +IAKLQHRNLVRLLGCCI+ +EK+L+YEY+PNKSLD+F+FDP K
Sbjct  551   SRSSMQGLDELKNEVMLIAKLQHRNLVRLLGCCIQEEEKILIYEYLPNKSLDAFLFDPIK  610

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             R  L+W+ R++IIE IARGL+YLHRDSRLR+IHRDLK SNILLD +MNPKISDFGMARIF
Sbjct  611   RGLLDWKTRYNIIEGIARGLVYLHRDSRLRVIHRDLKPSNILLDEDMNPKISDFGMARIF  670

Query  636   GGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS  457
             G ++NE NT R+VGT+GYM+PEYAM+GLFSVKSDVYSFGVLLLEIVSG +  +FR  + +
Sbjct  671   GNDENETNTKRLVGTFGYMSPEYAMQGLFSVKSDVYSFGVLLLEIVSGSKCNTFRHPELA  730

Query  456   -GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLF  280
               +I YAW+ W+E + M  +DP+I  SC  +EV RCI +GLLCVQD    RPNM++VV+ 
Sbjct  731   MNLIAYAWKLWNEDRVMEFVDPTISDSCSRREVSRCINVGLLCVQDRPNDRPNMASVVIM  790

Query  279   LETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITM  151
             L ++ V  P+PR P +T     S    S    N + ++ SITM
Sbjct  791   LGSEIVNHPLPRRPMFTVERNFSETNSSTIDLNVMSANASITM  833


 Score =   525 bits (1353),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 285/540 (53%), Positives = 379/540 (70%), Gaps = 17/540 (3%)
 Frame = -3

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD  1558
             C C+ GF PS   +W+  NW+GGC RRTPL CQ N +       DGF  V  +KLPD ++
Sbjct  977   CSCLDGFEPSSREEWSRGNWSGGCVRRTPLDCQLNRS------GDGFFRVAGVKLPDHSN  1030

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
                 + +   C+  C  +CSC AYA     GI CM W  +L+D+ Q  EG  + L+++L 
Sbjct  1031  WASTVLNEAGCETACLNNCSCKAYA--FVSGIGCMTWVRDLIDIYQYPEGD-NDLYLKLP  1087

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRAR----IRAKKRDEIPRTELPT  1210
             +SEL   S +  IIV VS +    ++  + +    ++R +    +  KK D +    L  
Sbjct  1088  ASELGTDSKRWKIIVTVSTLGGFFLITCIFLGWKYNKRIKDWLKMGRKKHDLLHNMFL--  1145

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             + E   DFS   +   E + G  ++L  ++F  I+ ATD+FS +NKLG+GGFGHVYKG+L
Sbjct  1146  NREVRPDFSGPSEYGEEVQEGEGAELPLYTFECISIATDNFSESNKLGEGGFGHVYKGML  1205

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P G+EIAVKRLSR SGQG++EF NE+ +IAKLQHRNLV+LLG CI+G+EK+L+YEYMPNK
Sbjct  1206  PGGEEIAVKRLSRSSGQGLEEFKNEVILIAKLQHRNLVKLLGYCIQGEEKILIYEYMPNK  1265

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD+F+F PAK++ L+WR RF+IIE IARGLLYLHRDSRLRI+HRDLKASNILLD +MNP
Sbjct  1266  SLDAFLFRPAKQALLDWRTRFNIIEGIARGLLYLHRDSRLRIVHRDLKASNILLDEDMNP  1325

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGG+QN+ANTNRVVGT+GYM+PEYAMEGLFSVKSDVYSFG+L+LEIV+GR
Sbjct  1326  KISDFGMARIFGGDQNQANTNRVVGTFGYMSPEYAMEGLFSVKSDVYSFGILVLEIVTGR  1385

Query  489   RNTSF-RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RN SF  T++   I+ YAW+ W+E K + L+DPSI  SC  ++V+RCI +GLLCVQD A 
Sbjct  1386  RNNSFHHTENSLNIVGYAWQLWNEDKAVELIDPSIRPSCSIRQVIRCIHIGLLCVQDRAN  1445

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              RP++  ++L L +  V LP+P+ PTYTA      + D      E  +++ IT++++ GR
Sbjct  1446  ERPDIPTIILMLASQAVILPMPKQPTYTAEGSPH-ESDLMANKYESFTTSDITITMLHGR  1504


 Score = 61.6 bits (148),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = -3

Query  2283  LRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPS  2110
             L ++  L++   +G      +W+SF  PTDTFLPGM++  D   G  ++FTSW    +PS
Sbjct  869   LLDSGNLVLRSANG----RVLWESFDHPTDTFLPGMKIGLDTKTGRRQIFTSWKGPDDPS  924

Query  2109  PGRFSMGIDPRASPQ  2065
              G +++ +DP  S Q
Sbjct  925   AGNYTLSLDPLGSAQ  939



>ref|XP_006464588.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330-like isoform X1 [Citrus sinensis]
Length=840

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/835 (46%), Positives = 527/835 (63%), Gaps = 41/835 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTS-NRYVGIWYNE--IIPQSVVWVAN  2419
             A D I   Q+I D  E I+S   KF LGFFSP+G S NRY+GIWYN+     ++VVWVAN
Sbjct  31    ATDTITSSQFIGDP-EAIISIGSKFKLGFFSPDGNSTNRYIGIWYNKGGSANKTVVWVAN  89

Query  2418  RERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTD  2245
             R +P+ D +G F I  +G  VVL+G+       N +S V +SN    L ++  L++    
Sbjct  90    RSKPLNDSSGIFTIWEDGNLVVLNGQKEIHWSSNVSSLVKNSNTRAQLLDSGNLVLHDN-  148

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
                   +IW SF + TDTF   M+V  DL  G+    TSW +  NPS G FS G+D    
Sbjct  149   --ISQVSIWDSFQEATDTFYSEMKVSTDLRTGKKVQLTSWRSLSNPSIGSFSAGLDSFTI  206

Query  2070  PQIVIW-EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND--NLYLEYKSSSSDL  1903
             P++ IW  G + YWRSG W+GR F+G+P M + ++ GF+L  ++     YL +  + +D 
Sbjct  207   PEVFIWINGTRPYWRSGPWNGRYFIGIPDMNSVYLDGFNLGEDHQKGTRYLTFAFADND-  265

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
             + F +   G   ++ W + +         P + C VY  CG F  C NS    I C C++
Sbjct  266   VFFTLTPQGNLEERAWVDGKAHLKIYFFYPTNDCDVYGKCGAFGSC-NSQKIPI-CSCLL  323

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQK----NNTEGGGAEKDGFREVKHIKLPDFADI  1555
             GF P +   WN  NW+GGC RR PL CQ+    +  EG   ++DGF +++ +K+P FA+ 
Sbjct  324   GFEPKNAEDWNRGNWSGGCVRRKPLLCQRTVKPSEVEG---KQDGFFKLETMKVPYFAE-  379

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
              R+    + CK +C  +CSC AYA  +  G+ CM+W + L+D+ +L  G G+ L++R+  
Sbjct  380   -RSSAKEDKCKDQCLNNCSCKAYAYEI--GVGCMIWTHNLIDIRKLPSG-GTNLYIRVAH  435

Query  1374  SELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFS  1195
              ELD K  K  II++V V      +     W   ++R  +  K+  ++ R +L   GE  
Sbjct  436   EELDRKDMKLVIILSVIVGIIAIAICTFFAWRWFAKRKAM--KENSKVQRLDL---GEAY  490

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             ++FS     T +       DL+ F+F  +A AT++F LANKLGQGGFG VYKG L  GQE
Sbjct  491   ANFS-----TEKVNPARLQDLLVFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDGQE  545

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLS+ SGQG +EF NE+ VI+ LQHRNLVRLLGCC+E +E ML+YEYMPNKSLDSF
Sbjct  546   IAVKRLSKASGQGQEEFMNEVMVISNLQHRNLVRLLGCCVEREENMLIYEYMPNKSLDSF  605

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP ++S L+W KRF+II+ I+RGLLYLHRDSRLRIIHRDLKASNILLD ++NPKISDF
Sbjct  606   LFDPQRQSLLDWPKRFNIIKGISRGLLYLHRDSRLRIIHRDLKASNILLDDDLNPKISDF  665

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+ARIFGGNQ++A T R+VGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF
Sbjct  666   GLARIFGGNQDQAATKRLVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSF  725

Query  474   RTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
               ++    ++ YAW+ W++   ++L+DP I  S    E++RC+ +GLLCVQ+    RPNM
Sbjct  726   YHEEFELTLLGYAWKLWNDNNVIDLVDPLISESGFKMEIIRCVNVGLLCVQEFVKDRPNM  785

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               VV  L ++   LP  + P +T          S NQN ++ S N +T++++ GR
Sbjct  786   PTVVSMLNSEIKDLPAAKQPAFTVRRGAYDSASSSNQNQQICSINDVTVTLMEGR  840



>emb|CBI25710.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/824 (43%), Positives = 519/824 (63%), Gaps = 35/824 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I    +IKD  E IVS+   F LGFFS +G+SNRYVGIWYN     +++WVAN++R
Sbjct  24    AIDTITSTHFIKDP-ETIVSSGRVFKLGFFSLDGSSNRYVGIWYNTTSLLTIIWVANKDR  82

Query  2409  PILDKNGAFGITGNGTFVVLDG-KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D +G   I+ +G   VL+G K +   +  S+  + N++  L+++  L++   +G   
Sbjct  83    PLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAAVNSSAQLQDSGNLVLRDKNG---  139

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGES--KLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               ++W+S   P+ +F+P M++  +      K+ TSW +S +PS G F+ G++P   PQ+ 
Sbjct  140   -VSVWESLQNPSHSFVPQMKISTNTRTRVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSSDLIM-FKVD  1885
             IW G + YWRSG WDG++  GV ++   + G +++ + +  +Y+ +    S     + + 
Sbjct  199   IWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTVYVTFAHPESGFFYAYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G  V+   ++  + W ++     ++C +Y  CG F  C NS  + I C C+ G+ P  
Sbjct  259   PEGILVETSRDKRNEDWERVWTTKENECEIYGKCGPFGHC-NSRDSPI-CSCLKGYEPKH  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWTGGC R+TPLQC++       A+ DGF ++ ++K+PDFA+    +      
Sbjct  317   TQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKVPDFAEQSYALED----  372

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
               + +   +C+  A     GI CM W  +L+D+ +L   +G+ LF+R+  SEL     + 
Sbjct  373   DCRQQCLRNCSCIAYSYYTGIGCMWWSGDLIDIQKL-SSTGANLFIRVAHSELKQDRKRD  431

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
               ++ +  V    + + +  + L     R  A++R  +        G+FS D S   D  
Sbjct  432   ARVIVIVTVIIGTIAIALCTYFL----RRWIARQRGNL------LIGKFS-DPSVPGDGV  480

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              + K     +L    F+ +A AT++F  ANKLGQGGFG VY+G L  GQ+IAVKRLSR S
Sbjct  481   NQVKL---EELPLIDFNKLATATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRAS  537

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QG++EF NE+ VI+KLQHRNLVRL+GCCIEGDEKML+YE+MPNKSLD+ +FDP KR  L
Sbjct  538   TQGLEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPVKRQIL  597

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR RF IIE I RGLLYLHRDSRLRIIHRDLKASNILLD ++NPKISDFGMARIFG NQ
Sbjct  598   DWRTRFKIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEDLNPKISDFGMARIFGSNQ  657

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             ++ANT RVVGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+N+SF  +++  ++ 
Sbjct  658   DQANTKRVVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEYFTLLG  717

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W E     L+D SI  +C  +E+LRCI +GLLCVQ+LA  RP++S VV  + ++ 
Sbjct  718   YAWKLWKEDNMKTLIDGSILEACFQEEILRCIHVGLLCVQELAKDRPSVSTVVGMICSEI  777

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               LP P+ P +T  MR  +D++S ++   L   N +++++I GR
Sbjct  778   AHLPPPKQPAFT-EMRSGIDIESSDKKCSL---NKVSITMIEGR  817



>ref|XP_010646876.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Vitis vinifera]
Length=826

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/824 (43%), Positives = 519/824 (63%), Gaps = 26/824 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I    +IKD  E IVS+   F LGFFS +G+SNRYVGIWYN     +++WVANR+R
Sbjct  24    AIDTITSTHFIKDP-ETIVSSGRVFKLGFFSLDGSSNRYVGIWYNTTSLLTIIWVANRDR  82

Query  2409  PILDKNGAFGITGNGTFVVLDG-KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D +G   I+ +G   VL+G K +   +  S+    N++  L+++  L++   +G   
Sbjct  83    PLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAGVNSSAQLQDSGNLVLRDNNG---  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               ++W+S   P+ +F+P M++  +   G  K+ TSW +S +PS G F+ G++P   PQ+ 
Sbjct  140   -VSVWESLQNPSHSFVPQMKISTNTRTGVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSSDLIM-FKVD  1885
             IW G + YWRSG WDG++  GV ++   + G +++ + +  +Y+ +    S     + + 
Sbjct  199   IWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTVYITFAYPDSGFFYAYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G  V+   ++  + W ++ +   ++C +Y  CG F  C NS  + I C C+ G+ P  
Sbjct  259   PEGILVETSRDKRNEDWERVWKTKENECEIYGKCGPFGHC-NSRDSPI-CSCLKGYEPKH  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWTGGC R+TPLQC++       A+ DGF ++ ++K+PDFA+    +      
Sbjct  317   TQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKVPDFAEQSYALED----  372

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
               + +   +C+  A     GI CM W  +L+D+ +L   +G+ LF+R+  SE+     + 
Sbjct  373   DCRQQCLRNCSCIAYSYHTGIGCMWWSGDLIDIQKLSS-TGAHLFIRVAHSEIKQDRKRG  431

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
               ++ +  V    + + +  + L    A+ RAKK  +I        G+FS D S   D  
Sbjct  432   ARVIVIVTVIIGTIAIALCTYFLRRWIAKQRAKK-GKIEEILSFNRGKFS-DPSVPGDGV  489

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              + K     +L    F+ ++ AT++F  ANKLGQGGFG VY+G L  GQ+IAVKRLSR S
Sbjct  490   NQVKL---EELPLIDFNKLSTATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRAS  546

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QG++EF NE+ VI+KLQHRNLVRL+GCCIEGDEKML+YE+MPNKSLD+ +FDP KR  L
Sbjct  547   TQGLEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPVKRQLL  606

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR RF IIE I RGLLYLHRDSRLRIIHRDLKA NILLD ++NPKISDFGMARIFG +Q
Sbjct  607   DWRTRFKIIEGIGRGLLYLHRDSRLRIIHRDLKAGNILLDEDLNPKISDFGMARIFGSDQ  666

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             ++ANT RVVGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+N+SF  +++  ++ 
Sbjct  667   DQANTKRVVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEYFTLLG  726

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W E     L+D SI  +C  +E+LRCI +GLLCVQ+LA  RP++S VV  + ++ 
Sbjct  727   YAWKLWKEDNMETLIDGSILEACFQEEILRCIHVGLLCVQELAKDRPSISTVVGMICSEI  786

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               LP P+ P +T  MR  ++ +S  +   L   N +++++I GR
Sbjct  787   AHLPPPKQPAFT-EMRSGINTESSYKKCSL---NKVSITMIEGR  826



>ref|XP_002262971.3| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Vitis vinifera]
Length=826

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/824 (43%), Positives = 520/824 (63%), Gaps = 26/824 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I    +IKD  E IVS+   F LGFFS +G+SNRYVGIWYN     +++WVANR+R
Sbjct  24    ATDTITSTHFIKDP-ETIVSSGRVFKLGFFSLDGSSNRYVGIWYNTTSLLTIIWVANRDR  82

Query  2409  PILDKNGAFGITGNGTFVVLDG-KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             P+ D +G   I+ +G   VL+G K +   +  S+    N++  L+++  L++   +G   
Sbjct  83    PLNDSSGVLTISEDGNIQVLNGRKEILWSSNVSNPAGVNSSAQLQDSGNLVLRDNNG---  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               ++W+S   P+ +F+P M++  +   G  K+ TSW +S +PS G F+ G++P   PQ+ 
Sbjct  140   -VSVWESLQNPSHSFVPQMKISTNTRTGVRKVLTSWKSSSDPSMGSFTAGVEPLNIPQVF  198

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSSDLIM-FKVD  1885
             IW G + YWRSG WDG++  GV ++   + G +++ + +  +Y+ +    S     + + 
Sbjct  199   IWNGSRPYWRSGPWDGQILTGVDVKWITLDGLNIVDDKEGTVYITFAYPDSGFFYAYVLT  258

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G  V+   ++  + W ++ +   ++C +Y  CG F  C NS  + I C C+ G+ P  
Sbjct  259   PEGILVETSRDKRNEDWERVWKTKENECEIYGKCGPFGHC-NSRDSPI-CSCLKGYEPKH  316

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWTGGC R+TPLQC++       A+ DGF ++ ++K+PD A+    +      
Sbjct  317   TQEWNRGNWTGGCVRKTPLQCERTKNGSEEAKVDGFLKLTNMKVPDLAEQSYALED----  372

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
               + +   +C+  A     GI CM W  +L+D+ +L   +G+ LF+R+  SEL     + 
Sbjct  373   DCRQQCLRNCSCIAYSYHTGIGCMWWSGDLIDIQKLSS-TGAHLFIRVAHSELKQDRKRG  431

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
               ++ +  V    + + +  + +    A+ RAKK  +I        G+FS D S   D  
Sbjct  432   ARVIVIVTVIIGTIAIALCTYFIRRWIAKQRAKK-GKIEEILSFNRGKFS-DPSVPGDGV  489

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
              + K     +L+   F+ ++ AT++F  ANKLGQGGFG VY+G L  GQ+IAVKRLSR S
Sbjct  490   NQVKL---EELLLIDFNKLSTATNNFHEANKLGQGGFGPVYRGKLAEGQDIAVKRLSRAS  546

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QG++EF NE+ VI+KLQHRNLVRL+GCCIEGDEKML+YE+MPNKSLD+ +FDP KR  L
Sbjct  547   TQGLEEFMNEVVVISKLQHRNLVRLIGCCIEGDEKMLIYEFMPNKSLDASLFDPVKRQLL  606

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR RF IIE I RGLLYLHRDSRLRIIHRDLKA NILLD ++NPKISDFGMARIFG +Q
Sbjct  607   DWRTRFKIIEGIGRGLLYLHRDSRLRIIHRDLKAGNILLDEDLNPKISDFGMARIFGSDQ  666

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             ++ANT RVVGTYGYM+PEYAM+G FS KSDV+SFGVLLLEIVSGR+N+SF  +++  ++ 
Sbjct  667   DQANTKRVVGTYGYMSPEYAMQGRFSEKSDVFSFGVLLLEIVSGRKNSSFYHEEYFTLLG  726

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W E     L+D S+  +C  +E+LRCI +GLLCVQ+LA  RP++S VV  + ++ 
Sbjct  727   YAWKLWKEDNMKTLIDGSMLEACFQEEILRCIHVGLLCVQELAKDRPSISTVVGMICSEI  786

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               LP P+ P +T  MR  ++ +S ++   L   N +++++I GR
Sbjct  787   AHLPPPKQPAFT-EMRSGINTESSDKKCSL---NKVSITMIEGR  826



>ref|XP_002316678.2| hypothetical protein POPTR_0011s03900g [Populus trichocarpa]
 gb|EEE97290.2| hypothetical protein POPTR_0011s03900g [Populus trichocarpa]
Length=824

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/799 (44%), Positives = 502/799 (63%), Gaps = 24/799 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q+IKD  E +VSA  KF LGFFSP  ++NRYVGIWY+ I   + VW+ANR +
Sbjct  18    AVDTITSSQYIKDP-EAVVSAGNKFKLGFFSPGNSTNRYVGIWYSNISVTTPVWIANRNK  76

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+ +G  VVLDG+   +W++N S   SN++  L +   +I+    G    
Sbjct  77    PLNDSSGIMTISEDGNIVVLDGRKEILWSSNVSNGVSNSSAQLTDDGNVIL---RGGEIG  133

Query  2229  NTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N++WQSF +P+DTF+  MR+  +   G+    TSW +  +PS G FS GI+P + P++ +
Sbjct  134   NSLWQSFQEPSDTFMLKMRLTANRRTGKKTQITSWKSPSDPSVGSFSSGIEPSSIPEVFV  193

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLY-LEYKSSSSDLIM-FKVD  1885
             W   + +WRSG W+G+ F+G+P M + ++ G++L+ + D  + L    ++   I  F + 
Sbjct  194   WNDSRPFWRSGPWNGQAFIGIPEMNSVYLNGYNLVQDGDGTFSLSVGLANESYITNFALS  253

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             + G+  +  W+ + ++W   ++ P D C +Y  CG F  C+  + N + C C+ GF P +
Sbjct  254   YEGRFGEMYWDSANERWEHKKQYPGDDCDIYGKCGPFGFCN--TQNSLICRCLKGFEPKN  311

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
              ++WN RNWT GC RR  L+C++  ++G   ++D F ++  +K+PDF++      S  + 
Sbjct  312   SDEWNRRNWTNGCVRRRELKCERTQSDGQVPKEDEFLKLDKVKVPDFSEWSS---SASEQ  368

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-DNKSSK  1348
               K E   +C+  A     GI CMLWR +L D+ +   G G+ L+VRL   E   N+  K
Sbjct  369   NCKDECLNNCSCIAYSYHTGIGCMLWRGKLTDIRKFSSG-GANLYVRLADLEFGKNRDMK  427

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
               I + V   A +  +     W    R A+ R +KR+            +   F+   +L
Sbjct  428   AVISITVVTGAIIVAVGAFFWW---RRMAKYRERKRESERILSSRRKKGYPIFFNG--NL  482

Query  1167  TVEGKAGAS-SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
               E        +L  F    + AATD F  ANKLG+GGFG VY+G LP GQEIAVKRLSR
Sbjct  483   IQESMNQVKFQELPLFKLQMLIAATDYFDAANKLGEGGFGPVYRGNLPDGQEIAVKRLSR  542

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG +EF NE+ VI++LQH+NLVRLLGCC+EGDEKML+YEYMPNKSLD+ +FDP ++ 
Sbjct  543   ASGQGQEEFMNEVVVISELQHKNLVRLLGCCVEGDEKMLVYEYMPNKSLDASLFDPVRKE  602

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+W+KRF+I++ I RGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG
Sbjct  603   VLDWKKRFNIVDGICRGLLYLHRDSRLRIIHRDLKPSNILLDQELNPKISDFGMARIFGG  662

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-G  454
             N++   T RVVGTYGYM+PEYAM G FS KSDV+SFGVLLLEIVSGRR+T    ++    
Sbjct  663   NEDHVKTRRVVGTYGYMSPEYAMHGRFSEKSDVFSFGVLLLEIVSGRRSTKIDGNEQGLN  722

Query  453   IIEYAWEQWDEGKPMNLLDPSI-FSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
             ++E+AW+ W+EG    L+DP++        E+ RCI +GLLCVQ+ A  RP +S ++  L
Sbjct  723   LLEFAWKLWNEGNAPALVDPALTLDQYSKVEIFRCIHVGLLCVQEFAKDRPAISTIISML  782

Query  276   ETDNVTLPVPRPPTYTASM  220
              ++ V LP+P  P YT  +
Sbjct  783   NSEIVDLPLPNNPAYTERL  801



>ref|XP_007022283.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
 gb|EOY13808.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
Length=838

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/828 (45%), Positives = 519/828 (63%), Gaps = 24/828 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   + IKD  E I+S N  F+LGFF+   +++RYVGIWYN I  Q+VVWVANR +
Sbjct  26    ALDTITPSKSIKDP-EVIISKNGVFLLGFFNFANSTHRYVGIWYNHIPVQTVVWVANRNK  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+ +G  VVL+G+   +W++N +   SN + +L ++  L+ LK D     
Sbjct  85    PLKDSSGVVKISEDGNLVVLNGQEEILWSSNVTNLISNTSALLLDSGNLV-LKNDDDDNG  143

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
              +IW+SF  P++ + P M++  DL  G+    +SW +  +PS G FS+ ++P   P+++I
Sbjct  144   ASIWESFQHPSNAYTPTMKISTDLRTGQRVQLSSWKSPSDPSDGNFSLSLEPLNIPEVII  203

Query  2055  WEGEKRYWRSGHWDGRVFLG-VPMRTDFVYGFDLITEN--DNLYLEYK-SSSSDLIMFKV  1888
                 + Y+R+G W+G++F+G + M + ++ GF L+ ++  +  YL Y  ++ S L  F+ 
Sbjct  204   LNNNQPYFRTGPWNGQIFIGMLHMNSVYLNGFSLVADDQKETFYLSYALANKSMLAYFEF  263

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             +  GK ++  W+E +  W        + C VY  CG F  CD+   +   C C+ GF P 
Sbjct  264   NPQGKIIELHWDEGKGDWANNWPILENDCDVYGKCGAFGSCDSMKPSI--CSCLRGFEPK  321

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NW  GC R TPL CQK N      + DGF +++ +K+P FA+      SP +
Sbjct  322   NREEWNRENWASGCVRTTPLGCQKVNNGSDVGKDDGFLKLEMMKVPAFAE----WSSPLE  377

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD-NKSS  1351
                + +   +C+  A     GI CMLW   L+D+ +     G  L++R+ SSELD  K S
Sbjct  378   ETCEEQCLRNCSCVAYAYDVGIGCMLWSGNLIDIQKF-PSRGVDLYIRVASSELDRKKKS  436

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K  II  +  +  + +        +   R R + K ++ +P        +FSSD     +
Sbjct  437   KVVIITVIVGIIIITIATFFLRSWMAKHRGR-KQKTKEMLPFDIGKAVAKFSSDNVVGEN  495

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
             L  E K      L  F+F  +A+AT++F L  KLG GGFG VY+G L  G+EIAVKRLSR
Sbjct  496   L-FEVKL---QQLPLFNFEELASATNNFHLTEKLGHGGFGPVYRGTLQDGKEIAVKRLSR  551

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++EF NE+ VI+KLQHRNLVRLLGCC+E +EKML+YEYMPNKSLD+F+FD  +R 
Sbjct  552   ASGQGLEEFMNEVVVISKLQHRNLVRLLGCCVEREEKMLVYEYMPNKSLDAFLFDQVQRQ  611

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              LNW K F+IIE I+RGLLYLHRDSRLRIIHRD+KASNILLD ++NPKISDFGMARIFGG
Sbjct  612   FLNWEKCFNIIEGISRGLLYLHRDSRLRIIHRDIKASNILLDQDLNPKISDFGMARIFGG  671

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-G  454
             N+N ANT RV+GTYGYM+PEYAM+G FS KSDV+SFGVLLLEIVSGR+NTSF  + HS  
Sbjct  672   NENHANTKRVMGTYGYMSPEYAMQGQFSEKSDVFSFGVLLLEIVSGRKNTSFYNNQHSFS  731

Query  453   IIEYAWEQWDEGKPMNLLDPSIFS-SCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
             ++ YAW+ W E   + L+D  +   S   +E+LRCI +GLLCVQ+ A  RP MS VV  L
Sbjct  732   LLGYAWKLWKEDNILGLVDMEVSDPSYDEKEILRCIHVGLLCVQEFAKERPAMSRVVSML  791

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              ++ V LP P+ P +T   + + DV+S   N +  S N ++++   GR
Sbjct  792   NSEIVDLPPPKQPAFTER-QINQDVESLPNNEDKFSVNDVSITDFDGR  838



>gb|KCW74916.1| hypothetical protein EUGRSUZ_E03662 [Eucalyptus grandis]
Length=740

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/735 (51%), Positives = 484/735 (66%), Gaps = 29/735 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
              A+ + QGQ ++D GE +VS +  F LGFF  E +S RYVGIWY +I  ++ VWVANR+ 
Sbjct  11    TANSLSQGQLVRD-GETLVSRSGNFELGFFRTENSSLRYVGIWYRKISFKTYVWVANRDS  69

Query  2409  PILDKNGAFGITGNGTFVVLDG--KnvsiwntnssvtssnatmVLRNTSELIIL------  2254
             P+ D++G   I+ +G  +VLDG  + V     NS+   +N+T VL +   L++L      
Sbjct  70    PVSDESGVLTISSDGNLMVLDGDHRLVWSSGINSTSVPTNSTAVLTDAGNLVLLAKADAD  129

Query  2253  --KTDGWRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGI  2086
                 DG   +N  WQSF  PTDTFLPGMRV +  +AGE+  F SW +  +PSPG +SMG+
Sbjct  130   TASADG-HVSNAYWQSFEHPTDTFLPGMRVRVNSAAGENHAFRSWRSLNDPSPGNYSMGV  188

Query  2085  DPRASPQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFV-YGFDLIT--ENDNLYLEYKS-  1918
             DP+  PQIVIW    R WRSGHW+G +F G+P  T+ + YGF L    E+ ++Y  Y   
Sbjct  189   DPQLPPQIVIWGQSGREWRSGHWNGLLFTGMPNMTENIRYGFRLSAPEEDGSMYFTYTPL  248

Query  1917  SSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN  1738
             + SDL+MF++ WNG   +  W+E+  +   +Q+QPA +C +YN CG FA C++  S    
Sbjct  249   NRSDLLMFRILWNGMGEELGWDETNNESTVLQKQPAKECDLYNKCGDFAICNDMGSP--K  306

Query  1737  CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNT--EGGGAEKDGFREVKHIKLPDF  1564
             C C+ GF P   +QW   NW+ GCT +T LQC  N++   G G   D F ++  +KLPDF
Sbjct  307   CSCMEGFIPKSPDQWKRGNWSMGCTWKTRLQCGNNSSISVGNGGRMDHFLKLVGVKLPDF  366

Query  1563  ADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVR  1384
             AD   +  S ++C+ KC E+CSC AYA      I CM+W   L+D+    EG G TL +R
Sbjct  367   ADY-FSATSGDECEVKCLENCSCKAYA--FVRSIGCMMWNKNLIDVQHFAEG-GMTLQIR  422

Query  1383  LHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSG  1204
             L +SE   KS K + +  +      A +  ++++LL   R +   K    +       S 
Sbjct  423   LANSEPGTKS-KISNLRMIVTAFVGAFVSGITVFLLW--RFKDNLKGEISVCGVNDLLSE  479

Query  1203  EFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPC  1024
             E   D S    L  + K      +  F FSSI AAT+ FS  NKLG GGFG VYKG L  
Sbjct  480   EQYLDLSRPDGLASDAKQVGGPRIPVFDFSSIEAATNVFSEENKLGLGGFGPVYKGKLLG  539

Query  1023  GQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSL  844
             GQEIAVKRLSR+S QGV+EF NE+ VIA+LQHRNLVRLLG CI+G++KML+YEYMPN+SL
Sbjct  540   GQEIAVKRLSRKSSQGVEEFKNEVMVIARLQHRNLVRLLGFCIQGEDKMLVYEYMPNRSL  599

Query  843   DSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKI  664
             D F+FDPAKR++LNW+KR  IIE IARG+LYLHRDSRLRIIHRDLK SNILLD EMNPKI
Sbjct  600   DYFIFDPAKRAQLNWKKRLEIIEGIARGILYLHRDSRLRIIHRDLKVSNILLDEEMNPKI  659

Query  663   SDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN  484
             SDFGMARIFGGN+NEA+TNRVVGTYGYM+PEYAMEGLFS KSDVYSFGVLLLEI+SG +N
Sbjct  660   SDFGMARIFGGNENEASTNRVVGTYGYMSPEYAMEGLFSFKSDVYSFGVLLLEIISGEKN  719

Query  483   TSFRTDDHSGIIEYA  439
               FRT +HS +I + 
Sbjct  720   IGFRTPEHSNLISHV  734



>ref|XP_010268956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Nelumbo nucifera]
Length=985

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/818 (46%), Positives = 515/818 (63%), Gaps = 26/818 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E++VSA   F LGFF+   +++RYVGIWYN I  Q++ W+ANR+ P+ D +G   I  
Sbjct  42    DPESLVSAGGFFKLGFFTTGNSTSRYVGIWYNNIPEQTIAWIANRDNPLPDSSGVIRIAN  101

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILK---TDGWRPNNTIWQSFHQP  2200
             +G  VV+DG+    W+TN S  + N++  L ++  L++ +   TDG    + +W+SF  P
Sbjct  102   DGNLVVVDGQEKIFWSTNISTIAQNSSAKLLDSGNLVLQQGSSTDGDNNGSVLWESFEHP  161

Query  2199  TDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRS  2026
              DTFLP M++  S    E +L TS     +PS GRF+ G+ P   P++ +W G   +WRS
Sbjct  162   CDTFLPKMKIGTSTKTAEKQLLTSKKGDSDPSTGRFTAGVVPLNIPEVFVWNGSLPHWRS  221

Query  2025  GHWDGRVFLGVP-MRTDFVYGFDLITE----NDNLYLEYKSSSSDLIMFKVDWNGKEVQQ  1861
             G W+ R+FLGVP M + ++ GF +  +    + +L   Y S    L+ F +D  GK V+ 
Sbjct  222   GPWNNRIFLGVPDMYSVYLDGFKMDRDAQDGSAHLTFSYVSLPFLLVRFVLDSEGKLVEY  281

Query  1860  RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARN  1681
              W + +K W      P  +C +Y  CG F  C N+  + I C C+ GF P    +W   N
Sbjct  282   DWGQEKKNWTIGWLAPRTECDIYGKCGAFGSC-NALDSPI-CSCLKGFIPKSVEEWTKGN  339

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             W+ GC RRT LQC++NNT     + D F ++K +K+PD A+      +  DC+K+C  +C
Sbjct  340   WSSGCMRRTELQCERNNTSSEKEKTDEFLKLKMMKVPDSANWSAAADA-NDCEKQCLSNC  398

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv  1321
             SC AYA  +   I CM W   L+D  +   G G  L +RL  SE   K SK  II  V V
Sbjct  399   SCVAYAFDI--NIGCMSWSGNLIDTQKFSTG-GVELHIRLAYSEFGRKHSKAVIITVVIV  455

Query  1320  vaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGAS  1141
             V AV + V+    L   R A+ R  ++  +   E+  S E S     +  +  +   G  
Sbjct  456   VGAVTLGVLACCVL--RRMAKQRGLRKKGVDGAEV--SKEVSDGVLHEDSIITQ--RGKC  509

Query  1140  SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFT  961
             +DL  F +  +A ATD F L NKLG+GGFG VYKG LP GQEIAVK+LS+ SGQG++EF 
Sbjct  510   TDLPVFEYEDLAIATDKFDLGNKLGKGGFGEVYKGRLPDGQEIAVKKLSKTSGQGLEEFK  569

Query  960   NELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHI  781
             NE+ VI+KLQHRNLV+LLGCCIEG+EKML+YEYMPNKSLD  +FDP KR+ L+W KR  I
Sbjct  570   NEVAVISKLQHRNLVKLLGCCIEGEEKMLVYEYMPNKSLDVILFDPTKRTILDWNKRLRI  629

Query  780   IEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRV  601
             IE I RGLLYLHRDSRL+IIHRDLKASNILLD E+NPKISDFGMA+I GG ++EA+T RV
Sbjct  630   IEGIGRGLLYLHRDSRLKIIHRDLKASNILLDEELNPKISDFGMAKIIGGTEDEASTRRV  689

Query  600   VGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF-RTDDHSGIIEYAWEQWD  424
             VGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+N SF    + S  + +AW  W+
Sbjct  690   VGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNGSFYHLQECSSFLGHAWTLWN  749

Query  423   EGKPMNLLDPSIFSS--CVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPV  250
             EGK + L+DP+I      + +EVLRCI++GLLCVQ+    RP +S+++  L ++   LP 
Sbjct  750   EGKILELIDPTILCEPPSIEEEVLRCIRVGLLCVQEFPKDRPTVSSIMSMLSSEIADLPT  809

Query  249   PRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVG  136
             P+ P +   +  S + +S+ +N  + S N +T++ + G
Sbjct  810   PKQPGFIERLVSS-ETESFQRNQMICSKNDVTITTLEG  846



>ref|NP_001059941.1| Os07g0550900 [Oryza sativa Japonica Group]
 dbj|BAC65366.1| putative S-receptor kinase KIK1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAD30706.1| putative S-receptor kinase KIK1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF21855.1| Os07g0550900 [Oryza sativa Japonica Group]
 gb|EAZ40229.1| hypothetical protein OsJ_24674 [Oryza sativa Japonica Group]
 dbj|BAG95155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=865

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/851 (45%), Positives = 531/851 (62%), Gaps = 45/851 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEG--TSNRYVGIWYNEIIPQSVVWVANR  2416
             AAD + QGQ +  + + +VSAN  F +GFF+P G      Y+G+ Y     Q+V+WVANR
Sbjct  28    AADTLSQGQSLGAN-DMLVSANGTFKVGFFTPAGGDPGKVYLGVMYATSNVQTVMWVANR  86

Query  2415  ERPILDKNGAFG--ITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG  2242
             + P+    GA    +TG+G  +V +G  V+     S+   S  T+ +R+   L+I  +D 
Sbjct  87    DAPVRTAAGAASATVTGSGELLVKEGDRVAWRTNASAAGRSKHTLTIRDDGNLVISGSDA  146

Query  2241  WRPNNTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
                 +  W+SFH PTDTF+PGM + L  + G+  L+TSW +  +P+ G F++G+D  AS 
Sbjct  147   -AGTDVEWESFHHPTDTFVPGMEIALRQTNGDRTLYTSWRSDADPATGDFTLGLD--ASA  203

Query  2067  QIVIWEGE----KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSS  1912
             Q+ IW  +      YWRSG W    F+G+P R  +VYGF L  +      ++ + +   +
Sbjct  204   QLYIWRSQGGKNSTYWRSGQWASGNFVGIPWRALYVYGFKLNGDPPPIAGDMSIAFTPFN  263

Query  1911  SDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCV  1732
             S L  F +  NG E       S   W  +  QP   C  YN CG  A C    +  I C 
Sbjct  264   SSLYRFVLRPNGVETCYMLLGS-GDWELVWSQPTIPCHRYNLCGDNAECTADDNEPI-CT  321

Query  1731  CIVGFNPSDWNQWNARNWTGGCTRRTPLQC--QKNNTEGGGAEKDG---FREVKHIKLPD  1567
             C  GF P    ++N  NWT GC R  PL C  ++NNT  GGA   G   F  ++ +KLPD
Sbjct  322   CFTGFEPKSPQEYNNGNWTQGCVRSVPLTCSSERNNTTAGGAGAGGGDGFTVIRGVKLPD  381

Query  1566  FADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLD---EGSGST  1396
             FA     +     C+K C  +CSC AY+       SC+ W  ELVD+ Q     EG+   
Sbjct  382   FAVWGSLVGDANSCEKACLGNCSCGAYSYSTG---SCLTWGQELVDIFQFQTGTEGAKYD  438

Query  1395  LFVRLHSSELDNKSS--KTTiivavsvvaavavlvivsIWLLCSRRARIR---AKKRDEI  1231
             L+V++ SS LD  S   KT ++V V VV  V +   + +W  C RR + +    +K+ ++
Sbjct  439   LYVKVPSSLLDKSSGRWKTVVVVVVVVVVVVLLASGLLMWK-CRRRIKEKLGIGRKKAQL  497

Query  1230  P--RTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGG  1057
             P  R       +FS    ++ + + EGK   + +L  F+F ++A ATD+FS++NKLG+GG
Sbjct  498   PLLRPARDAKQDFSGPAQSEHEKSEEGK---NCELPLFAFETLATATDNFSISNKLGEGG  554

Query  1056  FGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKM  877
             FGHVYKG LP G+EIAVKRLSR SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+
Sbjct  555   FGHVYKGRLPGGEEIAVKRLSRSSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKI  614

Query  876   LLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASN  697
             L+YEYMPNKSLD+F+FDP +R  L+WR RF IIE +ARGLLYLHRDSRLR++HRDLKASN
Sbjct  615   LVYEYMPNKSLDAFLFDPERRGLLDWRTRFQIIEGVARGLLYLHRDSRLRVVHRDLKASN  674

Query  696   ILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGV  517
             ILLD +MNPKISDFGMARIFGG+QN+ NTNRVVGT GYM+PEYAMEGLFSV+SDVYSFG+
Sbjct  675   ILLDRDMNPKISDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAMEGLFSVRSDVYSFGI  734

Query  516   LLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLG  340
             L+LEI++G++N+SF   + S  I+ YAW+ W+  +   L+DP+I  +C  +E LRC+ + 
Sbjct  735   LILEIITGQKNSSFHHMEGSLNIVGYAWQLWNGDRGQELIDPAIRGTCPAKEALRCVHMA  794

Query  339   LLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDS--WNQNNELPSS  166
             LLCVQD A  RP++  VVL L +D+  LP PRPPT+T     S       +    E  S+
Sbjct  795   LLCVQDHAHDRPDIPYVVLTLGSDSSVLPTPRPPTFTLQCTSSSSGRDMYYRDKEESYSA  854

Query  165   NSITMSVIVGR  133
             N +T++++ GR
Sbjct  855   NDLTVTMLQGR  865



>ref|XP_010547141.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Tarenaya hassleriana]
Length=834

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/835 (44%), Positives = 527/835 (63%), Gaps = 36/835 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             + D I     IKD D +++VS +  F  GFFSP  +++RYVGIWY++I  Q+VVWVAN+ 
Sbjct  20    SKDTITSSTQIKDSDSDSLVSNDGTFRFGFFSPGNSASRYVGIWYDKIPKQTVVWVANKN  79

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGW  2239
              P+ D +G   ++ +G  VV DG+       N    V+ +   + L++T  L++   D  
Sbjct  80    IPVNDSSGVVSMSEDGNLVVTDGRKRVLWSTNVTVPVSGNATWVQLQDTGNLVL--QDNR  137

Query  2238  RPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                  +W+SF  P D+FLP M +  D     +   TSW +  +PS G ++ G++P   P+
Sbjct  138   NNGEILWESFKHPYDSFLPRMTLGTDAKTRSNIKLTSWKSPSDPSVGIYTAGVEPLTFPE  197

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFK  1891
             ++IW+ E   WRSG W+G+VF+G+P     ++  GF+L  +N        +++S +  F 
Sbjct  198   LLIWKNEVPVWRSGPWNGQVFIGLPDMESLLFLDGFNLNNDNQGTVTMSYANNSFMYHFN  257

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G   Q+ W++ ++ W    + P+  C  Y+ CGQFA C N   +   C C+ GF  
Sbjct  258   LDSEGNIFQKDWSKDKQDWRIGVKFPSTNCDSYSKCGQFASCSNR--DNPPCRCVKGFEA  315

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
              +  +WN+ NWT GC RR PLQC+ +N+    G + D F +++ +K+P  A   R+  + 
Sbjct  316   RNATEWNSGNWTNGCKRRVPLQCEGQNDGSRRGGKADKFLKLQKMKVPISAL--RSEANE  373

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             + C K C + CSC AYA     GI CMLW   L+DM Q   GSG  L +RL +SE    +
Sbjct  374   QTCPKICLQSCSCTAYA--YDRGIGCMLWNGSLLDM-QAFLGSGIDLNIRLANSEFKKPN  430

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRR--ARIRAKKRDE-----IPRTELPTSGEFS  1195
              +  I+    +     ++V    +LL  R+  A+ +A ++D        R E  TSG   
Sbjct  431   YQPVIVAVSVIGGVFTLVVC---FLLACRKITAKPKAAEKDSDAKLLFERMEALTSG---  484

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
              + +A+ +L  + K     +L  F F  +A+ATD+F++ NKLGQGGFG VYKG LP GQE
Sbjct  485   -NVNARANLMNQAKL---KELPLFEFQVLASATDNFAITNKLGQGGFGPVYKGKLPEGQE  540

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSR SGQG++E  NE+ VI+KLQHRNLVRLLGCCIEG+E+ML+YE+MP KSLDS+
Sbjct  541   IAVKRLSRASGQGLEELMNEVVVISKLQHRNLVRLLGCCIEGEERMLVYEFMPKKSLDSY  600

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +F+  K+  L+W+ RF I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDF
Sbjct  601   LFNMKKQMLLDWKTRFSIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDEHMNPKISDF  660

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+AR+F GN++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN+SF
Sbjct  661   GLARVFRGNEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRNSSF  720

Query  474   RTDDH-SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
               D+  S ++ +AW+ W++G+   L DP I+     +E+ RC+Q+GLLCVQ++A  RPN+
Sbjct  721   HKDEKASNLLAHAWKLWNDGEATALADPEIYEERFEKEIRRCVQIGLLCVQEVANDRPNV  780

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             S V+  L  +N  L  P+ P +  + R + + +S  Q+++  S N+++++ + GR
Sbjct  781   STVIWMLGNENADLSDPKQPAFI-TRRGASEGESSEQSDQKASINNVSLTAVTGR  834



>gb|KEH22744.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=844

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/836 (44%), Positives = 531/836 (64%), Gaps = 34/836 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I   Q+IKD G  ++S +  F  GFFSP+ ++NRYVGIW+      S++WVANR +
Sbjct  26    AIEAITSSQFIKDPG-TLLSKDGNFTFGFFSPKNSTNRYVGIWWKS--QSSIIWVANRNK  82

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D NG   I+ +G  VVL+G+   IW++N S T+S+ T  L +   L++L++      
Sbjct  83    PLSDSNGIVTISEDGNLVVLNGQKQVIWSSNLSNTTSHTTAQLSDYGNLVLLEST---VG  139

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMG-IDPRASPQIV  2059
             + +WQSF +P DTFLPGM++  +   GE    TSW N  +PS G FS+  ID     ++ 
Sbjct  140   SMLWQSFQKPFDTFLPGMKLTRNKRTGEKVQLTSWKNPSDPSVGSFSISFIDRINLHELF  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTD-FVYGFDLITEND-NLYLEYKSSSS-DLIMFKV  1888
             I+   + YWRSG WDG VF G+ M T+ ++ G  ++ + + N+Y+ Y       L+++ +
Sbjct  200   IFNETQPYWRSGPWDGVVFTGMQMMTNPYINGNHVVDDGEGNIYIYYTVPKDISLVVYNL  259

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             +  G+ + + W+  +K+   IQ     +C +Y  CG FA C  SS     C C+ GF P 
Sbjct  260   NSQGQLIAKWWDYEKKELQIIQTSQLSECDIYGICGAFASC--SSLKLPICSCLRGFEPR  317

Query  1707  DWNQWNARNWTGGCTRRTPLQCQK-NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
             +  +WN  NWTGGC RR  LQC++ NN      ++DGF ++K +K+PDFA    +  +P+
Sbjct  318   NKQEWNRHNWTGGCVRRILLQCERVNNNTTSTKKEDGFLKLKMVKVPDFAQ--GSALTPD  375

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C+ +C E+CSC AY+     GI CM W   L+D+ Q   G G  L+VR+  +ELD +  
Sbjct  376   ICRSRCLENCSCIAYSHT--AGIGCMSWTGNLIDIQQFKNG-GLDLYVRVAYAELDKE--  430

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRAR---------IRAKKRDEIPRTELPTSGEF  1198
             + T I+  + V    ++++   + +C R A          +++K++  I   +       
Sbjct  431   RNTTIIITTTVIIGTLIIVTCAYFMCRRAANSPEAKLKPSLKSKRKKNIKAFQFFNKVGT  490

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S D ++   +    +     +L+ F F  +A AT++F  +NKLGQGGFG VYKG L   Q
Sbjct  491   SEDNTSDSIIRTLSQVKLQ-ELLLFDFERLAIATNNFHSSNKLGQGGFGPVYKGKLQDNQ  549

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             +IAVKRLSR SGQG++EF NE+ VI KLQHRNL+RLLGCC+EG+EKML+YEYMPNKSLD+
Sbjct  550   DIAVKRLSRSSGQGLEEFKNEVVVICKLQHRNLIRLLGCCVEGEEKMLIYEYMPNKSLDA  609

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             FVFDP+K   L WR R++II+ IARGLLYLHRDS+LRIIHRDLK SNILLD E+NPKISD
Sbjct  610   FVFDPSKNKLLEWRTRYNIIDGIARGLLYLHRDSKLRIIHRDLKTSNILLDEELNPKISD  669

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FGMARIF G ++  NT RVVGTYGY++PEYAM+GLFS KSDV+SFGVLLLEI+SGRRN+S
Sbjct  670   FGMARIFEGREDTENTIRVVGTYGYISPEYAMQGLFSEKSDVFSFGVLLLEIISGRRNSS  729

Query  477   FRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             F  ++H+  ++ + W QW EG  ++ ++  I+     + V+RCI +GLLCVQ+LAV RPN
Sbjct  730   FYDNEHALTLLGFVWIQWKEGNILSFINTEIYDPSHHKYVVRCIHIGLLCVQELAVDRPN  789

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             M+AV+  L ++   LP P  P +    +  +   S  +++   S NS++++ I GR
Sbjct  790   MAAVISMLNSEAELLPPPSQPAFILR-QNMLSTMSHEESHRRYSINSVSITDISGR  844



>ref|XP_010547149.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X2 [Tarenaya hassleriana]
Length=833

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/834 (44%), Positives = 527/834 (63%), Gaps = 35/834 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRE  2413
             + D I     IKD D +++VS +  F  GFFSP  +++RYVGIWY++I  Q+VVWVAN+ 
Sbjct  20    SKDTITSSTQIKDSDSDSLVSNDGTFRFGFFSPGNSASRYVGIWYDKIPKQTVVWVANKN  79

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGW  2239
              P+ D +G   ++ +G  VV DG+       N    V+ +   + L++T  L++   D  
Sbjct  80    IPVNDSSGVVSMSEDGNLVVTDGRKRVLWSTNVTVPVSGNATWVQLQDTGNLVL--QDNR  137

Query  2238  RPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                  +W+SF  P D+FLP M +  D     +   TSW +  +PS G ++ G++P   P+
Sbjct  138   NNGEILWESFKHPYDSFLPRMTLGTDAKTRSNIKLTSWKSPSDPSVGIYTAGVEPLTFPE  197

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFK  1891
             ++IW+ E   WRSG W+G+VF+G+P     ++  GF+L  +N        +++S +  F 
Sbjct  198   LLIWKNEVPVWRSGPWNGQVFIGLPDMESLLFLDGFNLNNDNQGTVTMSYANNSFMYHFN  257

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G   Q+ W++ ++ W    + P+  C  Y+ CGQFA C N   +   C C+ GF  
Sbjct  258   LDSEGNIFQKDWSKDKQDWRIGVKFPSTNCDSYSKCGQFASCSNR--DNPPCRCVKGFEA  315

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
              +  +WN+ NWT GC RR PLQC+ +N+    G + D F +++ +K+P  A   R+  + 
Sbjct  316   RNATEWNSGNWTNGCKRRVPLQCEGQNDGSRRGGKADKFLKLQKMKVPISAL--RSEANE  373

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             + C K C + CSC AYA     GI CMLW   L+DM Q   GSG  L +RL +SE    +
Sbjct  374   QTCPKICLQSCSCTAYA--YDRGIGCMLWNGSLLDM-QAFLGSGIDLNIRLANSEFKKPN  430

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRR--ARIRAKKRDE----IPRTELPTSGEFSS  1192
              +  I+    +     ++V    +LL  R+  A+ +A+K  +      R E  TSG    
Sbjct  431   YQPVIVAVSVIGGVFTLVVC---FLLACRKITAKPKAEKDSDAKLLFERMEALTSG----  483

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             + +A+ +L  + K     +L  F F  +A+ATD+F++ NKLGQGGFG VYKG LP GQEI
Sbjct  484   NVNARANLMNQAKL---KELPLFEFQVLASATDNFAITNKLGQGGFGPVYKGKLPEGQEI  540

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++E  NE+ VI+KLQHRNLVRLLGCCIEG+E+ML+YE+MP KSLDS++
Sbjct  541   AVKRLSRASGQGLEELMNEVVVISKLQHRNLVRLLGCCIEGEERMLVYEFMPKKSLDSYL  600

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             F+  K+  L+W+ RF I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG
Sbjct  601   FNMKKQMLLDWKTRFSIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDEHMNPKISDFG  660

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +AR+F GN++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN+SF 
Sbjct  661   LARVFRGNEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRNSSFH  720

Query  471   TDDH-SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
              D+  S ++ +AW+ W++G+   L DP I+     +E+ RC+Q+GLLCVQ++A  RPN+S
Sbjct  721   KDEKASNLLAHAWKLWNDGEATALADPEIYEERFEKEIRRCVQIGLLCVQEVANDRPNVS  780

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              V+  L  +N  L  P+ P +  + R + + +S  Q+++  S N+++++ + GR
Sbjct  781   TVIWMLGNENADLSDPKQPAFI-TRRGASEGESSEQSDQKASINNVSLTAVTGR  833



>ref|XP_010909793.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=839

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/826 (46%), Positives = 514/826 (62%), Gaps = 45/826 (5%)
 Frame = -3

Query  2544  ENIVSANEKFVLGFFSPEGTS--NRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             E +VS    F LGFF P G S  N Y+ IWYN I  +++VWVANRE+PI   +    I+ 
Sbjct  37    ETLVSDGGAFALGFF-PLGNSPPNLYLAIWYNNIAQKTIVWVANREKPINVSSAILTISN  95

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR-----PNNTIWQSFH  2206
             +   +++D K    W++N     S+     +N++   +L  DG        +  +WQSF 
Sbjct  96    DSNLLLVDSKGSVFWSSNVKNNGSS-----KNSNPAAVLLNDGNLVLRDGSDTILWQSFD  150

Query  2205  QPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYW  2032
               TDTFLPGM+  +S    E+   TSW +  +PS G FS G DP    +   W+G + YW
Sbjct  151   HLTDTFLPGMKFKISYKTHEASRLTSWKDPQDPSLGNFSYGGDPNTYFEAFTWQGSQPYW  210

Query  2031  RSGHWDGRVFLG--VPMRTDFVYGFDLITENDNLYLEYK-SSSSDLIMFKVDWNGKEVQQ  1861
             R   WDGR++    V   +   Y   + T +D  Y+ Y  S  S  I  K+D +G+    
Sbjct  211   RRRVWDGRLYSARQVTNSSYMTYQTVIATADDEFYVTYSLSDGSSNIRIKLDHSGQLQLL  270

Query  1860  RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARN  1681
              W+ S   W     +P+  C  Y HCG F  CD + S    C C+ GF P   + WN RN
Sbjct  271   GWDSSLNNWRIATAEPSSTCDKYGHCGTFGYCDRTESVPA-CKCMEGFEPKFQSDWNRRN  329

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             ++GGC RRTPL+C           +D F  +  +KLPD     RN ++  +CK +C  +C
Sbjct  330   FSGGCVRRTPLKC---------GSRDVFSILGSMKLPDQFLYLRN-KTIGECKAECIANC  379

Query  1500  SCNAYA-PPVPGGIS----CMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTii  1336
              CNAYA   +  G      C++W  EL+D  ++    G  L++RL  SEL +K +K  II
Sbjct  380   LCNAYAYANLSMGTRNVSRCLVWTGELIDA-EMFGSEGENLYLRLVGSELGSKRNKRIII  438

Query  1335  vavsvvaavavlvivsIWLLCSRRARIRAKKRDEI----PRTELPTSGEFSSDFSAQCDL  1168
             +   +++   +L I++ +L  + R +IR   +D      P  +L  S +F  D S     
Sbjct  439   IVAVLLSGAILLTILT-YLAWNFRDKIRGIWKDGKDKGWPLDDLSLSTDFPKDLSISSGY  497

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                GK G    L   +F SIA AT++FS ++KLGQGGFG VYKG LP GQEIA+KRLSR 
Sbjct  498   ---GKPGHGPRLPLINFESIAVATNNFSDSHKLGQGGFGKVYKGKLPRGQEIAIKRLSRN  554

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+++IAKLQHRNLVRLLGCCI+G+E++L+YEYMPNKSLD+F+FDPAK+  
Sbjct  555   SGQGLEEFKNEVSLIAKLQHRNLVRLLGCCIQGEERLLIYEYMPNKSLDAFLFDPAKKHL  614

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+W++RF II+ IARGLLYLH+DSRLRIIHRDLKA+NILLD +MNPKISDFGMARIFGG+
Sbjct  615   LDWQRRFSIIKGIARGLLYLHQDSRLRIIHRDLKAANILLDQDMNPKISDFGMARIFGGD  674

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR-TDDHSGI  451
             QNE NTNR+VGTYGYM+PEY M GLFSVKSDVYSFGVL+LEIVS  RN+SF  T D  G+
Sbjct  675   QNEVNTNRIVGTYGYMSPEYGMGGLFSVKSDVYSFGVLILEIVSSSRNSSFHLTMDSPGL  734

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + YAWE W EG+  +++D S+  SC P EVLRCI +GLLCVQD +  RP MS+VV  LE 
Sbjct  735   LAYAWELWKEGRAKDVIDISLLESCSPDEVLRCILVGLLCVQDHSNDRPTMSSVVSMLEN  794

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +     +PR PT+T   R+  + D+  QN E+ S+N++T ++  GR
Sbjct  795   ETTINLIPRQPTFTIG-RKLDECDARMQNIEIFSANNLTNTMAEGR  839



>ref|XP_009395388.1| PREDICTED: uncharacterized protein LOC103980655 [Musa acuminata 
subsp. malaccensis]
Length=1689

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/826 (46%), Positives = 528/826 (64%), Gaps = 22/826 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A+D I   Q ++D GE+++SA   F LGFFSP  +SNRYVGIWY+     +V+WVANR+ 
Sbjct  34    ASDTIVPDQPLRD-GESLISAGGIFELGFFSPGKSSNRYVGIWYHNFSTNTVLWVANRQN  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D  G   I  +G  V+LDG N  +W++N+   S+++ + L +   L++  +      
Sbjct  93    PVKDTTGVLAIAADGNLVILDGGNSILWSSNALTASNDSVLKLTDDGNLVLNNS-----G  147

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             +  WQSF  PTDT++PGM+V  DL    S+  TSW +  +P+PG FS+ +DPR S QI +
Sbjct  148   SVGWQSFDYPTDTYMPGMKVGLDLRTKVSQKLTSWASEFDPAPGNFSLSMDPRESTQIFM  207

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDL--ITENDNLYLEYKSSSSDLIMFKVD  1885
             WEG K  WRSG W+G+VF+G+  M   ++YGF L    +   +Y  Y + +S    + + 
Sbjct  208   WEGTKPRWRSGRWNGQVFIGIQGMVAQYIYGFKLNNFVQEQKMYFYYDAFNSSH-RYVLT  266

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             WNG E    W      W +   QP   C VYN CG+ A C +S++    C C+ GF P+ 
Sbjct  267   WNGIERHMIWKNDTNDWYQYWAQPITPCEVYNQCGKNAACTDSATP--ICSCLHGFVPAS  324

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +W+  NW+ GC RRT L C+ NN+ G G     F+ ++ +KLPD +D + ++ +    
Sbjct  325   SEEWDGGNWSSGCVRRTALGCRMNNSSGDGGGDG-FQTLQGVKLPDISDWNTDVGADSSE  383

Query  1524  kkkceedC-SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
              +       SC AYA  V  GI C++W  +L+D+     G G+ LF+RL SSELD+    
Sbjct  384   CQDRCLRNCSCTAYA--VVTGIGCLIWGVDLLDIQVFSIG-GNDLFLRLASSELDDNKKN  440

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             T +++   V+A +  L ++ +   C RR R   ++        + ++G  S D S    +
Sbjct  441   TAVLIVTVVLAVILSLGLIFLLWKCRRRIRNLFRRPINEEGLSMFSAGGGSRDRSGSVRV  500

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
               E    + S+L  +SF  + +AT SFS +N +G+GGFG VYKG+LP GQEIAVKRLSR 
Sbjct  501   NYESNDESLSELQLWSFDFVQSATKSFSDSNLVGEGGFGPVYKGLLPEGQEIAVKRLSRS  560

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ +I+KLQHRNLVRLLGCCI   E++L+YEYMPNKSLD+F++D  K++ 
Sbjct  561   SGQGIEEFKNEMVLISKLQHRNLVRLLGCCIHEQERILIYEYMPNKSLDAFLYDQTKKNL  620

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+W  R++IIE IARGLLYLHRDSRLRIIHRDLKASNILLD EMNPKISDFGMARIFG +
Sbjct  621   LDWTTRYNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGND  680

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
              NE NT RVVGT+GYMAPEYAM+GLFSVKSDVYSFGVLLLEI+SG+RN+++   +    +
Sbjct  681   DNETNTQRVVGTFGYMAPEYAMQGLFSVKSDVYSFGVLLLEILSGKRNSTYHHPELGINL  740

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             I  AW+ W+E + M  +DP +  SC  ++++RCI +GLLCVQD  + RP+M++VV+ LE+
Sbjct  741   IALAWKLWNEDRMMEFVDPVLAQSCTSKQLVRCINVGLLCVQDRPIDRPSMASVVVMLES  800

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +     +PR PT+T     S    S      +  ++SITM  + GR
Sbjct  801   ETSVPALPRQPTFTTDRSFSETDSSTIDLKAMSVNDSITM--LTGR  844


 Score =   540 bits (1390),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 331/806 (41%), Positives = 462/806 (57%), Gaps = 64/806 (8%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D++  G     DG ++VSA   F L FF+P   + R++GI +  I  ++VVW+ANR+ 
Sbjct  910   TGDRVTPGSSPIVDGRSLVSAGGIFELSFFAPGDANKRFLGIRFKNIEEKTVVWIANRDA  969

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +GA  +T +G   +L G  V +W+TN+S        +L ++  L++    G   N
Sbjct  970   PLEDDHGALNLTDDGNLSLLSGTGVVLWSTNTSNAIGPVLQLL-DSGNLVL---TGGASN  1025

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             NT+WQSF  PTDT L GM +  D S       TSW +  +PSPG ++  ++ R   Q+V+
Sbjct  1026  NTLWQSFDHPTDTILAGMNIGFDYSRNLDMYLTSWKSDSDPSPGEYTYKMETRGVAQLVL  1085

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLI-MFKVDW  1882
             W+G    +RSG W G+ F G P M  + ++ F        LY  ++  ++ ++    +D 
Sbjct  1086  WKGSTEMYRSGPWTGKGFSGRPNMSPNGLFNFQYTDNQSGLYYAFQVLNATVLGRATLDH  1145

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             NGK  +  W E    W    E P  QC  Y  CG    C    S+  +C C+ GF P   
Sbjct  1146  NGKFQRFMWTEGSSDWSLFWEVPDGQCDQYASCGINGICTMLYSS--SCNCLEGFVPKSP  1203

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
              +W+ R ++ GC R TPL C            DGFR+V+++KLPD  +     R+ ++C 
Sbjct  1204  AEWSLRQYSDGCVRGTPLNCST----------DGFRQVQNVKLPDTLNASATNRTLDECS  1253

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD-------  1363
               C  +CSC AYA  V     C+ W  +L+D+    +G    L VRL +SEL+       
Sbjct  1254  DWCRNNCSCTAYA--VFEQSKCVTWFGDLIDVRIFADGE-DVLHVRLAASELEFLNGDSG  1310

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK----KRDEIPRTELPTSGEFS  1195
              K +   + + + +   + V + + +WL C RR + + K    KRDE    ELP      
Sbjct  1311  KKKTMKIVSITLPIGILLLVCLCLVLWLKCRRRTQGKRKSFQSKRDEEDELELP------  1364

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
                                    F   +I  AT+ FS  N +G+GGFG VYKG L  G E
Sbjct  1365  ----------------------LFDILTIRTATNDFSNENIIGEGGFGPVYKGQLEDGVE  1402

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLS+ S QG+ EF  E+ +IAKLQH+NLVRL+GCC E DE++L+YEY+ NKSLD+F
Sbjct  1403  IAVKRLSKDSVQGLHEFKTEVMLIAKLQHKNLVRLIGCCTEEDERILVYEYLNNKSLDAF  1462

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FD  +   L+W+KR  II  IARGL+YLH DSRL+IIHRDLK SNILLD EMNPKISDF
Sbjct  1463  IFDKTRGGLLDWQKRLEIITGIARGLVYLHHDSRLKIIHRDLKTSNILLDNEMNPKISDF  1522

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRR-NTS  478
             G ARIF  +Q E NT RVVGTYGYM+PEYAMEG+FS KSDV+SFGV++LEI+SG+R  T 
Sbjct  1523  GTARIFNVDQIEENTTRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVMVLEILSGKRIRTI  1582

Query  477   FRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
               ++    ++++AW  W EG+ + L+D ++  S    +V R IQ+GLLCVQ+ +  RP M
Sbjct  1583  SPSEPCKNLLQHAWRLWKEGRCLELVDDALEDSYSTSKVTRFIQVGLLCVQEGSDDRPTM  1642

Query  297   SAVVLFLETDNVTLPVP-RPPTYTAS  223
               V L L +++V LP P RP  YTAS
Sbjct  1643  EDVFLMLSSEDVMLPQPSRPAFYTAS  1668



>ref|XP_010907385.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Elaeis guineensis]
Length=846

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/840 (45%), Positives = 513/840 (61%), Gaps = 42/840 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPE-GTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             D++  G+ I  + + +VS    F LGFF P+  +SN Y+GIWYN I  +++VWVANRE P
Sbjct  26    DRLSPGESISLN-KTLVSDGGAFALGFFFPDDSSSNFYLGIWYNNIAQRTIVWVANREEP  84

Query  2406  ILDKNGAFGITGNGTFVVLDGKn----vsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             I D +    I+ +   +++         S   +  S  ++    VL N   L++ + +  
Sbjct  85    INDSSATLTISNDSNLLIMGSNGNVFWSSNVRSPGSSPNNTLVAVLLNNGNLVLREGN--  142

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLSAGESKL--FTSWTNSGNPSPGRFSMGIDPRASPQ  2065
               N  +WQ F  P DT +PGM+++      K    TSW +  +PS G FS G DP  S Q
Sbjct  143   --NTILWQCFDHPADTLIPGMKLEFRYKTHKANRITSWKDPQDPSRGNFSFGADPNTSLQ  200

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPM-RTDFVYGFDLITENDNLYLEYK-SSSSDLIMFK  1891
             +  W+G K YWRS  W+GR+F G  +  + ++    +I   D +Y+ +  S  S    +K
Sbjct  201   LFTWQGSKLYWRSSVWNGRLFSGAQVTNSSYITYVAIIDTEDEIYMTFSLSDGSSNARYK  260

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G+     W+ S   W      P+  C  Y +CG F  CD++ S    C C+ GF P
Sbjct  261   LDHLGQLQLLGWDYSLNNWSIAASWPSSVCDRYGYCGPFGYCDSTESVP-TCKCLEGFEP  319

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
             +  ++WN  N++GGC R+T L C            DGF  ++ +KLPD     +N ++  
Sbjct  320   NFPHEWNGGNFSGGCVRKTALDC---------GYGDGFLILRGMKLPDRFLFLKN-KTVG  369

Query  1530  dckkkceedCSCNAYAPP----VPGGIS-CMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
             +C  KC  +CSCNAYA        G +S C++W  EL+D   +  G G  L++RL  S+L
Sbjct  370   ECAAKCIANCSCNAYAYANLSMGTGNVSRCLVWMEELLDAGMVSSG-GEDLYLRLLGSQL  428

Query  1365  ----DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRT----ELPT  1210
                    S +   I+ +    + A+L+I   +L    R +I+   +D   +     +L  
Sbjct  429   VFSQPTGSKRNKRIIIILAPVSGAILLITLTYLAWKFRDKIKGIWKDGKNKGRLLGDLSL  488

Query  1209  SGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
             S EF  DFS       EGK G        +F SI AAT++FS ++KLGQGGFG VYKG L
Sbjct  489   STEFPMDFSGSSGFG-EGKTGHGLQPPLINFESIVAATNNFSDSHKLGQGGFGKVYKGKL  547

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
             P GQEIAVKRLSR SGQG+ EF NE+ +IAKLQHRNLVRLLGCCI+GDEK+L+YEYM NK
Sbjct  548   PRGQEIAVKRLSRNSGQGLVEFKNEVLLIAKLQHRNLVRLLGCCIQGDEKLLIYEYMSNK  607

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD+F+FDPAK+  L+W KRF+II+ IARGLLYLH+DSRLRIIHRDLKASNILLD +MNP
Sbjct  608   SLDAFLFDPAKKQLLDWEKRFNIIKGIARGLLYLHQDSRLRIIHRDLKASNILLDQDMNP  667

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGG+QNE NTNRVVGTYGYM+PEYAM GLFSVKSDVYSFGVL+LEIVSG 
Sbjct  668   KISDFGMARIFGGDQNEVNTNRVVGTYGYMSPEYAMGGLFSVKSDVYSFGVLILEIVSGS  727

Query  489   RNTSFR-TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAV  313
             RN+SF  T D   ++ YAWE W EGK  +L+D S+  SC P EV RCI +GLLCVQD + 
Sbjct  728   RNSSFHLTMDSPSLLAYAWELWKEGKAKDLVDTSLLESCSPDEVFRCILVGLLCVQDHSN  787

Query  312   HRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              RP M ++V  LE +      P  PT+T   ++  + D+  QN E+ S+N++T+++  GR
Sbjct  788   DRPTMLSIVSMLENETTINLTPGQPTFTVG-KKLDECDAQMQNLEIFSANNLTITMAEGR  846



>ref|XP_003593415.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=753

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/732 (50%), Positives = 483/732 (66%), Gaps = 43/732 (6%)
 Frame = -3

Query  2577  IQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL  2401
             I+ G++I+D +GE +VS    FV+GFF  E +S+RYVGIWY  I    V+WVANR +PI 
Sbjct  36    IKHGEFIRDKEGEVLVSDGYNFVMGFFGFENSSSRYVGIWYYNIPGPEVIWVANRNKPIN  95

Query  2400  DKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG----WRP  2233
                G+F ++ NG  V+LDG    +W+TN S+  +N     +N SE  +L+ DG       
Sbjct  96    GNGGSFTVSTNGNLVILDGNKNQLWSTNVSIIQTN-----KNNSE-AVLRDDGNLVLSNE  149

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVI  2056
                +W+SF  P+DT++PGM+V ++ G+S  FTSW +S +PS G  +MG+DP   P QIV+
Sbjct  150   KVVLWESFENPSDTYVPGMKVPVN-GKSFFFTSWKSSTDPSLGNHTMGVDPAGLPTQIVV  208

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDL---------ITENDNLYLEYKSSSSDL  1903
             WEG++R WRSG+WDGR+F GV M   F++GF L            NDN   E K + +  
Sbjct  209   WEGDRRTWRSGYWDGRIFTGVDMTGSFLHGFILNYDSNGDRSFVYNDN---ELKENDNSS  265

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
             + F++ W+G E +  W E+ K+W +IQ+ P + C VYN+CG FA C+ S S    C C+ 
Sbjct  266   VRFQIGWDGIEREFLWKENEKRWTEIQKGPHNVCEVYNYCGDFAACELSVSGSAICNCLK  325

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
             GF   D      RN + GC R T L+  + N   G   +DGF     +KLPDFA +    
Sbjct  326   GFELKD-----KRNLSSGCRRMTALKGDQRN---GSFGEDGFLVRGSMKLPDFARV----  373

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
                +DCK  C ++ SC AYA  +  GI CM+W  +LVD++    G G+ L +RL  S+L 
Sbjct  374   VDTKDCKGNCLQNGSCTAYAEVI--GIGCMVWYGDLVDILHFQHGEGNALHIRLAYSDLG  431

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRAR-IRA---KKRDEIPRTELPTSGEFS  1195
             +      I++ + + +   ++ I  I LL  R  R ++A   K  D +P  +   S E S
Sbjct  432   DGGKNEKIMMVIILTSLAGLICIGIIVLLVWRYKRQLKASCSKNSDVLPVFDAHKSREMS  491

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             ++     +L +EG   +  +L FF+FS +++AT++FS  NKLGQGGFG VYKG LP G+E
Sbjct  492   AEIPGSVELGLEGNQLSKVELPFFNFSCMSSATNNFSEENKLGQGGFGPVYKGKLPSGEE  551

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLSRRSGQG+ EF NE+ + A+LQHRNLV+L+GC IEGDEK+L+YE+M NKSLD F
Sbjct  552   IAVKRLSRRSGQGLDEFKNEMRLFAQLQHRNLVKLMGCSIEGDEKLLVYEFMLNKSLDRF  611

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP K+++L+W +R+ IIE IARGLLYLHRDSRLRIIHRDLKASNILLD  MNPKISDF
Sbjct  612   LFDPIKKTQLDWARRYEIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDENMNPKISDF  671

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+ARIFGGNQNE N  +VVGTYGYM+PEYAMEGL SVKSDVYSFGVLLLEIVSGRRNTSF
Sbjct  672   GLARIFGGNQNEENATKVVGTYGYMSPEYAMEGLVSVKSDVYSFGVLLLEIVSGRRNTSF  731

Query  474   RTDDHSGIIEYA  439
             R  D S +I Y 
Sbjct  732   RHSDDSSLIGYV  743



>gb|KEH22751.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=819

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/826 (45%), Positives = 522/826 (63%), Gaps = 43/826 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D I   Q+IKD  E ++S +  +  GFFSPE ++NRYVGIW+N     +VVWVANR +P+
Sbjct  28    DTITSSQFIKDP-ETLLSKDGSYAFGFFSPENSTNRYVGIWWNS--RSTVVWVANRNQPL  84

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
              D NG   I+ +G   VL+G+   IW++N S  ++N +    +   L++L+       N 
Sbjct  85    NDSNGIVTISEDGNIEVLNGQKRVIWSSNVSNIATNTSSQFSDYGNLVLLEN---ATGNV  141

Query  2223  IWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVIW  2053
             +WQS  QPTDT L GM++ ++   GE    TSW +  +PS G FS     R +  ++ IW
Sbjct  142   LWQSIQQPTDTLLSGMKLSINKRTGEKSKLTSWKSPSDPSVGIFSSSSVERGNILEVFIW  201

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSSSDLIMFKVD  1885
                + YWRSG W+G VF G+   T   +      +    N N+Y    ++   LI + ++
Sbjct  202   NETRPYWRSGPWNGGVFTGIDTMTTAYFNGFQGGDDGQGNINIYFTMPNNEVFLI-YNLN  260

Query  1884  WNGKEVQQRWNESRKQW-IKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               GK  + RWN+ +K+  +K   Q + +C VY  CG FA C NS S  I C C+ GF+P 
Sbjct  261   SQGKLEEMRWNDEKKEVEVKFTSQKS-ECDVYGICGAFAIC-NSLSTPI-CSCLKGFDPI  317

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NWT GC RR  LQC++ N +    ++DGF +++ +K+PDFA+      +P+ 
Sbjct  318   NIQEWNRNNWTSGCVRRRSLQCERVNNKTTSTKEDGFLKLQMVKVPDFAE--GVAVTPDI  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C E+CSC AY+     GI CM W   L+D+ QL+ G G  L+ R+  +ELD  + K
Sbjct  376   CRSLCLENCSCTAYSND--AGIGCMSWTGNLLDIQQLESG-GLDLYFRVPETELDKGTKK  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             T II  + ++  + +       ++C      R  K  +  ++E   S +    FS Q  L
Sbjct  433   TIIITIIVILGTLLI-------VICGYIMWRRISKNSD-GKSEENNSDDAIGGFS-QVKL  483

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                       +L+ F F  +A AT++F L+NKLG+GGFG VYKG L  GQEIAVKRLSR 
Sbjct  484   ---------QELLVFDFGKLATATNNFHLSNKLGEGGFGPVYKGKLQDGQEIAVKRLSRA  534

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ V+ KLQHRNLVRLLGCC +GDEKML+YEYMPNKSLD+F+FDP+K   
Sbjct  535   SGQGLEEFMNEVVVLCKLQHRNLVRLLGCCTDGDEKMLMYEYMPNKSLDAFIFDPSKSKL  594

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+WR R++IIE IARGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG 
Sbjct  595   LDWRTRYNIIEGIARGLLYLHRDSRLRIIHRDLKTSNILLDEELNPKISDFGMARIFGGR  654

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
             +N+ANT RVVGTYGYM+PEYAM GLFS KSDV+SFGVL+LEIVSGRRN+SF  ++H+  +
Sbjct  655   ENQANTTRVVGTYGYMSPEYAMRGLFSEKSDVFSFGVLILEIVSGRRNSSFYDNEHAPSL  714

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + + W QW E   ++L+DP I+       +LRCI +GLLCVQ+ AV RP M+ V+  L +
Sbjct  715   LGFVWIQWREENMLSLIDPEIYDHSHHTNILRCIHIGLLCVQESAVDRPTMATVISMLIS  774

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  LP P  P +    + +++     +N  + SSN+++++ + GR
Sbjct  775   EDAFLPPPSQPAFILR-QNTLNSTQPEENQGVFSSNTVSITDMCGR  819



>gb|KEH22748.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=815

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/826 (45%), Positives = 520/826 (63%), Gaps = 47/826 (6%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D I   Q+IKD  E ++S +  +  GFFSPE ++NRYVGIW+N     +VVWVANR +P+
Sbjct  28    DTITSSQFIKDP-ETLLSKDGSYAFGFFSPENSTNRYVGIWWNS--RSTVVWVANRNQPL  84

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
              D NG   I+ +G   VL+G+   IW++N S  ++N +    +   L++L+       N 
Sbjct  85    NDSNGIVTISEDGNIEVLNGQKRVIWSSNVSNIATNTSSQFSDYGNLVLLEN---ATGNV  141

Query  2223  IWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVIW  2053
             +WQS  QPTDT L GM++ ++   GE    TSW +  +PS G FS     R +  ++ IW
Sbjct  142   LWQSIQQPTDTLLSGMKLSINKRTGEKSKLTSWKSPSDPSVGIFSSSSVERGNILEVFIW  201

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSSSDLIMFKVD  1885
                + YWRSG W+G VF G+   T   +      +    N N+Y    ++   LI + ++
Sbjct  202   NETRPYWRSGPWNGGVFTGIDTMTTAYFNGFQGGDDGQGNINIYFTMPNNEVFLI-YNLN  260

Query  1884  WNGKEVQQRWNESRKQW-IKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               GK  + RWN+ +K+  +K   Q + +C VY  CG FA C NS S  I C C+ GF+P 
Sbjct  261   SQGKLEEMRWNDEKKEVEVKFTSQKS-ECDVYGICGAFAIC-NSLSTPI-CSCLKGFDPI  317

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NWT GC RR  LQC++ N +    ++DGF +++ +K+PDFA+      +P+ 
Sbjct  318   NIQEWNRNNWTSGCVRRRSLQCERVNNKTTSTKEDGFLKLQMVKVPDFAE--GVAVTPDI  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C E+CSC AY+     GI CM W   L+D+ QL+ G G  L+ R+  +ELD  + K
Sbjct  376   CRSLCLENCSCTAYSND--AGIGCMSWTGNLLDIQQLESG-GLDLYFRVPETELDKGTKK  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
             T II  + ++  + +       ++C      R  K  E   ++    G     FS Q  L
Sbjct  433   TIIITIIVILGTLLI-------VICGYIMWRRISKNSEENNSDDAIGG-----FS-QVKL  479

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                       +L+ F F  +A AT++F L+NKLG+GGFG VYKG L  GQEIAVKRLSR 
Sbjct  480   ---------QELLVFDFGKLATATNNFHLSNKLGEGGFGPVYKGKLQDGQEIAVKRLSRA  530

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ V+ KLQHRNLVRLLGCC +GDEKML+YEYMPNKSLD+F+FDP+K   
Sbjct  531   SGQGLEEFMNEVVVLCKLQHRNLVRLLGCCTDGDEKMLMYEYMPNKSLDAFIFDPSKSKL  590

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+WR R++IIE IARGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG 
Sbjct  591   LDWRTRYNIIEGIARGLLYLHRDSRLRIIHRDLKTSNILLDEELNPKISDFGMARIFGGR  650

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
             +N+ANT RVVGTYGYM+PEYAM GLFS KSDV+SFGVL+LEIVSGRRN+SF  ++H+  +
Sbjct  651   ENQANTTRVVGTYGYMSPEYAMRGLFSEKSDVFSFGVLILEIVSGRRNSSFYDNEHAPSL  710

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + + W QW E   ++L+DP I+       +LRCI +GLLCVQ+ AV RP M+ V+  L +
Sbjct  711   LGFVWIQWREENMLSLIDPEIYDHSHHTNILRCIHIGLLCVQESAVDRPTMATVISMLIS  770

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  LP P  P +    + +++     +N  + SSN+++++ + GR
Sbjct  771   EDAFLPPPSQPAFILR-QNTLNSTQPEENQGVFSSNTVSITDMCGR  815



>ref|XP_004514287.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300-like [Cicer arietinum]
Length=823

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/834 (45%), Positives = 521/834 (62%), Gaps = 32/834 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A + I   Q+IKD  E ++S +  + LGFFSPE ++NRYVGIW+      + +WVANR  
Sbjct  7     AINTITPSQFIKDP-ETLLSKDGYYSLGFFSPENSTNRYVGIWWKS--QSTNIWVANRNH  63

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+ +G  VVL+G+   IW++N S  +SN T    +   L++L +      
Sbjct  64    PLNDSDGIVTISEDGNLVVLNGQKQVIWSSNVSNIASNTTSQFFDFGNLVLLDSTS---G  120

Query  2229  NTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIV  2059
             N +WQS  QP+DT LPGM++ ++   GE     SW +  +PS G FS     R +  ++ 
Sbjct  121   NILWQSIQQPSDTLLPGMKLSINKRTGEKVKLKSWKSPSDPSVGSFSSSSVERQNILEVF  180

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITE---NDNLYLEYKSSSSDLIMFK  1891
             IW   + YWRSG W+G VF G+  M T + YGF        N N+Y        + +++ 
Sbjct  181   IWNETRPYWRSGPWNGSVFTGIDYMTTAYFYGFKGGDGGDGNINVYYTIPDDV-EFLIYN  239

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             ++  G   + RWN+ +K+          +C VY  CG+FA C  SS     C C+ GF P
Sbjct  240   LNSQGILEETRWNDEQKEVQVTWTSRDSECDVYGTCGEFASC--SSLISPTCSCLRGFEP  297

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
              +  +WN  NWTGGC RRTPLQC++   +    ++DGF +++ +K+PD+A+      +P+
Sbjct  298   RNIREWNRHNWTGGCVRRTPLQCERVINKTTRTKEDGFLKLQMVKVPDYAE--GTAVTPD  355

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C+  C E+CSC AY+     GI CM W   L+D+ QL+ G G  L+VR+  +ELDN   
Sbjct  356   ICRSLCLENCSCIAYSHD--AGIGCMSWTGNLLDIEQLESG-GLDLYVRVAHAELDN--G  410

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEF-------SS  1192
             +   I+   +V    +++++  +++  R +   AK    I  T    +  F       +S
Sbjct  411   RIKTIIITIIVIIGTLVIVICAYIMWRRTSNNPAKLWHSIKSTRKMNNKTFVVFNKGGTS  470

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             + +   D+          DL+ F F+ +A ATD+F L NKLGQGGFG VYKG L  GQEI
Sbjct  471   EENNSEDVIGGMSQDKLQDLLLFDFAKLATATDNFHLNNKLGQGGFGPVYKGKLQDGQEI  530

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++EF NE+ VI KLQHRNLVRLLGCCIEGDEKML+YEYMPNKSLD+F+
Sbjct  531   AVKRLSRSSGQGLEEFMNEVVVICKLQHRNLVRLLGCCIEGDEKMLMYEYMPNKSLDAFI  590

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP+K   L+WR R++IIE IARGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFG
Sbjct  591   FDPSKNKLLDWRTRYNIIEGIARGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFG  650

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             MARIFGG +++ANT RVVGTYGYM+PEYAM+GLFS KSDV+SFGVL+LEIV+GRRN+SF 
Sbjct  651   MARIFGGREDQANTTRVVGTYGYMSPEYAMQGLFSEKSDVFSFGVLILEIVTGRRNSSFY  710

Query  471   TDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
              ++H   ++   W QW E   ++L+D  I+       + RCI +GLLCVQ+LAV RP M+
Sbjct  711   DNEHVLSLLGSVWIQWREENILSLIDQGIYEPSHHNYISRCIHIGLLCVQELAVDRPTMA  770

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              V+  L ++   LP P  P +    +  ++  S  +N  + S N+++++ I GR
Sbjct  771   TVISMLNSEVSLLPPPSQPAFILR-QNMLNSKSAEENQSVSSINNVSITDICGR  823



>ref|XP_010052476.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X2 [Eucalyptus grandis]
Length=840

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/838 (44%), Positives = 513/838 (61%), Gaps = 42/838 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D + Q   IKD G  +VS+ + FVLGFFSP+ +S RYVGIWY  +  Q++VWVANRERPI
Sbjct  24    DILNQNNTIKD-GNLLVSSGKTFVLGFFSPDNSSRRYVGIWYYRVSEQTIVWVANRERPI  82

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
                 GA  I  +G  V+ +            +S +++ + T  L ++  L++++      
Sbjct  83    SGTTGALSIDSDGNLVLHEKNGSFPVWSTKVSSGLSNYSTTARLMDSGNLVLVQD---FS  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              + IWQSF  PTDT LP M++  DL  G ++  TSW +  +P+PG +S  IDP+   Q+ 
Sbjct  140   KSVIWQSFDYPTDTLLPLMKLGLDLKTGLNRFLTSWKSPEDPAPGNYSYRIDPKGYAQLF  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +++    YWRSG W G  + G+P M   F++    +   D + + Y   ++ +I   V  
Sbjct  200   LYKDGDPYWRSGSWIGDRWSGIPEMTRRFIFNVSFVNNPDEVSVVYAMVNASIISRMVLK  259

Query  1881  NGKEVQQ-RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
                 VQ+  W+   ++WI+    P DQC  Y  CG  + C+  ++    C C+ GF P  
Sbjct  260   ESGSVQRFTWHGQEQRWIEFWYDPKDQCDYYGKCGPNSNCNPYNAGQFECTCLPGFEPKS  319

Query  1704  WNQWNARNWTGGCTRRTPLQ-CQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPe  1531
                W  R+ + GC RR     CQ           +GF +V  +K+PD +    NM  S  
Sbjct  320   PTDWYLRDGSAGCVRRPRASACQHG---------EGFVKVSLVKVPDTSQAHTNMSFSLN  370

Query  1530  dckkkceedCSCNAYAPP--VPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
             +C+K+C  +CSC AYA    + GG  C++W + LVD     + SG  L+VR+ + EL   
Sbjct  371   ECEKECLRNCSCTAYASANEILGGFGCLIWHDNLVDTRTFTD-SGQDLYVRVDAIELARY  429

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPR-------TELPTSGEF  1198
               KT+ +   + VA + V V+ ++ L  S    +  KKR+ + R       +E+     F
Sbjct  430   RKKTSFLSKKARVAIILVSVLTALLLASSISYCLVIKKRNSVDRRRQNPLISEMTNLTHF  489

Query  1197  SSDFSAQ-CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                 S + CD      A  + D+  F  S+IA+AT++FS  NKLGQGGFG VYKGV+  G
Sbjct  490   EGSPSVEDCD----DGARRNRDVPLFDLSTIASATNNFSFLNKLGQGGFGSVYKGVMDNG  545

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
              EIA+KRLS+ SGQGV+EF NE+ +IAKLQHRNLVR+LGCC+E DEKML+YEY+PNKSLD
Sbjct  546   AEIAIKRLSKHSGQGVEEFKNEVQLIAKLQHRNLVRILGCCVEEDEKMLIYEYLPNKSLD  605

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
             +F+FD  K S L+W+KRF I   +ARGLLYLH+DSRLRIIHRDLKASN+LLD  MNPKI+
Sbjct  606   AFLFDNTKSSLLDWKKRFEIASGVARGLLYLHQDSRLRIIHRDLKASNVLLDAVMNPKIA  665

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARI GG+Q + NTNRVVGTYGYM+PEYAMEG+FS+KSDVYSFGVLLLEI+SG+RN+
Sbjct  666   DFGMARICGGDQMQGNTNRVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLLLEIISGKRNS  725

Query  480   SFRTDD-HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             ++  ++  S ++   WE W E   ++++D S+  SC  +EVLRCIQ+GLLCVQ+ A  RP
Sbjct  726   AYYHENPSSNLVGRVWELWQEENCVDVVDESMGDSCSKEEVLRCIQIGLLCVQEFAEDRP  785

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMR-RSVDVDSWNQNNELPSSNSITMSVIVGR  133
             NMSAVV  L  +NV L  P+ P Y    +   V++ S   N+   S N + +SV+ GR
Sbjct  786   NMSAVVFMLANNNVVLASPKRPAYVFKNKYHGVNLSS---NDGTTSVNDVMISVVEGR  840



>ref|XP_009411995.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/840 (45%), Positives = 526/840 (63%), Gaps = 46/840 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSP-EGTSNRYVGIWYNEIIPQ-SVVWVANRER  2410
             D++  G++I  + E +VS   +FV GFFSP   T + Y G+WYN  IPQ +V+WVANRE+
Sbjct  26    DRLTPGEFISLN-ETLVSDAGEFVFGFFSPTNSTGDFYAGVWYN--IPQRTVIWVANREQ  82

Query  2409  PILDKNGAFGITGNGTFVVLD---GKnvsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             PI D +    I+ +   V++D   G   S   +      ++   VL N+  L++      
Sbjct  83    PINDSSATLRISDDSNLVIMDSEGGIFWSSNLSGFGTPGNDTAAVLLNSGSLVLRANS--  140

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLSAGE--SKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
               +N +WQSF  PTDTF+PGM++  + G+  ++  TSW ++ +PSPG FS+GI    + Q
Sbjct  141   --HNILWQSFDHPTDTFVPGMKIQYNFGKQSARYITSWKDTNDPSPGNFSLGIGSSTAAQ  198

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGV-PMRTDFVYGFDLITENDNLYLEYKSSSSDL-IMFK  1891
             ++IW G K YWRS  W G++F G   + T  V    ++ ++D + +    S + L I + 
Sbjct  199   LLIWSGTKLYWRSQVWIGKMFTGSRAINTTAVAYLTVLEDDDEIGITLSVSDASLYIRYT  258

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +++ G+     W+ S K W K    P D+C  Y  CGQFA CD++ S    C C+ GF P
Sbjct  259   LNYLGQIELLIWDNSSKNWTKYSSVPNDKCETYGWCGQFAYCDSTESVPA-CKCMEGFKP  317

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
                + W   N++ GCTR+  L+C          + DGF  V+ +KLPD     RN R+  
Sbjct  318   KVQSDWENGNFSAGCTRKKALRC---------GDGDGFLRVEGMKLPDHVVFLRN-RNIG  367

Query  1530  dckkkceedCSCNAYA-PPVPGG---IS-CMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
             DC+  C  +CSC AYA   V  G   IS C++W  EL+D   +  G G  L++RL    L
Sbjct  368   DCRTACLTNCSCTAYAYSDVTTGNETISGCLIWVGELIDTEMVSSG-GEDLYLRLMDISL  426

Query  1365  DNKSSKTTiivavsvvaavavlvivs----IWLLCSRRARIRAKKRDEIPRTELPTSGEF  1198
                 SKT     V +V+  A +V ++     W         + +K+  +  ++L +S +F
Sbjct  427   GTSGSKTKTRRIVIIVSLPASIVSLACIFIFWKFSEVFGVFKDRKKGNL-LSDLSSSTDF  485

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             +++ S   +  +E +     +L    F +I  AT+SFS +NKLGQGGFG VYKG LP GQ
Sbjct  486   ANNISGSNEF-IERQPHQGPELPLIGFENILFATNSFSDSNKLGQGGFGIVYKGNLPGGQ  544

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             EIAVKRL R S QG++EF NE+ +IAKLQHRNLV+LL CCI G+EK+L+YEYMPNKSLD 
Sbjct  545   EIAVKRLLRGSRQGLEEFKNEVILIAKLQHRNLVKLLACCIHGEEKLLVYEYMPNKSLDF  604

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             F+FDP ++++L+W KRF+II+ IAR LLYLH+DSRLRIIHRDLKASNILLD EMNPKISD
Sbjct  605   FLFDPTQKAKLDWGKRFNIIKGIARALLYLHQDSRLRIIHRDLKASNILLDAEMNPKISD  664

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FGMARIFGGNQ+EANTNRVVGTYGYM+PEYAMEGLFSVKSDVYS+GVLLLEIVSG RN+S
Sbjct  665   FGMARIFGGNQDEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSYGVLLLEIVSGFRNSS  724

Query  477   FR-TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             F    D   ++ YAWE W+EGK  + +D SI  +C P EVLR I +GLLCVQD    RP 
Sbjct  725   FHLIMDFPNLLAYAWELWNEGKANDYVDSSIADTCSPTEVLRSIHVGLLCVQDSPNDRPA  784

Query  300   MSAVVLFLETDNVTL-PVPRPPTYTASMRRSVDVDSW---NQNNELPSSNSITMSVIVGR  133
             MS+VV  LE +  T+   P+ P +T  ++R+++ D+    +   ++ S N++T++   GR
Sbjct  785   MSSVVFMLENEEATISAAPKQPIFT--IQRNLNPDTGHPPDDTYQVYSYNNVTVTAAEGR  842



>ref|XP_010052475.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Eucalyptus grandis]
 gb|KCW76522.1| hypothetical protein EUGRSUZ_D00910 [Eucalyptus grandis]
Length=840

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/837 (44%), Positives = 513/837 (61%), Gaps = 40/837 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D + Q   IKD G  +VS+ + FVLGFFSP+ +S RYVGIWY  +  Q++VWVANRERPI
Sbjct  24    DILNQNNTIKD-GNLLVSSGKTFVLGFFSPDNSSRRYVGIWYYRVSEQTIVWVANRERPI  82

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
                 GA  I  +G  V+ +            +S +++ + T  L ++  L++++      
Sbjct  83    SGTTGALSIDSDGNLVLHEKNGSFPVWSTKVSSGLSNYSTTARLMDSGNLVLVQD---FS  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              + IWQSF  PTDT LP M++  DL  G ++  TSW +  +P+PG +S  IDP+   Q+ 
Sbjct  140   KSVIWQSFDYPTDTLLPLMKLGLDLKTGLNRFLTSWKSPEDPAPGNYSYRIDPKGYAQLF  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +++    YWRSG W G  + G+P M   F++    +   D + + Y   ++ +I   V  
Sbjct  200   LYKDGDPYWRSGSWIGDRWSGIPEMTRRFIFNVSFVNNPDEVSVVYAMVNASIISRMVLK  259

Query  1881  NGKEVQQ-RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
                 VQ+  W+   ++WI+    P DQC  Y  CG  + C+  ++    C C+ GF P  
Sbjct  260   ESGSVQRFTWHGQEQRWIEFWYDPKDQCDYYGKCGPNSNCNPYNAGQFECTCLPGFEPKS  319

Query  1704  WNQWNARNWTGGCTRRT-PLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPe  1531
                W  R+ + GC RR     CQ           +GF +V  +K+PD +    NM  S  
Sbjct  320   PTDWYLRDGSAGCVRRPRASACQHG---------EGFVKVSLVKVPDTSQAHTNMSFSLN  370

Query  1530  dckkkceedCSCNAYAPP--VPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
             +C+K+C  +CSC AYA    + GG  C++W + LVD     + SG  L+VR+ + EL   
Sbjct  371   ECEKECLRNCSCTAYASANEILGGFGCLIWHDNLVDTRTFTD-SGQDLYVRVDAIELARY  429

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPR-------TELPTSGEF  1198
               KT+ +   + VA + V V+ ++ L  S    +  KKR+ + R       +E+     F
Sbjct  430   RKKTSFLSKKARVAIILVSVLTALLLASSISYCLVIKKRNSVDRRRQNPLISEMTNLTHF  489

Query  1197  SSDFSAQ-CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                 S + CD      A  + D+  F  S+IA+AT++FS  NKLGQGGFG VYKGV+  G
Sbjct  490   EGSPSVEDCD----DGARRNRDVPLFDLSTIASATNNFSFLNKLGQGGFGSVYKGVMDNG  545

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
              EIA+KRLS+ SGQGV+EF NE+ +IAKLQHRNLVR+LGCC+E DEKML+YEY+PNKSLD
Sbjct  546   AEIAIKRLSKHSGQGVEEFKNEVQLIAKLQHRNLVRILGCCVEEDEKMLIYEYLPNKSLD  605

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
             +F+FD  K S L+W+KRF I   +ARGLLYLH+DSRLRIIHRDLKASN+LLD  MNPKI+
Sbjct  606   AFLFDNTKSSLLDWKKRFEIASGVARGLLYLHQDSRLRIIHRDLKASNVLLDAVMNPKIA  665

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARI GG+Q + NTNRVVGTYGYM+PEYAMEG+FS+KSDVYSFGVLLLEI+SG+RN+
Sbjct  666   DFGMARICGGDQMQGNTNRVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLLLEIISGKRNS  725

Query  480   SFRTDD-HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             ++  ++  S ++   WE W EG  ++++D ++  SC  +EVLRCIQ+GLLCVQ+ A  RP
Sbjct  726   AYYHENPSSNLVGRVWELWQEGNCVDIVDETMDDSCSKEEVLRCIQIGLLCVQEFAEDRP  785

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             NMSAVV  L  +NV L  P+ P Y    + +    + + ++   S N +T++ + GR
Sbjct  786   NMSAVVFMLANNNVVLASPKRPAYV--FKSNYHGTNLSSSDGTTSVNDVTITEVEGR  840



>ref|XP_007022282.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
 gb|EOY13807.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
Length=837

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/827 (44%), Positives = 526/827 (64%), Gaps = 23/827 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I     IKD  E I+S N  F LGFF+   +++RYVGI YN+I  Q+VVWVANR +
Sbjct  26    ALDSITPSNSIKDP-EVILSKNGVFRLGFFNFSDSTDRYVGISYNQIPVQTVVWVANRNQ  84

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+ +G  VVL+G++  +W++N +  +SN + +L ++  L+ LK +     
Sbjct  85    PLKDSSGIVKISDDGNLVVLNGQDEILWSSNVTNLASNTSALLLDSGNLV-LKNNEDDNG  143

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
              +IW+SF  P++ +   M++  DL  G+    +SW +  +PS G FS G++P   P+++I
Sbjct  144   ASIWESFQHPSNAYTATMKISTDLRTGQKVQLSSWKSPSDPSDGNFSFGLEPVNIPELII  203

Query  2055  WEGEKRYWRSGHWDGRVFLG-VPMRTDFVYGFDLITEN--DNLYLEYK-SSSSDLIMFKV  1888
             W   + Y RSG W+G++F+G + M + ++ GF L+T++  ++ YL Y  ++ S L+ +++
Sbjct  204   WNNNQPYIRSGPWNGQIFIGMLNMNSVYLNGFSLVTDDQKESFYLTYALANKSTLLYYEL  263

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             +  G  V++ W+E +  W        + C VY  CG F  CD  S     C C+ GF P 
Sbjct  264   NPLGNLVERYWDEGKGDWG--NNWLENDCDVYGKCGAFGSCD--SMKPKICSCLRGFEPK  319

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NWT GC R T L CQK N      ++DGF +++ +K+P FA+      SP +
Sbjct  320   NREEWNRENWTSGCVRTTLLGCQKVNNGSEVGKEDGFLKLEMMKVPAFAE----WSSPFE  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
                + +   +C+  A     GI CMLWR  L+D+ +     G  L++R+ SSELD K  +
Sbjct  376   ETCEEQCLRNCSCVAYAYDVGIGCMLWRENLIDIQKF-PSRGVDLYIRVASSELDKK--E  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
              + ++ +  V    +++ +S + L S  A+ R +K+ ++    L   G+   +FS+   +
Sbjct  433   KSKVIVIVTVVVGIIIITISTFFLWSWMAKHRGRKQ-KVGEMLLFNKGKAVGNFSSDNMV  491

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                        L  F+F  +A+AT++F L  KLGQGGFG VY+G L  G+EIAVKRLSR 
Sbjct  492   GENLFEVKLQQLPLFNFEELASATNNFHLTKKLGQGGFGPVYRGTLQDGKEIAVKRLSRA  551

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ VI+KLQHRNLVRLLGCC+E +EKML+YEYMPNKSLD+F+FD  +R  
Sbjct  552   SGQGLEEFMNEVVVISKLQHRNLVRLLGCCVEREEKMLVYEYMPNKSLDAFIFDQVQRQF  611

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             LNW KRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD ++N KISDFGMARIFGGN
Sbjct  612   LNWEKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDQDLNSKISDFGMARIFGGN  671

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
             +N ANT RV+GTYGYM+PEYAM+G FS KSDV+SFGVLLLEIVSGR+NTSF  + HS  +
Sbjct  672   ENHANTKRVMGTYGYMSPEYAMQGQFSEKSDVFSFGVLLLEIVSGRKNTSFYDNQHSFSL  731

Query  450   IEYAWEQWDEGKPMNLLDPSIFS-SCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             + YAW+ W E     L++  +   S   +++LRCI +G LCVQ+ A  RP MS VV  L 
Sbjct  732   LGYAWKLWKEDNIFGLVEMGVSDPSYDEKQILRCIHVGFLCVQESAKDRPIMSRVVSMLN  791

Query  273   TDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++ V LP P  P +    + + D +S+  N +  S N +T++ +VGR
Sbjct  792   SEIVDLPTPTQPAFIGG-QINEDAESFPNNEDRFSLNDVTVTDVVGR  837



>ref|NP_001059942.1| Os07g0551300 [Oryza sativa Japonica Group]
 dbj|BAC65367.1| putative S-receptor kinase KIK1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAD30708.1| putative S-receptor kinase KIK1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF21856.1| Os07g0551300 [Oryza sativa Japonica Group]
 gb|EAZ04278.1| hypothetical protein OsI_26420 [Oryza sativa Indica Group]
Length=853

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/833 (44%), Positives = 507/833 (61%), Gaps = 28/833 (3%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGT--SNRYVGIWYNEIIPQSVVWVANRER  2410
             D ++QG+ +      + S +  F +GFF+P+    S  Y+GIWY  I P++VVWVANR  
Sbjct  33    DTLRQGESLTGAATLVSSPSGVFEVGFFAPDPKLPSRLYLGIWYRSISPRTVVWVANRAA  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR--  2236
             P    + +  +  NG   VLDG            ++++     R   + +I  T      
Sbjct  93    PATAPSPSLTLAANGELRVLDGSAADADAPLLWRSNASTQSAPRGGYKAVIQDTGSLEVR  152

Query  2235  -PNNTIWQSFHQPTDTFLPGMRVDLSA-----GESKLFTSWTNSGNPSPGRFSMGIDPRA  2074
               + T+W SF  P+DT L GMR+ +        E   FTSWT+  +PSPGR+++G+DP  
Sbjct  153   SDDGTLWDSFWHPSDTMLSGMRITVRTPGRGPSEPMRFTSWTSETDPSPGRYALGLDPAN  212

Query  2073  SPQIVIW-EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE-NDNLYLEYKSSSSDLI  1900
             S Q  IW +G    WRSG W G+ F+G+P R  ++YGF    + N   Y  Y +S++ L 
Sbjct  213   SGQAYIWRDGNVTIWRSGQWTGQNFVGIPWRPLYLYGFKPANDANLGAYYTYTASNTSLQ  272

Query  1899  MFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVG  1720
              F V  NG ++     +S ++W  +  QP+++C  Y  CG  A+C         C C+ G
Sbjct  273   RFVVMPNGTDICYMVKKSAQEWETVWMQPSNECEYYATCGANAKCTAMQDGKAKCTCLKG  332

Query  1719  FNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR  1540
             F P   +QWN  NW+ GC R  PL CQ N T       DGF  + +IK PDF+     ++
Sbjct  333   FQPKLLDQWNMGNWSQGCVRSPPLGCQVNQT------GDGFLSIPNIKWPDFSYWPSTVQ  386

Query  1539  SPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
                 C   C  +CSC AY       I C+LW ++L+DM Q   G G TL ++L +SEL  
Sbjct  387   DENGCMNACLSNCSCGAYVYMTT--IGCLLWGSDLIDMYQFQSG-GYTLNLKLPASEL--  441

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSS---D  1189
             +S      +A  V A V  +++  ++L   R   I+             T  + +S   D
Sbjct  442   RSHHAVWKIATIVSAVVLFVLLACLFLWWKRGRNIKDVMHKSWRSMHTSTRSQQNSGMLD  501

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              S       + + G S +L  +SF  I AAT +FS +NKLG GGFG VY G LP G+E+A
Sbjct  502   ISQSIPFEDDTEDGKSHELKVYSFDRIKAATCNFSDSNKLGAGGFGPVYMGKLPGGEEVA  561

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRL R+SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+YEYMPNKSLD+F+F
Sbjct  562   VKRLCRKSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKILVYEYMPNKSLDAFLF  621

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             +P K+  L+WRKRF IIE IARGLLYLHRDSRLR++HRDLKASNILLD +MNPKISDFGM
Sbjct  622   NPEKQGLLDWRKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDKDMNPKISDFGM  681

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR-  472
             AR+FGG+QN+ NTNRVVGT+GYM+PEYAMEG+FSVKSD+YSFGVL+LEI++G+R  SF  
Sbjct  682   ARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDIYSFGVLMLEIITGKRALSFHG  741

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
               D   I  +AW QW+E K   L+DP I +SC  ++VLRCI + LLCVQD A  RP++ A
Sbjct  742   QQDSLNIAGFAWRQWNEDKGEELIDPLIRASCSLRQVLRCIHIALLCVQDHAQERPDIPA  801

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+L L +D+ +LP+PRPPT      RS +    ++ ++  S  +++M+ + GR
Sbjct  802   VILMLSSDSSSLPMPRPPTLMLH-GRSAETSKSSEKDQSHSIGTVSMTQLHGR  853



>gb|KEH22752.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=824

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/826 (45%), Positives = 518/826 (63%), Gaps = 38/826 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D I   Q+IKD  E ++S +  +  GFFSPE ++NRYVGIW+N     +VVWVANR +P+
Sbjct  28    DTITSSQFIKDP-ETLLSKDGSYAFGFFSPENSTNRYVGIWWNS--RSTVVWVANRNQPL  84

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
              D NG   I+ +G   VL+G+   IW++N S  ++N +    +   L++L+       N 
Sbjct  85    NDSNGIVTISEDGNIEVLNGQKRVIWSSNVSNIATNTSSQFSDYGNLVLLEN---ATGNV  141

Query  2223  IWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVIW  2053
             +WQS  QPTDT L GM++ ++   GE    TSW +  +PS G FS     R +  ++ IW
Sbjct  142   LWQSIQQPTDTLLSGMKLSINKRTGEKSKLTSWKSPSDPSVGIFSSSSVERGNILEVFIW  201

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSSSDLIMFKVD  1885
                + YWRSG W+G VF G+   T   +      +    N N+Y    ++   LI + ++
Sbjct  202   NETRPYWRSGPWNGGVFTGIDTMTTAYFNGFQGGDDGQGNINIYFTMPNNEVFLI-YNLN  260

Query  1884  WNGKEVQQRWNESRKQW-IKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               GK  + RWN+ +K+  +K   Q + +C VY  CG FA C NS S  I C C+ GF+P 
Sbjct  261   SQGKLEEMRWNDEKKEVEVKFTSQKS-ECDVYGICGAFAIC-NSLSTPI-CSCLKGFDPI  317

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NWT GC RR  LQC++ N +    ++DGF +++ +K+PDFA+      +P+ 
Sbjct  318   NIQEWNRNNWTSGCVRRRSLQCERVNNKTTSTKEDGFLKLQMVKVPDFAE--GVAVTPDI  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C E+CSC AY+     GI CM W   L+D+ QL+ G G  L+ R+  +EL   +  
Sbjct  376   CRSLCLENCSCTAYSND--AGIGCMSWTGNLLDIQQLESG-GLDLYFRVPETELGMHALD  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
                   + +   V +  ++   ++C      R  K  +  ++E   S +    FS Q  L
Sbjct  433   KGTKKTIIITIIVILGTLLI--VICGYIMWRRISKNSD-GKSEENNSDDAIGGFS-QVKL  488

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                       +L+ F F  +A AT++F L+NKLG+GGFG VYKG L  GQEIAVKRLSR 
Sbjct  489   ---------QELLVFDFGKLATATNNFHLSNKLGEGGFGPVYKGKLQDGQEIAVKRLSRA  539

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ V+ KLQHRNLVRLLGCC +GDEKML+YEYMPNKSLD+F+FDP+K   
Sbjct  540   SGQGLEEFMNEVVVLCKLQHRNLVRLLGCCTDGDEKMLMYEYMPNKSLDAFIFDPSKSKL  599

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+WR R++IIE IARGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG 
Sbjct  600   LDWRTRYNIIEGIARGLLYLHRDSRLRIIHRDLKTSNILLDEELNPKISDFGMARIFGGR  659

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
             +N+ANT RVVGTYGYM+PEYAM GLFS KSDV+SFGVL+LEIVSGRRN+SF  ++H+  +
Sbjct  660   ENQANTTRVVGTYGYMSPEYAMRGLFSEKSDVFSFGVLILEIVSGRRNSSFYDNEHAPSL  719

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + + W QW E   ++L+DP I+       +LRCI +GLLCVQ+ AV RP M+ V+  L +
Sbjct  720   LGFVWIQWREENMLSLIDPEIYDHSHHTNILRCIHIGLLCVQESAVDRPTMATVISMLIS  779

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  LP P  P +    + +++     +N  + SSN+++++ + GR
Sbjct  780   EDAFLPPPSQPAFILR-QNTLNSTQPEENQGVFSSNTVSITDMCGR  824



>gb|KEH22750.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=820

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/826 (45%), Positives = 516/826 (62%), Gaps = 42/826 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D I   Q+IKD  E ++S +  +  GFFSPE ++NRYVGIW+N     +VVWVANR +P+
Sbjct  28    DTITSSQFIKDP-ETLLSKDGSYAFGFFSPENSTNRYVGIWWNS--RSTVVWVANRNQPL  84

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
              D NG   I+ +G   VL+G+   IW++N S  ++N +    +   L++L+       N 
Sbjct  85    NDSNGIVTISEDGNIEVLNGQKRVIWSSNVSNIATNTSSQFSDYGNLVLLEN---ATGNV  141

Query  2223  IWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP-QIVIW  2053
             +WQS  QPTDT L GM++ ++   GE    TSW +  +PS G FS     R +  ++ IW
Sbjct  142   LWQSIQQPTDTLLSGMKLSINKRTGEKSKLTSWKSPSDPSVGIFSSSSVERGNILEVFIW  201

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE----NDNLYLEYKSSSSDLIMFKVD  1885
                + YWRSG W+G VF G+   T   +      +    N N+Y    ++   LI + ++
Sbjct  202   NETRPYWRSGPWNGGVFTGIDTMTTAYFNGFQGGDDGQGNINIYFTMPNNEVFLI-YNLN  260

Query  1884  WNGKEVQQRWNESRKQW-IKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               GK  + RWN+ +K+  +K   Q + +C VY  CG FA C NS S  I C C+ GF+P 
Sbjct  261   SQGKLEEMRWNDEKKEVEVKFTSQKS-ECDVYGICGAFAIC-NSLSTPI-CSCLKGFDPI  317

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
             +  +WN  NWT GC RR  LQC++ N +    ++DGF +++ +K+PDFA+      +P+ 
Sbjct  318   NIQEWNRNNWTSGCVRRRSLQCERVNNKTTSTKEDGFLKLQMVKVPDFAE--GVAVTPDI  375

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C+  C E+CSC AY+     GI CM W   L+D+ QL+ G G  L+ R+  +EL   +  
Sbjct  376   CRSLCLENCSCTAYSND--AGIGCMSWTGNLLDIQQLESG-GLDLYFRVPETELGMHALD  432

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
                   + +   V +  ++   ++C      R  K  E   ++    G     FS Q  L
Sbjct  433   KGTKKTIIITIIVILGTLLI--VICGYIMWRRISKNSEENNSDDAIGG-----FS-QVKL  484

Query  1167  TVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRR  988
                       +L+ F F  +A AT++F L+NKLG+GGFG VYKG L  GQEIAVKRLSR 
Sbjct  485   ---------QELLVFDFGKLATATNNFHLSNKLGEGGFGPVYKGKLQDGQEIAVKRLSRA  535

Query  987   SGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE  808
             SGQG++EF NE+ V+ KLQHRNLVRLLGCC +GDEKML+YEYMPNKSLD+F+FDP+K   
Sbjct  536   SGQGLEEFMNEVVVLCKLQHRNLVRLLGCCTDGDEKMLMYEYMPNKSLDAFIFDPSKSKL  595

Query  807   LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGN  628
             L+WR R++IIE IARGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG 
Sbjct  596   LDWRTRYNIIEGIARGLLYLHRDSRLRIIHRDLKTSNILLDEELNPKISDFGMARIFGGR  655

Query  627   QNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GI  451
             +N+ANT RVVGTYGYM+PEYAM GLFS KSDV+SFGVL+LEIVSGRRN+SF  ++H+  +
Sbjct  656   ENQANTTRVVGTYGYMSPEYAMRGLFSEKSDVFSFGVLILEIVSGRRNSSFYDNEHAPSL  715

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + + W QW E   ++L+DP I+       +LRCI +GLLCVQ+ AV RP M+ V+  L +
Sbjct  716   LGFVWIQWREENMLSLIDPEIYDHSHHTNILRCIHIGLLCVQESAVDRPTMATVISMLIS  775

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  LP P  P +    + +++     +N  + SSN+++++ + GR
Sbjct  776   EDAFLPPPSQPAFILR-QNTLNSTQPEENQGVFSSNTVSITDMCGR  820



>ref|XP_006494689.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330-like isoform X2 [Citrus sinensis]
Length=801

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/827 (44%), Positives = 510/827 (62%), Gaps = 64/827 (8%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q I+D  + I+S    F LGFF+P  +  RY+GIWY+    ++V+WVANR+ P+ D
Sbjct  26    ITSSQLIRDP-DAILSNGSNFKLGFFNPTNSPYRYMGIWYDMPSEKAVIWVANRDNPLKD  84

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
              +G   I+ +G  V+++G+   +W++N S   +N+T      S  ++L+ +  R    +W
Sbjct  85    SSGIITISEDGNLVLVNGQKEVLWSSNVSNLVNNSTSAQLLDSGNLVLRDNINRA--IVW  142

Query  2217  QSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE  2044
             +SF +PTD+FLPGM   +D   G+    TSW +  +PS G FS G+  +  P+I +W   
Sbjct  143   ESFQEPTDSFLPGMHHGIDQRTGKKVQLTSWKSLSDPSTGSFSAGLIHQNIPEIFVWNVS  202

Query  2043  KRYWRSGHWDGRVFLGVP-------MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             + YWRSG W+G++F+G+P        R +F +GF                ++D   F + 
Sbjct  203   RPYWRSGPWNGQIFIGIPELKSVYLFRHNFTFGF----------------ANDWTFFALT  246

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   ++ W + +  W         +C VY  CG F  C NS    I C C+ GF P +
Sbjct  247   AQGILEERIWIKWKDNWEVGFLNLRTECDVYGKCGAFGIC-NSQEKPI-CSCLEGFEPKN  304

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RR+ LQC++ N  G   ++DGF ++  +K+PDF +      SP   
Sbjct  305   AEEWNRGNWTSGCIRRSKLQCERRNITGKVGKEDGFSKLNKMKVPDFTE----WTSPATE  360

Query  1524  kkkcee-dCSCNAYAPPVPGGISCMLWRN-ELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              +  E+   +C+  A    GGI CM+WR+  L+D+ +L  G G+ L++R+ +S++D K  
Sbjct  361   DECREQCLKNCSCIAYAFDGGIGCMVWRSINLIDIQRLPFG-GTDLYIRVANSDVDEKGK  419

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K   +  +        +  + +W   ++R  + AK                    SA   
Sbjct  420   KDVFVSPLIKGMFALAICTLFLWRWIAKRKEVIAK-------------------LSATNV  460

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
              TV+ +     DL  F F  +A AT++F L++KLGQGGFG VY G L  GQEIAVKRLS+
Sbjct  461   NTVKLQ-----DLPLFQFEELATATNNFQLSSKLGQGGFGPVYWGRLKDGQEIAVKRLSK  515

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPN+SLD+ +FDP K+ 
Sbjct  516   ASGQGLEEFMNEVMVISKLQHRNLVRLLGCCVEGEEKMLIYEYMPNRSLDALLFDPLKKE  575

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+WRKRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA+IFGG
Sbjct  576   RLDWRKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMAKIFGG  635

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             NQ++A+T RVVGT+GYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF  DD + I
Sbjct  636   NQDQADTGRVVGTFGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSFFEDDLT-I  694

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQE-VLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             + YAW+ W+E K + L+DP +  S    + ++RCI +GLLCVQ+L   RPNMS VV  L 
Sbjct  695   LGYAWKLWNENKILALVDPFLSESSFQLDMIIRCIHVGLLCVQELVKDRPNMSTVVSMLN  754

Query  273   TDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++   LP P+ P +T   + + D +S+ Q  +  S N IT ++  GR
Sbjct  755   SEIRDLPYPKEPAFTER-QGADDSESFKQIQQAYSFNDITFTLTAGR  800



>ref|XP_010052477.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Eucalyptus grandis]
Length=840

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/837 (43%), Positives = 513/837 (61%), Gaps = 40/837 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D + Q   I+D G  +VS+ + FVLGFFSP+ +S RYVGIWY  +  Q++VWVANRERPI
Sbjct  24    DILSQNNTIRD-GNLLVSSGKTFVLGFFSPDNSSRRYVGIWYYRVSEQTIVWVANRERPI  82

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
                 GA  I  +G  V+ +            +S +++ + T  L ++  L++++      
Sbjct  83    SGTTGALSIDSDGNLVLHEKNGSFPVWSTKVSSGLSNYSTTARLMDSGNLVLVQD---FS  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              + IWQSF  PTDT LP M++  DL    ++  TSW +  +P+PG +S  IDP+   Q+ 
Sbjct  140   KSVIWQSFDYPTDTLLPLMKLGLDLKTVLNRFLTSWASPEDPAPGNYSYRIDPKGYAQLF  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +++    YWRSG W G  + G+P M   F++    +   D + + Y   ++ +I   V  
Sbjct  200   LYKDGDPYWRSGSWIGDRWSGIPEMTRRFIFNVSFVNNPDEVSVVYAMVNASIISRMVLK  259

Query  1881  NGKEVQQ-RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
                 VQ+  W++  ++WI+    P DQC  Y  CG  + C+  ++    C C+ GF P  
Sbjct  260   ESGSVQRFTWHDQEQRWIEFWYDPKDQCDYYGKCGPNSNCNPYNAGQFECTCLPGFEPKS  319

Query  1704  WNQWNARNWTGGCTRRTPLQ-CQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPe  1531
                W  R+ + GC RR     CQ           +GF +V  +K+PD +    NM  S  
Sbjct  320   PTDWYLRDGSAGCVRRPRASACQHG---------EGFVKVPLVKVPDTSQAHTNMSFSLN  370

Query  1530  dckkkceedCSCNAYAPP--VPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
             +C+K+C  +CSC AYA    + GG  C++W + LVD     + SG  L+VR+ + EL   
Sbjct  371   ECEKECLRNCSCTAYASANEILGGFGCLIWHDNLVDTRTFTD-SGQDLYVRVDAIELARY  429

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPR-------TELPTSGEF  1198
               KT+ +   + VA + V V+ ++ L  S    +  KKR+ I R       +E+     F
Sbjct  430   RKKTSFLSKKARVAIILVSVLTALLLASSISYCLVIKKRNGIDRRRKNPLISEMTNLTRF  489

Query  1197  SSDFSAQ-CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                 S + CD      A  + D+  F  S+IA+AT++FS  NKLGQGGFG VYKGV+  G
Sbjct  490   EGSPSVEDCD----DGARRNRDVPLFDLSTIASATNNFSFLNKLGQGGFGSVYKGVMDNG  545

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
              EIA+KRLS+ SGQGV+EF NE+ +IAKLQHRNLVR+LGCC+E DEKML+YEY+PNKSLD
Sbjct  546   AEIAIKRLSKHSGQGVEEFKNEVQLIAKLQHRNLVRILGCCVEEDEKMLIYEYLPNKSLD  605

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
             +F+FD  K S L+W+KRF I   +ARGLLYLH+DSRLRIIHRDLKASN+LLD  MNPKI+
Sbjct  606   AFLFDNTKSSLLDWKKRFEIASGVARGLLYLHQDSRLRIIHRDLKASNVLLDAVMNPKIA  665

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARI GG+Q + NTNRVVGTYGYM+PEYAMEG+FS+KSDVYSFGVLLLEI+SG+RN+
Sbjct  666   DFGMARICGGDQMQGNTNRVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLLLEIISGKRNS  725

Query  480   SFRTDD-HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRP  304
             ++  ++  S ++   WE W EG  ++++D ++  SC  +EVLRCIQ+GLLCVQ+ A  RP
Sbjct  726   AYYHENPSSNLVGRVWELWQEGNCVDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRP  785

Query  303   NMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             NMSAVV  L  +NV L  P+ P Y    + +    + + ++   S N +T++ + GR
Sbjct  786   NMSAVVFMLANNNVVLASPKRPAYV--FKSNYHGANLSSSDGTTSVNDVTITEVEGR  840



>ref|XP_006494688.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330-like isoform X1 [Citrus sinensis]
Length=802

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/828 (44%), Positives = 511/828 (62%), Gaps = 65/828 (8%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q I+D  + I+S    F LGFF+P  +  RY+GIWY+    ++V+WVANR+ P+ D
Sbjct  26    ITSSQLIRDP-DAILSNGSNFKLGFFNPTNSPYRYMGIWYDMPSEKAVIWVANRDNPLKD  84

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
              +G   I+ +G  V+++G+   +W++N S   +N+T      S  ++L+ +  R    +W
Sbjct  85    SSGIITISEDGNLVLVNGQKEVLWSSNVSNLVNNSTSAQLLDSGNLVLRDNINRA--IVW  142

Query  2217  QSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE  2044
             +SF +PTD+FLPGM   +D   G+    TSW +  +PS G FS G+  +  P+I +W   
Sbjct  143   ESFQEPTDSFLPGMHHGIDQRTGKKVQLTSWKSLSDPSTGSFSAGLIHQNIPEIFVWNVS  202

Query  2043  KRYWRSGHWDGRVFLGVP-------MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             + YWRSG W+G++F+G+P        R +F +GF                ++D   F + 
Sbjct  203   RPYWRSGPWNGQIFIGIPELKSVYLFRHNFTFGF----------------ANDWTFFALT  246

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   ++ W + +  W         +C VY  CG F  C NS    I C C+ GF P +
Sbjct  247   AQGILEERIWIKWKDNWEVGFLNLRTECDVYGKCGAFGIC-NSQEKPI-CSCLEGFEPKN  304

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RR+ LQC++ N  G   ++DGF ++  +K+PDF +      SP   
Sbjct  305   AEEWNRGNWTSGCIRRSKLQCERRNITGKVGKEDGFSKLNKMKVPDFTE----WTSPATE  360

Query  1524  kkkcee-dCSCNAYAPPVPGGISCMLWRN-ELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              +  E+   +C+  A    GGI CM+WR+  L+D+ +L  G G+ L++R+ +S++D K  
Sbjct  361   DECREQCLKNCSCIAYAFDGGIGCMVWRSINLIDIQRLPFG-GTDLYIRVANSDVDEKGK  419

Query  1350  KTTiivavsvvaavavlvivsIW-LLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQC  1174
             K   +  +        +  + +W  +  R+A + AK                    SA  
Sbjct  420   KDVFVSPLIKGMFALAICTLFLWRWIAKRKAEVIAK-------------------LSATN  460

Query  1173  DLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
               TV+ +     DL  F F  +A AT++F L++KLGQGGFG VY G L  GQEIAVKRLS
Sbjct  461   VNTVKLQ-----DLPLFQFEELATATNNFQLSSKLGQGGFGPVYWGRLKDGQEIAVKRLS  515

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             + SGQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPN+SLD+ +FDP K+
Sbjct  516   KASGQGLEEFMNEVMVISKLQHRNLVRLLGCCVEGEEKMLIYEYMPNRSLDALLFDPLKK  575

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
               L+WRKRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA+IFG
Sbjct  576   ERLDWRKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMAKIFG  635

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSG  454
             GNQ++A+T RVVGT+GYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF  DD + 
Sbjct  636   GNQDQADTGRVVGTFGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSFFEDDLT-  694

Query  453   IIEYAWEQWDEGKPMNLLDPSIFSSCVPQE-VLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
             I+ YAW+ W+E K + L+DP +  S    + ++RCI +GLLCVQ+L   RPNMS VV  L
Sbjct  695   ILGYAWKLWNENKILALVDPFLSESSFQLDMIIRCIHVGLLCVQELVKDRPNMSTVVSML  754

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              ++   LP P+ P +T   + + D +S+ Q  +  S N IT ++  GR
Sbjct  755   NSEIRDLPYPKEPAFTER-QGADDSESFKQIQQAYSFNDITFTLTAGR  801



>ref|XP_010052478.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X2 [Eucalyptus grandis]
Length=837

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/836 (44%), Positives = 511/836 (61%), Gaps = 41/836 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D + Q   I+D G  +VS+ + FVLGFFSP+ +S RYVGIWY  +  Q++VWVANRERPI
Sbjct  24    DILSQNNTIRD-GNLLVSSGKTFVLGFFSPDNSSRRYVGIWYYRVSEQTIVWVANRERPI  82

Query  2403  LDKNGAFGITGNGTFVVLDGKnvs---iwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
                 GA  I  +G  V+ +            +S +++ + T  L ++  L++++      
Sbjct  83    SGTTGALSIDSDGNLVLHEKNGSFPVWSTKVSSGLSNYSTTARLMDSGNLVLVQD---FS  139

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              + IWQSF  PTDT LP M++  DL    ++  TSW +  +P+PG +S  IDP+   Q+ 
Sbjct  140   KSVIWQSFDYPTDTLLPLMKLGLDLKTVLNRFLTSWASPEDPAPGNYSYRIDPKGYAQLF  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +++    YWRSG W G  + G+P M   F++    +   D + + Y   ++ +I   V  
Sbjct  200   LYKDGDPYWRSGSWIGDRWSGIPEMTRRFIFNVSFVNNPDEVSVVYAMVNASIISRMVLK  259

Query  1881  NGKEVQQ-RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
                 VQ+  W++  ++WI+    P DQC  Y  CG  + C+  ++    C C+ GF P  
Sbjct  260   ESGSVQRFTWHDQEQRWIEFWYDPKDQCDYYGKCGPNSNCNPYNAGQFECTCLPGFEPKS  319

Query  1704  WNQWNARNWTGGCTRRTPLQ-CQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPe  1531
                W  R+ + GC RR     CQ           +GF +V  +K+PD +    NM  S  
Sbjct  320   PTDWYLRDGSAGCVRRPRASACQHG---------EGFVKVPLVKVPDTSQAHTNMSFSLN  370

Query  1530  dckkkceedCSCNAYAPP--VPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
             +C+K+C  +CSC AYA    + GG  C++W + LVD     + SG  L+VR+ + EL   
Sbjct  371   ECEKECLRNCSCTAYASANEILGGFGCLIWHDNLVDTRTFTD-SGQDLYVRVDAIELARY  429

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPR-------TELPTSGEF  1198
               KT+ +   + VA + V V+ ++ L  S    +  KKR+ I R       +E+     F
Sbjct  430   RKKTSFLSKKARVAIILVSVLTALLLASSISYCLVIKKRNGIDRRRKNPLISEMTNLTRF  489

Query  1197  SSDFSAQ-CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
                 S + CD      A  + D+  F  S+IA+AT++FS  NKLGQGGFG VYKGV+  G
Sbjct  490   EGSPSVEDCD----DGARRNRDVPLFDLSTIASATNNFSFLNKLGQGGFGSVYKGVMDNG  545

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
              EIA+KRLS+ SGQGV+EF NE+ +IAKLQHRNLVR+LGCC+E DEKML+YEY+PNKSLD
Sbjct  546   AEIAIKRLSKHSGQGVEEFKNEVQLIAKLQHRNLVRILGCCVEEDEKMLIYEYLPNKSLD  605

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
             +F+FD  K S L+W+KRF I   +ARGLLYLH+DSRLRIIHRDLKASN+LLD  MNPKI+
Sbjct  606   AFLFDNTKSSLLDWKKRFEIASGVARGLLYLHQDSRLRIIHRDLKASNVLLDAVMNPKIA  665

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFGMARI GG+Q + NTNRVVGTYGYM+PEYAMEG+FS+KSDVYSFGVLLLEI+SG+RN+
Sbjct  666   DFGMARICGGDQMQGNTNRVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLLLEIISGKRNS  725

Query  480   SFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             ++  ++ S      WE W EG  ++++D ++  SC  +EVLRCIQ+GLLCVQ+ A  RPN
Sbjct  726   AYYHENPSS--NLVWELWQEGNCVDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRPN  783

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             MSAVV  L  +NV L  P+ P Y    + +    + + ++   S N +T++ + GR
Sbjct  784   MSAVVFMLANNNVVLASPKRPAYV--FKSNYHGANLSSSDGTTSVNDVTITEVEGR  837



>ref|XP_010924049.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=835

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/822 (44%), Positives = 514/822 (63%), Gaps = 37/822 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++SA   F LGFFSP  ++NRYVGIWY+++  Q+VVWVANR+ PI ++ G   IT 
Sbjct  35    DGQTLISAGRIFELGFFSPANSNNRYVGIWYHKVSVQTVVWVANRQHPISERKGNLSITA  94

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT--DGWRPNNTIWQSFHQPT  2197
             NGT ++ D +N +   ++ S   +N    L +T  LII +T  D   PN+  WQSF  PT
Sbjct  95    NGTLIITD-QNSTTIWSSGSSGLANPVAQLLDTGNLIIRQTSDDTHDPNSFAWQSFDHPT  153

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             DT LP M++  +L++  ++  T+WT+S +P+PG +SM +D +  P+I +W G  R WR+G
Sbjct  154   DTLLPSMKLGWNLTSHLNRNLTAWTSSSDPAPGYYSMAMDIQGDPEIFLWNGAHRVWRAG  213

Query  2022  HWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLI-MFKVDWNGKEVQQRWNE  1849
              W G+ F GVP M+T  ++ FD + + D +Y  +   +  +I    V+ +G   +  W E
Sbjct  214   PWVGQRFSGVPEMKTYSMFKFDFVNDQDEIYYSFNIFNESIISRLIVNQSGVTQRMVWLE  273

Query  1848  SRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGG  1669
               + W      P DQC   + CG F  CD   +N   C C+ GF P     W  R+ + G
Sbjct  274   QSQMWSIFWFAPKDQCDNVSPCGPFGVCD--PNNSPICDCLQGFEPKSPTNWALRDGSEG  331

Query  1668  CTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPedckkkceedCSCN  1492
             C R+T   C +N T       DGF  V   KLPD +    +M  + + C+ KC  +CSC 
Sbjct  332   CKRKTARDC-RNGT-------DGFVTVSDAKLPDTSGSTVDMSLNLDQCRAKCLTNCSCT  383

Query  1491  AYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL--------DNKSSKTTii  1336
             A+A     G  C++W  EL D+     G G  L+VR+ +++L        D+ +S  +  
Sbjct  384   AFASAKTSGDGCIIWTTELTDLRVFGFG-GQDLYVRVAAADLGMCCSIALDSSASDHSHR  442

Query  1335  vavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEG  1156
               +  V   +VL I+ +  +C      + KKR          S  F+S++    D + EG
Sbjct  443   NDIIAVVVGSVLGILLLGFICC--CFWKKKKRTRRQAQSTLGSVSFASNY---IDESTEG  497

Query  1155  KAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQG  976
             +     +L  F   +IAAAT++FS+ NKLG+GGFG VYKG L   QEIAVKRL++ S QG
Sbjct  498   R---ELELPLFDLGTIAAATNNFSIQNKLGEGGFGPVYKGKLGDEQEIAVKRLAKTSVQG  554

Query  975   VQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWR  796
             + EF NE+ +IAKLQHRNLVRLLGCC++G+E+ML+YEYMPN+SLD+F+FD AK + L+WR
Sbjct  555   LDEFKNEVMLIAKLQHRNLVRLLGCCVQGEERMLIYEYMPNRSLDAFLFDKAKAALLDWR  614

Query  795   KRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEA  616
              R+HII  IARG+LYLH+DSR RIIHRDLKASNILLD EMNPKISDFGMARIFGG++ EA
Sbjct  615   TRYHIIVGIARGILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEA  674

Query  615   NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS-FRTDDHSGIIEYA  439
             NT RVVGTYGYM+PEYAM+G+FSVKSDV+SFGVL+LEI+SG++N   + +  H  +  +A
Sbjct  675   NTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISGKKNRGIYLSHHHVNLPGHA  734

Query  438   WEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVT  259
             W  W EG  ++L+D SI  S    E LRCI++GLLCVQ+    RP MS+VVL L ++N  
Sbjct  735   WSSWKEGNGLDLVDDSIVHSFPVSEALRCIKVGLLCVQEHPEDRPTMSSVVLMLGSENTP  794

Query  258   LPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LP P+ P +  S +  +++DS +   +  + N +++++  GR
Sbjct  795   LPDPKQPGF-VSTKGPLEIDSSSSKQDSLTVNGLSVTIFEGR  835



>ref|XP_010052422.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X2 [Eucalyptus grandis]
Length=823

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/827 (44%), Positives = 520/827 (63%), Gaps = 36/827 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I   + I+D  ++I S+   + +GFFSP G++NRYVGIWY+ +   +V+WVANRE 
Sbjct  25    GGDVITANEHIQDP-DSITSSGGLYRMGFFSPNGSANRYVGIWYDNVPTYNVLWVANREN  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PILD +G   I+ +G  VV++GK   +W++N S + ++A   L ++  L++LK       
Sbjct  84    PILDSSGVVKISNDGNLVVMNGKGELVWSSNVSNSVTDAKAQLLDSGNLVLLKHSSNSNG  143

Query  2229  NTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             + +WQSF   T++FL  M++    +  E +  TSW +  +PS G FS  + P   P++ I
Sbjct  144   DPLWQSFQHMTNSFLAKMKLSTISNPNEKQALTSWKSPSDPSIGSFSASLVPWYIPELFI  203

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTD-FVYGFDLITEND-NLYLEYK-SSSSDLIMFKVD  1885
             W     YWRSG       +G+P +   ++ GFDL+ + +  +YL++  S +S L    + 
Sbjct  204   WNCSSLYWRSGP------IGIPKKQSVYINGFDLVNDQEGTVYLDHSFSEASYLSYLLLK  257

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              NG  VQ   + +   W  +       C VY  CG F  C+  + N   C C+ GF P +
Sbjct  258   SNGDLVQPYLDHNSSSWKIVWSSRVSDCDVYGQCGPFGICN--ARNSPICSCLRGFEPKN  315

Query  1704  WNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +W   NW+ GC R++ LQC    N     ++KDGF +++ +K+P+ A     + +  D
Sbjct  316   SEEWRRGNWSSGCIRKSSLQCNGTTNGSSTASKKDGFLKLEMMKVPNSAIFYSTLEN--D  373

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C   C  +CSC AYA     G+ CM W  +L+D+ +L  G G+ L+VRL  SELD K   
Sbjct  374   CPGNCSINCSCVAYA--YDSGVGCMFWTGDLIDLQKLSVG-GTALYVRLAHSELDEKGH-  429

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDL  1168
                 +  + V    ++VI++IW      AR +AKKR +  + +  +SGE SS      +L
Sbjct  430   -LREIVATTVIMGTLIVIITIWF-----ARWKAKKRVKEGKEKHLSSGEVSSLVMLGENL  483

Query  1167  T-VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
             + VE +     + V +    + AAT +F  ANKLG+GGFG VYKG LP GQEIA+KRLSR
Sbjct  484   SNVEFQ-----EFVKYKIEELVAATGNFGEANKLGRGGFGPVYKGRLPNGQEIAIKRLSR  538

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG QEF NE+ VI  +QHRNLVRLLGCC EGDEK+++YE+MPNKSLD+F+FDP K+ 
Sbjct  539   ASGQGQQEFMNEMVVICNVQHRNLVRLLGCCFEGDEKIIIYEFMPNKSLDTFLFDPLKQV  598

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+WR RF+I++ I RGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFGG
Sbjct  599   HLDWRTRFNIVDGICRGLLYLHRDSRLRIIHRDLKPSNILLDEELNPKISDFGMARIFGG  658

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH-SG  454
             N+N+ANT RVVGTYGYMAPEYAMEG FS KSDV+SFG+LLLEI+SGRRNTSF  +D    
Sbjct  659   NENQANTRRVVGTYGYMAPEYAMEGRFSEKSDVFSFGILLLEIISGRRNTSFHYEDQFLS  718

Query  453   IIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             ++  AW+ W+E   + L+DP+I + C   ++ RCI +GLLC Q+ A  RP++S V+  + 
Sbjct  719   LLGLAWKLWNEDNVLALVDPNIPAKCFEVQLSRCINVGLLCTQERAKDRPSISTVISMIN  778

Query  273   TDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++ V LP P+ P +T   + + D DS  ++ +  S+N +T++V+ GR
Sbjct  779   SE-VDLPRPKKPAFTPR-KITQDTDSSRKSQKTCSANDVTLTVLQGR  823



>emb|CDP04297.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/821 (44%), Positives = 504/821 (61%), Gaps = 42/821 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D   IVSA++ F L FFSP  TS+RYVGI  N I  QSVVWVANR+ PI D  G   I+ 
Sbjct  49    DPATIVSASQNFKLAFFSPVNTSDRYVGIILN-IPAQSVVWVANRDDPITDSAGMLTISE  107

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  V+L+G+   +W++N + + +N++  L +T  L++      R    +W+SF  PTDT
Sbjct  108   DGNAVILNGQKNVLWSSNVANSVANSSAQLLDTGNLVLRDNSNGR---ILWESFQTPTDT  164

Query  2190  FLPGMRVDLSAGESKL-FTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWD  2014
              +  M++ + +  S +  TSW +  +PS G FS G+DP   P+  IW   K YWRSG W+
Sbjct  165   LVRTMKIGVISKNSMIRLTSWRSPSDPSVGNFSFGVDPLRIPEFFIWNHSKPYWRSGPWN  224

Query  2013  GRVFLGVP-MRTDFVYGFDLITE------------NDNLYLEYKSSSSDLIMFKVDWNGK  1873
             G VF+G+P M + +   FDL+T             ND   L Y  +SS +++ KV + G 
Sbjct  225   GNVFIGIPEMSSAYQNRFDLVTNPNGSEYFTHSFINDLALLYYVLNSSGVLVEKVSYYGD  284

Query  1872  EVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQW  1693
                     S+  W  ++ +    C VY  CG F  C+   S    C C+ GF P +  +W
Sbjct  285   ------GHSKVSWTSLESE----CDVYGKCGPFGSCNPQHSP--ICTCLQGFEPKNKEEW  332

Query  1692  NARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkc  1513
             +  NWTGGC+R+  LQC +N + G   + DGF ++ +IK+PDFA +   +RS  +     
Sbjct  333   DKGNWTGGCSRKALLQCDRNISAGQVGKPDGFLKLANIKIPDFAHLMELLRSATEQDCGN  392

Query  1512  eedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiiv  1333
             +   +C+  A     GI CM W + L+D+ Q    +G+ L +R+  +EL  + +   +I 
Sbjct  393   QCLNNCSCIAYAYSTGIGCMYWSSSLIDIQQF-SFNGADLHIRVAHTELGFRKNMKAVIA  451

Query  1332  avsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
             +  V+  + + +       C R+   R +   +     L   GE     S   D   + K
Sbjct  452   STVVLGLLFLAISA----YCFRKWLTRHRGNKQNVELSLFEEGEVPKKESILSDKPEQSK  507

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
                  +L  +S+ ++A ATD+F + NKLG GGFG V+KG L  GQ+IAVKRLS  S QG+
Sbjct  508   L---EELPLYSYETLAIATDTFHVKNKLGTGGFGPVFKGKLLSGQKIAVKRLSNSSNQGI  564

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +EF NE+ +I+KLQHRNLVRLLGCC+E +EKML+YEYMPNKSLD+++FD  KR  L W +
Sbjct  565   KEFMNEVELISKLQHRNLVRLLGCCVEREEKMLIYEYMPNKSLDAYLFDLQKRDLLYWNR  624

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             R  IIE I RGLLYLHRDSRL+IIHRDLK SNILLD E+NPKISDFG+ARIFGGNQ++AN
Sbjct  625   RKLIIEGIGRGLLYLHRDSRLKIIHRDLKPSNILLDEELNPKISDFGLARIFGGNQDQAN  684

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAW  436
             TNRVVGTYGYMAPEYAM+G FS KSDVYSFGVLLLEIVSG++NTS   D++   +I YAW
Sbjct  685   TNRVVGTYGYMAPEYAMKGKFSEKSDVYSFGVLLLEIVSGKKNTSSHADENDLSLIGYAW  744

Query  435   EQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTL  256
             + W+E + + L+DP++    V  E+LR + +GLLCVQ+ A  RPN+S V+  L ++   L
Sbjct  745   KLWNENEAVKLVDPALSDPRVEMEILRYVHVGLLCVQESANDRPNVSNVLSMLNSEIAEL  804

Query  255   PVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P P+ P YTA +  S + +   Q+    S N +++++I GR
Sbjct  805   PPPKLPAYTARL-GSTESEGSQQSGH--SVNDVSLTIIQGR  842



>ref|XP_006417365.1| hypothetical protein EUTSA_v10006795mg [Eutrema salsugineum]
 gb|ESQ35718.1| hypothetical protein EUTSA_v10006795mg [Eutrema salsugineum]
Length=838

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/836 (44%), Positives = 518/836 (62%), Gaps = 44/836 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRER  2410
             D+I     IKD  E ++  +  F  GFF+P  ++ R  YVGIWY++I  Q+VVWVAN++ 
Sbjct  28    DRITFSTPIKD-SETLLCKSGIFRFGFFTPVNSTTRLRYVGIWYDKIPIQTVVWVANKDT  86

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             PI D +G   I+ +G  VV DG+N      N    V  ++    L +T  L +   D   
Sbjct  87    PINDTSGVISISDDGNLVVTDGRNRLVWSTNVTVPVAPNDTCAQLMDTGNLRL--QDNRN  144

Query  2235  PNNTIWQSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
                 +W+SF  P ++ LP M  R D   GE+   TSW +  +PS G +++G+     P++
Sbjct  145   KGEILWESFKHPYNSMLPRMNLRTDPRTGENLTLTSWRSYVDPSTGSYTVGLVSFPFPEL  204

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDF--VYGFDLITENDNLYLEYKSSSSDLIMFKV  1888
             ++W+     WRSG W+G+VF+G+P       + GF+L+ +N        ++ S +  F +
Sbjct  205   LVWKNNVPKWRSGPWNGQVFIGLPEMDTLLNIDGFNLLNDNQGTVTLTYANDSFMYHFNL  264

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             D +G   Q+ W+ S   W      P+  C  Y+ CG +  C         C C+ GF P 
Sbjct  265   DPDGVIYQRDWSTSMNAWRIGARFPSTFCDAYSRCGPYGSCHTRGDPP--CKCVKGFVPR  322

Query  1707  DWNQWNARNWTGGCTRRTPLQCQK------NNTEGGGAEKDGFREVKHIKLPDFADIDRN  1546
             +  +WNARNWT GC RR PL+C++      N   G G + DGF +++ +K+P   + +R+
Sbjct  323   NNTEWNARNWTNGCVRRAPLRCERQSNVSSNGGGGRGGKGDGFLKLQKMKVP--VNAERS  380

Query  1545  MRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL  1366
             + + + C K C ++CSC AYA     GI CMLW   LVDM     GSG+ L+VRL  SEL
Sbjct  381   LANEQACPKVCLDNCSCTAYA--YDRGIGCMLWSGSLVDMQSF-LGSGTDLYVRLAHSEL  437

Query  1365  DNKSSKTTiivavsvvaavavlvivsIWLLC---SRRARIRAKKRDEI--PRTELPTSGE  1201
              + S +  II A  V  A    V V   L C    RR  +   +  E+   R E  TSG 
Sbjct  438   KSHSKRAIIITAPVVGVAFVAAVCVL--LACQKFKRRPELEKDRSAELLFKRMEALTSGN  495

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
              S+  S Q  L          +L  F F  +AA+TD+FSL NKLGQGGFG VYKG L  G
Sbjct  496   ESA--SNQVKL---------KELPLFDFQVLAASTDNFSLRNKLGQGGFGPVYKGKLQEG  544

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             QEIAVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD
Sbjct  545   QEIAVKRLSRSSGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLD  604

Query  840   SFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKIS  661
             +++FDP+K+  L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKIS
Sbjct  605   AYLFDPSKQKILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKIS  664

Query  660   DFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNT  481
             DFG+AR+F  N++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN 
Sbjct  665   DFGLARVFRANEDEANTRRVVGTYGYMSPEYAMEGLFSKKSDVFSLGVILLEIISGRRN-  723

Query  480   SFRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPN  301
             S + +++  ++ YAW+ W+EG+  +L DP +F  C  +E+ +C+Q GLLCVQ++A  RPN
Sbjct  724   SHKEENNLNLLAYAWKLWNEGEAASLADPIVFGECFAKEITKCVQTGLLCVQEVASDRPN  783

Query  300   MSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +S V+  L T+N  LP P+ P + A  R   D +S +Q+++  S N ++++ + GR
Sbjct  784   VSTVIGMLTTENTNLPEPKQPAFIAK-RGVSDAESSDQSSQKASVNDVSLTAVTGR  838



>ref|XP_010647319.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Vitis vinifera]
Length=804

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/818 (45%), Positives = 504/818 (62%), Gaps = 34/818 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             + E IVS    F LGFFSP  ++ RYVGIWY +    SVVWVANR++P+ D +G   I+ 
Sbjct  9     NSETIVSNGSLFKLGFFSPSNSTKRYVGIWYGKTSVSSVVWVANRDKPLNDTSGIMKISE  68

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G   +L+G+   I ++N S   SN T  L ++  L+ LK D       IW+SF  P+  
Sbjct  69    DGNLQILNGEKEVIRSSNVSNAVSNTTAQLLDSGNLV-LKDD----RRIIWESFQHPSHA  123

Query  2190  FLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
              L  M++  ++  GE ++ TSW  + +PS G FS+G+DP    Q  IW G   Y+R+G W
Sbjct  124   LLANMKLSTNMYTGERRVLTSWKKASDPSIGSFSVGVDPSNITQTFIWNGSHPYYRTGPW  183

Query  2016  DGRVFLGVPMRTDFV-YGFDL-ITENDNLYLEYKSS---SSDLIMFKVDWNGKEVQQRWN  1852
             +G++F+GV     FV  GF +   E   + L   +S   SS  + + +   G   Q    
Sbjct  184   NGQIFIGVANMNSFVGNGFRMDHDEEGTVVLTVGTSFANSSIFLYYVLTSQGSLEQTDRE  243

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
               +++W         +C VY  CG F  C NS ++ I C C+ G+ P    +W+  NWT 
Sbjct  244   YGKEEWGVTWRSNNSECDVYGTCGAFGIC-NSGTSPI-CSCLRGYEPKYTEEWSRGNWTS  301

Query  1671  GCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCN  1492
             GC R+T LQC++ N+ G   + DGF  +  +K+PD+AD   ++   ++C+++C ++CSC 
Sbjct  302   GCVRKTTLQCERTNSSGQLGKIDGFFRLTTVKVPDYADW--SLAHEDECREECLKNCSCI  359

Query  1491  AYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS-KTTiivavsvva  1315
             AY+     GI CMLW   L+D+ +  +  G+ L++RL  SELD K   K  I V + +  
Sbjct  360   AYS--YYSGIGCMLWSGSLIDLQKFTK-RGADLYIRLAHSELDKKRDMKVIISVTIVIGT  416

Query  1314  avavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEG---KAGA  1144
                 +    +W    R+A ++ K ++ +P            D     D+ + G       
Sbjct  417   IAIAICTYFLWRWIGRQA-VKEKSKEILPSDR--------GDAYQNYDMNMLGDNVNRVK  467

Query  1143  SSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEF  964
               +L    F  +AAAT++F  ANKLGQGGFG VY+G LP GQEIAVKRLSR S QG +EF
Sbjct  468   LEELPLLDFEKLAAATNNFHEANKLGQGGFGPVYRGNLPGGQEIAVKRLSRASAQGQEEF  527

Query  963   TNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFH  784
              NE+ +I+K+QHRNLVRLLG CIEGDEK+L+YEYMPNKSLD+F+FDP KR  L+WR+RF 
Sbjct  528   MNEMILISKIQHRNLVRLLGFCIEGDEKLLIYEYMPNKSLDAFLFDPLKRESLDWRRRFS  587

Query  783   IIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNR  604
             IIE I RGLLY HRDSRL+IIHRDLKASNILLD ++N KISDFGMARIFG NQ++ANT R
Sbjct  588   IIEGIGRGLLYPHRDSRLKIIHRDLKASNILLDEDLNAKISDFGMARIFGSNQDQANTMR  647

Query  603   VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD-HSGIIEYAWEQW  427
             VVGTYGYM+PEYAM G FS KSDV+SFGVLLLEIVSGRRNTSF+ DD +  ++ YAW  W
Sbjct  648   VVGTYGYMSPEYAMGGQFSEKSDVFSFGVLLLEIVSGRRNTSFQYDDQYMSLLGYAWTLW  707

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              E     L+D +I  +C  +E+ RCI +GLLCVQ+ A  RP++S V+  L ++   LP P
Sbjct  708   SEHNIQELIDETIAEACFLEEISRCIHVGLLCVQESAKERPSISTVLSMLSSEIAHLPSP  767

Query  246   RPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + P +    + ++D +S        SSN +T+++I GR
Sbjct  768   KQPPFLEK-QTAIDTESSQPRENQCSSNQVTVTIIQGR  804



>ref|XP_010547161.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Tarenaya hassleriana]
Length=829

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/832 (44%), Positives = 511/832 (61%), Gaps = 33/832 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D+I     IKD  E IVS    F+ GFFSP  ++ RY GIWYN I  Q+VVWVAN++ 
Sbjct  18    AVDRITFSTPIKD-SETIVSDKGMFMFGFFSPVDSTGRYAGIWYNNIPVQTVVWVANKDN  76

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             P+ D +G   ++ +G  VV+DG+       N + S ++++    L +T  L++  T+   
Sbjct  77    PVEDMSGVVSMSEDGNLVVMDGRRRVFWSTNVSVSASANSTWAQLLDTGNLVLQGTEN--  134

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
                  W+SF  P+D++LP M +  D   G +   TSW +  +PSPG ++ G+     P++
Sbjct  135   DGEFFWESFRNPSDSYLPRMVLESDARTGRTIKITSWKSPSDPSPGNYTAGLAADPLPEV  194

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN---LYLEYKSSSSDLIMFK  1891
              IW+     WR+G W+G++F+G P     ++  +    NDN   + + Y + S     FK
Sbjct  195   FIWKDGVAVWRTGPWNGQIFIGFPDVDTGLFLNEFALNNDNQGKVSVSYANDSGKY-HFK  253

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D  G   Q+ WNE +K W    + P  +C  +  CGQFA C N     + C CI GF P
Sbjct  254   LDHEGYISQKSWNEEKKNWSVELKLPKTECDEFGKCGQFASC-NPRRKPL-CRCIKGFEP  311

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGA-EKDGFREVKHIKLPDFADIDRNMRSP  1534
              ++ +WN  NWT GC RR PL+C++ N   G   E+DGF  +K +K P+     R+  + 
Sbjct  312   KNYTEWNRGNWTSGCRRRAPLKCERRNNGNGNGGEEDGFLRLKKMKAPN--STQRSDANE  369

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             ++C + C ++CSC AY      G  CM W   L DM +    +G  L +RL +SE+    
Sbjct  370   QECPRSCLQNCSCTAYT--FDRGYGCMFWTGSLFDMQEF-RVNGIDLQIRLANSEI----  422

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
              K   +  V  +  +    I+   +L +RR   + R  ++D   +        FSS    
Sbjct  423   KKPNKLPVVVTIPVIGGTFIIVFCILFARRKATKRREAEKDRKAKLVFERMEAFSSGNPT  482

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
             Q  L  + K     DL  F F  +AAATD F+LANK+GQGGFG VYKG +  GQEIAVKR
Sbjct  483   QAHLINQAKL---KDLPLFEFQVLAAATDDFALANKIGQGGFGPVYKGKMEEGQEIAVKR  539

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LSR SGQG++E  NE+ VI+KLQHRNLVRLLGCCIEG+E++L+YE+MP KSLDS++FDP 
Sbjct  540   LSRASGQGLEELVNEVVVISKLQHRNLVRLLGCCIEGEERLLVYEFMPKKSLDSYLFDPL  599

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             K+  L+W+ RF I+E I RGLLYLHRDSRLRIIHRDLK SNILLD  +NPKISDFG+ARI
Sbjct  600   KQKLLHWKTRFRIMEGICRGLLYLHRDSRLRIIHRDLKPSNILLDEHLNPKISDFGLARI  659

Query  639   FGGNQNE-ANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             F GN++E ANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRR++SF  D+
Sbjct  660   FHGNEDEAANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRSSSFHKDE  719

Query  462   H-SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
               + ++ YAW+ W+EGK   L DP+++     +E+ RC+ + LLCVQ+LA  RP++S V+
Sbjct  720   ETTNLLAYAWKLWNEGKASELADPAVYDEGFEKEIRRCVHISLLCVQELANDRPSVSTVI  779

Query  285   LFLETDNVTLPVPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
               L  +N  LP P+ P + A  R+ V D +S ++++   S N+ +++ + GR
Sbjct  780   WMLSNENSDLPEPKQPAFIA--RKGVSDAESSDRSSRKASINNASITAVTGR  829



>emb|CDP04301.1| unnamed protein product [Coffea canephora]
Length=871

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/824 (45%), Positives = 505/824 (61%), Gaps = 29/824 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q ++D  E IVS+ + F LGFFSP  +S+RYVGI +N      V  VANR+R
Sbjct  72    AVDYITISQPLQDS-ETIVSSGQTFKLGFFSPANSSDRYVGIMFNVPAVAVVW-VANRDR  129

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+G+G  VVL+G+   +W++N S + +N+T  L +T  L++      R  
Sbjct  130   PLNDSSGTLTISGDGNLVVLNGQKEILWSSNVSNSVANSTAQLLDTGNLVLTDNPSGR--  187

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAGESKL-FTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
              T+W+SF  PTD++L  MR+  S    K+  TSW N  +PS G FS+GI+P+  PQ+ IW
Sbjct  188   -TLWESFQIPTDSYLRRMRLSSSTKGQKIRLTSWRNPSDPSIGSFSLGIEPQQIPQLFIW  246

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSD--LIMFKVDW  1882
                K YWRSG W+  VF+GVP M   ++ GF+L T++  L     + S+D  L+  ++  
Sbjct  247   NDNKPYWRSGPWNNNVFIGVPAMDPVYLNGFNLETDDTGLVSATFTYSNDSGLLYLELSS  306

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G  +Q+  ++ +  W         QC VY  CG F  C    S    C C+ GF P D 
Sbjct  307   SGSILQKVLSDRKGDWEVTFSSQGSQCDVYGICGPFGSCKPHGSP--ICTCLQGFEPRDK  364

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
              +W   NWT GCTRR  LQC++NN+     ++DGF ++ + K+PD A+      S ++C 
Sbjct  365   VEWEGGNWTSGCTRRAMLQCERNNSVRSEGKQDGFLKLPNTKVPDLAEWVAT--SEDECG  422

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTT  1342
              +C  +CSC AYA     GI CM W+  L+D+ Q     G+ L++R+  SEL  K     
Sbjct  423   TQCSNNCSCLAYA--TYPGIGCMHWKGILIDIQQFSSSYGADLYIRVPYSELGKKRDMKA  480

Query  1341  iivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTV  1162
             +I    + A+++  +       C +    R  K D+I   E     +  S FS   +   
Sbjct  481   VIATSVIGASLSFALSA---YFCWKWLAKRKGKEDQISLIEAGEVYKVESLFSHNLE---  534

Query  1161  EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSG  982
                     +L  +S+ ++A ATD F   ++LG+GGFG VYKG L  GQ IAVK+LS+ SG
Sbjct  535   ---QPKLEELPLYSYETLANATDDFEPKSELGKGGFGPVYKGKLSDGQGIAVKKLSKSSG  591

Query  981   QGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELN  802
             QG +EF NE+ VI+KLQHRNLVRLLGCC+  +EKML+YEYMPNKSLD+++F+P+KR  L+
Sbjct  592   QGTEEFMNEVMVISKLQHRNLVRLLGCCVGREEKMLVYEYMPNKSLDTYLFEPSKRGLLD  651

Query  801   WRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQN  622
             W  R  IIE IARGLLYLHRDSRL+IIHRDLKASNILLD ++ PKISDFG+ARIFGGNQ+
Sbjct  652   WNTRISIIEGIARGLLYLHRDSRLKIIHRDLKASNILLDDQLKPKISDFGLARIFGGNQD  711

Query  621   EANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIE  445
             +ANTNRVVGTYGYMAPEYAMEG FS KSDVYSFGVLLLE+VSGRRNT F  D++   ++ 
Sbjct  712   QANTNRVVGTYGYMAPEYAMEGSFSEKSDVYSFGVLLLEVVSGRRNTGFYHDEYELSLLG  771

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W+     NL+DP IF  C+  EV+R + +GLLCVQ+    RPN+S V+  L ++ 
Sbjct  772   YAWKLWNGNDITNLIDPLIFDPCIEVEVMRYVHVGLLCVQEYTKDRPNVSTVLSMLNSEI  831

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               LP P  P Y   +  S      +      S N  T++ + GR
Sbjct  832   ADLPRPNLPAYIGRLGASAG----SPQKSTDSVNGATLTSVQGR  871



>gb|AAC95353.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=830

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/816 (42%), Positives = 492/816 (60%), Gaps = 28/816 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E +VS +  F  GFFSP  ++ RY GIW+N I  Q+VVWVAN   PI D +G   I+ 
Sbjct  33    DSETVVSNHSTFRFGFFSPVNSTGRYAGIWFNNIPVQTVVWVANSNSPINDSSGMVSISK  92

Query  2370  NGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
              G  VV+DG+       N    V ++     L NT  L++L T     +  +W+SF  P 
Sbjct  93    EGNLVVMDGRGQVHWSTNVLVPVAANTFYARLLNTGNLVLLGTTN-TGDEILWESFEHPQ  151

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             + +LP M +  D   G S    SW +  +PSPGR+S G+ P   P++V+W+ +   WRSG
Sbjct  152   NIYLPTMSLATDTKTGRSLKLRSWKSPFDPSPGRYSAGLIPLPFPELVVWKDDLLMWRSG  211

Query  2022  HWDGRVFLGVPMRTDFVYGFDLITENDN---LYLEYKSSSSDLIMFKVDWNGKEVQQRWN  1852
              W+G+ F+G+P     +  F+L   +DN   + + Y + ++ L  F +D  G   Q+ WN
Sbjct  212   PWNGQYFIGLPNMDYRINLFELTLSSDNRGSVSMSY-AGNTLLYHFLLDSEGSVFQRDWN  270

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
              + ++W    + P+ +C  Y  CGQFA C  +  +   C+CI  F P  + +WN  NWT 
Sbjct  271   VAIQEWKTWLKVPSTKCDTYATCGQFASCRFNPGSTPPCMCIKRFKPQSYAEWNNGNWTQ  330

Query  1671  GCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCN  1492
             GC R+ PLQC+  +   G  + DGF  V+ +K+P     +       +         +C+
Sbjct  331   GCVRKAPLQCESRDNNDGSRKSDGFVRVQKMKVPH----NPQRSGANEQDCPESCLKNCS  386

Query  1491  AYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv--v  1318
               A     GI C+LW   L+DM +   G+G   ++RL  SE   +++++ +I    +   
Sbjct  387   CTANSFDRGIGCLLWSGNLMDMQEF-SGTGVVFYIRLADSEFKKRTNRSIVITVTLLVGA  445

Query  1317  aavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASS  1138
                A  V++++W +   R + R   R    R E  +S +  +    Q  L          
Sbjct  446   FLFAGTVVLALWKIAKHREKNR-NTRLLNERMEALSSNDVGAILVNQYKL---------K  495

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTN  958
             +L  F F  +A AT++FS+ NKLGQGGFG VYKG L  G +IAVKRLSR SGQGV+EF N
Sbjct  496   ELPLFEFQVLAVATNNFSITNKLGQGGFGAVYKGRLQEGLDIAVKRLSRTSGQGVEEFVN  555

Query  957   ELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHII  778
             E+ VI+KLQHRNLVRLLG CIEG+E+ML+YE+MP   LD+++FDP K+  L+W+ RF+II
Sbjct  556   EVFVISKLQHRNLVRLLGFCIEGEERMLVYEFMPENCLDAYLFDPVKQRLLDWKTRFNII  615

Query  777   EEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVV  598
             + I RGL+YLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+ARIF GN++E +T RVV
Sbjct  616   DGICRGLMYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGLARIFQGNEDEVSTVRVV  675

Query  597   GTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDE  421
             GTYGYMAPEYAM GLFS KSDV+S GV+LLEIVSGRRN+SF  D  +  +  YAW+ W+ 
Sbjct  676   GTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNSSFYNDGQNPNLSAYAWKLWNT  735

Query  420   GKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRP  241
             G+ + L+DP IF  C   E+ RC+ +GLLCVQD A  RP+++ V+  L ++N  LP P+ 
Sbjct  736   GEDIALVDPVIFEECFENEIRRCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQ  795

Query  240   PTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P +    R + +V+S  Q++   S N+++++ I GR
Sbjct  796   PAFIPR-RGTSEVESSGQSDPRASINNVSLTKITGR  830



>ref|XP_010547170.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X2 [Tarenaya hassleriana]
Length=817

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/831 (44%), Positives = 510/831 (61%), Gaps = 33/831 (4%)
 Frame = -3

Query  2586  ADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
              D+I     IKD  E IVS    F+ GFFSP  ++ RY GIWYN I  Q+VVWVAN++ P
Sbjct  7     VDRITFSTPIKD-SETIVSDKGMFMFGFFSPVDSTGRYAGIWYNNIPVQTVVWVANKDNP  65

Query  2406  ILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             + D +G   ++ +G  VV+DG+       N + S ++++    L +T  L++  T+    
Sbjct  66    VEDMSGVVSMSEDGNLVVMDGRRRVFWSTNVSVSASANSTWAQLLDTGNLVLQGTEN--D  123

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                 W+SF  P+D++LP M +  D   G +   TSW +  +PSPG ++ G+     P++ 
Sbjct  124   GEFFWESFRNPSDSYLPRMVLESDARTGRTIKITSWKSPSDPSPGNYTAGLAADPLPEVF  183

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDN---LYLEYKSSSSDLIMFKV  1888
             IW+     WR+G W+G++F+G P     ++  +    NDN   + + Y + S     FK+
Sbjct  184   IWKDGVAVWRTGPWNGQIFIGFPDVDTGLFLNEFALNNDNQGKVSVSYANDSGKY-HFKL  242

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             D  G   Q+ WNE +K W    + P  +C  +  CGQFA C N     + C CI GF P 
Sbjct  243   DHEGYISQKSWNEEKKNWSVELKLPKTECDEFGKCGQFASC-NPRRKPL-CRCIKGFEPK  300

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGA-EKDGFREVKHIKLPDFADIDRNMRSPe  1531
             ++ +WN  NWT GC RR PL+C++ N   G   E+DGF  +K +K P+     R+  + +
Sbjct  301   NYTEWNRGNWTSGCRRRAPLKCERRNNGNGNGGEEDGFLRLKKMKAPN--STQRSDANEQ  358

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
             +C + C ++CSC AY      G  CM W   L DM +    +G  L +RL +SE+     
Sbjct  359   ECPRSCLQNCSCTAYT--FDRGYGCMFWTGSLFDMQEF-RVNGIDLQIRLANSEI----K  411

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
             K   +  V  +  +    I+   +L +RR   + R  ++D   +        FSS    Q
Sbjct  412   KPNKLPVVVTIPVIGGTFIIVFCILFARRKATKRREAEKDRKAKLVFERMEAFSSGNPTQ  471

Query  1176  CDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRL  997
               L  + K     DL  F F  +AAATD F+LANK+GQGGFG VYKG +  GQEIAVKRL
Sbjct  472   AHLINQAKL---KDLPLFEFQVLAAATDDFALANKIGQGGFGPVYKGKMEEGQEIAVKRL  528

Query  996   SRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAK  817
             SR SGQG++E  NE+ VI+KLQHRNLVRLLGCCIEG+E++L+YE+MP KSLDS++FDP K
Sbjct  529   SRASGQGLEELVNEVVVISKLQHRNLVRLLGCCIEGEERLLVYEFMPKKSLDSYLFDPLK  588

Query  816   RSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIF  637
             +  L+W+ RF I+E I RGLLYLHRDSRLRIIHRDLK SNILLD  +NPKISDFG+ARIF
Sbjct  589   QKLLHWKTRFRIMEGICRGLLYLHRDSRLRIIHRDLKPSNILLDEHLNPKISDFGLARIF  648

Query  636   GGNQNE-ANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
              GN++E ANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRR++SF  D+ 
Sbjct  649   HGNEDEAANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRSSSFHKDEE  708

Query  459   -SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
              + ++ YAW+ W+EGK   L DP+++     +E+ RC+ + LLCVQ+LA  RP++S V+ 
Sbjct  709   TTNLLAYAWKLWNEGKASELADPAVYDEGFEKEIRRCVHISLLCVQELANDRPSVSTVIW  768

Query  282   FLETDNVTLPVPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
              L  +N  LP P+ P + A  R+ V D +S ++++   S N+ +++ + GR
Sbjct  769   MLSNENSDLPEPKQPAFIA--RKGVSDAESSDRSSRKASINNASITAVTGR  817



>ref|NP_172600.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
 gb|AEE28718.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
Length=840

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/831 (44%), Positives = 521/831 (63%), Gaps = 35/831 (4%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + E ++  +  F  GFF+P  ++ R  YVGIWY +I  Q+VVWVAN++
Sbjct  31    DRITFSSPIKDSESETLLCKSGIFRFGFFTPVNSTTRLRYVGIWYEKIPIQTVVWVANKD  90

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I  +G   V DG+N  +W+TN SV  +     ++      ++  D    
Sbjct  91    SPINDTSGVISIYQDGNLAVTDGRNRLVWSTNVSVPVAPNATWVQLMDSGNLMLQDNRNN  150

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +W+SF  P D+F+P M +  D   G +   TSWT+  +PS G ++ GI P   P+++
Sbjct  151   GEILWESFKHPYDSFMPRMTLGTDGRTGGNLKLTSWTSHDDPSTGNYTAGIAPFTFPELL  210

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             IW+     WRSG W+G+VF+G+P     ++  GF+L ++N        ++ S +  F +D
Sbjct  211   IWKNNVPTWRSGPWNGQVFIGLPNMDSLLFLDGFNLNSDNQGTISMSYANDSFMYHFNLD  270

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   Q+ W+ S + W    + P   C  Y  CG+F  C   +     C C+ GF P +
Sbjct  271   PEGIIYQKDWSTSMRTWRIGVKFPYTDCDAYGRCGRFGSCH--AGENPPCKCVKGFVPKN  328

Query  1704  WNQWNARNWTGGCTRRTPLQC--QKNNTEGGGAEK-DGFREVKHIKLPDFADIDRNMRSP  1534
               +WN  NW+ GC R+ PLQC  Q+N + GGG  K DGF +++ +K+P  A+  R+  S 
Sbjct  329   NTEWNGGNWSNGCMRKAPLQCERQRNVSNGGGGGKADGFLKLQKMKVPISAE--RSEASE  386

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             + C K C ++CSC AYA     GI CMLW  +LVDM     GSG  LF+R+  SEL  K+
Sbjct  387   QVCPKVCLDNCSCTAYA--YDRGIGCMLWSGDLVDMQSF-LGSGIDLFIRVAHSEL--KT  441

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE---IPRTELPTSGEFSSDFS  1183
                  ++  + V  V ++  V + L C +  +  AK R       R E  TS   S+  S
Sbjct  442   HSNLAVMIAAPVIGVMLIAAVCVLLACRKYKKRPAKDRSAELMFKRMEALTSDNESA--S  499

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
              Q  L          +L  F F  +A +TDSFSL NKLGQGGFG VYKG LP GQEIAVK
Sbjct  500   NQIKL---------KELPLFEFQVLATSTDSFSLRNKLGQGGFGPVYKGKLPEGQEIAVK  550

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLSR+SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E+ML+YEYMP KSLD+++FDP
Sbjct  551   RLSRKSGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERMLVYEYMPKKSLDAYLFDP  610

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
              K+  L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+AR
Sbjct  611   MKQKILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGLAR  670

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN-TSFRTD  466
             IF  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SGRRN +S + +
Sbjct  671   IFRANEDEANTRRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGRRNSSSHKEE  730

Query  465   DHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
             ++  ++ YAW+ W++G+  +L DP++F  C  +E+ +C+ +GLLCVQ++A  RPN+S V+
Sbjct  731   NNLNLLAYAWKLWNDGEAASLADPAVFDKCFEKEIEKCVHIGLLCVQEVANDRPNVSNVI  790

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               L T+N++L  P+ P +    R + + +S +Q+++  S N ++++ + GR
Sbjct  791   WMLTTENMSLADPKQPAFIVR-RGASEAESSDQSSQKVSINDVSLTAVTGR  840



>ref|XP_002462991.1| hypothetical protein SORBIDRAFT_02g035930 [Sorghum bicolor]
 gb|EER99512.1| hypothetical protein SORBIDRAFT_02g035930 [Sorghum bicolor]
Length=879

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/859 (45%), Positives = 524/859 (61%), Gaps = 50/859 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGT---SNRYVGIWYNEIIPQSVVWVAN  2419
             AA  + QG  +   G+ +VS++  F L FF+P G    S RY+G+ Y +   Q+V WVAN
Sbjct  31    AAAALSQGHSLGA-GDKLVSSDGTFELAFFTPTGAADPSRRYLGVMYAQSNEQTVPWVAN  89

Query  2418  RERPI-LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDG  2242
             R+ P+    + +  +T  G   VL+G+ V     +++  SS+++     T  L +L T  
Sbjct  90    RDAPVSAGSSYSATVTDAGELQVLEGERVVWRTNSATTASSSSSSPANVT--LTLLDTGN  147

Query  2241  WRPN---NTIWQSFHQPTDTFLPGMRVDL-----SAGESKLFTSWTNSGNPSPGRFSMGI  2086
              +       +WQSF  P DTFLPGM + L     SA    LFTSW + G+P  G F++G 
Sbjct  148   LQLTAGATVLWQSFDHPADTFLPGMSITLDRTNRSAVRRTLFTSWRSPGDPGTGDFTLGQ  207

Query  2085  DPRASPQIVIWE--GE---KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE--NDNLYLE  1927
             DP  S Q+ IW   GE     YWRSG W    F+GVP R+ +VYGF L  +  ND+  + 
Sbjct  208   DPLGSAQLYIWRTGGENTNSTYWRSGQWANTNFVGVPWRSLYVYGFKLNGDPYNDSGVMS  267

Query  1926  Y--KSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSS  1753
             Y   + +S    F +  NG E      ++   W  +  QP   C  YN CG  ARC    
Sbjct  268   YVFNTYNSSEYRFMLHSNGTETCYMLLDT-GDWETVWSQPTIPCQAYNMCGANARCAGGG  326

Query  1752  SNGIN----CVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVK  1585
                      C C+ GF P + +++   NWT GC R +PL C  +    GG   DGF ++ 
Sbjct  327   GGDDGQQAVCTCLTGFEPRNVSEYGNGNWTQGCVRSSPLACSSDANVSGGGGGDGFADLP  386

Query  1584  HIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGS  1405
              +KLP+FA     +   + CK+ C  +CSC AY+    GG  C+ W  +L+D+ Q  +G 
Sbjct  387   GVKLPNFAAWGSTVGDADACKQSCLANCSCGAYS--YSGGTGCLTWGQDLLDIYQFPDGE  444

Query  1404  GSTLFVRLHSSELDNKSSK----TTiivavsvvaavavlvivsIWLLCSRRARI------  1255
             G  L +++ +  LD   S+    TT+ VAV +V  V     + +W  C RR +       
Sbjct  445   GYDLQIKVPAYLLDQTGSRRRRWTTVAVAVVIVVVVLAGCGLLLWK-CRRRIKEKLGIVG  503

Query  1254  RAKKRDEIPRTELPTSGEFSSDFSA--QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSL  1081
             R K +     + LP   E   DFS   Q D   E + G   +L  FS   +AAAT  FS 
Sbjct  504   REKTKTTTQPSLLPLR-EARQDFSGPKQVDQE-EAEGGKKCELPLFSLEMVAAATGDFSA  561

Query  1080  ANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGC  901
              NKLG+GGFGHVYKG LP G+E+AVKRLSR SGQG++EF NE+ +IAKLQHRNLV+LLGC
Sbjct  562   DNKLGEGGFGHVYKGRLPGGEEVAVKRLSRGSGQGLEEFKNEVILIAKLQHRNLVKLLGC  621

Query  900   CIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRII  721
             CI+G+EK+L+YEYMPNKSLD+F+FDPA+R  L+W+ RFHIIE IARGLLYLHRDSRLR++
Sbjct  622   CIQGEEKILVYEYMPNKSLDAFLFDPARRGLLDWKTRFHIIEGIARGLLYLHRDSRLRVV  681

Query  720   HRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVK  541
             HRDLKASNILLD +MNPKISDFGMARIFGG+QN+ NTNRVVGT GYM+PEYAMEGLFSV+
Sbjct  682   HRDLKASNILLDRDMNPKISDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAMEGLFSVR  741

Query  540   SDVYSFGVLLLEIVSGRRNTSF-RTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQE  364
             SDVYSFG+L+LEIVSG++N+SF R +    I+ +AW+ W+  +   L+DP+I  +C  +E
Sbjct  742   SDVYSFGILILEIVSGQKNSSFHRMEGSLNIVGHAWQLWNADRGEQLIDPAILPACPVRE  801

Query  363   VLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSW--N  190
              LRC+ + LLCVQD A  RP++S VV+ L +D+  LP+P+PPT+T     S D D     
Sbjct  802   ALRCVHMALLCVQDHACDRPDISYVVMALGSDSSVLPMPKPPTFTLQCTSS-DRDGIFPE  860

Query  189   QNNELPSSNSITMSVIVGR  133
             + +E  S+  +T++++ GR
Sbjct  861   RVDESYSACDLTVTMLHGR  879



>ref|XP_010052421.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Eucalyptus grandis]
Length=824

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/828 (44%), Positives = 520/828 (63%), Gaps = 37/828 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I   + I+D  ++I S+   + +GFFSP G++NRYVGIWY+ +   +V+WVANRE 
Sbjct  25    GGDVITANEHIQDP-DSITSSGGLYRMGFFSPNGSANRYVGIWYDNVPTYNVLWVANREN  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PILD +G   I+ +G  VV++GK   +W++N S + ++A   L ++  L++LK       
Sbjct  84    PILDSSGVVKISNDGNLVVMNGKGELVWSSNVSNSVTDAKAQLLDSGNLVLLKHSSNSNG  143

Query  2229  NTIWQSFHQPTDTFLPGMRVDL--SAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             + +WQSF   T++FL  M++    +  E +  TSW +  +PS G FS  + P   P++ I
Sbjct  144   DPLWQSFQHMTNSFLAKMKLSTISNPNEKQALTSWKSPSDPSIGSFSASLVPWYIPELFI  203

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTD-FVYGFDLITEND-NLYLEYK-SSSSDLIMFKVD  1885
             W     YWRSG       +G+P +   ++ GFDL+ + +  +YL++  S +S L    + 
Sbjct  204   WNCSSLYWRSGP------IGIPKKQSVYINGFDLVNDQEGTVYLDHSFSEASYLSYLLLK  257

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              NG  VQ   + +   W  +       C VY  CG F  C+  + N   C C+ GF P +
Sbjct  258   SNGDLVQPYLDHNSSSWKIVWSSRVSDCDVYGQCGPFGICN--ARNSPICSCLRGFEPKN  315

Query  1704  WNQWNARNWTGGCTRRTPLQCQ-KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPed  1528
               +W   NW+ GC R++ LQC    N     ++KDGF +++ +K+P+ A     + +  D
Sbjct  316   SEEWRRGNWSSGCIRKSSLQCNGTTNGSSTASKKDGFLKLEMMKVPNSAIFYSTLEN--D  373

Query  1527  ckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSK  1348
             C   C  +CSC AYA     G+ CM W  +L+D+ +L  G G+ L+VRL  SELD K   
Sbjct  374   CPGNCSINCSCVAYA--YDSGVGCMFWTGDLIDLQKLSVG-GTALYVRLAHSELDEKGH-  429

Query  1347  TTiivavsvvaavavlvivsIWLLCSRRARIRAKKRD-EIPRTELPTSGEFSSDFSAQCD  1171
                 +  + V    ++VI++IW      AR +AKKR  +  + +  +SGE SS      +
Sbjct  430   -LREIVATTVIMGTLIVIITIWF-----ARWKAKKRAVKEGKEKHLSSGEVSSLVMLGEN  483

Query  1170  LT-VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLS  994
             L+ VE +     + V +    + AAT +F  ANKLG+GGFG VYKG LP GQEIA+KRLS
Sbjct  484   LSNVEFQ-----EFVKYKIEELVAATGNFGEANKLGRGGFGPVYKGRLPNGQEIAIKRLS  538

Query  993   RRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKR  814
             R SGQG QEF NE+ VI  +QHRNLVRLLGCC EGDEK+++YE+MPNKSLD+F+FDP K+
Sbjct  539   RASGQGQQEFMNEMVVICNVQHRNLVRLLGCCFEGDEKIIIYEFMPNKSLDTFLFDPLKQ  598

Query  813   SELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFG  634
               L+WR RF+I++ I RGLLYLHRDSRLRIIHRDLK SNILLD E+NPKISDFGMARIFG
Sbjct  599   VHLDWRTRFNIVDGICRGLLYLHRDSRLRIIHRDLKPSNILLDEELNPKISDFGMARIFG  658

Query  633   GNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH-S  457
             GN+N+ANT RVVGTYGYMAPEYAMEG FS KSDV+SFG+LLLEI+SGRRNTSF  +D   
Sbjct  659   GNENQANTRRVVGTYGYMAPEYAMEGRFSEKSDVFSFGILLLEIISGRRNTSFHYEDQFL  718

Query  456   GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFL  277
              ++  AW+ W+E   + L+DP+I + C   ++ RCI +GLLC Q+ A  RP++S V+  +
Sbjct  719   SLLGLAWKLWNEDNVLALVDPNIPAKCFEVQLSRCINVGLLCTQERAKDRPSISTVISMI  778

Query  276   ETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              ++ V LP P+ P +T   + + D DS  ++ +  S+N +T++V+ GR
Sbjct  779   NSE-VDLPRPKKPAFTPR-KITQDTDSSRKSQKTCSANDVTLTVLQGR  824



>ref|XP_007021377.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12902.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=815

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/797 (45%), Positives = 493/797 (62%), Gaps = 44/797 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A DKI   + + D G  +VS +  F LGFF+P  + NRY+GIWYN I  Q+VVWVANR  
Sbjct  20    ALDKISPSESLTD-GMTLVSNDGSFALGFFNPGSSENRYLGIWYNNIPMQNVVWVANRIT  78

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI D  G   I   G  V+L     ++W+ NS+  + N  + L ++  L++   +     
Sbjct  79    PINDTTGLLKIESTGRVVLLGQNQTTVWSINSTKAAQNPILQLLDSGNLVVRDGNDGNSE  138

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N +WQSF  PTDT LPGM++  DL  G ++   +W NS +PSPG  + G++ + +P++VI
Sbjct  139   NYLWQSFDHPTDTMLPGMKIGWDLRTGLNRRLAAWKNSDDPSPGDLTYGVELQGNPEMVI  198

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLI-TENDNLYLEYKSSSSDLIMFKVDW  1882
              +G ++Y+RSG W+G  F G P +R++ V+ +D +  E +  Y+ Y  + S +  F ++ 
Sbjct  199   RKGSEKYYRSGLWNGDGFSGTPNLRSNPVFDYDFVWNEEEVYYIYYLKNKSVMSRFVLN-  257

Query  1881  NGKEVQQR--WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
               + V+QR  WN   + W      P+D C     CG    CDNS      C C+  F P 
Sbjct  258   QTESVRQRYTWNPETQTWKLFSIMPSDYCDRRGLCGANGNCDNSKLPA--CQCLKAFRPK  315

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD--FADIDRNMRSP  1534
                +WN+ +W+ GC    PL CQ           DGF  +  +K PD   + +++ M + 
Sbjct  316   SLEKWNSSDWSDGCVHNKPLNCQSG---------DGFLRIGRVKTPDTSLSWVNKTM-NL  365

Query  1533  edckkkceedCSCNAY--APPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
             ++C+ +C ++CSC AY  A    GG  C +W ++L+D+ Q  +  G  L++R+ +SE + 
Sbjct  366   KECRARCLQNCSCMAYTNADIRGGGSGCAMWFDDLIDIKQF-QSFGQDLYIRVSASEAEL  424

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
             K+++   +  +        L I+       RR R   K +DE+             D   
Sbjct  425   KNTRKAKLAVIIATPIALFLGILVAIYYVRRRRR---KLKDEV-------------DERK  468

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
             + D   +G+     DL  F   +IA ATDSFS  NKLG+GGFG VYKG L  GQEIAVKR
Sbjct  469   ENDQKNQGRT-EDMDLAVFELGTIARATDSFSFNNKLGEGGFGPVYKGTLANGQEIAVKR  527

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS+ SGQG+ EF  E+ +IAKLQHRNLVRLLGCCI G+EKML+YEYMPN+SLDSF+FD  
Sbjct  528   LSKSSGQGLNEFKTEVKLIAKLQHRNLVRLLGCCIHGEEKMLVYEYMPNRSLDSFIFDQR  587

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             +   L+W KRF II  IARGLLYLH+DSRLRIIHRDLKASN+LLD EMNPKISDFGMAR 
Sbjct  588   RCKVLDWPKRFQIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMART  647

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDH  460
             FGG+Q EANTNRVVGTYGYMAPEYA++GLFSVKSDV+SFG+LLLEI+SGR+N  F   + 
Sbjct  648   FGGDQTEANTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILLLEIISGRKNRGFYHQNQ  707

Query  459   SG-IIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
             SG +IE+AW  W EGKP+NL D  +  +    +VLRCI + LLCVQ     RP+MS+VVL
Sbjct  708   SGNLIEHAWRLWKEGKPLNLADDLLAETGSLSQVLRCIHISLLCVQQHPEERPSMSSVVL  767

Query  282   FLETDNVTLPVPRPPTY  232
              L ++N  LP+P+ P +
Sbjct  768   MLGSEN-ELPLPKQPGF  783



>ref|NP_001184962.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
 sp|Q9SXB8.3|Y1133_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28719.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
Length=842

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/832 (44%), Positives = 519/832 (62%), Gaps = 35/832 (4%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + E ++  +  F  GFF+P  ++ R  YVGIWY +I  Q+VVWVAN++
Sbjct  31    DRITFSSPIKDSESETLLCKSGIFRFGFFTPVNSTTRLRYVGIWYEKIPIQTVVWVANKD  90

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I  +G   V DG+N  +W+TN SV  +     ++      ++  D    
Sbjct  91    SPINDTSGVISIYQDGNLAVTDGRNRLVWSTNVSVPVAPNATWVQLMDSGNLMLQDNRNN  150

Query  2232  NNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +W+SF  P D+F+P M +  D   G +   TSWT+  +PS G ++ GI P   P+++
Sbjct  151   GEILWESFKHPYDSFMPRMTLGTDGRTGGNLKLTSWTSHDDPSTGNYTAGIAPFTFPELL  210

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             IW+     WRSG W+G+VF+G+P     ++  GF+L ++N        ++ S +  F +D
Sbjct  211   IWKNNVPTWRSGPWNGQVFIGLPNMDSLLFLDGFNLNSDNQGTISMSYANDSFMYHFNLD  270

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   Q+ W+ S + W    + P   C  Y  CG+F  C   +     C C+ GF P +
Sbjct  271   PEGIIYQKDWSTSMRTWRIGVKFPYTDCDAYGRCGRFGSCH--AGENPPCKCVKGFVPKN  328

Query  1704  WNQWNARNWTGGCTRRTPLQC--QKNNTEGGGAEK-DGFREVKHIKLPDFADIDRNMRSP  1534
               +WN  NW+ GC R+ PLQC  Q+N + GGG  K DGF +++ +K+P  A+  R+  S 
Sbjct  329   NTEWNGGNWSNGCMRKAPLQCERQRNVSNGGGGGKADGFLKLQKMKVPISAE--RSEASE  386

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             + C K C ++CSC AYA     GI CMLW  +LVDM     GSG  LF+R+  SEL   S
Sbjct  387   QVCPKVCLDNCSCTAYA--YDRGIGCMLWSGDLVDMQSF-LGSGIDLFIRVAHSELKTHS  443

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQC  1174
             +   +I A  +   +          +C   A  + KKR   P      S E    F    
Sbjct  444   NLAVMIAAPVIGVMLIAA-------VCVLLACRKYKKR---PAPAKDRSAELM--FKRME  491

Query  1173  DLTVEGKAGAS----SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
              LT + ++ ++     +L  F F  +A +TDSFSL NKLGQGGFG VYKG LP GQEIAV
Sbjct  492   ALTSDNESASNQIKLKELPLFEFQVLATSTDSFSLRNKLGQGGFGPVYKGKLPEGQEIAV  551

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLSR+SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E+ML+YEYMP KSLD+++FD
Sbjct  552   KRLSRKSGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERMLVYEYMPKKSLDAYLFD  611

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
             P K+  L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+A
Sbjct  612   PMKQKILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGLA  671

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN-TSFRT  469
             RIF  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SGRRN +S + 
Sbjct  672   RIFRANEDEANTRRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGRRNSSSHKE  731

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
             +++  ++ YAW+ W++G+  +L DP++F  C  +E+ +C+ +GLLCVQ++A  RPN+S V
Sbjct  732   ENNLNLLAYAWKLWNDGEAASLADPAVFDKCFEKEIEKCVHIGLLCVQEVANDRPNVSNV  791

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +  L T+N++L  P+ P +    R + + +S +Q+++  S N ++++ + GR
Sbjct  792   IWMLTTENMSLADPKQPAFIVR-RGASEAESSDQSSQKVSINDVSLTAVTGR  842



>ref|XP_006427832.1| hypothetical protein CICLE_v10027468mg, partial [Citrus clementina]
 gb|ESR41072.1| hypothetical protein CICLE_v10027468mg, partial [Citrus clementina]
Length=789

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/835 (45%), Positives = 508/835 (61%), Gaps = 67/835 (8%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTS-NRYVGIWYNE--IIPQSVVWVAN  2419
             A D I   Q+I D  E I+S   KF LGFFSP+G S NRY+GIWYN+     ++VVWVAN
Sbjct  6     ATDTITSSQFIGDP-EAIISIGSKFKLGFFSPDGNSTNRYIGIWYNKGGSANKTVVWVAN  64

Query  2418  RERPILDKNGAFGITGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTD  2245
             R +P+ D +G F I  +G  VVL+G+       N +S V +SN    L ++  L++    
Sbjct  65    RSKPLNDSSGIFTIWEDGNLVVLNGQKEIHWSSNVSSLVKNSNTRAQLLDSGNLVLHDNI  124

Query  2244  GWRPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRAS  2071
                   +IW SF + TDTF   M+V  DL  G+    TSW +  NPS G FS G+D    
Sbjct  125   S---QVSIWDSFQEATDTFYSEMKVSTDLRTGKKVQLTSWRSLSNPSIGSFSAGLDSFTI  181

Query  2070  PQIVIW-EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND--NLYLEYKSSSSDL  1903
             P++ IW  G + YWRSG W+GR F+G+P M + ++ GF+L  ++     YL +  + +D 
Sbjct  182   PEVFIWINGTRPYWRSGPWNGRYFIGIPDMNSVYLDGFNLGEDHQKGTRYLTFAFADND-  240

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
             + F +   G   ++ W + +         P + C VY  CG F  C NS    I C C++
Sbjct  241   VFFTLTPQGNLEERAWVDGKAHLKIYFFYPTNDCDVYGKCGAFGSC-NSQKIPI-CSCLL  298

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQK----NNTEGGGAEKDGFREVKHIKLPDFADI  1555
             GF P +   WN  NW+GGC RR PL CQ+    +  EG   ++DGF +++ +K       
Sbjct  299   GFEPKNAEDWNRGNWSGGCVRRKPLLCQRTVKPSEVEG---KQDGFFKLETMK-------  348

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHS  1375
                MR                         + CM+W + L+D+ +L  G G+ L++R+  
Sbjct  349   HMLMRL-----------------------ALGCMIWTHNLIDIRKLPSG-GTNLYIRVAH  384

Query  1374  SELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFS  1195
              ELD K  K  II++V V      +     W   ++R  +  K+  ++ R +L   GE  
Sbjct  385   EELDRKDMKLVIILSVIVGIIAIAICTFFAWRWFAKRKAM--KENSKVQRLDL---GEAY  439

Query  1194  SDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQE  1015
             ++FS     T +       DL+ F+F  +A AT++F LANKLGQGGFG VYKG L  GQE
Sbjct  440   ANFS-----TEKVNPARLQDLLVFNFEELANATNNFQLANKLGQGGFGPVYKGKLQDGQE  494

Query  1014  IAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSF  835
             IAVKRLS+ SGQG +EF NE+ VI+ LQHRNLVRLLGCC+E +E ML+YEYMPNKSLDSF
Sbjct  495   IAVKRLSKASGQGQEEFMNEVMVISNLQHRNLVRLLGCCVEREENMLIYEYMPNKSLDSF  554

Query  834   VFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDF  655
             +FDP ++S L+W KRF+II+ I+RGLLYLHRDSRLRIIHRDLKASNILLD ++NPKISDF
Sbjct  555   LFDPQRQSLLDWPKRFNIIKGISRGLLYLHRDSRLRIIHRDLKASNILLDDDLNPKISDF  614

Query  654   GMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF  475
             G+ARIFGGNQ++A T R+VGTYGYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF
Sbjct  615   GLARIFGGNQDQAATKRLVGTYGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSF  674

Query  474   RTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
               ++    ++ YAW+ W++   ++L+DP I  S    E++RC+ +GLLCVQ+    RPNM
Sbjct  675   YHEEFELTLLGYAWKLWNDNNVIDLVDPLISESGFKMEIIRCVNVGLLCVQEFVKDRPNM  734

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
               VV  L ++   LP  + P +T          S NQN ++ S N +T++++ GR
Sbjct  735   PTVVSMLNSEIKDLPAAKQPAFTVRRGAYDSASSSNQNQQICSINDVTVTLMEGR  789



>ref|XP_009148462.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Brassica rapa]
Length=914

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/833 (43%), Positives = 514/833 (62%), Gaps = 40/833 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + + ++S +  F  GFF+P  ++ R  YVGIWY++I  Q+VVWVANRE
Sbjct  106   DRITFSTPIKDSESKTLLSKSGVFRFGFFTPVNSTGRLRYVGIWYDKIPVQTVVWVANRE  165

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I+ +G  VV DG+N  +W+TN +V  +     ++      +   D    
Sbjct  166   APINDTSGVVSISDDGNLVVTDGRNSLLWSTNVTVPVAPNETWVQLMENGNLRLQDNRNN  225

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +W+SF  P  + LP M + ++   GE+   TSW +  +PS G +++G+     P+++
Sbjct  226   GEILWESFKHPYSSMLPRMSLGINNGTGENTGLTSWRSYTDPSTGNYTVGLVAFPFPELL  285

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDF--VYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             IW+ +   WRSG W+G+VF+G+P       + GF+L  +N    L   ++ S L  F +D
Sbjct  286   IWKNKVPQWRSGPWNGQVFIGLPDMDSLLNIDGFNLNNDNQGTVLLTFANDSFLYHFNLD  345

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              NG   Q+ W+ S   W      P+  C  YN CG +  C+        C CI GF P +
Sbjct  346   PNGAIYQRDWSTSMNDWRVGVRFPSTDCDEYNRCGPYGSCNYREDP--QCKCIKGFVPRN  403

Query  1704  WNQWNARNWTGGCTRRTPLQCQ--KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
               +W+  NW  GC RR PL+C+  KN +  GG E D F +V+ +K+P   ++  ++ + +
Sbjct  404   NTEWSLGNWISGCVRRAPLRCERVKNGSSNGGKE-DWFLKVQKMKVP--VNVQPSLANAQ  460

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C K C ++CSC AYA     GI CMLW   LVDM     GSG  L++RL  SEL   S 
Sbjct  461   ACPKVCLDNCSCTAYA--YDQGIGCMLWSGSLVDMQSF-LGSGIDLYIRLSHSELKAHSK  517

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEF-------SS  1192
             +  +I A+ +              +C   A ++ KKR   P+ +              S 
Sbjct  518   RAVMITALVLGIVFVSA-------VCVLLACLKLKKRPGEPKKDRSVEQLLKRMEEVNSG  570

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             D +A   + +E       +L  F F  +A ATD FSL +KLGQGGFG VYKG LP GQEI
Sbjct  571   DEAASNQVKLE-------ELPLFEFQVLATATDDFSLRSKLGQGGFGPVYKGKLPEGQEI  623

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMPNKSLD+++
Sbjct  624   AVKRLSRASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPNKSLDAYL  683

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP K+  L+W+ R +I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  +NPKISDFG
Sbjct  684   FDPLKQKILDWKTRLNIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDDNLNPKISDFG  743

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +AR+F  N++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN S++
Sbjct  744   LARVFRANEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRN-SYK  802

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              D++  ++ Y W  W+EG+  +L DPS+F     +E+ +C+Q+ LLCVQ++A  RPN+S 
Sbjct  803   KDNYPNLLAYVWTLWNEGEAASLADPSVFDESFEKEITKCVQISLLCVQEVANDRPNVST  862

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  L T+N+ LP P+ P +     +S + +S +Q+++  S N ++++ + GR
Sbjct  863   VIWMLTTENMDLPEPKQPAFITRREKS-EGESSDQSSQKESINDVSLTSVTGR  914



>ref|XP_010529375.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X2 [Tarenaya hassleriana]
Length=774

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/737 (49%), Positives = 479/737 (65%), Gaps = 34/737 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKD--DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANR  2416
             A ++I +G+ ++D  D E +VS ++ F LGFFS   +++RY+GI Y  I  ++VVW+ANR
Sbjct  41    AGNRITRGESLRDGDDHEPLVSPDKIFELGFFSLGTSTSRYLGIRYGNIEDKAVVWIANR  100

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGW  2239
              +PI DK+G   +  +G  V+ DG N  +  +     +SSN   VLR++   ++ +T   
Sbjct  101   AKPISDKSGVLTLGNDGNLVLSDGNNSVVWSSGTKIESSSNTEAVLRDSGNFLLSETG--  158

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
               +   WQSF  PTDTFLP MRV ++   GE++ F SW +S +PSPG F+MG+DP  +P+
Sbjct  159   -KSKVYWQSFDHPTDTFLPEMRVKVNQRMGENRAFVSWKSSDDPSPGNFTMGVDPSGAPE  217

Query  2064  IVIWEGE-KRYWRSGHWDGRVFLGVP---MRTDFVYGFDLIT---ENDNLYLEY-KSSSS  1909
             IV+WEG   R WRSG W+  +F G+P     T+++YGF L +   EN ++   Y  S  S
Sbjct  218   IVVWEGNGTRKWRSGQWNSAIFTGIPNMAASTNYLYGFKLSSPPDENGSVDFTYVPSDRS  277

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L+ F+V  NG E + RW+   K+W   Q +P  +C  YN CG F  C+    N   C C
Sbjct  278   VLLRFRVLPNGTEQELRWDADIKKWTIFQSEPDFECDEYNRCGNFGICN--MKNAEICSC  335

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGG---AEKDGFREVKHIKLPDFAD  1558
             I G+ P      +  +W+ GC RRT L+CQ   T        +KD F  +K +KLPDF  
Sbjct  336   IKGYEPV-----SPGDWSKGCRRRTELKCQSQRTNASTVLEGQKDEFFTLKTVKLPDFER  390

Query  1557  IDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLH  1378
             +  +  S +  +K  E+  SCNAY      GI CM+W   LVD+ Q   G G++L +RL 
Sbjct  391   VLASTDSDKCKEKCLEDC-SCNAYV--FANGIGCMVWNGSLVDVQQFTNG-GASLHIRLD  446

Query  1377  SSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAK---KRDEIPRTELPTS  1207
              SEL      + +I+   VV  + +  I+       RR    A    + +++   ++  S
Sbjct  447   GSELGTNHVSSLVIIIPVVVGVILLGGILLFLCRFRRRKATSASACCQNNDVSAVDVTRS  506

Query  1206  -GEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVL  1030
              G  ++  S   D+ +EGK   +S+L  FS S+++AAT +F   N+LG+GGFG VYKGVL
Sbjct  507   KGSSAAAISGSIDIVIEGKPVNTSELPVFSLSTVSAATYNFCRENELGRGGFGPVYKGVL  566

Query  1029  PCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNK  850
               GQEIAVKRLS +SGQG +EF NE+ +IAKLQHRNLVRLLGCC EG+EKML+YEYMPNK
Sbjct  567   QDGQEIAVKRLSGKSGQGDEEFKNEIILIAKLQHRNLVRLLGCCFEGEEKMLVYEYMPNK  626

Query  849   SLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNP  670
             SLD F+F+ +KR+ L+W+ RF I+E IARGLLYLHRDSRLRIIHRD+KASN+LLD EMNP
Sbjct  627   SLDFFLFNESKRALLDWKLRFSIVEGIARGLLYLHRDSRLRIIHRDMKASNVLLDAEMNP  686

Query  669   KISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGR  490
             KISDFGMARIFGGNQNEANT RVVGTYGYM+PEYAMEGLFSVKSDVYSFGVLLLEIVSG+
Sbjct  687   KISDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGK  746

Query  489   RNTSFRTDDHSGIIEYA  439
             RNTSFR+ +H  +I Y 
Sbjct  747   RNTSFRSSEHGSLINYV  763



>emb|CDP04302.1| unnamed protein product [Coffea canephora]
Length=826

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/825 (44%), Positives = 519/825 (63%), Gaps = 30/825 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q ++D  E IVS+N+ F LGFFSP  +S RYVGI +N      V  VANR+R
Sbjct  26    AVDYITITQPLQDS-ETIVSSNQTFKLGFFSPANSSGRYVGIMFNVPAVAVVW-VANRDR  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +G   I+G+G  VVL+G+   +W++N S + +N+T  L +T  L++      R  
Sbjct  84    PLNDSSGTLTISGDGNLVVLNGQKEILWSSNVSNSVANSTAQLLDTGNLVLTDNPSGR--  141

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSAGESKL-FTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
              T+W+SF  PTD++L  MR+  S    K+  TSW N+ +PS G FS+GI+P+ +PQ+ IW
Sbjct  142   -TLWESFQIPTDSYLRRMRLSSSTKGQKIRLTSWRNASDPSIGSFSLGIEPQQTPQLFIW  200

Query  2052  EGEKRYWRSGHWDGRVFLGV-PMRTDFVYGFDLITENDNLYLEYKSSSSD--LIMFKVDW  1882
                K YWRSG W+   F+GV  M   ++ GF+L+T++  L     + SSD  L+  ++  
Sbjct  201   NDNKPYWRSGPWNSSAFIGVSAMDPVYLNGFNLVTDDTGLVSATFTYSSDSGLLYLELSS  260

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G  +Q+  ++ +  W         QC VY  CG F  C    S    C C+ GF P D 
Sbjct  261   SGSILQKVLSDRKGDWEVTWSSQGSQCDVYGICGPFGSCKPHGSP--ICTCLQGFEPRDK  318

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
              +W   NWT GCTRR  LQC++NN+     ++DGF ++ + K+PD A+      S ++C 
Sbjct  319   VEWEGGNWTSGCTRREMLQCERNNSVRSEGKQDGFLKLPNTKVPDLAEWVAT--SEDECG  376

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS-KT  1345
              +C  +CSC AYA   PG I CM W+  L+D+ Q     G+ L++R+  SEL  K   K 
Sbjct  377   TQCSNNCSCLAYAS-YPG-IGCMHWKGSLIDIQQFSSSYGADLYIRVPYSELGKKRDMKA  434

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
              I  +V   +    + +   W   ++    + K +D+           F   ++ +  ++
Sbjct  435   VIATSVIAASLFIAVSLYFCWKWWTKH---KGKDQDD-------QVSSFEPAYNVENMVS  484

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
               G      +L  +++ ++A ATD+F   N+LG+GGFG VYKG L  GQEIAVKRLS  S
Sbjct  485   KTGDGAKLEELPLYTYETLAKATDNFEHCNELGKGGFGQVYKGKLLDGQEIAVKRLSNTS  544

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG++EF NE+ VI+KLQHRNLVRL+GCC E +EKML+YEYMPNKSLD  +FD  K S L
Sbjct  545   GQGIEEFMNEVVVISKLQHRNLVRLIGCCAEREEKMLVYEYMPNKSLDFHIFDSDKPSVL  604

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W+KR  I++ I RGLLYLHRDSRL+IIHRDLKASNILLD E+ PKISDFG+ARIF GN+
Sbjct  605   DWKKRVTIVDGIGRGLLYLHRDSRLKIIHRDLKASNILLDKELRPKISDFGLARIFRGNE  664

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GII  448
             ++ANT RVVGTYGY+APEYAMEG+FS KSDVYSFGVLLLEIV+GRRN++F   ++   ++
Sbjct  665   DQANTRRVVGTYGYIAPEYAMEGMFSEKSDVYSFGVLLLEIVTGRRNSNFYYHENELSLL  724

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAW+ W+E + + L+D ++F   + +EVLR +  GLLCVQ+ A  RP++SAV+  L ++
Sbjct  725   GYAWKLWNEKEAVKLIDAAMFVPGIEKEVLRYVHAGLLCVQEFAKDRPDISAVLSMLNSE  784

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
                LP+P+ P YT   RR    +S + +  + S N++T++++ G+
Sbjct  785   ISDLPLPKLPAYT---RRLGSSESDSSSQRVGSINNVTVTIVEGQ  826



>emb|CDX97950.1| BnaA06g07010D [Brassica napus]
Length=863

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/833 (43%), Positives = 513/833 (62%), Gaps = 40/833 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + + ++  +  F  GFF+P  ++ R  YVGIWY++I  Q+VVWVANR+
Sbjct  55    DRITFSTPIKDLESKTLLCKSGVFRFGFFTPVNSTGRLRYVGIWYDKIPVQTVVWVANRD  114

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I+ +G  VV DG+N  +W+TN +V  +     ++      +   D    
Sbjct  115   APINDTSGVVSISDDGNLVVTDGRNSLLWSTNVTVLVAPNATWVQLMENGNLRLQDNRNN  174

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +W+SF  P  + LP M + L+   GE+   TSW +  +PS G +++G+     P+++
Sbjct  175   GEILWESFKHPYSSMLPRMSLGLNNGTGENTGLTSWRSYTDPSTGNYTVGLVAFPFPELL  234

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDF--VYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             IW+ +   WRSG W+G+VF+G+P       + GF+L  +N    L   ++ S L  F +D
Sbjct  235   IWKNKVPQWRSGPWNGQVFIGLPDMDSLLNIDGFNLNNDNQGTVLLTFANDSFLYHFNLD  294

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              NG   Q+ W+ S   W      P+  C  YN CG +  C+        C CI GF P +
Sbjct  295   PNGAIYQRDWSTSMNDWRVGVRFPSTDCDEYNRCGPYGSCNYREDP--QCKCIKGFVPRN  352

Query  1704  WNQWNARNWTGGCTRRTPLQCQ--KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
               +W+  NW  GC RR PL+C+  KN +  GG E D F +V+ +K+P   ++  ++ + +
Sbjct  353   NTEWSLGNWISGCVRRAPLRCERVKNGSSNGGKE-DWFLKVQKMKVP--VNVQPSLANAQ  409

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C K C ++CSC AYA     GI CMLW   LVDM     GSG  L++RL  SEL   S 
Sbjct  410   ACPKVCLDNCSCTAYA--YDQGIGCMLWSGNLVDMQSF-LGSGIDLYIRLSHSELKAHSK  466

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEF-------SS  1192
             +  +I A+ +              +C   A ++ KKR   P+ +              S 
Sbjct  467   RAVMITALVLGIVFVSA-------VCVLLACLKLKKRPGEPKKDRSVEQLLKRMEEVNSG  519

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             D +A   + +E       +L  F F  +A ATD FSL +KLGQGGFG VYKG LP GQEI
Sbjct  520   DEAASNQVKLE-------ELPLFEFQVLATATDDFSLRSKLGQGGFGPVYKGKLPEGQEI  572

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMPNKSLD+++
Sbjct  573   AVKRLSRASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPNKSLDAYL  632

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP K+  L+W+ R +I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  +NPKISDFG
Sbjct  633   FDPLKQKILDWKTRLNIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDDNLNPKISDFG  692

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +AR+F  N++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN S++
Sbjct  693   LARVFRANEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRN-SYK  751

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              D++  ++ Y W  W+EG+  +L DP++F     +E+ +C+Q+ LLCVQ++A  RPN+S 
Sbjct  752   KDNYPNLLAYVWTLWNEGEAASLADPNVFDESFEKEITKCVQISLLCVQEVANDRPNVST  811

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  L T+N+ LP P+ P +     +S + +S +Q+++  S N ++++ + GR
Sbjct  812   VIWMLTTENMDLPEPKQPAFITRREKS-EGESSDQSSQKESINDVSLTSVTGR  863



>gb|KDO53989.1| hypothetical protein CISIN_1g003599mg [Citrus sinensis]
Length=803

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/795 (45%), Positives = 494/795 (62%), Gaps = 63/795 (8%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q I+D  + I+S    F LGFF+P  +  RY+GIWY+    ++V+WVANR+ P+ D
Sbjct  26    ITSSQLIRDP-DAILSNGSNFKLGFFNPADSPYRYMGIWYDMPSEKAVIWVANRDNPLKD  84

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
              +G   I+ +G  V+++G+   +W++N S   +N+T      S  ++L+ +  R    +W
Sbjct  85    SSGIITISEDGNLVLVNGQKEVLWSSNVSNLVNNSTSAQLLDSGNLVLRDNINRA--IVW  142

Query  2217  QSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE  2044
             +SF +PTD+FLPGM   +D   G+    TSW +  +PS G FS G+  +  P+I +W   
Sbjct  143   ESFQEPTDSFLPGMHHGIDQRTGKKVQLTSWKSLSDPSTGSFSAGLIHQNIPEIFVWNVS  202

Query  2043  KRYWRSGHWDGRVFLGVP-------MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             + YWRSG W+G++F+G+P        R +F +GF                ++D   F + 
Sbjct  203   RPYWRSGPWNGQIFIGIPELKSVYLFRHNFTFGF----------------ANDWTFFALT  246

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   ++ W + +  W         +C VY  CG F  C NS    I C C+ GF P +
Sbjct  247   AQGILEERIWIKWKDNWEVGFLNLRTECDVYGKCGAFGIC-NSQEKPI-CSCLEGFEPKN  304

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RR+ LQC++ N  G   ++DGF ++  +K+PDF +      SP   
Sbjct  305   AEEWNRGNWTSGCIRRSKLQCERRNITGKVGKEDGFSKLNKMKVPDFTE----WTSPATE  360

Query  1524  kkkcee-dCSCNAYAPPVPGGISCMLWRN-ELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              +  E+   +C+  A    GGI CM+WR+  L+D+ +L  G G+ L++R+ +S++D K  
Sbjct  361   DECREQCLKNCSCIAYAFDGGIGCMVWRSINLIDIQRLPFG-GTDLYIRVANSDVDEKGK  419

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K   +  +        +  + +W   ++R  + AK                    SA   
Sbjct  420   KDVFVSPLIKGMFALAICTLFLWRWIAKRKEVIAK-------------------LSATNV  460

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
              TV+ +     DL  F F  +A AT++F L++KLGQGGFG VY G L  GQEIAVKRLS+
Sbjct  461   NTVKLQ-----DLPLFQFEELATATNNFQLSSKLGQGGFGPVYWGRLKDGQEIAVKRLSK  515

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPN+SLD+ +FDP K+ 
Sbjct  516   ASGQGLEEFMNEVMVISKLQHRNLVRLLGCCVEGEEKMLIYEYMPNRSLDALLFDPLKKE  575

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+WRKRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA+IFGG
Sbjct  576   RLDWRKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMAKIFGG  635

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             NQ++A+T RVVGT+GYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF  DD + I
Sbjct  636   NQDQADTGRVVGTFGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSFFEDDLT-I  694

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQE-VLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             + YAW+ W+E K + L+DP +  S    + ++RCI +GLLCVQ+L   RPNMS VV  L 
Sbjct  695   LGYAWKLWNENKILALVDPFLSESSFQLDMIIRCIHVGLLCVQELVKDRPNMSTVVSMLN  754

Query  273   TDNVTLPVPRPPTYT  229
             ++   LP P+ P +T
Sbjct  755   SEIRDLPYPKEPAFT  769



>ref|XP_002462992.1| hypothetical protein SORBIDRAFT_02g035940 [Sorghum bicolor]
 gb|EER99513.1| hypothetical protein SORBIDRAFT_02g035940 [Sorghum bicolor]
Length=864

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/847 (44%), Positives = 503/847 (59%), Gaps = 54/847 (6%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGT--SNRYVGIWYNEIIPQSVVWVANRER  2410
             D ++QGQ +      + S    F LGFF+P+    S +Y+GIWY+ I P++VVWVANR  
Sbjct  42    DTLRQGQSLSGAATLVSSPEGVFELGFFAPDTNQPSRQYLGIWYHGISPRTVVWVANRVA  101

Query  2409  PILDKNGAFGITGNGTFVVLDGKnv----------siwntnssvtssnatmVLRNTSELI  2260
             P      +  +T  G   VLDG             S   T+ +      + VL ++  L 
Sbjct  102   PATSALPSLALTVTGELRVLDGTTANGTADAPLLWSSNATSRAAPRGGYSAVLHDSGNLE  161

Query  2259  ILKTDGWRPNNTIWQSFHQPTDTFLPGMRVDLSA-----GESKLFTSWTNSGNPSPGRFS  2095
             +   D    +  +W SF  PTDT L GMR+ L        E  LFTSW +  +PSPGR++
Sbjct  162   VRSED----DGVLWDSFSHPTDTILSGMRITLQTPGRGPKERMLFTSWASETDPSPGRYA  217

Query  2094  MGIDPRASPQIVIW-EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND----NLYL  1930
             +G+DP A  Q  IW +G   YWRSG W+G  F+G+P R  ++ GF     ND      Y 
Sbjct  218   LGLDPNA--QAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYLSGF--TPSNDPALGGKYY  273

Query  1929  EYKSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSS  1750
              Y ++++ L  F V  NG ++     +S ++W  +  QP+++C  Y  CG  + C     
Sbjct  274   TYTATNTSLQRFVVLPNGTDICYMVKKSSQEWETVWYQPSNECEYYATCGPNSLCTALQD  333

Query  1749  NGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLP  1570
                 C C+ GF P    QWNA NW+ GC R  PL C+ N +       DGF  +++IK P
Sbjct  334   GKAKCTCLKGFRPKLQEQWNAGNWSQGCIRSPPLGCEANQS------GDGFLPMRNIKWP  387

Query  1569  DFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLF  1390
             D +     +     C+  C  +CSC AY      G  C+ W NEL+DM +L  G+  TL 
Sbjct  388   DLSYWVSTVADETGCRTDCLNNCSCGAYVYTSTTG--CLAWGNELIDMHELPTGA-YTLN  444

Query  1389  VRLHSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRAR-IRAKKRDEIPRTELP  1213
             ++L +SEL        I    S +    +   + +W    +R R I+             
Sbjct  445   LKLPASELRGHHPIWKIATIASAIVLFVLAACLLLWW---KRGRNIKDAVHRSWRSRHSS  501

Query  1212  TSGEFSS---DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVY  1042
             +  + +S   D S       + + G S +L  +S   I AAT +FS +NKLG+GGFG VY
Sbjct  502   SRSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLERIKAATSNFSDSNKLGEGGFGPVY  561

Query  1041  KGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEY  862
              G  P G+E+AVKRL R SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+ +EK+L+YEY
Sbjct  562   MGTFPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQREEKILVYEY  621

Query  861   MPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDG  682
             MPNKSLD+F+F+P K+  L+W+KRF IIE IARGLLYLHRDSRLR++HRDLKASNILLD 
Sbjct  622   MPNKSLDAFLFNPEKQGLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDA  681

Query  681   EMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEI  502
             +MNPKISDFGMARIFGG+QN+ NTNRVVGT+GYM+PEYAMEG+FSVKSDVY FGVL+LEI
Sbjct  682   DMNPKISDFGMARIFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEI  741

Query  501   VSGRRNTSFRT-DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQ  325
             ++G+R  SF   +D   I  YAW QW+E K   L+DP I +SC  ++VLRCI + LLCVQ
Sbjct  742   ITGKRAVSFHCHEDSLNIAGYAWRQWNEDKAAELIDPVIRASCSVRQVLRCIHIALLCVQ  801

Query  324   DLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSI---T  154
             D A  RP++  V+L L  D+ +LP PRPPT    M R  +++S ++++E   S+SI   +
Sbjct  802   DHADERPDIPTVILMLSNDSSSLPNPRPPTL---MLRGREIES-SKSSEKDRSHSIGTVS  857

Query  153   MSVIVGR  133
             M+ + GR
Sbjct  858   MTQLHGR  864



>gb|KDO53988.1| hypothetical protein CISIN_1g003599mg [Citrus sinensis]
Length=807

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/795 (45%), Positives = 494/795 (62%), Gaps = 63/795 (8%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q I+D  + I+S    F LGFF+P  +  RY+GIWY+    ++V+WVANR+ P+ D
Sbjct  26    ITSSQLIRDP-DAILSNGSNFKLGFFNPADSPYRYMGIWYDMPSEKAVIWVANRDNPLKD  84

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
              +G   I+ +G  V+++G+   +W++N S   +N+T      S  ++L+ +  R    +W
Sbjct  85    SSGIITISEDGNLVLVNGQKEVLWSSNVSNLVNNSTSAQLLDSGNLVLRDNINRA--IVW  142

Query  2217  QSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE  2044
             +SF +PTD+FLPGM   +D   G+    TSW +  +PS G FS G+  +  P+I +W   
Sbjct  143   ESFQEPTDSFLPGMHHGIDQRTGKKVQLTSWKSLSDPSTGSFSAGLIHQNIPEIFVWNVS  202

Query  2043  KRYWRSGHWDGRVFLGVP-------MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             + YWRSG W+G++F+G+P        R +F +GF                ++D   F + 
Sbjct  203   RPYWRSGPWNGQIFIGIPELKSVYLFRHNFTFGF----------------ANDWTFFALT  246

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   ++ W + +  W         +C VY  CG F  C NS    I C C+ GF P +
Sbjct  247   AQGILEERIWIKWKDNWEVGFLNLRTECDVYGKCGAFGIC-NSQEKPI-CSCLEGFEPKN  304

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RR+ LQC++ N  G   ++DGF ++  +K+PDF +      SP   
Sbjct  305   AEEWNRGNWTSGCIRRSKLQCERRNITGKVGKEDGFSKLNKMKVPDFTE----WTSPATE  360

Query  1524  kkkcee-dCSCNAYAPPVPGGISCMLWRN-ELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              +  E+   +C+  A    GGI CM+WR+  L+D+ +L  G G+ L++R+ +S++D K  
Sbjct  361   DECREQCLKNCSCIAYAFDGGIGCMVWRSINLIDIQRLPFG-GTDLYIRVANSDVDEKGK  419

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K   +  +        +  + +W   ++R  + AK                    SA   
Sbjct  420   KDVFVSPLIKGMFALAICTLFLWRWIAKRKEVIAK-------------------LSATNV  460

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
              TV+ +     DL  F F  +A AT++F L++KLGQGGFG VY G L  GQEIAVKRLS+
Sbjct  461   NTVKLQ-----DLPLFQFEELATATNNFQLSSKLGQGGFGPVYWGRLKDGQEIAVKRLSK  515

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPN+SLD+ +FDP K+ 
Sbjct  516   ASGQGLEEFMNEVMVISKLQHRNLVRLLGCCVEGEEKMLIYEYMPNRSLDALLFDPLKKE  575

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+WRKRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA+IFGG
Sbjct  576   RLDWRKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMAKIFGG  635

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             NQ++A+T RVVGT+GYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF  DD + I
Sbjct  636   NQDQADTGRVVGTFGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSFFEDDLT-I  694

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQE-VLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             + YAW+ W+E K + L+DP +  S    + ++RCI +GLLCVQ+L   RPNMS VV  L 
Sbjct  695   LGYAWKLWNENKILALVDPFLSESSFQLDMIIRCIHVGLLCVQELVKDRPNMSTVVSMLN  754

Query  273   TDNVTLPVPRPPTYT  229
             ++   LP P+ P +T
Sbjct  755   SEIRDLPYPKEPAFT  769



>ref|XP_002889863.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66122.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=842

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/833 (44%), Positives = 521/833 (63%), Gaps = 39/833 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRER  2410
             D+I     IKD  E ++  +  F  GFF+P  ++ R  YVGIWY++I  Q+VVWVAN++ 
Sbjct  33    DRITFTTPIKD-SETLLCKSGIFRFGFFTPVNSTTRLRYVGIWYDKIPIQTVVWVANKDA  91

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI D +G   I  +G   V DG+   +W+TN SV  +     ++      ++  D     
Sbjct  92    PINDTSGVISIYNDGNLAVTDGRKRLVWSTNVSVPVAPNATWVQLMDSGNLMLQDNRNNG  151

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               +W+SF  P D+F+P M +  D   G +   TSWT+  +PS G ++ GI P   P+++I
Sbjct  152   EILWESFKHPYDSFMPRMTLGTDGRTGGNLKLTSWTSHDDPSTGNYTAGIAPFTFPELLI  211

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             W+     WRSG W+G+VF+G+P     ++  GF+L ++N        ++ S +  F +D 
Sbjct  212   WKNNVTTWRSGPWNGQVFIGLPNMDSLLFLDGFNLNSDNQGTISMSYANDSFMYHFNLDP  271

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
              G   Q+ W+ S + W    + P   C  Y  CG++  C   +     C C+ GF P + 
Sbjct  272   EGIIYQKDWSTSMRTWRIGVKFPYTDCDAYGRCGRYGSC--HAGENPPCKCVKGFVPKNN  329

Query  1701  NQWNARNWTGGCTRRTPLQC--QKNNTEGGGAEK-DGFREVKHIKLPDFADIDRNMRSPe  1531
              +WN  NW+ GC R+ PLQC  Q+N + GGG  K DGF +++ +K+P  A+  R+  + +
Sbjct  330   TEWNGGNWSNGCVRKAPLQCERQRNVSNGGGGGKADGFLKLQKMKVPISAE--RSEANEQ  387

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C K C ++CSC AYA     GI CMLW  +LVDM     GSG  LF+R+  SEL   S+
Sbjct  388   VCPKVCLDNCSCTAYA--YDRGIGCMLWSGDLVDMQSF-LGSGIDLFIRVAHSELKTHSN  444

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIR---AKKRDE---IPRTELPTSGEFSSD  1189
                +I A  +  A+   V V   LL  R+ R R   AK R       R E  TS   S+ 
Sbjct  445   LAIMIAAPVIGVALIAAVCV---LLACRKFRKRPAPAKDRSAELMFKRMEALTSDNESA-  500

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              S Q  L          +L  F F  +A ATDSFSL NKLGQGGFG VYKG LP GQEIA
Sbjct  501   -SNQIKL---------KELPLFEFQVLATATDSFSLRNKLGQGGFGPVYKGKLPEGQEIA  550

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSR+SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E+ML+YEYMP KSLD+++F
Sbjct  551   VKRLSRKSGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERMLVYEYMPKKSLDAYLF  610

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K++ L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+
Sbjct  611   DPLKQNILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGL  670

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN-TSFR  472
             ARIF  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SGRRN +S +
Sbjct  671   ARIFRANEDEANTRRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGRRNSSSHK  730

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              +++  ++ +AW+ W++G+  +L DP++F  C  +E+ +C+ +GLLCVQ++A  RPN+S 
Sbjct  731   EENNLNLLAHAWKLWNDGEAASLADPAVFEKCFEKEIEKCVHIGLLCVQEVANDRPNVSN  790

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  L T+N+ L  P+ P +    R + + +S +Q+++  S N ++++ + GR
Sbjct  791   VIWMLTTENMNLADPKQPAFIVR-RGAPEAESSDQSSQKVSVNDVSLTAVTGR  842



>ref|XP_010268929.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Nelumbo nucifera]
 ref|XP_010268930.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Nelumbo nucifera]
 ref|XP_010268931.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Nelumbo nucifera]
Length=828

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/826 (45%), Positives = 507/826 (61%), Gaps = 41/826 (5%)
 Frame = -3

Query  2580  KIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL  2401
             +I  G+ I  +   I+SA E F LGFFSP  ++NRY+GIWYN I  Q+VVWVANRE P+ 
Sbjct  26    RITAGETISGN-HTIISAGETFALGFFSPGNSTNRYLGIWYNNIPQQTVVWVANREAPLF  84

Query  2400  D-KNGAFGITGNGTFVVLDGKnv---siwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             +  +G F +  +G  +VLDG      S   + + V  +N   +L ++  L++  +     
Sbjct  85    NNSSGVFTVADDGNLMVLDGSKKVLWSSNISVADVDKNNTIGLLMDSGNLVLRNS-----  139

Query  2232  NNT--IWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
             NNT  +WQSF  P+DT LPGMRV  +L  G+S   TSW +  +P+PG F++ ID   S Q
Sbjct  140   NNTADLWQSFDYPSDTILPGMRVSLNLKTGQSIHATSWISEDDPAPGEFNLAID--GSLQ  197

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLI--MFK  1891
             ++       YWRS  WDGR+ +G     +    +   T ND       S S D +  MFK
Sbjct  198   LLTRRSSGTYWRSETWDGRLSVGALENINNYAFYLTYTVNDEEANVTFSLSRDSMPAMFK  257

Query  1890  VDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNP  1711
             +D +G+     W ES  QW  +   P + C  +N CG    CD +SS+ I C C+ GF P
Sbjct  258   LDRSGQIELLSWFESENQWKLLSSIPEEACDFFNQCGPNGSCDRNSSSLI-CKCLEGFEP  316

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
                 +W   NW+GGC RR  L C   N         GF   + +KLPD   I     S  
Sbjct  317   KVLTEWEKGNWSGGCVRRKKLSCDNTN---------GFLRFESVKLPD-QSISMGDFSMT  366

Query  1530  dckkkceedCSCNAYA-PPVPGGIS--CMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
             +C+  C  +CSC AYA     G ++  C+ W  +  D +Q   G G  L+VRL SSEL  
Sbjct  367   ECRAACLRNCSCTAYAFSNFSGAVTTRCLNWVGDFNDFVQNYSG-GHDLYVRLDSSELVG  425

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
                   +I        +AV  +    LL         ++R      E  +  E ++  S 
Sbjct  426   IGETRNVIDKNRRRVIIAVATVACGVLLMGALGYFLWRRRLSKEGEEAESILEVNNRGSQ  485

Query  1179  QCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKR  1000
                  V G    +S+L  FSFS+I A T +FS  NKLGQGGFG VYKG+LP GQE+AVKR
Sbjct  486   -----VLGGEANASELSTFSFSTIQAVTQNFSEVNKLGQGGFGSVYKGILPDGQEVAVKR  540

Query  999   LSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPA  820
             LS++SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G EK+L+YEY+PNKSL+  +FDP 
Sbjct  541   LSKKSGQGLEEFMNEIKLIAKLQHRNLVRLLGCCIQGTEKILIYEYLPNKSLNKLLFDPT  600

Query  819   KRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARI  640
             K+S+L+W KR++I+E IA+GLLYLH+ SR+++IHRDLKASNILLDG+MNPKISDFGMAR+
Sbjct  601   KQSDLDWCKRYNIVEGIAQGLLYLHKHSRVKVIHRDLKASNILLDGDMNPKISDFGMARM  660

Query  639   FGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS-FRTDD  463
             FG NQ EANT+R+VGT+GYM+PEYA++G FS KSDV+SFGVLLLEI+SG++NT  + T+ 
Sbjct  661   FGANQTEANTDRLVGTFGYMSPEYALDGTFSEKSDVFSFGVLLLEIISGKKNTGMYPTNQ  720

Query  462   HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVL  283
                ++ YAW+ W E +   L+DPSI  +C+  +V++C+ +GLLCVQ+  V RP MS+V+ 
Sbjct  721   TLPLVGYAWQLWREDRAAELIDPSIRETCLENQVVKCVHVGLLCVQEDPVDRPTMSSVIF  780

Query  282   FLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSV  145
              L  ++  LP+PR P ++A +RRS  V S +  N+  S N +T+++
Sbjct  781   MLGNESAILPMPREPLFSA-VRRSATVTSSSNLNDY-SINQVTLTM  824



>ref|XP_010476053.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Camelina sativa]
Length=843

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/833 (42%), Positives = 519/833 (62%), Gaps = 36/833 (4%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + E ++S N  F  GFF+P  ++ R  YVGIWY++I  Q+VVWVAN++
Sbjct  31    DRITFSTPIKDSESETLLSKNGIFRFGFFTPVNSTTRLRYVGIWYDKIPLQTVVWVANKD  90

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I  +G   V DG+N  +W+TN +V  +     ++      ++  D    
Sbjct  91    APINDTSGVISIYKDGNLAVTDGRNRLLWSTNVTVPVAANATWIQLMDSGNLMLQDNRNN  150

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
               T+W+ F  P D+F+P M +  +   GE+   TSW +  +PS G ++ GI P   P+++
Sbjct  151   GETLWEMFKHPYDSFMPRMTLGTNGITGENLKLTSWRSHDDPSTGNYTAGIAPFTFPELL  210

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             +W+     WRSG W+G+VF+G+P     ++  GF+L ++N        ++ S +  F +D
Sbjct  211   VWKNNLISWRSGPWNGQVFIGLPNMDSLLFLDGFNLNSDNQGTISMSYANDSFMYHFNLD  270

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              +G   Q+ W+ S ++W    + P   C  Y  CG +  CD   +    C+C+ GF P +
Sbjct  271   PDGAIYQKDWSTSMRKWRIGVKFPFTDCDAYGRCGPYGTCDTRENPP--CICVKGFVPKN  328

Query  1704  WNQWNARNWTGGCTRRTPLQCQK----NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
               +WN   W+ GC R+ PL C++    +   GGG + D F +++ +K+P   + +R+  +
Sbjct  329   STEWNGGKWSNGCVRKAPLLCERQRNVSTGGGGGGKADVFFKLQKMKVP--VNAERSQAN  386

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNK  1357
              + C K C ++CSC AYA     GI CMLW   LVDM     GSG  L++R+  SEL   
Sbjct  387   EQVCPKVCLDNCSCTAYA--YDRGIGCMLWSGNLVDMQSF-LGSGIDLYIRVAHSELKTH  443

Query  1356  SSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQ  1177
             S+   +I A  +   +          +C   A  + KKR E  +     S E    F   
Sbjct  444   SNLAIMIAAPVIGVTLIAA-------VCILLACRKFKKRPEPVKDR---SAEIL--FKRM  491

Query  1176  CDLTVEGKAGAS----SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
               LT + ++ +S     +L  F F  +A +TD+FSL NKLGQGGFG VYKG LP GQEIA
Sbjct  492   EALTSDNESASSQIKLKELPLFDFQVLATSTDNFSLRNKLGQGGFGPVYKGKLPEGQEIA  551

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSR+SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E+ML+YEYMP KSLD+++F
Sbjct  552   VKRLSRKSGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERMLVYEYMPKKSLDAYLF  611

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K++ L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+
Sbjct  612   DPLKQTILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGL  671

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRN-TSFR  472
              RIF  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SGRRN +S +
Sbjct  672   VRIFRANEDEANTRRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGRRNSSSHK  731

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              + +  ++ YAW+ W++G+  +L DP +F  C  +E+ +C+ +GLLCVQ++A  RPN+S+
Sbjct  732   EESNLNLLAYAWKLWNDGEAASLADPVVFDKCFEKEIEKCVHIGLLCVQEVANDRPNVSS  791

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  L T++  L VP+ P + A  R + + +S +Q+++  S N ++++ + GR
Sbjct  792   VIWMLTTESTNLAVPKQPAFIAR-RGASEAESSDQSSQKVSINDVSLTAVTGR  843



>ref|XP_010237216.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Brachypodium distachyon]
Length=890

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/870 (43%), Positives = 520/870 (60%), Gaps = 60/870 (7%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGT---SNRYVGIWYNEIIPQSVVWVAN  2419
             AA  + QGQ +  + + +VS N  F+L FF P G    S  Y+G+ Y     ++V WVAN
Sbjct  30    AATTLLQGQSLGRN-DKLVSPNGAFLLAFFVPRGGGDGSRAYLGVLYARAAEETVPWVAN  88

Query  2418  RERPILDKNGAFG--ITGNGTFVVLDG-----KnvsiwntnssvtssnatmVLRNTSELI  2260
             R+ P+   +  +   +T +G   +L+G     +  +   ++SS  ++N T+ +++T  L+
Sbjct  89    RDAPVSASSALYSATVTSSGQLQILEGDRVVWQTSNTPPSSSSGNNNNFTLTIQDTGNLV  148

Query  2259  ILKTDGWRPNNTIWQSFHQPTDTFLPGMRVDL-----SAGESKLFTSWTNSGNPSPGRFS  2095
             +   +G +    +WQSF  PTDTFLPGM + L     +   + LFTSW + G+P+PG F+
Sbjct  149   L--GNGGQNTAPLWQSFDHPTDTFLPGMSITLDRRDGAVASNTLFTSWASPGDPAPGNFT  206

Query  2094  MGIDPRASPQIVIWEGEK---------RYWRSGHWDGRVFLGVPMRTDFVYGFDLI----  1954
             +G DP  S Q+ IW             +YWRSG W    F+G+P R+ +VYGF L     
Sbjct  207   LGQDPLGSAQLYIWRHTPGNTPNNSGIKYWRSGQWANTKFVGIPWRSLYVYGFRLAGDAS  266

Query  1953  ----TENDNLYLEYKSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNH  1786
                 T    +   + + +     F +  NG E      ES   W  +  QP   C  YN 
Sbjct  267   RGSGTRGGVMSYTFSAYNESQFRFVLKPNGTETCYMLLESTGAWEVVWSQPTIPCHAYNT  326

Query  1785  CGQFARCDNSSSNG--INCVCIVGFNPSDWNQWNAR-NWTGGCTRRTPLQCQKNNTEGGG  1615
             CG  A C  +  +G    C C+ GF P    ++  R NWT GC R  PL C + N E  G
Sbjct  327   CGPNAGCAAADDHGRAAACKCLQGFEPRSEEEYYGRGNWTRGCVRSKPLTCSERNVEVSG  386

Query  1614  AEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRN-E  1438
                D F  +  +KLPDFA  +  +   + CK  C  +C+C AY+     G  C+ W   +
Sbjct  387   G--DAFAALPGVKLPDFAVWESTVGGADACKGWCLANCTCGAYS--YSDGTGCLTWSGRD  442

Query  1437  LVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlvivsIWLL---CSR  1267
             LVD+ +   G G  L +++ +S L+  + +      +  V     +V+ +  +L   C R
Sbjct  443   LVDVYKFPNGEGYDLHIKVPASLLETGAKRRRWTAVIVSVVTALAVVLAACGILLWKCRR  502

Query  1266  R--ARIRAKKRDEI-PR-TELPTSGEFSSDFSA---QCDLTVEGKAGASSDLVFFSFSSI  1108
             R   ++    R+E  PR + L    E  +DFS    Q DL  E + G S +L  F   ++
Sbjct  503   RIGEKLGVGGREEKKPRPSMLHPRREAKNDFSGPKQQPDLE-EAENGDSCELPLFPLETL  561

Query  1107  AAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQH  928
             A AT  FS +NKLG+GGFGHVYKG LP G+E+AVKRLS+ SGQG +EF NE+ +I+KLQH
Sbjct  562   AEATGGFSDSNKLGEGGFGHVYKGSLPGGEEVAVKRLSKSSGQGCEEFKNEVILISKLQH  621

Query  927   RNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYL  748
             RNLVR+LGCCI+G EKML+YEYMPNKSLD+F+FDPA+R  L+W+ R  IIE IARGLLYL
Sbjct  622   RNLVRILGCCIQGHEKMLVYEYMPNKSLDAFLFDPARRGLLDWKTRLSIIEGIARGLLYL  681

Query  747   HRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEY  568
             HRDSRLR++HRDLKASNILLD +MNPKISDFGMARIFGG+Q + NTNRVVGT GYM+PEY
Sbjct  682   HRDSRLRVVHRDLKASNILLDHDMNPKISDFGMARIFGGDQKQENTNRVVGTLGYMSPEY  741

Query  567   AMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPS  391
             AMEGLFSV+SDVYSFG+L+LEI++G++N+SF   + S  I+ YAW+ W+  K   L+DPS
Sbjct  742   AMEGLFSVRSDVYSFGILVLEIITGQKNSSFHHMEGSLNIVGYAWQMWNADKGSELIDPS  801

Query  390   IFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRS  211
             I SS   +E LRC+ + LLCVQD A  RP++  VV+ L +D+  LP+P+PPT+T     S
Sbjct  802   IRSSSASREALRCVHMALLCVQDHACDRPDIPYVVMALGSDSSVLPMPKPPTFTLQCTSS  861

Query  210   VDVDSWNQNN----ELPSSNSITMSVIVGR  133
              D + +   N    E  S++ +T++++ GR
Sbjct  862   -DREGFLGGNADYYESYSASDLTVTMLQGR  890



>gb|AES63671.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=821

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/832 (44%), Positives = 512/832 (62%), Gaps = 39/832 (5%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   + IKD  E I S ++ F LGFFSP  T+NRYVGIWY  +   +++WVANRE+P+ D
Sbjct  12    ITSSKLIKDS-ETISSNDDAFKLGFFSPMNTTNRYVGIWY--LNQSNIIWVANREKPLQD  68

Query  2397  KNGAFGITGNGT-FVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILK-TDGWRPN  2230
              +G   ++ + T  VVL+G+       N ++  ++ N T  ++NT  L++ + T G    
Sbjct  69    SSGVITMSDDNTNLVVLNGQKHVIWSSNVSNFASNFNVTAYIQNTGNLVLQEDTTG----  124

Query  2229  NTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               IW+SF  P+D  L  M +  +   GE    TSW    +P+ G FS  ++   +P++ +
Sbjct  125   KIIWESFKHPSDAVLLNMTISTNQKTGEKVKLTSWKTPSDPAYGNFSFSLERLNAPEVFV  184

Query  2055  WEGEKRYWRSGHWDGRVFLGVPMRT----DFVYGFDLITENDNLYLEYKSS---SSDLIM  1897
             W   K YWRSG W+G+VF+G+P R+     ++ GF +  +++   +E   +   SSD   
Sbjct  185   WNQTKPYWRSGPWNGQVFIGLPSRSLYTSGYLNGFSIARKDNGNVVELMFTLLNSSDFGT  244

Query  1896  FKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGF  1717
               V   GK V   W    +    + +Q  ++C +Y +CG    CD    N   C C+ GF
Sbjct  245   LVVSSEGKLVYTSWINRYQVGTNVPQQ--NECDIYGYCGPNGSCD--LKNLPICTCLEGF  300

Query  1716  NPSDWNQWNARNWTGGCTRRTPLQCQ--KNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
              P + ++WN +NW+ GC RR  LQC+  K N    G + D F +++  K+PDF  + ++ 
Sbjct  301   EPKNVDEWNKQNWSSGCVRRASLQCERVKYNGSALGGKGDDFVKLETTKVPDF--VQQSY  358

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL-  1366
              S   C+ +C  +C+C AYA     GI C+ W   L+D+++    +G+ L++R   SEL 
Sbjct  359   LSVNACRAECLNNCNCTAYA--FDDGIQCLTWSGNLIDIVRFSS-AGTDLYIRQAYSELS  415

Query  1365  -DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSD  1189
              D K  +    + +S V   A++     + L S  ++  + +R E     L T   +  +
Sbjct  416   IDTKGKRNVRKIIISTVVVGAIIFATCTYFLWSWASK-HSGRRKEPNSLILNTRQSYPEN  474

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              +A     V  K     DL  F F  I+AAT++F  ANK+GQGGFG VYKG LP G+EIA
Sbjct  475   QNASTIKNV--KQIKIEDLTLFEFQKISAATNNFGSANKIGQGGFGSVYKGKLPGGREIA  532

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRL+R S QG++EF NE+ VI++LQHRNL+RLLGCCIE +EKML+YEYMPN SLD ++F
Sbjct  533   VKRLARTSSQGIEEFMNEVIVISELQHRNLLRLLGCCIEEEEKMLVYEYMPNNSLDFYLF  592

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K+  L+W+KR +IIE I+RGLLYLHRDSRLRIIHRDLK SNILLDGE+NPKISDFGM
Sbjct  593   DPIKKKILDWQKRLYIIEGISRGLLYLHRDSRLRIIHRDLKPSNILLDGELNPKISDFGM  652

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGG++NE NT R+VGTYGYM+PEYAMEGLFS KSDV+SFGVLLLEI+SGR+NTSF  
Sbjct  653   ARIFGGSENEGNTRRIVGTYGYMSPEYAMEGLFSEKSDVFSFGVLLLEIISGRKNTSFYN  712

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
                  ++ Y W+ W+E + + L+D  I ++     +LRCI +GLLCVQ++A  RP M+ V
Sbjct  713   HQALTLLGYTWKLWNEDEVVALIDQEICNADYVGNILRCIHIGLLCVQEIAKERPTMATV  772

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V  L ++ V LP P  P +  S       DS  QNN+  S+NS+T++ + GR
Sbjct  773   VSMLNSEIVKLPHPSQPAFLLSQTEH-RADSGQQNND--SNNSVTVTSLQGR  821



>ref|XP_010667681.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Beta vulgaris subsp. vulgaris]
Length=816

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/786 (45%), Positives = 494/786 (63%), Gaps = 41/786 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQ--SVVWVANRERPILDKNGAFGI  2377
             D E ++S+N  F LGFFSP  ++NRY GIWYN        ++W+ANR+ P+ D +G   I
Sbjct  30    DPEELISSNSIFKLGFFSPVNSTNRYAGIWYNNNDSNVLEIIWIANRDNPLNDSSGMLNI  89

Query  2376  TGNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQ  2203
             + +G   +L+G+N +    N   +   +N+   L +T  L++L        N IWQSF  
Sbjct  90    SEDGDLQLLNGQNSTFWSSNIAGNHEVNNSVAQLLDTGNLVLLSN---ASGNIIWQSFEH  146

Query  2202  PTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWR  2029
              TD+ LP M V  D +   S+   SW +S + S GRFS+GID R   +I +W+G + YWR
Sbjct  147   HTDSLLPRMEVIVDENTNTSQRLRSWMSSSDVSTGRFSVGIDHRTLSEIFVWDGGRPYWR  206

Query  2028  SGHWDGRVFLGVPMRTDF--VYGFDLITENDN-LYLEYKSSSSDLI-MFKVDWNGKEVQQ  1861
             SG W+G VF+GVP    F  V GF L    D  L L + ++   +   + + ++G   Q+
Sbjct  207   SGPWNGHVFIGVPTMYYFALVDGFRLDDNRDGRLTLSFATARQRITEHYVLTYDGIVEQR  266

Query  1860  RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARN  1681
              W+E+   W  I +    +C +Y  CG+F  C+   +N   C C+ GF P + ++WN  N
Sbjct  267   DWDEATGNWTVIWQSLESECDIYGMCGEFGSCN--FNNSPICSCLRGFEPRNDHEWNRGN  324

Query  1680  WTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedC  1501
             W+ GC RRTPLQC+       G E+DGF  V+++K+PD A+   ++ S ++   + +   
Sbjct  325   WSSGCVRRTPLQCRII-----GGEEDGFVRVRNMKVPDNAE---SVSSEDEDSCRNQCLG  376

Query  1500  SCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS--KTTiivav  1327
             +C+  A     GI CM+W   L+D+ +     G  LFVRL  SELD   +  K  + + +
Sbjct  377   NCSCLAYSYYLGIGCMIWNGSLLDIQEF-SSVGVDLFVRLAHSELDESGNRWKLILAITL  435

Query  1326  svvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
              + AA   LVI  +W    RR R   ++   +  ++L  S +   DFS   D+ ++    
Sbjct  436   VMGAATIALVIYCLW----RRMRTTNERNSIVDGSQLH-SIKVEPDFS---DVKLQ----  483

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
                DL  F F  +AAAT++F    KLGQGGFG V+KG L   QEIAVKRLSR SGQG QE
Sbjct  484   ---DLPLFRFEELAAATNNFDDRYKLGQGGFGPVFKGELEDRQEIAVKRLSRASGQGQQE  540

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
             F NE+ VI+K+QHRNLV+LLGCC++G+EKML+YEYMPNKSLD+F+FDP  R  L W+KR 
Sbjct  541   FMNEVDVISKVQHRNLVKLLGCCVDGEEKMLVYEYMPNKSLDAFIFDPQDRELLGWKKRL  600

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
             +IIE I RGLLYLHRDSRL+IIHRDLKASNILLD ++NPKISDFG+ARIFGG +++ NT 
Sbjct  601   NIIEGICRGLLYLHRDSRLKIIHRDLKASNILLDEDLNPKISDFGLARIFGGKEDQGNTK  660

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYM+PEYAMEG FS KSDVYSFGVLLLEI+SG++NTSF  DD   ++ YAW+  
Sbjct  661   RVVGTYGYMSPEYAMEGRFSEKSDVYSFGVLLLEIISGKKNTSFNDDDSMSLVGYAWKLR  720

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
             ++   ++L+DP+I  +    E+LRCI++GLLCVQ+    RP++S ++  L+++   LP P
Sbjct  721   NDDNILSLIDPTIQDTHFQGEILRCIEVGLLCVQEFPEERPSISTIISMLDSEITDLPQP  780

Query  246   RPPTYT  229
               P ++
Sbjct  781   VQPVFS  786



>ref|NP_172602.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
SD1-13 [Arabidopsis thaliana]
 sp|Q9LPZ9.2|SD113_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13; AltName: Full=Calmodulin-binding receptor-like 
protein kinase 1; AltName: Full=Receptor-like protein 
kinase 2; AltName: Full=S-domain-1 (SD1) receptor kinase 
13; Short=SD1-13; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28721.1| calmodulin-binding receptor-like portein kinase [Arabidopsis 
thaliana]
Length=830

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/816 (43%), Positives = 504/816 (62%), Gaps = 28/816 (3%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E +VS +  F  GFFSP  ++ RY GIW+N I  Q+VVWVAN   PI D +G   I+ 
Sbjct  33    DSETVVSNHSTFRFGFFSPVNSTGRYAGIWFNNIPVQTVVWVANSNSPINDSSGMVSISK  92

Query  2370  NGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
              G  VV+DG+       N    V ++     L NT  L++L T     +  +W+SF  P 
Sbjct  93    EGNLVVMDGRGQVHWSTNVLVPVAANTFYARLLNTGNLVLLGTTN-TGDEILWESFEHPQ  151

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             + +LP M +  D   G S    SW +  +PSPGR+S G+ P   P++V+W+ +   WRSG
Sbjct  152   NIYLPTMSLATDTKTGRSLKLRSWKSPFDPSPGRYSAGLIPLPFPELVVWKDDLLMWRSG  211

Query  2022  HWDGRVFLGVPMRTDFVYGFDLITENDN---LYLEYKSSSSDLIMFKVDWNGKEVQQRWN  1852
              W+G+ F+G+P     +  F+L   +DN   + + Y + ++ L  F +D  G   Q+ WN
Sbjct  212   PWNGQYFIGLPNMDYRINLFELTLSSDNRGSVSMSY-AGNTLLYHFLLDSEGSVFQRDWN  270

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
              + ++W    + P+ +C  Y  CGQFA C  +  +   C+CI GF P  + +WN  NWT 
Sbjct  271   VAIQEWKTWLKVPSTKCDTYATCGQFASCRFNPGSTPPCMCIRGFKPQSYAEWNNGNWTQ  330

Query  1671  GCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCN  1492
             GC R+ PLQC+  +   G  + DGF  V+ +K+P   +  R+  + +DC + C ++CSC 
Sbjct  331   GCVRKAPLQCESRDNNDGSRKSDGFVRVQKMKVPH--NPQRSGANEQDCPESCLKNCSCT  388

Query  1491  AYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsv--v  1318
             AY+     GI C+LW   L+DM +   G+G   ++RL  SE   +++++ +I    +   
Sbjct  389   AYS--FDRGIGCLLWSGNLMDMQEF-SGTGVVFYIRLADSEFKKRTNRSIVITVTLLVGA  445

Query  1317  aavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASS  1138
                A  V++++W +   R + R   R    R E  +S +  +    Q  L          
Sbjct  446   FLFAGTVVLALWKIAKHREKNR-NTRLLNERMEALSSNDVGAILVNQYKL---------K  495

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTN  958
             +L  F F  +A AT++FS+ NKLGQGGFG VYKG L  G +IAVKRLSR SGQGV+EF N
Sbjct  496   ELPLFEFQVLAVATNNFSITNKLGQGGFGAVYKGRLQEGLDIAVKRLSRTSGQGVEEFVN  555

Query  957   ELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHII  778
             E+ VI+KLQHRNLVRLLG CIEG+E+ML+YE+MP   LD+++FDP K+  L+W+ RF+II
Sbjct  556   EVVVISKLQHRNLVRLLGFCIEGEERMLVYEFMPENCLDAYLFDPVKQRLLDWKTRFNII  615

Query  777   EEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVV  598
             + I RGL+YLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+ARIF GN++E +T RVV
Sbjct  616   DGICRGLMYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGLARIFQGNEDEVSTVRVV  675

Query  597   GTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWEQWDE  421
             GTYGYMAPEYAM GLFS KSDV+S GV+LLEIVSGRRN+SF  D  +  +  YAW+ W+ 
Sbjct  676   GTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNSSFYNDGQNPNLSAYAWKLWNT  735

Query  420   GKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRP  241
             G+ + L+DP IF  C   E+ RC+ +GLLCVQD A  RP+++ V+  L ++N  LP P+ 
Sbjct  736   GEDIALVDPVIFEECFENEIRRCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQ  795

Query  240   PTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P +    R + +V+S  Q++   S N+++++ I GR
Sbjct  796   PAFIPR-RGTSEVESSGQSDPRASINNVSLTKITGR  830



>gb|KEH22681.1| S-locus lectin kinase family protein [Medicago truncatula]
Length=827

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/824 (43%), Positives = 515/824 (63%), Gaps = 41/824 (5%)
 Frame = -3

Query  2565  QWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL-DKNG  2389
             Q I  D E + S +  F LGFF+P+ ++NRYVGIW    +   VVWVANR +P++ D +G
Sbjct  32    QQIIKDSETLSSNSGNFTLGFFTPQNSTNRYVGIWCKTQL--FVVWVANRNQPLINDSSG  89

Query  2388  AFGITGNGTFVVLDGKnvsi-wntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQS  2212
                I+ +   V+L+GK   +     ++V++SN+++ L +   LI+ +T   +   TIWQS
Sbjct  90    VLEISNDNNIVLLNGKKNVVWSTNLNNVSTSNSSVTLSDYGNLILFETTTEK---TIWQS  146

Query  2211  FHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYW  2032
                PT++ LP     L+   +   TSW  S +PS G F++GI+    P++ I +  + YW
Sbjct  147   SDHPTNSILPS----LTFTSNMTLTSWKTSNDPSNGSFTLGIERLNMPEVFIRKENRPYW  202

Query  2031  RSGHWDGRVFLGVP-MRTDFVYGFDLITEND--NLYLEYKSSSSDLIMFKVDWNGKEVQQ  1861
             RSG W+ ++F+G+  M   ++ GF    +     L L +++    L+M+ V+  G+  ++
Sbjct  203   RSGPWNNQIFIGIEDMSALYLNGFHFQKDRTGGTLDLVFRADDYGLVMYVVNSTGQMNEK  262

Query  1860  RWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARN  1681
              W+   ++W+         C +Y  CG F  C NS  + I C C+ GF P +  +WN +N
Sbjct  263   SWSIENEEWMDTWTNQRSDCDLYGFCGSFGIC-NSKGSPI-CRCLEGFEPRNNQEWNRQN  320

Query  1680  WTGGCTRRTPLQCQKNNTE---GGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkce  1510
             WT GC R+TPLQC+  N +     G + D F ++  +K+PDFA+    + S E  + + +
Sbjct  321   WTNGCVRKTPLQCESANNQNKSANGNDADSFMKLTLVKVPDFAE----LLSVEQDECENQ  376

Query  1509  edCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiiva  1330
                +C+  A      I CM W   L+D+ Q + G G+ L++R+ SS+  NK +   I V+
Sbjct  377   CLMNCSCTAYSYVADIGCMSWNRNLIDIQQFETG-GTDLYIRVPSSDKGNKGT-VIITVS  434

Query  1329  vsvvaavavlvivsIWLLCSRRARIRAKKR----DEIPRTELPTSGEFSSDFSAQCDLTV  1162
             V V   +       IW+  S+  R + K R    ++I + E     E+ +D     ++  
Sbjct  435   VLVGIIIIATGAYFIWIKVSKPVRNKKKHRIFQFNKIEKDE-----EYKTD-----NVIG  484

Query  1161  EGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSG  982
             E       +L+ +SF  +A AT++F L+NKLGQGGFG VYKG+L  G+EIAVKRLSR SG
Sbjct  485   ELSQAKLQELLLYSFEKLAIATNNFHLSNKLGQGGFGPVYKGILQDGKEIAVKRLSRSSG  544

Query  981   QGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELN  802
             QG++EF NE+ VI+KLQHRNLVRL+GCCIEG+EKML+YE+MPN SLD++VFDP++   L+
Sbjct  545   QGLEEFMNEVVVISKLQHRNLVRLVGCCIEGNEKMLMYEFMPNSSLDAYVFDPSRNKLLD  604

Query  801   WRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQN  622
             W KRF IIE IARGLLYLHRDSRL+IIHRD+KASNILLD  +NPKISDFGMARIFG +++
Sbjct  605   WEKRFSIIEGIARGLLYLHRDSRLKIIHRDMKASNILLDENLNPKISDFGMARIFGVSED  664

Query  621   EANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIE  445
              ANT RVVGTYGYMAPEYAM+G+FS KSDV+SFGVLL+EIVSGRRN+SF   ++S  ++ 
Sbjct  665   HANTQRVVGTYGYMAPEYAMQGVFSDKSDVFSFGVLLIEIVSGRRNSSFYEHENSLTLLG  724

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             +AW QW E   ++L++P I+     + + RCI +GLLCVQ+ A  RP M+AV+  L ++ 
Sbjct  725   FAWIQWKEDNILSLIEPEIYDHSHHRSISRCIHIGLLCVQESAADRPTMAAVISMLNSEI  784

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + +P  R P +         V S  + NE  S+N+++++ I GR
Sbjct  785   MDIPPAREPAFLLRQNMLNTVPS-EERNEFYSNNALSITDIHGR  827



>sp|Q9SXB4.1|Y1130_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD49993.1|AC007259_6 Very similar to receptor-like protein kinases [Arabidopsis thaliana]
Length=820

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/821 (43%), Positives = 505/821 (62%), Gaps = 51/821 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  +++RY GIWYN +  Q+V+WVAN+++PI D +G   ++
Sbjct  37    NDSETIVSSFRTFRFGFFSPVNSTSRYAGIWYNSVSVQTVIWVANKDKPINDSSGVISVS  96

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
              +G  VV DG+       N ++  ++++    L ++  L++ +      +  +W+SF  P
Sbjct  97    QDGNLVVTDGQRRVLWSTNVSTQASANSTVAELLDSGNLVLKEASS---DAYLWESFKYP  153

Query  2199  TDTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE---KR  2038
             TD++LP M V  +A   G +   TSW +  +PSPG ++  +   A P++ I         
Sbjct  154   TDSWLPNMLVGTNARIGGGNVTITSWKSPSDPSPGSYTAALVLAAYPELFIMNNNNNNST  213

Query  2037  YWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
              WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F +D+ G  +
Sbjct  214   VWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYMDYRGSVI  272

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C  Y  CG+FA C N   N + C CI GF P +  +WN 
Sbjct  273   RRDWSETRRNWTVGLQVPATECDNYRRCGEFATC-NPRKNPL-CSCIRGFRPRNLIEWNN  330

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NW+GGCTRR PLQC++ N  G     DGF  ++ +KLPDFA   R+  S  +C + C +
Sbjct  331   GNWSGGCTRRVPLQCERQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTCLQ  385

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  K  +  +I  +
Sbjct  386   TCSCIAAAHGL--GYGCMIWNGSLVDSQELS-ASGLDLYIRLAHSEIKTKDKRPILIGTI  442

Query  1326  svvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
                    V       +L +RR   + RAKK+           G  +     + +    G 
Sbjct  443   LAGGIFVVAAC----VLLARRIVMKKRAKKK-----------GRDAEQIFERVEALAGGN  487

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
              G   +L  F F  +AAAT++FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG+
Sbjct  488   KGKLKELPLFEFQVLAAATNNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQGL  547

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W+ 
Sbjct  548   EELVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDYYLFDSRRAKLLDWKT  607

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+II  I RGLLYLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN++EAN
Sbjct  608   RFNIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDEAN  667

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYMAPEYAM GLFS KSDV+S GV+LLEI+SGRRN+      +S ++ Y W 
Sbjct  668   TRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIISGRRNS------NSTLLAYVWS  721

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W+EG+  +L+DP IF     +E+ +CI +GLLCVQ+ A  RP++S V   L ++   +P
Sbjct  722   IWNEGEINSLVDPEIFDLLFEKEIHKCIHIGLLCVQEAANDRPSVSTVCSMLSSEIADIP  781

Query  252   VPRPPTYTASMRRSVDVDSWNQNNELPSS-NSITMSVIVGR  133
              P+ P + +  R +V     ++N++L  S N++T++ + GR
Sbjct  782   EPKQPAFIS--RNNVPEAESSENSDLKDSINNVTITDVTGR  820



>ref|XP_007025881.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY28503.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=838

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/834 (43%), Positives = 504/834 (60%), Gaps = 34/834 (4%)
 Frame = -3

Query  2586  ADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             AD I    +IKD G+ IVS  + F LGFFSP  + NRYVGIWYN++  ++VVWVANRE+P
Sbjct  23    ADTITIDHFIKD-GKVIVSGGKIFALGFFSPGSSRNRYVGIWYNQVSEKTVVWVANREKP  81

Query  2406  ILDKNGAFGITGNGTFVVLDGKnvsi--wntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             + D +G   I   G   +              S   + N+   L ++  L++L+ D  R 
Sbjct  82    LDDSSGILSIDSRGNLALFQRNQAHPVWSTNVSITGTGNSIAQLLDSGNLVLLQNDSRRA  141

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                +WQSF  PT+T LP M++ LS   G ++  TSW +  +P  G FS  IDP   PQ+ 
Sbjct  142   --VLWQSFDYPTNTMLPFMKLGLSFKTGLNRFLTSWKSPDDPGIGDFSYRIDPSGFPQLS  199

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDW  1882
             +++G   +WRSG W G+ + GVP M  ++++    +  +D + + Y  +++ +I   +  
Sbjct  200   LYKGSALWWRSGTWTGQRWSGVPEMTRNYIFNVSFVNTDDEVSITYGVTNASIITRMIT-  258

Query  1881  NGKEVQQR--WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             N   +Q+R  W+   ++WI     P +QC +Y HCG    C+  +S+   C C  GF P 
Sbjct  259   NETGIQERFTWSNQARKWIGFWSAPKEQCDLYGHCGPNGCCNPDNSDRFECTCFPGFEPK  318

Query  1707  DWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPe  1531
                +W  RN  GGC R+  +     N EG       F +V  +K+P+ +    +M    +
Sbjct  319   SPQEWYIRNGAGGCVRKGNVSATCRNGEG-------FVKVARVKVPNTSAARVDMSLGLK  371

Query  1530  dckkkceedCSCNAYAPPV---PGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDN  1360
              C++KC  DCSC AYA       GGI C+ W  +LVD       +G  L++R+ + EL  
Sbjct  372   RCEEKCLRDCSCVAYAGAYYESKGGIGCLTWHGDLVDARTY-TAAGQDLYIRVDADELAR  430

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
              + K  +     +   +    +V + ++      +R K+R    ++  P S   SS    
Sbjct  431   YTKKGPLQKKGVLAVIIVSAAVVFLIVVAFLSWLVRRKRRGNRRQSRNPFSFAGSSSL--  488

Query  1179  QCDLTVEGK----AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
               + +V+GK    +  ++DL FF  S+IAAAT++FS  NKLGQGGFG VYKG+L   +EI
Sbjct  489   -IEDSVDGKDIEESRRNADLPFFDLSTIAAATNNFSSDNKLGQGGFGTVYKGLLFNRKEI  547

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLS+ SGQGV+EF NE+ +IAKLQHRNLVR+LGCCIEG+EK+L+YEY+PNKSLDS +
Sbjct  548   AVKRLSKHSGQGVEEFKNEIVLIAKLQHRNLVRILGCCIEGEEKLLIYEYLPNKSLDSII  607

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FD  KRS L+W+KR  II  +ARG+LYLH+DSRLRIIHRDLKASN+LLD  MNPKISDFG
Sbjct  608   FDETKRSSLDWKKRIEIICGVARGILYLHQDSRLRIIHRDLKASNVLLDAAMNPKISDFG  667

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             MARIFGG+Q E NTNRVVGTYGYM+PEYAMEG FS+KSDVYSFGVLLLEI++GR+N+   
Sbjct  668   MARIFGGDQIEGNTNRVVGTYGYMSPEYAMEGHFSMKSDVYSFGVLLLEIITGRKNSDDY  727

Query  471   TDD-HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
              D   S ++ + WE W   + M ++D ++  SC   E L+CIQ+GLLCVQ+ A  RP MS
Sbjct  728   PDSPSSNLVGHVWELWKHDRAMEVVDSTLGDSCPANEFLKCIQIGLLCVQEHATDRPTMS  787

Query  294   AVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              VV  L  + V  P P+ P +     R  D ++W+      S N +T++++  R
Sbjct  788   TVVFMLGNETVLAP-PKQPAFIMKKARKGD-ETWSSEGT-SSVNDVTVTMVQAR  838



>ref|XP_010476045.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Camelina sativa]
Length=821

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/821 (43%), Positives = 500/821 (61%), Gaps = 51/821 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  +++RY GIWYN +  Q+V+WVAN+++PI D +G   ++
Sbjct  38    NDSETIVSSFRTFRFGFFSPVNSTSRYAGIWYNSVSVQTVIWVANKDKPINDSSGVISVS  97

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
              +G  +V DG+       N ++   +++    L ++  L++ +T+    +  +W+SF  P
Sbjct  98    EDGNLLVTDGQKRVLWSTNVSTQARANSTVAELLDSGNLVLKETN---TDAYLWESFKYP  154

Query  2199  TDTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE---KR  2038
             TD++LP M V  +A   G +   TSW N  +PSPG ++  +   A P++ I         
Sbjct  155   TDSWLPNMLVGTNARTGGGNVTITSWRNPSDPSPGSYTAALILAAYPELFILNNNNNNST  214

Query  2037  YWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
              WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F VD+ G  +
Sbjct  215   VWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYVDYRGSVI  273

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C +Y  CGQFA C+        C CI GF P +  +WN 
Sbjct  274   RRDWSEARRNWTVGLQVPATECDLYRRCGQFATCNPRKKP--PCSCIKGFRPRNLIEWNN  331

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NW+GGC RR PLQC + N  G     DGF  ++ +KLPDFA   R+  S  +C + C +
Sbjct  332   GNWSGGCIRRVPLQCDRQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTCLQ  386

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  K  +  +I A 
Sbjct  387   TCSCIAAAHGL--GYGCMIWNGSLVDSQEL-SASGMDLYIRLAHSEIKTKDRRPILIGAT  443

Query  1326  svvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
                  + V        L +RR   + RAKK+           G  +     + +    G 
Sbjct  444   LAGGILVVAACG----LLARRIIMKKRAKKK-----------GTDAEQIFERVEALAGGN  488

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
              G   +L  F F  +AAATD+FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG+
Sbjct  489   KGKLKELPLFEFQVLAAATDNFSLKNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQGL  548

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W+ 
Sbjct  549   EELVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDFYLFDSRRAKLLDWKT  608

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+II  I RGL+YLHRDSRLRIIHRD+KASNILLD  + PKISDFG+ARIF GN++EAN
Sbjct  609   RFNIINGICRGLMYLHRDSRLRIIHRDMKASNILLDENLIPKISDFGLARIFPGNEDEAN  668

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYMAPEYAM GLFS KSDV+  GV+LLEIVSGRRN+      +S ++ Y W 
Sbjct  669   TRRVVGTYGYMAPEYAMGGLFSEKSDVFGLGVILLEIVSGRRNS------NSTLLAYVWS  722

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W+EG+   L+DP IF     +E+ +C+ +GLLCVQ+ A  RP++S V   L ++ V +P
Sbjct  723   IWNEGEINGLVDPEIFDQLYEKEIRKCVHIGLLCVQEAANDRPSVSTVCSMLSSEIVDIP  782

Query  252   VPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
              P+ P + +  R  V + +S   ++   S N++T++ + GR
Sbjct  783   EPKQPAFIS--RNGVPEAESSENSDPHASINNVTITDVTGR  821



>ref|XP_009148465.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Brassica rapa]
Length=827

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/822 (44%), Positives = 504/822 (61%), Gaps = 45/822 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQ--SVVWVANRERPILDKNGAFGI  2377
             D E +VS+   F  GFFSP  +  RY G+W+N I  Q  +VVWVAN++ PI D +G   I
Sbjct  35    DSETLVSSPSTFRFGFFSPVNSKGRYAGVWFNNIPAQKQAVVWVANKDSPINDSSGKILI  94

Query  2376  TGNGTFVVLDGKnv---siwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFH  2206
             + +G  VV+DG+     S   +    + +     L +T  L++ + D       +W+SF 
Sbjct  95    SKDGNLVVIDGRGHVHWSTNLSRPLGSPNTTHARLLSTGNLVLQEGD-----KKLWESFE  149

Query  2205  QPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYW  2032
              P + FLP M +  D   G+  +  SW +  +PSPGR+S G+ P   P++ +W+     W
Sbjct  150   HPQNAFLPTMTISTDARTGKRLILRSWKSLSDPSPGRYSAGVIPLPFPELALWKDGLMLW  209

Query  2031  RSGHWDGRVFLGVPMRTDFV--YGFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQR  1858
             RSG W+G+ FLG+P R   +  YGF L  +N          +  +  F +D  G  +++ 
Sbjct  210   RSGPWNGQNFLGLPERDSRIDLYGFKLANDNRGSVSMSFGYNQSMYHFLLDTEGHAMEKY  269

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN--CVCIVGFNPSDWNQWNAR  1684
             W+E+ ++W      P + C +Y  CGQF  C +    G++  C CI GF P  + +WN  
Sbjct  270   WSEANQEWSSGLMFPIN-CDIYAKCGQFTSCQS----GLDPPCKCIKGFEPRSYQEWNRG  324

Query  1683  NWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceed  1504
             NWT GC R+T LQCQ+ N  G   E DGF  +K +K+P+  +  R+  + +DC   C  +
Sbjct  325   NWTQGCVRKTLLQCQRANNNGS-REGDGFLRLKKMKVPN--NPQRSEVNEQDCPGSCLRN  381

Query  1503  CSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavs  1324
             CSC AY      G+ C+LW  +L+DM +    SG TL VRL  SEL   S+++ +IV   
Sbjct  382   CSCTAYF--YDTGLGCLLWSGDLIDMQEFLT-SGVTLHVRLAGSELKTSSNRSLVIVITI  438

Query  1323  vvaavavlvivsIWLLCSRR-ARIRAKKRDE---IPRTELPTSGEFSSDFSAQCDLTVEG  1156
             V  A  V VIV   LL  R+ A+ R K R+      R E   S E  +    Q  L    
Sbjct  439   VGCAFLVAVIV---LLALRKVAKRREKTRNARLLFERMEALNSNESGAIAVNQNKL----  491

Query  1155  KAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQG  976
                   +L  F +  +AA T++F++ NKLG+GGFG VYKG L  GQEIAVKRLS+ SGQG
Sbjct  492   -----KELPLFEYQVLAAVTENFAVTNKLGEGGFGSVYKGKLREGQEIAVKRLSQTSGQG  546

Query  975   VQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWR  796
             + EF NE+ VI+KLQHRNLVRLLG CIEG+E+ML+YE+MP  SLD+ + DP K+  L+W+
Sbjct  547   LDEFVNEVVVISKLQHRNLVRLLGFCIEGEERMLVYEFMPGNSLDACLSDPVKQRLLDWK  606

Query  795   KRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEA  616
              RF+II+ I RGL+YLHRDSRLRIIHRDLK SNILLD  +NPKISDFG+ARIF GN++EA
Sbjct  607   TRFNIIDGICRGLMYLHRDSRLRIIHRDLKGSNILLDENLNPKISDFGLARIFRGNEDEA  666

Query  615   NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYA  439
             +T RVVGTYGYMAPEYA+ GLFS KSDV+S GV+LLEIVSGRRN+SF  DD +  +  YA
Sbjct  667   STLRVVGTYGYMAPEYALGGLFSEKSDVFSLGVILLEIVSGRRNSSFNNDDQNLNLSAYA  726

Query  438   WEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVT  259
             W+ W++G+   L+DP I   C   ++ RC+ +GLLCVQD A  RP++S V+  L T+N  
Sbjct  727   WKLWNDGEATTLVDPVILEECFENQIRRCVHIGLLCVQDHANDRPSVSTVIWMLSTENSN  786

Query  258   LPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             LP P+ P + A  R S D +S  ++ +  S N+++++ I+GR
Sbjct  787   LPEPKQPAFIAR-RVSPDAESPWESEQRASINNVSITEIIGR  827



>ref|XP_010492578.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Camelina sativa]
Length=821

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/823 (43%), Positives = 501/823 (61%), Gaps = 55/823 (7%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  +++RY GIWYN +  Q+V+WVAN+++PI D +G   ++
Sbjct  38    NDSETIVSSFRTFRFGFFSPVNSTSRYAGIWYNSVSVQTVIWVANKDKPINDSSGVISVS  97

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELII--LKTDGWRPNNTIWQSFH  2206
              +G  +V DG+       N ++   +++    L ++  L++    TD +     +W+SF 
Sbjct  98    EDGNILVTDGQKRVLWSTNVSTQARANSTVAELLDSGNLVLKEANTDAY-----LWESFK  152

Query  2205  QPTDTFLPGMRVDLSAGESK---LFTSWTNSGNPSPGRFSMGIDPRASPQIVI---WEGE  2044
              PTD++LP M V  +A   +     TSW N  +PSPG ++  +   A P++ I       
Sbjct  153   YPTDSWLPNMLVGTNARTGRGNVTITSWRNPSDPSPGSYTAALILAAYPELFIINNNNNN  212

Query  2043  KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGK  1873
                WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F +D+ G 
Sbjct  213   STVWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYMDYRGS  271

Query  1872  EVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQW  1693
              +++ W+E+R+ W    + PA +C +Y+ CGQFA C+    N  +C CI GF P +  +W
Sbjct  272   VIRRDWSEARRNWTVGLQVPATECDLYSRCGQFATCN--PRNKPSCSCIRGFRPRNLIEW  329

Query  1692  NARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkc  1513
             N  NW+GGC RR PLQC + N  G     DGF  ++ +KLPDFA   R+  S  +C + C
Sbjct  330   NNGNWSGGCIRRVPLQCDRQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTC  384

Query  1512  eedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiiv  1333
              + CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  +  +  +I 
Sbjct  385   LQTCSCIAAAHGL--GYGCMIWNGSLVDSQEL-SASGMDLYIRLAHSEIKTQDKRPILIG  441

Query  1332  avsvvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVE  1159
             A        V        L +RR   + RAKK+           G  +     + +    
Sbjct  442   ATLAGGIFVVAACG----LLARRIVMKKRAKKK-----------GTDAEQIFERVEALAG  486

Query  1158  GKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQ  979
             G  G   +L  F F  +AAATD+FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQ
Sbjct  487   GNKGKLKELPLFEFQVLAAATDNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQ  546

Query  978   GVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNW  799
             G++E  NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W
Sbjct  547   GLEELVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDFYLFDSRRAKLLDW  606

Query  798   RKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNE  619
             + RF+II  I RGLLYLHRDSRLRIIHRD+KASNILLD  + PKISDFG+ARIF GN++E
Sbjct  607   KTRFNIINGICRGLLYLHRDSRLRIIHRDMKASNILLDENLIPKISDFGLARIFPGNEDE  666

Query  618   ANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYA  439
             ANT RVVGTYGYMAPEYAM GLFS KSDV+S GV+LLEIVSGRRN+      +S ++ Y 
Sbjct  667   ANTRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNS------NSTLLAYV  720

Query  438   WEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVT  259
             W  W+EG+   L+DP IF     +E+ +C+ +GLLCVQ+ A  RP++S V   L ++ V 
Sbjct  721   WSIWNEGEINGLVDPEIFDQLYEKEIRKCVHIGLLCVQEAANDRPSVSTVCSMLSSEIVD  780

Query  258   LPVPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
             +P P+ P + +  R  V + +S   ++   S N++T++ + GR
Sbjct  781   IPEPKQPAFIS--RNGVPEAESSENSDPHASINNVTITDVTGR  821



>ref|XP_008775529.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=822

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/815 (44%), Positives = 510/815 (63%), Gaps = 36/815 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++SA+  F LGFFSP  ++NRYVGIWY+E+  Q+VVWVANR+ PI ++ G+  ITG
Sbjct  35    DGQTLISASGNFELGFFSPVNSNNRYVGIWYHEVSVQTVVWVANRQHPITERKGSLSITG  94

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKT--DGWRPNNTIWQSFHQPT  2197
             NGT ++ D  + +IW++ SS   ++    L +T   II +   +   P++  WQSF  PT
Sbjct  95    NGTLIITDQNSTTIWSSGSSGRLASPVARLLDTGNFIIPEASDNSNHPDSFAWQSFDYPT  154

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             DT LPGM++  +L +  ++  T+WT+  +P+PG +S  +D +  P+I +W G +R WR+G
Sbjct  155   DTLLPGMKLGWNLKSHLNRNVTAWTSPSDPAPGYYSAAMDVQGDPEIFLWAGAQRLWRTG  214

Query  2022  HWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQR--WN  1852
              W G  F GVP M+T  ++ F+ + + D +Y  +   +  +I  ++  N   V QR  W 
Sbjct  215   PWVGHRFSGVPEMKTYSMFTFNFVDDRDEIYYTFNILNGSIIS-RLVVNQSGVIQRLVWL  273

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
             E  + W      P DQC   + CG F  CD   +N   C C+ GF P     W  R+ +G
Sbjct  274   EQSQMWNIFWFAPKDQCDSVSPCGPFGVCD--PNNSPICDCLQGFEPKSPANWALRDGSG  331

Query  1671  GCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPedckkkceedCSC  1495
             GC R+TPL C +N T       DGF  V   KLPD +    +M  + + CK  C ++CSC
Sbjct  332   GCKRKTPLDC-RNGT-------DGFLTVNDAKLPDTSSSTVDMSLNLDQCKAACLKNCSC  383

Query  1494  NAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvva  1315
              AYA     G  C++W  EL  +     G G  L++RL +++L + S  +  I  V+VV 
Sbjct  384   TAYASANTSGDGCIIWTAELTGLRVFGFG-GQDLYIRLAAADLGSASDHSHQIHIVAVVV  442

Query  1314  avavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSD  1135
                +  ++   + C    + + ++R        P +  F+S+         EG  G   +
Sbjct  443   GSVLGTLLLGSICCCIWKKKKRRRR--------PGTVSFASNH------IDEGTEGRELE  488

Query  1134  LVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNE  955
             L  F   +IAAAT+ FS+ NKLG+GGFG VYKG L   QEIAVKRL++ S QG+ EF NE
Sbjct  489   LPLFDMGTIAAATNDFSIQNKLGEGGFGPVYKGKLGHEQEIAVKRLAKTSVQGLDEFKNE  548

Query  954   LTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIE  775
             + +IA+LQHRNLVRLLGCCI+G+E+ML+YEYMPN+SLD+F+FD A+ + L+WR R++II 
Sbjct  549   VVLIARLQHRNLVRLLGCCIQGEERMLVYEYMPNRSLDAFLFDKARAALLDWRIRYNIIL  608

Query  774   EIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVG  595
              IARG+LYLH+DSR RIIHRDLKASNILLD EMNPKISDFGMARIFGG++ E NT RVVG
Sbjct  609   GIARGILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEVNTCRVVG  668

Query  594   TYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS-FRTDDHSGIIEYAWEQWDEG  418
             TYGYM+PEYAM+G+FSVKSDV+SFGVL+LEI+SG++N   + +     ++ +AW  W EG
Sbjct  669   TYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISGKKNRGVYLSHQRMNLLGHAWSLWKEG  728

Query  417   KPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPP  238
               + L+D SI  S    E LRCI++GLLCVQ+    RP MS++V  L +++ +LP P+ P
Sbjct  729   NGLELVDESIIHSFPMAEALRCIKVGLLCVQEHPEDRPTMSSLVFMLGSESASLPDPKQP  788

Query  237   TYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              + A+        S ++ + L + N +++++  GR
Sbjct  789   GFVATKGHLETYSSSSKQDSL-TVNGLSVTIFEGR  822



>emb|CDY34839.1| BnaA09g47650D [Brassica napus]
Length=837

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/833 (44%), Positives = 516/833 (62%), Gaps = 43/833 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANRER  2410
             D+I     IKD  E ++S N  F  GFF+P  ++   RYVGIWY+++  Q+VVWVAN++ 
Sbjct  32    DRITFSTSIKDS-ETLLSNNGIFRFGFFTPVTSTGHLRYVGIWYDKVPVQTVVWVANKDT  90

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatm--VLRNTSELIILKTDGWR  2236
             PI + +G   I+ +G  VV  G+N  +W+TN + + S  T    L +   L++       
Sbjct  91    PINNTSGVVSISEDGNLVVKGGQNRHVWSTNVTASVSPNTTWVQLMDNGNLVLQDN----  146

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQI  2062
               + +W+SF    +T LP M +  +L  GE+   TSW +  +PSPG +++ + P   P++
Sbjct  147   -RDILWESFKHNYNTLLPRMNLMTNLKTGENLGLTSWKSYVDPSPGNYTVSLVPFPFPEL  205

Query  2061  VIWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKV--  1888
             +        WRSG W+G+VF+G+P     +    L   NDN  +   + ++D  M+ +  
Sbjct  206   LTKYNNVTKWRSGPWNGQVFIGLPDMDTLLNIDGLNLNNDNQGMVSLTYANDSFMYHITL  265

Query  1887  DWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPS  1708
             D NG   Q+ W  S   W      P+  C  Y+ CG +  C+        C C+ GF P 
Sbjct  266   DPNGAIYQRDWRPSMNDWRVGVRFPSTDCDSYSRCGPYGSCNPGEDP--QCKCVKGFVPR  323

Query  1707  DWNQWNARNWTGGCTRRTPLQCQK--NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             +  +W+  NW  GC RR PL+CQ+  N +  GG ++DGF +++ +K+P   +++  +   
Sbjct  324   NNTEWSGGNWIHGCVRRAPLRCQRLGNRSGNGGGKRDGFLKLEKMKVP--VNVEPYLADE  381

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             E C K C ++CSC AYA     GI CM+W  ELVDM     GSG  L++RL  SEL   S
Sbjct  382   EACPKVCLDNCSCTAYA--YDQGIGCMIWSGELVDMQSF-LGSGIDLYIRLAHSELKTHS  438

Query  1353  SKTTiivavsvvaavavlvi---vsIWLLCSRRARIRAKKRDEI--PRTELPTSGEFSSD  1189
              +  I++   V+       +   ++ W    R A  +  +  EI   R E  TSG   + 
Sbjct  439   KRVLIMITAPVLGVAFAATVCILIACWKFKKRPAEPQENRSAEILLQRMEALTSGNEPT-  497

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              S Q +L          +L  F F  +A ATD FSL NKLGQGGFG VYKGVL  GQEIA
Sbjct  498   -SNQANL---------KELPLFEFQVLATATDHFSLGNKLGQGGFGPVYKGVLSEGQEIA  547

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSR SGQG+ E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++F
Sbjct  548   VKRLSRASGQGLDELLNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLF  607

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K++ L+WR RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+
Sbjct  608   DPLKQNILDWRTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGL  667

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             AR+F  N++EANT RVVGTYGYM+PEYAMEGL+S KSDV+S GV+ L+I+SGRRN S + 
Sbjct  668   ARVFQVNEDEANTIRVVGTYGYMSPEYAMEGLYSEKSDVFSLGVIFLQIISGRRN-SHKE  726

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
             D+   ++ YAW+ W+EG+  +L DP +F  C  +E+ +C+Q+GLLCVQ++A  RPN+S V
Sbjct  727   DNDLNLLAYAWKLWNEGEAASLADPIVFDECFEKEITKCVQIGLLCVQEVANDRPNVSTV  786

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
             +  L T+N+ LP P+ P + A  RR V + +S +Q+++  S N ++++ I GR
Sbjct  787   IWMLTTENMNLPKPKQPAFIA--RRGVSEAESSDQSHQNVSINDVSLTAITGR  837



>ref|XP_011009495.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=869

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/848 (43%), Positives = 507/848 (60%), Gaps = 51/848 (6%)
 Frame = -3

Query  2583  DKIQQGQWIKDD-GENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERP  2407
             D I Q  +I D   E+++S+N  F LGFFSP  + +RYVGIW+N++  Q+VVWVANRE P
Sbjct  42    DIINQTHFISDSKNESLISSNGNFKLGFFSPGNSPSRYVGIWFNKVSKQTVVWVANREIP  101

Query  2406  ILDKNGAFGITGNGTFVVLD--GKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
             +    G F I  +G   V+D  G+        S   ++++  +L + + ++++K +    
Sbjct  102   LEKSAGIFKIAADGNLDVVDSKGRTPLWSTNISMPNANSSAKLLPSGNLVLVVKNNSGNS  161

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              + +WQSF  PTDT LPGMR  L+   G ++  TSW +S  P+PG FS G++P  SPQ  
Sbjct  162   ESIVWQSFDYPTDTILPGMRFGLNRETGLNQFLTSWKSSDEPAPGDFSFGLNPNGSPQYF  221

Query  2058  IWEGEKRYWRSGHWDGRVFLGVP--------MRTDF-----VYGFDLITENDNLYLEYK-  1921
             ++     YWR G W+GR   G P         R DF     ++ +  ++     Y+ +  
Sbjct  222   LYRNLAPYWRGGPWNGRSLSGTPDISTRVKSNRADFNNEAGLFNYSFVSNKRGTYITFHL  281

Query  1920  SSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGI  1741
              ++S      ++  G   +  W E  + W     +P D C VY +CG ++ C+   +N I
Sbjct  282   RNTSVFSSLVLEPTGIVKRVTWREDSQDWALFWLEPDDSCDVYANCGSYSMCN--FNNAI  339

Query  1740  NCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFA  1561
              C C+ GF P   + W  R     C  +   QC K    G G   +GF ++ ++K+PD A
Sbjct  340   KCSCLPGFEPLSPHDWRTR-----CVEKRKFQCGK----GAG---EGFLKMANVKIPD-A  386

Query  1560  DIDRNMRSPedckkkceedCSCN--AYAPPVPG--GISCMLWRNELVDMMQLDEGSGSTL  1393
                R   +    + + E   SCN   YA       G  C+ W  EL DM Q  +  G   
Sbjct  387   TRTRTYTNLSLKECEMECLRSCNCSGYASLDINNEGQGCLAWYGELNDMQQYTD-EGQDF  445

Query  1392  FVRLHSSEL-------DNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE  1234
             ++R+ + EL          S+ T  IV V ++ A+A+L++  +  L SR+ R R    ++
Sbjct  446   YLRVEAGELAAYAKNSSKSSTATNWIVRVVILFAIALLLLFVLIYLHSRKRRARKGYLEK  505

Query  1233  IPRTELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGF  1054
               R EL  S +  +  S   +LT   +   + ++ F+   +I AATD+FS   KLG+GGF
Sbjct  506   RSRREL-LSLDPENCMSNSKELTSAHECEENLNITFYDLGTIRAATDNFSSERKLGEGGF  564

Query  1053  GHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKML  874
             G VYKG L  G+E+A+KRLS+ SGQG+ EF NE+ +IAKLQHRNLVRLLGCC+E +EKML
Sbjct  565   GPVYKGKLSNGKEVAIKRLSKSSGQGIDEFKNEVLLIAKLQHRNLVRLLGCCVEAEEKML  624

Query  873   LYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNI  694
             +YEYMPNKSLD F+FD ++++ L W KRF II  IARG+LYLH+DSRLRIIHRDLK SN+
Sbjct  625   IYEYMPNKSLDYFIFDKSRKASLEWEKRFEIIMGIARGILYLHQDSRLRIIHRDLKTSNV  684

Query  693   LLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVL  514
             LLDGEMN KISDFG ARIF GNQN+ANTNRVVGT+GYM+PEYA++GLFSVKSDV+SFGVL
Sbjct  685   LLDGEMNAKISDFGTARIFCGNQNQANTNRVVGTFGYMSPEYALDGLFSVKSDVFSFGVL  744

Query  513   LLEIVSGRRNTSFRTDD-HSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGL  337
             LLEI+SGR+N  F  +D  S +I Y W  W +GK + ++D SI  SC   EVLRCI +GL
Sbjct  745   LLEIISGRKNIGFFKEDLSSNLIRYTWNLWKDGKALEMMDSSIRQSCPSPEVLRCIHVGL  804

Query  336   LCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSI  157
             LCVQD A +RP MS ++  L TD  TLP P  PTY  S+ RS +  S+   +   S N +
Sbjct  805   LCVQDCAENRPTMSEIIFMLSTD-TTLPSPTQPTY--SITRSQNDPSFPAMDTSSSVNQV  861

Query  156   TMSVIVGR  133
             T+S++  R
Sbjct  862   TISLVDAR  869



>emb|CDP04303.1| unnamed protein product [Coffea canephora]
Length=830

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/825 (44%), Positives = 516/825 (63%), Gaps = 33/825 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I  G+ ++D+ E IVS+ + F LGFFSP  T+NRYVGI YN I   +V+WVANR++
Sbjct  33    AIDTITIGRPVQDN-ETIVSSGQTFKLGFFSPANTTNRYVGIMYN-IPGTTVIWVANRDK  90

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIIL-KTDGWRP  2233
             P+ D  G   I G+G  V+L+G+  +IW++N S + ++++  L +T  L++   +DG   
Sbjct  91    PVKDSTGILTIAGDGNLVILNGERETIWSSNVSKSVASSSAKLWDTGNLVLTDNSDG---  147

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
              +T+W+SF  PTD+ +P MR+   A E    TSW +  +PS G FS G      PQ  +W
Sbjct  148   -STMWESFQIPTDSLVPKMRLSAGAKEKLQLTSWRSPSDPSIGDFSAGFHLFRPPQFFVW  206

Query  2052  EGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITEND-NLYLEYKS-SSSDLIMFKVDW  1882
             E     WRSG W G  F+G+P M + +    DL+ +N  + Y  Y S ++ DL  + ++ 
Sbjct  207   ENNVPRWRSGPWSGNTFIGIPGMSSAYQSRLDLVEDNSGSTYFTYNSVNNPDLFYYALNS  266

Query  1881  NGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDW  1702
             +G  +Q +    +  W         QC +Y  CG F  C+   S    C C+ GF P D 
Sbjct  267   SGC-LQAKVLIGKGDWSVTWLSLESQCDIYGKCGPFGSCNRLQSP--ICTCLQGFKPRDE  323

Query  1701  NQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedck  1522
              +WN  +W+GGC R+  L+C++N +    A++DGF  + ++K+PDF  +   + S E C 
Sbjct  324   EEWNRGHWSGGCIRKELLKCERNQSSSTDAKEDGFVRLPNMKVPDFLVL--VVFSEEACG  381

Query  1521  kkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS-SKT  1345
               C ++CSC AYA     GI CM W   L+D+       G+ L+VR+  SELD K  +K 
Sbjct  382   SSCLKNCSCTAYA--YYKGIGCMHWSGNLIDVQHFSY-DGADLYVRVPYSELDKKKDTKA  438

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
                V V   +    + +   W     +   + K +D+  +  L     F   ++ +  ++
Sbjct  439   VTAVIVVAASLFIAVSLYFCW-----KWWTKHKGKDQDDQVSL-----FEPAYNVENMVS  488

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
               G      +L  +++ ++A ATD+F   N+LG+GGFG VYKG L  GQEIAVKRLS  S
Sbjct  489   KTGDRAKLEELPLYAYETLAKATDNFEQCNELGKGGFGQVYKGKLLDGQEIAVKRLSNTS  548

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG++EF NE+ VI+KLQHRNLVRLLGCC E +EKML+YEYM NKSLD  +FD  K S L
Sbjct  549   GQGIEEFMNEVVVISKLQHRNLVRLLGCCAEREEKMLVYEYMANKSLDFHLFDSDKPSVL  608

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +W+KR  I++ I RGLLYLHRDSRL+IIHRDLKASNILLD E+ PKISDFG+ARIFGGN+
Sbjct  609   DWKKRVTIVDGIGRGLLYLHRDSRLKIIHRDLKASNILLDEELRPKISDFGLARIFGGNE  668

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GII  448
             ++ANT RVVGTYGY+APEYAMEG+FS KSDVYSFGVLLLEIV+GRRN++F   ++   ++
Sbjct  669   DQANTRRVVGTYGYIAPEYAMEGMFSEKSDVYSFGVLLLEIVTGRRNSNFYYHENELSLL  728

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
              YAW+ W+E + + L+D ++F   + +EVLR +  GLLCVQ+ A  RP++SAV+  L ++
Sbjct  729   GYAWKLWNEKEAVKLIDAAMFVPGIEKEVLRYVHAGLLCVQEFAKDRPDISAVLSMLNSE  788

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
                LP+P+ P YT   RR    +S + +  + S N++T++++ GR
Sbjct  789   ISNLPLPKLPAYT---RRLGSSESDSSSQRVDSINNVTVTIVEGR  830



>ref|XP_003562945.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Brachypodium distachyon]
Length=847

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/800 (44%), Positives = 478/800 (60%), Gaps = 23/800 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGT--SNRYVGIWYNEIIPQSVVWVANR  2416
             A+D ++QG+ +      + S    F  GF++P+    +  Y+ IWY  I P++V WVANR
Sbjct  24    ASDTLKQGESLTVSATLVSSPAGVFEAGFYAPDPKQPARLYLCIWYRGIQPRTVAWVANR  83

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
                    + +  +T  G   VLDG            +++      R     +IL T  ++
Sbjct  84    ANAATGPSPSLTLTAAGELRVLDGAARDDGAPLLWSSNTTTRAAPRGGYSAVILDTGSFQ  143

Query  2235  PNNT----IWQSFHQPTDTFLPGMRVDLSA-----GESKLFTSWTNSGNPSPGRFSMGID  2083
               +     IW SF  P+DT L GMR+ ++A      E  LFTSW +  +PSPGR+++G+D
Sbjct  144   VRDVDGTEIWDSFWHPSDTMLSGMRISVNAQGKGPAERMLFTSWASETDPSPGRYALGLD  203

Query  2082  PRASPQIVIW-EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND-NLYLEYKSSSS  1909
             P    Q  IW +G    WRSG W G  F+G+P R  +VYG+    +     Y  Y ++++
Sbjct  204   PVNPNQAYIWRDGNVPVWRSGQWTGLNFVGIPYRPLYVYGYKQGNDQTLGTYFTYTATNT  263

Query  1908  DLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVC  1729
              L  F V  +GK+V     ++ ++W  +  QP ++C  Y  CG  A C         C C
Sbjct  264   SLQRFVVTPDGKDVCYMVKKATQEWETVWMQPLNECEYYATCGSNAICTVVQDRKAKCTC  323

Query  1728  IVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDR  1549
             + GF P   +QWNA N + GC R  PL CQ N T       DGF  ++++K PDF+    
Sbjct  324   LKGFQPKSPDQWNAGNRSQGCVRNPPLGCQVNQT------GDGFLSIQNVKWPDFSYWVS  377

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
              +     C   C+++CSC AY   +     C+ W +EL+D+ Q   G G  L ++L +SE
Sbjct  378   GVTDEIGCMNSCQQNCSCGAYVY-MTTLTGCLHWGSELIDVYQFQTG-GYALNLKLPASE  435

Query  1368  LDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFS-S  1192
             L  + +   I   VS V    ++V + +W    R  +          R+   +       
Sbjct  436   LRERHTIWKIATVVSAVVLFLLIVCLFLWWKRGRNIKDAVHTSWRSRRSSTRSQQSAGMQ  495

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
             D +       E + G S +L   S   I AAT +FS +NKLG+GGFG VY G+LP G+E+
Sbjct  496   DITNSIPFDDETEDGKSHELKVLSLDRIKAATSNFSESNKLGEGGFGPVYLGILPGGEEV  555

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRL + SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+YEYMPNKSLD+F+
Sbjct  556   AVKRLCKNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKILVYEYMPNKSLDAFI  615

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             F+  K+  L+WR RF IIE IARGLLYLHRDSRLRI+HRDLKASNILLD +MNPKISDFG
Sbjct  616   FNSEKQGLLDWRMRFDIIEGIARGLLYLHRDSRLRIVHRDLKASNILLDTDMNPKISDFG  675

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             MARIFGG++N+ NTNRVVGT+GYM+PEYAMEG+FSVKSDVYSFGVL+LEI++G+R  SF 
Sbjct  676   MARIFGGDENQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYSFGVLILEIITGKRAVSFH  735

Query  471   -TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMS  295
                D   I  YAW QW+E K   L+DPSI SSC  ++V+RCI + LLCVQD A  RP++ 
Sbjct  736   GQQDSLNIAGYAWRQWNEDKCEELIDPSIRSSCSVRQVMRCIHIALLCVQDHAQDRPDIP  795

Query  294   AVVLFLETDNVTLPVPRPPT  235
             AV+L L  D+  L +PRPPT
Sbjct  796   AVILMLSNDSSALAMPRPPT  815



>ref|XP_006370370.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
 gb|ERP66939.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
Length=799

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/831 (43%), Positives = 508/831 (61%), Gaps = 65/831 (8%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D +   Q ++D GE +VS    F LGFF+P G+++RY+G+WY +  PQ+VVWVANR  
Sbjct  22    ALDAMNTTQSLRD-GETLVSTGGSFELGFFTPAGSTSRYLGLWYKKS-PQTVVWVANRGI  79

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI +K G   +T  G  V+L+G N  +W++N+S T+ N    L ++  L++   +  + +
Sbjct  80    PISNKFGTLNVTSQGILVLLNGTNNIVWSSNTSTTAQNPVAQLLDSGNLVVRDGNDNKAD  139

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N +WQSF  P DT LPGM++  +L  G ++  +SW    NP+PG+F++GID +  PQ+++
Sbjct  140   NFLWQSFDYPCDTLLPGMKLGSNLVTGLNRFLSSWKGKENPAPGQFTLGIDVQGYPQLIL  199

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWN  1879
              +  +  +R G W+G+ F G P ++ D +Y F+ +   + +Y +++  +S + +F     
Sbjct  200   RKETRIMYRVGSWNGQYFTGFPELKPDPIYTFEFVFNRNEVYFKFELQNSLVQLFT----  255

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWN  1699
                    W+     W        D+C  Y  CG  ARCD++SS    C C+ GF      
Sbjct  256   -------WSHQTNDWYVFATAVVDRCENYALCGANARCDSNSSP--VCDCLDGFIHKSPT  306

Query  1698  QWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD--IDRNMRSPedc  1525
             +WN++NWTGGC RRTPL C          +KDGF+    +KLPD +    D +  S  +C
Sbjct  307   EWNSQNWTGGCIRRTPLDC---------TDKDGFQSYTGVKLPDTSSSWYDDSF-SLVEC  356

Query  1524  kkkceedCSCNAYAP-PVPG-GISCMLWRNELVDMMQLDEGSGSTLFVRLHSSEL----D  1363
             +  C ++CSC AYA     G G  C+ W  +L+D  +L EG G  +++RL +S+     +
Sbjct  357   EGLCIQNCSCFAYANLDFRGRGSGCLRWFGDLIDTRRLAEG-GQDIYIRLAASQSGVTGE  415

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFS  1183
              K  K T    +     +   +++   + C RR + R              +G F     
Sbjct  416   KKRKKKTHAGVIGGAVILGSSILILGIVFCIRRRKHRK-------------NGNF-----  457

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
                    E +     +L     ++I  ATD+FS + KLG+GGFG VYKG L  GQEIAVK
Sbjct  458   -------EDRKEEEMELPMLDLTTIEHATDNFSSSKKLGEGGFGAVYKGELIEGQEIAVK  510

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS+ SGQG+ EF NE+ +IAKLQHRNLV+LLGCCI  DEKML+YEYMPN+SLDSF+FDP
Sbjct  511   RLSKSSGQGLNEFKNEVLLIAKLQHRNLVKLLGCCIHEDEKMLIYEYMPNRSLDSFIFDP  570

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
              +R  L+W KR HII+ IARGLLYLH+DSRLRIIHRD+KASNILLD E+NPKISDFG+AR
Sbjct  571   TRRKFLDWSKRTHIIDGIARGLLYLHQDSRLRIIHRDIKASNILLDNELNPKISDFGLAR  630

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
             +FGG+Q EANT RVVGTYGYM+PEYA++G FSVKSDV+SFGVL+LEIVSG++N  F   D
Sbjct  631   MFGGDQTEANTKRVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIVSGKKNRGFCHPD  690

Query  462   HS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
             ++  ++ +AW  W  G P+ L+D     SC P E LRCI + LLCVQ     RPNMS+VV
Sbjct  691   YNQNLLGHAWMLWFNGIPLELIDECFADSCTPSEALRCIHVALLCVQQRPEDRPNMSSVV  750

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             L L ++N  LP P+ P +        + D+ +  ++  S+N +T++++  R
Sbjct  751   LMLGSEN-PLPQPKQPGFFMG-SNPPEKDTSSNKHQSHSANEVTVTLLQAR  799



>emb|CDX97948.1| BnaA06g06990D [Brassica napus]
Length=836

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/833 (44%), Positives = 514/833 (62%), Gaps = 42/833 (5%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANRE  2413
             D+I     IKD + + ++  +  F  GFF+P  ++   RYVGIWY+++  Q+VVWVAN++
Sbjct  30    DRITFTTPIKDSNSDTLLCKSGVFRFGFFTPVNSTGKLRYVGIWYDKMPIQTVVWVANKD  89

Query  2412  RPILDKNGAFGITG-NGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDG  2242
              PI D +G   I+  +G  VV DG+N +    N    V  +   + L +T  L +   D 
Sbjct  90    SPINDTSGVVSISSEDGNLVVTDGRNRTLWSTNVTVPVAPTTTWVQLMDTGNLAL--QDS  147

Query  2241  WRPNNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASP  2068
                  T+W+SF  P ++FLP M +  +   GE+   TSW +  +PS G ++ G+ P   P
Sbjct  148   RNNGETLWESFKHPYNSFLPKMTLGTNNRTGENLKLTSWKSYTDPSTGEYTAGLAPYTFP  207

Query  2067  QIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMF  1894
             +++IW+     WRSG W+G+VF+G+P     ++  GF+L  +N        ++ S +  F
Sbjct  208   ELLIWKNNVPIWRSGPWNGQVFVGLPDVDSLLFLDGFNLNNDNQGTVSMSYANGSFMYHF  267

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
              +D +G   Q+ W    + W      P   C  Y  CG +  C+  S     C C+ GF 
Sbjct  268   NLDPDGAIYQRDWRAPLRDWRIGVRFPKTDCDAYGKCGPYGICN--SREETQCKCVKGFV  325

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             P +  +W+ARNW+ GC R+  L+C  +N  GGG E DGF +++ +K+P   +  +++ + 
Sbjct  326   PMNETEWDARNWSNGCVRKAMLKCNASNGGGGGKE-DGFMKLEKMKVP--INAIQSLANE  382

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             + C ++C ++CSC AYA     GI CMLW   LVDM     GSG  L +RL  SEL   S
Sbjct  383   QACPQQCTDNCSCTAYA--YDKGIGCMLWSGSLVDMQSF-VGSGIDLNIRLAHSELKTHS  439

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE------IPRTELPTSGEFSS  1192
             S   +I A  +  A    V V   LL  RR R R + + +        R E  TSG  S+
Sbjct  440   SLAIVITASVLGVAFVAAVCV---LLACRRFRKRPEPKKDRSAEIMFKRMEELTSGNESA  496

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
               S Q  L          +L  F F  +A ATDSFSL NKLGQGGFG VYKG LP GQEI
Sbjct  497   --SNQVKL---------KELPLFEFQVLATATDSFSLRNKLGQGGFGPVYKGKLPEGQEI  545

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYM  KSLD+++
Sbjct  546   AVKRLSRASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMSKKSLDAYL  605

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP K+  L+W+ R +I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG
Sbjct  606   FDPLKQKILDWKTRLNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDDNLNPKISDFG  665

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +AR+F  N++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRR  S +
Sbjct  666   LARVFRANEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRR-ISHK  724

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              +++  ++ YAW+ W+EG+  +L DPS+F     +E+ +C+Q+GLLCVQ++A  RPN+S 
Sbjct  725   EENNLNLLAYAWKLWNEGEAASLADPSVFDESFEKEITKCVQIGLLCVQEVANDRPNVST  784

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V+  L T+N  L  P+ P   A  R + + +S +Q+++  S N ++++ + GR
Sbjct  785   VIWMLTTENTNLKEPKQPAIIAR-RGASEAESSDQSSQKVSINDVSLTAVTGR  836



>gb|AES63672.2| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=841

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/832 (44%), Positives = 511/832 (61%), Gaps = 40/832 (5%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q IK   E I S+++ F LGFFSP  T+NRYVGIWY  +   +++WVANRE+PI D
Sbjct  33    ITSSQLIKYS-ETISSSDDAFKLGFFSPVNTTNRYVGIWY--LNQSNIIWVANREKPIQD  89

Query  2397  KNGAFGITGNGTFVVLDGKnvsiw-----ntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              +G   I+ + T +V+  ++  +      ++N + ++SN T  L+NT  LI L+ D    
Sbjct  90    SSGVITISDDNTNLVVLNRHKHVIWSSNVSSNLASSNSNVTAQLQNTGNLI-LQED--TT  146

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              N IW+SF  P+D FLP M +  +   GE   +TSW    +P+ G FS+ ++   SP++ 
Sbjct  147   GNIIWESFKHPSDAFLPNMIISTNQRTGEKVKYTSWKTPLDPAIGNFSLSLERLNSPEVF  206

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLIT----ENDNLYLEYKS----SSSDL  1903
             +W   K YWRSG W+G+V +G+P R   +Y  D++T      DN  +   +    +SS  
Sbjct  207   VWNQTKPYWRSGPWNGQVLVGLPSR--LLYASDILTLSIGRKDNGSIVETTYTLLNSSFF  264

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
              +  V+  GK V   W    +    + ++  ++C +Y  CG    CD   +N   C C+ 
Sbjct  265   AIATVNSEGKLVYTSWMNGHQVGTTVVQE--NECDIYGFCGPNGSCD--LTNSPICTCLK  320

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG--GAEKDGFREVKHIKLPDFADIDR  1549
             GF P + ++WN +NW  GC R+  LQC++    G   G + DGF +++  K+PDF  + +
Sbjct  321   GFEPRNVDEWNRQNWISGCARKASLQCERVKYNGSELGGKGDGFVKLEMTKIPDF--VQQ  378

Query  1548  NMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSE  1369
             +    + C+ +C  +CSC AYA     GI C+ W   L+D+++   G G  L++R   SE
Sbjct  379   SYLFADACRTECLNNCSCVAYA--YDDGIRCLTWSGNLIDIVRFSSG-GIDLYIRQAYSE  435

Query  1368  LDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSD  1189
             L     +    + +S+    A++   + + L S  ++  A+++ E     L +S      
Sbjct  436   LYRDGKRNFTKIIISMGVVGAIIFATASYFLWSWASKYSARRKIE---KMLVSSTRQIHP  492

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
              +    L    K     DL  F F  I+ AT++F   NK+GQGGFG  YKG L  G EIA
Sbjct  493   ENRNASLIGNVKQVKIEDLPLFEFQKISTATNNFGSPNKIGQGGFGSAYKGELQDGLEIA  552

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLS+ SGQG++EF NE+ VI+KLQHRNLVRLLGCCIEG+EKML+YEYMPN SLD ++F
Sbjct  553   VKRLSKASGQGLEEFMNEVIVISKLQHRNLVRLLGCCIEGEEKMLVYEYMPNNSLDFYLF  612

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
             DP K+  L+W+KR +IIE I+RGLLYLHRDSRLRIIHRDLK SNILLDGE+NPKISDFGM
Sbjct  613   DPIKKKILDWQKRLYIIEGISRGLLYLHRDSRLRIIHRDLKPSNILLDGELNPKISDFGM  672

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGG++NE NT R+VGTYGYM+PEYAMEGLFS KSDV+SFGVLLLEI+SGR+NTSF  
Sbjct  673   ARIFGGSENEGNTRRIVGTYGYMSPEYAMEGLFSEKSDVFSFGVLLLEIISGRKNTSFYN  732

Query  468   DDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
                  ++ Y W+ W+E + + L+D  I ++     +LRCI +GLLCVQ++A  RP M+ V
Sbjct  733   HQALTLLGYTWKLWNEDEVVALIDQEICNADYVGNILRCIHIGLLCVQEIAKERPTMATV  792

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             V  L ++ V LP P  P +  S       DS  QNN+  S+NS+T++ + GR
Sbjct  793   VSMLNSEIVKLPHPSQPAFLLSQTEH-RADSGQQNND--SNNSVTVTSLQGR  841



>ref|XP_007140616.1| hypothetical protein PHAVU_008G127100g [Phaseolus vulgaris]
 gb|ESW12610.1| hypothetical protein PHAVU_008G127100g [Phaseolus vulgaris]
Length=850

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/832 (45%), Positives = 514/832 (62%), Gaps = 30/832 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A D I   Q ++D  E + S +  F LGFF P  ++N YVGIW+      +VVWVANR++
Sbjct  36    ATDTITSSQSLRDP-ETLSSKDGNFTLGFFVPPNSTNHYVGIWWKS--QSTVVWVANRDQ  92

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ D +GA   + +G  VV++G+N  IW+T  S TSSN +  L +  +L + +T      
Sbjct  93    PLNDSSGAVTFSEDGNLVVVNGENQVIWSTFVSNTSSNTSAQLSDVGKLELTET---TTG  149

Query  2229  NTIWQSFHQPTDTFLPGMRVDLS-AGESKLFTSWTNSGNPSPGRFSMGIDPRAS-PQIVI  2056
              ++W SF QP+DTFLP M++  +  G     TSW +  NPS G FS+G+  R    +  I
Sbjct  150   KSLWDSFQQPSDTFLPQMKISSNKTGSGGKLTSWKSPSNPSAGSFSVGVAERVKIVEAFI  209

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWN  1879
             W   + YWRSG W   VF G+  M + ++  F ++  +  LY      S+ LI + ++  
Sbjct  210   WNETRPYWRSGPWSSGVFTGIEQMNSAYLNSFSVL--DGVLYYNLDGLSAFLI-YVLNSQ  266

Query  1878  GKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGIN----CVCIVGFNP  1711
             G+  ++RW+E  K+           C VY  CG FA CD + S G N    C C+ GF P
Sbjct  267   GQFQEKRWDEEEKEVQVTWTSKQSDCDVYGVCGSFAICD-AHSQGTNGSSICSCLKGFEP  325

Query  1710  SDWNQWNARNWTGGCTRRTPLQCQ--KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRS  1537
                 +W+A+NWT GC   TPLQC+  K+        +D F E++ +K+PD ++   +   
Sbjct  326   RSKEEWDAQNWTSGCFWSTPLQCERAKDQNTSIDTNEDKFLELQKVKIPDLSEWSND--D  383

Query  1536  PedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRL-HSSELDN  1360
             P+ C+ +C E+CSC AY+     GI CM W   L+D+ QL +  G  L+VR+ +S+EL++
Sbjct  384   PDTCRSRCLENCSCVAYSHD--DGIGCMSWTENLLDIQQLSD-RGLPLYVRVAYSTELEH  440

Query  1359  KSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSA  1180
                K T I+ +  V    ++ +    ++  R +    K    I         +F   F+ 
Sbjct  441   DEGKKTTIIIIVTVIIGIMITVTCACVMWRRNSCHPVKIWYSIKSAMKRDKKDFIR-FNN  499

Query  1179  QCDLTVEGKAGASS--DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
                L   G        +L+ F F  +A AT++F  +NKLGQGGFG VYKG L  GQEIAV
Sbjct  500   VKPLEQTGHKVFEELKELLLFDFERLATATNNFHESNKLGQGGFGPVYKGKLQDGQEIAV  559

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLSR SGQG++EF NE+ VI+KLQHRNLVRLLGCC EGDEKMLLYEYMPNKSLD F+FD
Sbjct  560   KRLSRSSGQGLEEFMNEVVVISKLQHRNLVRLLGCCTEGDEKMLLYEYMPNKSLDVFIFD  619

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
             P K   L+WR+R  IIE IARGLLYLHRDSRL+IIHRDLKASNILLD E+NPKISDFGMA
Sbjct  620   PTKHKLLDWRRRCSIIEGIARGLLYLHRDSRLKIIHRDLKASNILLDEELNPKISDFGMA  679

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD  466
             RIFGG ++ ANTNR+VGTYGYM+PEYAM+GL S KSDV+SFGVLLLEIVSGRRN+SF  D
Sbjct  680   RIFGGTEDHANTNRIVGTYGYMSPEYAMQGLVSEKSDVFSFGVLLLEIVSGRRNSSFYDD  739

Query  465   DHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAV  289
             + S  +I + W QW+EG  ++LLD  I+     +++LR I +GLLCVQ+LA+ RP M+ V
Sbjct  740   ERSLTLIGFVWTQWNEGNILSLLDSEIYDPNDHEDILRVIHIGLLCVQELALERPTMATV  799

Query  288   VLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +  L +D   LP P  P +   ++  ++ +S  ++  + S N I+++ I GR
Sbjct  800   ISMLNSDVAFLPPPSQPAF-VRVQNVLNSESSKESQRVCSVNIISITDIHGR  850



>ref|XP_006423695.1| hypothetical protein CICLE_v10027849mg [Citrus clementina]
 gb|ESR36935.1| hypothetical protein CICLE_v10027849mg [Citrus clementina]
Length=794

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/827 (43%), Positives = 505/827 (61%), Gaps = 71/827 (9%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q I+D  + I+S    F LGFF+P  +  RY+GIWY+    ++V+WVANR+ P+ D
Sbjct  26    ITSSQLIRDP-DAILSNGSNFKLGFFNPADSPYRYMGIWYDMPSEKAVIWVANRDNPLKD  84

Query  2397  KNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIW  2218
              +G   I+ +G  V+++G+   +W++N S   +N+T      S  ++L+ +  R    +W
Sbjct  85    SSGIITISEDGNLVLVNGQKEVLWSSNVSNLVNNSTSAQLLDSGNLVLRDNINRV--IVW  142

Query  2217  QSFHQPTDTFLPGM--RVDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE  2044
             +SF +PTD+FLPGM  R+D   G+    TSW +  +PS G FS G+  +  P+I +W   
Sbjct  143   ESFQEPTDSFLPGMHHRIDQRTGKKVQLTSWKSLSDPSTGSFSAGLIHQNIPEIFVWNDS  202

Query  2043  KRYWRSGHWDGRVFLGVP-------MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             + YWRSG W+G++F+G+P        R ++ +GF                ++D   F + 
Sbjct  203   RPYWRSGPWNGQIFIGIPELKSVYLFRHNYTFGF----------------ANDWTFFALT  246

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   ++ W + +  W         +C VY  CG F  C NS    I C C+ GF P +
Sbjct  247   AQGILEERFWIKWKDNWEVGFLNLRTECDVYGKCGAFGIC-NSQEKPI-CSCLEGFEPKN  304

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
               +WN  NWT GC RR+ +QC++ N  G   ++DGF ++  +K+PDF +      SP   
Sbjct  305   AEEWNRGNWTSGCIRRSKMQCERRNITGKVGKEDGFLKLNKMKVPDFTE----WTSPATE  360

Query  1524  kkkcee-dCSCNAYAPPVPGGISCMLWRN-ELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              +  ++   +C+  A    GGI CM+WR+  L+D+ +L    G+ L++R+ +S++D K  
Sbjct  361   DECRDQCLKNCSCIAYAFDGGIGCMVWRSINLIDIQRL-PFEGTDLYIRVANSDVDEKGK  419

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             K   +  +        +  + +W   ++R  + AK                    SA   
Sbjct  420   KDVFVSPLIKGMFALAICTLFLWRWIAKRKEVIAK-------------------LSATNV  460

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
              TV+ +     DL  F F  +A AT++F L++KLGQGGF  VY G        AVKRLS+
Sbjct  461   NTVKLQ-----DLPLFQFEELATATNNFQLSSKLGQGGFEPVYWGN-------AVKRLSQ  508

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++EF NE+ VI+KLQHRNLVRLLGCC+EG+EKML+YEYMPN+SLD+ +FDP K+ 
Sbjct  509   ASGQGLEEFMNEVMVISKLQHRNLVRLLGCCVEGEEKMLIYEYMPNRSLDALLFDPLKKE  568

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+WRKRF+IIE I+RGLLYLHRDSRLRIIHRDLKASNILLD E+NPKISDFGMA+IFGG
Sbjct  569   RLDWRKRFNIIEGISRGLLYLHRDSRLRIIHRDLKASNILLDEELNPKISDFGMAKIFGG  628

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             NQ++A+T RVVGT+GYM+PEYAMEG FS KSDV+SFGVLLLEIVSGR+NTSF  DD + I
Sbjct  629   NQDQADTGRVVGTFGYMSPEYAMEGRFSEKSDVFSFGVLLLEIVSGRKNTSFFEDDLT-I  687

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQE-VLRCIQLGLLCVQDLAVHRPNMSAVVLFLE  274
             + YAW+ W+E K + L+DP +  S    + ++RCI +GLLCVQ+L   RPNMS VV  L 
Sbjct  688   LGYAWKLWNENKILALVDPFLSESSFQLDMIIRCIHVGLLCVQELVKDRPNMSTVVSMLN  747

Query  273   TDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++   LP P+ P +T   + +VD +S+ Q  +  S N IT ++  GR
Sbjct  748   SEIRDLPYPKEPAFTER-QGAVDSESFKQIQQTYSFNDITFTLTAGR  793



>ref|XP_007021379.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12904.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=817

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/831 (44%), Positives = 511/831 (61%), Gaps = 47/831 (6%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             A DKI   + + D G  +VS++  F LGFF+P  + NRY+GIWYN I  Q+VVWVANR  
Sbjct  22    ALDKISPSESLTD-GTTLVSSDGSFALGFFTPGSSKNRYLGIWYNNIPMQTVVWVANRIN  80

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             PI D  G   I   G  V+L     ++W+ NS+  + N  + L ++  L++         
Sbjct  81    PINDTTGLLKIESTGRAVLLGQNQTTVWSINSTEAAQNPILQLLDSGNLVVRDGKDGDSE  140

Query  2229  NTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
             N +WQSF  PTDT L GM++  DL  G ++  ++W NS +PSPG  + G++ + +PQ+V+
Sbjct  141   NYLWQSFDYPTDTMLAGMKIGWDLRTGLNRRLSAWKNSDDPSPGDLTYGVELQGNPQMVL  200

Query  2055  WEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWN  1879
              +G ++Y+RSG W+G  F GVP +R++ V+ +D +   + +Y  Y   +  ++   V   
Sbjct  201   RKGSEKYYRSGLWNGNGFSGVPNLRSNPVFDYDFVWNKEEVYYIYYLKNKSVMSRFVLNQ  260

Query  1878  GKEVQQR--WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              ++V+QR  WN   + W      P+D C     CG    CDNS      C C+  F P  
Sbjct  261   TEKVRQRYTWNPETQTWKLFSFMPSDYCDTPGLCGANGNCDNSKLPA--CQCLKAFRPKS  318

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFAD--IDRNMRSPe  1531
               +WN+ +W+ GC    PL CQ+          D F  ++ +K PD +   ++++M + +
Sbjct  319   LERWNSSDWSEGCIHNKPLNCQRG---------DAFIRIERVKTPDTSHSWVNKSM-NLK  368

Query  1530  dckkkceedCSCNAYAP-PVPGGIS-CMLWRNELVDMMQLDEGSGSTLFVRLHSS--ELD  1363
             +C+ +C ++CSC AY    + G  S C +W ++L+D+ Q  +  G  L++R+ +S  EL 
Sbjct  369   ECRARCLQNCSCMAYTNLDIRGRASGCAMWFDDLIDIKQF-QSFGQDLYIRVSASEAELK  427

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFS  1183
             NKS     ++  + +A    L++V          R R K  DE+                
Sbjct  428   NKSEAKLAMIIATPIAVFLGLLVVI-----YYIRRRRRKLEDEVEE-------------R  469

Query  1182  AQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVK  1003
              + D   +G++    DL  F   +IA ATDSFS  NKLG+GGFG VYKG L  GQEIAVK
Sbjct  470   IENDQKNQGRS-EDMDLAVFELGTIARATDSFSFHNKLGEGGFGPVYKGTLANGQEIAVK  528

Query  1002  RLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDP  823
             RLS+ SGQG+ EF  E+ +IAKLQHRNLVRLLGCCI G+EKML+YEYMPN+SLDSF+FD 
Sbjct  529   RLSKSSGQGLNEFKTEVKLIAKLQHRNLVRLLGCCIHGEEKMLVYEYMPNRSLDSFIFDQ  588

Query  822   AKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMAR  643
              +   L+W KRF II  IARGLLYLH+DSRLRIIHRDLKASN+LLD EMNPKISDFGMAR
Sbjct  589   RRCKVLDWPKRFQIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMAR  648

Query  642   IFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDD  463
              FGG+Q EANTNRVVGTYGYMAPEYA++GLFSVKSDV+SFG+LLLEI+SGR+N  F   +
Sbjct  649   TFGGDQTEANTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILLLEIISGRKNRGFYHKN  708

Query  462   HSG-IIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVV  286
              SG +IE+AW  W EGKP+NL D  +  +    +VLRCI + LLCVQ     RP+MS+VV
Sbjct  709   QSGNLIEHAWRLWKEGKPLNLADDFLAETGSLSQVLRCIHISLLCVQQHPEGRPSMSSVV  768

Query  285   LFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             L L ++N  LP+P+ P +    +   + DS + N+   S N I++SV+  R
Sbjct  769   LMLGSEN-ELPLPKQPGFLFH-KSPFEADSSSGNHGSSSKNEISLSVLEAR  817



>ref|XP_006657817.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like [Oryza brachyantha]
Length=862

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/849 (44%), Positives = 528/849 (62%), Gaps = 45/849 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANR  2416
             AA  + QGQ ++ + E ++SA+  F +GFF P G  +   Y+G+ Y +   Q+V+WVANR
Sbjct  29    AAASLSQGQSLRGN-ETLLSASGAFKVGFFKPAGGDHGRVYLGVMYAQAREQTVMWVANR  87

Query  2415  ERPILDKNG-AFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGW  2239
             + P+   +  +  +T +G   V++G  V+    +S   +++    + +  +L+I  +DG 
Sbjct  88    DAPVSAASAYSATLTASGELRVMEGDRVAWRTNSSGGLANHTLT-IGDDGDLVIAGSDG-  145

Query  2238  RPNNTIWQSFHQPTDTFLPGMRVDL--SAGES---KLFTSWTNSGNPSPGRFSMGIDPRA  2074
                  +W+SF  PTDTF+PGM + L  S G S    L+TSW + G+P+ G F++G+D  +
Sbjct  146   AGKEQVWRSFDHPTDTFVPGMEIALRQSNGSSISRTLYTSWRSDGDPATGDFTLGLD--S  203

Query  2073  SPQIVIWEGE----KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITE---NDNLYLEYKSS  1915
             S Q+ IW  +      YWRSG W    F+G+P R+ +VYGF  I +     +++L +   
Sbjct  204   SAQLYIWRSQDGKNSTYWRSGQWTNTNFVGIPWRSLYVYGFKFIGDPLLGGDMFLTFVPF  263

Query  1914  SSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINC  1735
             +S L  F +  +G E      +S   W  +  QP   C +YN CG  A C  +      C
Sbjct  264   NSSLYRFVLRPDGVETCYMLLDS-GDWEVVWSQPTIPCHMYNKCGANAECAAADDGQPIC  322

Query  1734  VCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADI  1555
              C+ GF P    ++N+ NWT GC R  PL C            DGF  V+ +KLPDFA  
Sbjct  323   TCLKGFTPKSEAEYNSGNWTQGCVRSAPLTCSGGGNV---TGGDGFAVVQGVKLPDFAVW  379

Query  1554  DRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGST--LFVRL  1381
                      CKK C ++CSC AY+  +    SC+ W  ELVD+      SG    L+V++
Sbjct  380   GSVAGDANACKKLCLDNCSCGAYSYSIN---SCLTWGQELVDVYHFPSSSGVLYELYVKV  436

Query  1380  HSSELDNKSSK---TTiivavsvvaavavlvivsIWLLCSRRARIR---AKKRDEIP--R  1225
              SS L   S     TT+IV V VV A+A++  V +   C RR + +    +K+ ++P  R
Sbjct  437   PSSLLVTSSKSGRWTTVIVVVVVVVAIALVACVLLMWKCRRRIKEKLCIGRKKIDLPLLR  496

Query  1224  TELPTSGEFSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHV  1045
                  + +FS    ++ +   +GK   + +L  F+F ++A ATD+FS +NKLG+GGFGHV
Sbjct  497   PGRDANKDFSGPAQSEHEKPDDGK---NCELPLFAFEALATATDNFSSSNKLGEGGFGHV  553

Query  1044  YKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYE  865
             YKG LP G+EIAVKRLSR SGQG++EF NE+ +IAKLQHRNLVRLLGCCI+G+EK+L+YE
Sbjct  554   YKGRLPGGEEIAVKRLSRSSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKILVYE  613

Query  864   YMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLD  685
             YMPNKSLD+F+FDP +R  L+WR RF IIE +ARGLL L RDSRLR++HRDLKASNILLD
Sbjct  614   YMPNKSLDAFLFDPERRGLLDWRTRFQIIEGVARGLLSLPRDSRLRVVHRDLKASNILLD  673

Query  684   GEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLE  505
              +MNPKISDFGMARIFGG+QN+ NTNRVVGT GYM+PEYAMEGLFSV+SDVYSFG+L+LE
Sbjct  674   HDMNPKISDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAMEGLFSVRSDVYSFGILILE  733

Query  504   IVSGRRNTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCV  328
             I++G++N+SF   + S  I+ YAW+ W+  +   L+DP+I  +C  +E LRCI + LLCV
Sbjct  734   IITGQKNSSFHHMEGSLNIVGYAWQLWNGDRGEQLIDPAIRGACPAKEALRCIHMALLCV  793

Query  327   QDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASMRRSVDVDSW----NQNNELPSSNS  160
             QD A  RP++  VVL L +D   LP+PRPPT+T     S          ++ +   SSN 
Sbjct  794   QDHAHDRPDVPYVVLTLGSDASVLPMPRPPTFTLQCTSSSSGRDMYCCRDKEDGSHSSND  853

Query  159   ITMSVIVGR  133
             +T++++ GR
Sbjct  854   LTVTMLQGR  862



>gb|KFK35677.1| hypothetical protein AALP_AA4G022800 [Arabis alpina]
Length=837

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/821 (42%), Positives = 514/821 (63%), Gaps = 34/821 (4%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRERPILDKNGAFG  2380
             +D E ++     F  GFF+P  ++ R  YVGIWY++I  Q+V+WVAN++ P+ D +G   
Sbjct  37    NDSETLLCKRGIFRFGFFTPVNSTTRLRYVGIWYDKIPIQTVIWVANKDTPVNDTSGVVS  96

Query  2379  ITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
             I+ +G  VV DG+N  +W+TN +V  +     ++      ++  D      T+W+SF  P
Sbjct  97    ISEDGNLVVKDGRNRLLWSTNVTVQVAPNATWVQLMDSGNLMLQDNRNKGETLWESFKHP  156

Query  2199  TDTFLPGMRVDLSA--GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRS  2026
              ++F+P M +  +   GE+   TSW +  +PS G ++ G+ P A P+++IW+ +   WRS
Sbjct  157   YNSFMPRMNLGTNGRTGENLKLTSWRSDQDPSTGNYTAGLAPFAFPELLIWKNKVPQWRS  216

Query  2025  GHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQRWN  1852
             G W+G+VF+G+P     ++  GF+L ++N        ++ S +  F +D +G   Q+ W+
Sbjct  217   GPWNGQVFIGLPDMDSLLFLDGFNLNSDNQGTVSMSYANDSFMYHFNLDPDGAIYQRDWS  276

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
              S + W      P+  C  Y  CG +  C    +    C C+ GF P +  +WN  NW+ 
Sbjct  277   TSMRSWRIGIRFPSTDCDAYGRCGPYGICHPRGNPP--CKCVKGFVPRNETEWNGGNWSN  334

Query  1671  GCTRRTPLQCQK----NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceed  1504
             GC RRTPL+C++    ++  GGG + D F +++ +K+P  A+  +++ + + C   C ++
Sbjct  335   GCVRRTPLRCERLRNGSSNGGGGGKGDVFLKLQKMKVPISAE--QSLANEQACPNVCLDN  392

Query  1503  CSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavs  1324
             CSC AYA     G+ CM+W   LVDM     GSG  L +RL  SEL   S +  +I A  
Sbjct  393   CSCTAYA--YDRGVGCMIWSGGLVDMQSF-LGSGIDLNIRLAHSELKTHSKRAIMITAPV  449

Query  1323  vvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGA  1144
             +  A+          +C   A  + KKR   P    P        F     LT   +A +
Sbjct  450   LGVALVAA-------VCVLLACRKLKKRPAEP----PKDRSAEILFERMEALTSGNEAAS  498

Query  1143  S----SDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQG  976
             +     +L  F F  +A +TD+F L NKLGQGGFG VYKG LP GQEIAVKRLSR SGQG
Sbjct  499   NQVKLKELPLFEFQVLATSTDNFCLRNKLGQGGFGPVYKGKLPEGQEIAVKRLSRASGQG  558

Query  975   VQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWR  796
             ++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++FDP K+  L+W+
Sbjct  559   LEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLFDPLKQKILDWK  618

Query  795   KRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEA  616
              RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+AR+F  N++EA
Sbjct  619   TRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDEYLNPKISDFGLARVFQANEDEA  678

Query  615   NTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAW  436
             NT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+ LEI+SGR+N S + +++  ++ YAW
Sbjct  679   NTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVIFLEIISGRKN-SHKEENNLNLLAYAW  737

Query  435   EQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTL  256
             + W++G+  +L DP++   C  +E+ +C+Q+GLLCVQ++A  RPN+S V+  L T+N  L
Sbjct  738   KLWNDGEAASLADPNVSDECFEKEIQKCVQIGLLCVQEVANDRPNVSTVIWMLSTENSNL  797

Query  255   PVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             P P+ P + A  R + D +S +Q+++  S N ++++ + GR
Sbjct  798   PEPKQPAFIAR-RGASDAESSDQSSQKASVNDVSLTAVTGR  837



>ref|XP_010458519.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Camelina sativa]
Length=863

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/821 (43%), Positives = 498/821 (61%), Gaps = 51/821 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  +++RY GIWYN +  Q+V+WVAN+++PI D +G   ++
Sbjct  80    NDSETIVSSFRTFRFGFFSPVNSTSRYAGIWYNSVSVQTVIWVANKDKPINDSSGVISVS  139

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
              +G  +V DG+       N ++   +++    L ++  L++ + +    +  +W+SF  P
Sbjct  140   EDGNLLVTDGQKRVLWSTNVSTQARANSTVAELLDSGNLVLKEAN---TDAYLWESFKYP  196

Query  2199  TDTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI---WEGEKR  2038
             TD++LP M V  +A   G +   TSW N  +PSPG ++  +   A P++ I         
Sbjct  197   TDSWLPNMLVGTNARTGGGNVTITSWRNPSDPSPGSYTAALVLAAYPELFIINNNNNNST  256

Query  2037  YWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
              WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F +D+ G  +
Sbjct  257   VWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYMDYRGSVI  315

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C +Y  CGQFA C+        C CI GF P +  +WN 
Sbjct  316   RRDWSEARRNWTVGLQVPATECDLYRRCGQFATCNPRKKP--PCSCIKGFRPRNLIEWNN  373

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NWTGGC RR PLQC + N  G     DGF  ++ +KLPDFA   R+  S  +C + C +
Sbjct  374   GNWTGGCIRRVPLQCDRQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTCLQ  428

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  +  +  +I A 
Sbjct  429   TCSCIAAAHGL--GYGCMIWNGSLVDSQEL-SASGMDLYIRLAHSEIKTQDRRPILIGAT  485

Query  1326  svvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
                    V        L +RR   + RAKK+           G  +     + +    G 
Sbjct  486   LAGGIFVVAACG----LLARRIVMKKRAKKK-----------GTDAEQIFERVEALAGGN  530

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
              G   +L  F F  +AAATD+FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG+
Sbjct  531   KGKLKELPLFEFQVLAAATDNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQGL  590

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W+ 
Sbjct  591   EELVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDFYLFDSRRAKLLDWKT  650

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+II  I RGL+YLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN++EAN
Sbjct  651   RFNIINGICRGLMYLHRDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDEAN  710

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYMAPEYAM GLFS KSDV+S GV+LLEIVSGRRN+      +S ++ Y W 
Sbjct  711   TRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNS------NSTLLAYVWS  764

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W+EG+   L+DP IF     +E+ +C+ +GLLCVQ+ A  RP++S V   L ++ V +P
Sbjct  765   IWNEGEISGLVDPEIFDQLYEKEIRKCVHIGLLCVQESANDRPSVSTVCSMLSSEIVDIP  824

Query  252   VPRPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
              P+ P + +  R  V + +S   ++   S N +T++ + GR
Sbjct  825   EPKQPAFIS--RNGVPEAESSENSDPHASINDVTITDVTGR  863



>ref|XP_009118190.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X1 [Brassica rapa]
Length=834

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/836 (44%), Positives = 525/836 (63%), Gaps = 44/836 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANR  2416
             + D+I     IKD  + ++S +  F  GFF+P  ++   RYVGIWY+++  Q+VVWVAN+
Sbjct  26    SEDRITLSTPIKD-SDTLLSRSGVFRFGFFTPVNSTGHLRYVGIWYDKVPVQTVVWVANK  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             + PI D +G   I+ +G  VV DG+N  +W+TN +VT S     ++      +   D   
Sbjct  85    DTPINDTSGVISISDDGNLVVTDGRNRLLWSTNVTVTVSPNATWVQLMDNGNLRLQDNRN  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGID----PRA  2074
                T+W+SF  P ++FLP M +  +   GE+   TSW +  +PS G ++ G+     P+ 
Sbjct  145   NGETLWESFKHPYNSFLPRMTLGTNTKTGENLKLTSWRSYVDPSTGNYTAGLASFTFPKL  204

Query  2073  S-PQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDL  1903
               P+++IW+     WRSG W+G+VF+G+P     ++  GF+LI +N   +    ++ S +
Sbjct  205   MFPELLIWKNNVPIWRSGPWNGQVFIGLPDVDSLLFLDGFNLINDNQGTFSMSFANDSFM  264

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
               F +D +G   Q+ W  S + W      P+  C  +  CG +  C+  S    NC C+ 
Sbjct  265   YHFNLDPDGAIYQRDW--STRGWRIGVRFPSTDCDAFGRCGPYGICN--SREDPNCKCVK  320

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
             GF P +  +WNARNWT GC RR  LQC  +N  G   + DGF +++ +K+P   + ++++
Sbjct  321   GFVPRNNTEWNARNWTSGCVRRASLQCNVSNGGG--GKGDGFLKLQKMKVP--INAEQSL  376

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
              + + C K C ++CSC AYA     GI CMLW  ELVDM     GSG  L++R+  SEL 
Sbjct  377   ANVQACPKVCSDNCSCTAYA--YDRGIGCMLWSGELVDMQSF-LGSGIDLYIRVAHSELK  433

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE-----IPRTELPTSGEF  1198
               S K  +++   V+    V  +  +      + R  A ++D        R E  TSG  
Sbjct  434   THS-KLAVMITAPVLGVAFVAAVCVVLACQKLKKRPAAPEKDRSAELLYKRMEELTSGNE  492

Query  1197  SSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQ  1018
             S+  S Q  L          DL  F F  +A +TDSFS  NKLGQGGFG VYKG+LP GQ
Sbjct  493   SA--SNQVKL---------KDLPLFEFKVLATSTDSFSPGNKLGQGGFGPVYKGILPEGQ  541

Query  1017  EIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDS  838
             EIAVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+
Sbjct  542   EIAVKRLSRASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDA  601

Query  837   FVFDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISD  658
             ++FDP K++ L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISD
Sbjct  602   YLFDPMKQNILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISD  661

Query  657   FGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS  478
             FG+AR+F  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SG++N S
Sbjct  662   FGLARVFRANEDEANTTRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGKKN-S  720

Query  477   FRTDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNM  298
              + D++  ++ YAW+ W++GK  +L DP++F  C  +E  +C+Q+GLLCVQ++A  RPN+
Sbjct  721   HKDDNNLNLLAYAWKLWNDGKANSLADPTVFDECFEKEFTKCVQIGLLCVQEVASDRPNV  780

Query  297   SAVVLFLETDNVTLPVPRPPTYTASMRRSVDV-DSWNQNNELPSSNSITMSVIVGR  133
             S ++  L T+N  LP P+ P + A  RR   + +S +Q+++  S N ++++ + GR
Sbjct  781   STMIWMLTTENTDLPEPKQPAFIA--RRGFSIAESSDQSSQKVSINDVSLTAVTGR  834



>emb|CDY19356.1| BnaC05g08650D [Brassica napus]
Length=884

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/826 (43%), Positives = 503/826 (61%), Gaps = 26/826 (3%)
 Frame = -3

Query  2583  DKIQQGQWIKD-DGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRE  2413
             D++     IKD + + ++     F  GFF+P  +++R  YVGIWY++I  Q+VVWVANR+
Sbjct  76    DRLTFSTPIKDSESKTLLCKKGIFRFGFFTPANSTSRLRYVGIWYDKIPVQTVVWVANRD  135

Query  2412  RPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              PI D +G   I+ +G  VV DG+N SIW+TN +V  +     ++      +   D    
Sbjct  136   APINDTSGVVSISDDGNLVVTDGRNRSIWSTNVTVPVAPNATWVQLMENGNLRLQDNRNN  195

Query  2232  NNTIWQSFHQPTDTFLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
                IW+SF  P  + LP M   ++   GE+   TSW +  +PS G +++ +     P+++
Sbjct  196   GEIIWESFKHPYSSVLPRMSLLINSKTGENIGLTSWRSYTDPSTGNYTVTLVAFPFPELL  255

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDF--VYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             I +     WRSG W+G+VF+G+P       + GF+L  +N        ++ S +  F +D
Sbjct  256   IRKNSATQWRSGPWNGQVFIGLPDMDSLLNIDGFNLNNDNQGTVSLSYANDSFMYHFNLD  315

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
              NG   Q+ W+ S   W      P+  C  Y+ CG +  C+        C CI GF P +
Sbjct  316   PNGAIYQRDWSTSMNDWRVGVRFPSTDCDEYSRCGPYGSCNYREDP--QCKCIQGFVPRN  373

Query  1704  WNQWNARNWTGGCTRRTPLQCQ--KNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPe  1531
               +W+  NW  GC RR PL+C+  KN T  GG E D F +V+ +K+P   ++  ++ + +
Sbjct  374   STEWSVGNWISGCVRRAPLRCERVKNGTSNGGKE-DWFLKVQKMKVP--VNVQPSLANAQ  430

Query  1530  dckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSS  1351
              C K C ++CSC AYA     GI CMLW + LVDM     GSG  L++RL  SEL   S 
Sbjct  431   ACPKVCLDNCSCTAYA--YDQGIGCMLWSDSLVDMQSF-LGSGIDLYIRLSHSELKAHSK  487

Query  1350  KTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCD  1171
             +  +I A+ +              +C   A ++ KKR   P+ +                
Sbjct  488   RAIMITALVLGVVFVSA-------VCVLLACLKLKKRPGEPKKDRSVEQLLKRMEEVNSG  540

Query  1170  LTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSR  991
             +          +L  F F  +A ATD FSL +KLGQGGFG VYKG LP GQEIAVKRLSR
Sbjct  541   VEPASNQVKLEELPLFEFQVLATATDDFSLRSKLGQGGFGPVYKGKLPEGQEIAVKRLSR  600

Query  990   RSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRS  811
              SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++FDP K+ 
Sbjct  601   ASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLFDPLKQK  660

Query  810   ELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGG  631
              L+W+ RF+I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  +NPKISDFG+AR+F  
Sbjct  661   ILDWKTRFNIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDDNLNPKISDFGLARVFRA  720

Query  630   NQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGI  451
             N++EANT RVVGTYGYM+PEYAMEGLFS KSDV+S GV+LLEI+SGRRN S + ++H  +
Sbjct  721   NEDEANTRRVVGTYGYMSPEYAMEGLFSEKSDVFSLGVILLEIISGRRN-SHKEENHPNL  779

Query  450   IEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLET  271
             + Y W  W+EG+  +L DP++F     +E+  C+Q+GLLCVQ++A  RPN+S V+  L T
Sbjct  780   LSYVWTLWNEGEAASLADPNVFDESFVKEIANCVQIGLLCVQEVADDRPNVSTVIWMLTT  839

Query  270   DNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             +N+ LP P+ P +     +S + +S NQ+++  S N ++++ + GR
Sbjct  840   ENMNLPEPKQPAFITRREKS-EGESSNQSSQKVSINDVSLTSVTGR  884



>ref|XP_009110726.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Brassica rapa]
Length=821

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/821 (43%), Positives = 497/821 (61%), Gaps = 50/821 (6%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D + IVS+   F  GFF+P  +++RY GIWYN I  Q+V+WVAN+++PI D +G   ++ 
Sbjct  36    DSDTIVSSLGTFRFGFFTPVNSTSRYAGIWYNNIPIQTVIWVANKDKPINDSSGVISLSE  95

Query  2370  NGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
             +G  V+ DG+       N  +   +++    L +T  L+ LK D      T+W+SF  PT
Sbjct  96    DGNLVLTDGQRRVLWSTNVTTQSRANSTVAELLDTGNLV-LKDDN--SETTLWESFRHPT  152

Query  2196  DTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW---EGEKRY  2035
             D++LP M V  +A   GE+   TSW +  +PSPG ++  +   A P++ I    +     
Sbjct  153   DSWLPNMVVGTNARASGENITITSWKSPSDPSPGSYTAALVLAAYPELFIMNKDDNNATV  212

Query  2034  WRSGHWDGRVFLGVP-MRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
             WRSG W+G++F G+P +    ++ F     +D   ++ + Y + S+ L    +D+ G  +
Sbjct  213   WRSGPWNGQMFNGLPDVEPGVIFLFRFTVNDDTNGSVTMSYANDST-LRYLYMDYRGSVI  271

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C +Y  CG F  C+   +   +C CI GF P    +WN 
Sbjct  272   RRDWSEARRNWTVGLQVPASECDIYKRCGPFTTCNPRKNP--SCSCIKGFGPRSLVEWNN  329

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NW+GGCTRRTPLQC++ N  G     DGF  ++ +KLPDFA   R+  S  +C + C  
Sbjct  330   GNWSGGCTRRTPLQCERQNNNGSA---DGFTRLRRMKLPDFAI--RSEASEPECLRTCLR  384

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L  G G  L++RL  SE+     +  II + 
Sbjct  385   TCSCIACAHGL--GYGCMIWNGSLVDSQELPAG-GMDLYIRLAHSEIKTPDRRPVIIASS  441

Query  1326  sv--vaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
                 +  V    ++   L+  RRAR + +  ++I       +G               G 
Sbjct  442   LAGGILVVVACGLMVRQLVMKRRARKKGRDAEQIFNRVEALAG---------------GD  486

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
                  +L  F F  +AAAT++FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG+
Sbjct  487   KAKLKELPLFEFQVLAAATNNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQGL  546

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCI GDE+ML+YE+MP KSLD ++F+P K   L W  
Sbjct  547   EELVNEVVVISKLQHRNLVKLLGCCIAGDERMLVYEFMPKKSLDYYLFNPVKAKLLAWET  606

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+II  I RGLLYLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN++EAN
Sbjct  607   RFNIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLVPKISDFGLARIFPGNKDEAN  666

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYM+PEYAM GLFS KSDV+S GV+LLEIVSGRRN+      +S ++ YAW 
Sbjct  667   TRRVVGTYGYMSPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNS------NSTLLAYAWS  720

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W+EG+   L+DP IF     +E+ +C+ + LLCVQ+ A  RP+++ +   L ++ V +P
Sbjct  721   IWNEGEITELVDPVIFEQVFEKEIKKCVHIALLCVQEAANDRPSVATMCSMLSSEIVDIP  780

Query  252   VPRPPTY-TASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              P+ P + T ++  S +  S   +    S N++T++ + GR
Sbjct  781   EPKQPAFITRNVVASEEAGSSENSEPKASINNVTITDVSGR  821



>ref|XP_009118189.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Brassica rapa]
Length=836

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/824 (44%), Positives = 504/824 (61%), Gaps = 51/824 (6%)
 Frame = -3

Query  2544  ENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             E ++S N  F  GFF+P  ++   RYVGIWY ++  Q+VVWVAN++ PI +  G   I+G
Sbjct  44    ETLLSNNGIFRFGFFTPVNSTGHLRYVGIWYAKVPVQTVVWVANKDTPINNTYGVISISG  103

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatm--VLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
              G  VV DG+N  +W+TN + + S       L +   L++         + +W+SF    
Sbjct  104   KGNLVVKDGQNRHVWSTNVTASVSPNATWVQLMDNGNLVLQDN-----RDILWESFKHNY  158

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             +T LP M +  +L  GE+   TSW +  +PS G +++ + P   P+++        WRSG
Sbjct  159   NTLLPRMNLMTNLKTGENLGLTSWKSYVDPSTGNYTVSLVPFPFPELLTKYNNVTKWRSG  218

Query  2022  HWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKV--DWNGKEVQQRWNE  1849
              W+G+VF+G+P     +    L   NDN  +   + ++D  M+ +  D NG   Q+ W  
Sbjct  219   PWNGQVFIGLPDMDTLLNIDGLNLNNDNQGMVSLTYANDSFMYHITLDPNGAIYQRDWRP  278

Query  1848  SRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGG  1669
             S   W      P+  C  Y+ CG +  C+        C C+ GF P +  +W A NW  G
Sbjct  279   SMNDWRVGVRFPSTDCDSYSRCGPYGSCNPGEDP--QCKCVKGFVPRNNTEWTAGNWMNG  336

Query  1668  CTRRTPLQCQK--NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSC  1495
             C RR PL+CQ+  N +  GG ++DGF +++ +K+P   +++ +  + E C K C ++CSC
Sbjct  337   CVRRAPLRCQRLGNRSGNGGGKRDGFLKLEKMKVP--VNVEPSQANKEACPKVCLDNCSC  394

Query  1494  NAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvva  1315
              AYA     GI CMLW  ELVDM     GSG  L++RL  SEL   S +  I++   V+ 
Sbjct  395   TAYA--YDQGIGCMLWSGELVDMQSF-LGSGIDLYIRLAHSELKTHSERVLIMITAPVLG  451

Query  1314  avavlvivsIWLLCSRRARIRAKKRDE----------IPRTELPTSGEFSSDFSAQCDLT  1165
                         +C   A  + KKR E          + R E  TSG   +  S Q +L 
Sbjct  452   VAFAAT------VCILIACWKFKKRPEPQENRSAEILLQRMEALTSGNEPT--SNQANL-  502

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
                      +L  F F  +A ATD+FSL NKLGQGGFG VYKGVL  GQEIAVKRLSR S
Sbjct  503   --------KELPLFEFQVLATATDNFSLGNKLGQGGFGPVYKGVLSEGQEIAVKRLSRAS  554

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
             GQG+ E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++FDP K+  L
Sbjct  555   GQGLDELLNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLFDPLKQKIL  614

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WR RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+AR+F  N+
Sbjct  615   DWRTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFGLARVFQVNE  674

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIE  445
             +EANT RVVGTYGYM+PEYAMEGL+S KSDV+S GV+ L+I+SGRRN S + D+   ++ 
Sbjct  675   DEANTIRVVGTYGYMSPEYAMEGLYSEKSDVFSLGVIFLQIISGRRN-SHKEDNDLNLLA  733

Query  444   YAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDN  265
             YAW+ W+EG+  +L DP +F  C  +E+ +C+Q+GLLCVQ++A  RPN+S V+  L T+N
Sbjct  734   YAWKLWNEGEAASLADPIVFDECFEKEITKCVQIGLLCVQEVANDRPNVSTVIWMLTTEN  793

Query  264   VTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             + LP P+ P + A+   S + +S  Q+ +  S N ++++ I GR
Sbjct  794   MKLPKPKQPAFIATSGVS-EAESSGQSRQNVSINDVSLTAITGR  836



>ref|XP_009118191.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 isoform X2 [Brassica rapa]
Length=833

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/834 (44%), Positives = 522/834 (63%), Gaps = 41/834 (5%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANR  2416
             + D+I     IKD  + ++S +  F  GFF+P  ++   RYVGIWY+++  Q+VVWVAN+
Sbjct  26    SEDRITLSTPIKD-SDTLLSRSGVFRFGFFTPVNSTGHLRYVGIWYDKVPVQTVVWVANK  84

Query  2415  ERPILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR  2236
             + PI D +G   I+ +G  VV DG+N  +W+TN +VT S     ++      +   D   
Sbjct  85    DTPINDTSGVISISDDGNLVVTDGRNRLLWSTNVTVTVSPNATWVQLMDNGNLRLQDNRN  144

Query  2235  PNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGID----PRA  2074
                T+W+SF  P ++FLP M +  +   GE+   TSW +  +PS G ++ G+     P+ 
Sbjct  145   NGETLWESFKHPYNSFLPRMTLGTNTKTGENLKLTSWRSYVDPSTGNYTAGLASFTFPKL  204

Query  2073  S-PQIVIWEGEKRYWRSGHWDGRVFLGVPMRTDFVY--GFDLITENDNLYLEYKSSSSDL  1903
               P+++IW+     WRSG W+G+VF+G+P     ++  GF+LI +N   +    ++ S +
Sbjct  205   MFPELLIWKNNVPIWRSGPWNGQVFIGLPDVDSLLFLDGFNLINDNQGTFSMSFANDSFM  264

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
               F +D +G   Q+ W  S + W      P+  C  +  CG +  C+  S    NC C+ 
Sbjct  265   YHFNLDPDGAIYQRDW--STRGWRIGVRFPSTDCDAFGRCGPYGICN--SREDPNCKCVK  320

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNM  1543
             GF P +  +WNARNWT GC RR  LQC  +N  G   + DGF +++ +K+P   + ++++
Sbjct  321   GFVPRNNTEWNARNWTSGCVRRASLQCNVSNGGG--GKGDGFLKLQKMKVP--INAEQSL  376

Query  1542  RSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELD  1363
              + + C K C ++CSC AYA     GI CMLW  ELVDM     GSG  L++R+  SEL 
Sbjct  377   ANVQACPKVCSDNCSCTAYA--YDRGIGCMLWSGELVDMQSF-LGSGIDLYIRVAHSELK  433

Query  1362  NKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDE---IPRTELPTSGEFSS  1192
               S    +I A  +  A    V V +     ++     K R       R E  TSG  S+
Sbjct  434   THSKLAVMITAPVLGVAFVAAVCVVLACQKLKKRPAPEKDRSAELLYKRMEELTSGNESA  493

Query  1191  DFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEI  1012
               S Q  L          DL  F F  +A +TDSFS  NKLGQGGFG VYKG+LP GQEI
Sbjct  494   --SNQVKL---------KDLPLFEFKVLATSTDSFSPGNKLGQGGFGPVYKGILPEGQEI  542

Query  1011  AVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFV  832
             AVKRLSR SGQG++E  NE+ VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++
Sbjct  543   AVKRLSRASGQGLEELMNEVVVISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYL  602

Query  831   FDPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFG  652
             FDP K++ L+W+ RF+I+E I RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG
Sbjct  603   FDPMKQNILDWKTRFNIMEGICRGLLYLHRDSRLKIIHRDLKASNILLDENLNPKISDFG  662

Query  651   MARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFR  472
             +AR+F  N++EANT RVVGTYGYM+PEYAMEG FS KSDV+S GV+ LEI+SG++N S +
Sbjct  663   LARVFRANEDEANTTRVVGTYGYMSPEYAMEGFFSEKSDVFSLGVIFLEIISGKKN-SHK  721

Query  471   TDDHSGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              D++  ++ YAW+ W++GK  +L DP++F  C  +E  +C+Q+GLLCVQ++A  RPN+S 
Sbjct  722   DDNNLNLLAYAWKLWNDGKANSLADPTVFDECFEKEFTKCVQIGLLCVQEVASDRPNVST  781

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDV-DSWNQNNELPSSNSITMSVIVGR  133
             ++  L T+N  LP P+ P + A  RR   + +S +Q+++  S N ++++ + GR
Sbjct  782   MIWMLTTENTDLPEPKQPAFIA--RRGFSIAESSDQSSQKVSINDVSLTAVTGR  833



>ref|XP_008235408.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Prunus mume]
Length=851

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/834 (43%), Positives = 505/834 (61%), Gaps = 50/834 (6%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPIL---DKN----  2392
             DG+ ++S+ + F LGFFSP  + NRYVG+WYN++  Q++VWVANR  PI+   D N    
Sbjct  40    DGDVLLSSTKIFALGFFSPANSRNRYVGVWYNKVPNQTIVWVANRNNPIIPVTDNNASGV  99

Query  2391  GAFGITGNGTFVVLDGKnvsi----wntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
             G   + GNG  V+  GK+ +      N + S  +++ T  L +T  L++ + D       
Sbjct  100   GLLAVHGNGGLVIY-GKDQNTPLWSANVSVSSPNNSMTAKLWDTGNLVLFEEDNGLSQRV  158

Query  2223  IWQSFHQPTDTFLPGMRVDLSAGESKL---FTSWTNSGNPSPGRFSMGIDPRASPQIVIW  2053
             +WQ F  PT+T LP M++ L    SKL    TSW +  +P  G +S GIDP   PQ  ++
Sbjct  159   LWQGFDHPTNTMLPFMKLGLDR-RSKLNWFLTSWKSQDDPGIGNYSYGIDPSGFPQAFLY  217

Query  2052  EGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWNGK  1873
             +G+   WR+G W G  + GVP  T+F++    +   D L + Y S S  L    +D +G 
Sbjct  218   KGQAPRWRAGSWTGERWSGVPKMTNFIFNASFVNNQDELSIMYMSESI-LSRMVLDESGA  276

Query  1872  EVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQW  1693
              V+  W++  +QWIK    P ++C  Y  CG  + CD S+     C C+ G+ P     W
Sbjct  277   VVRSIWHDQGQQWIKYWSAPKEECDEYGKCGANSNCDPSNMTKFECTCLPGYEPKLPRDW  336

Query  1692  NARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPedckkk  1516
               R+ +GGC R++ +    N         DGF +V  +K+PD +    NM  S + C+++
Sbjct  337   YLRDGSGGCVRKSGVSICGNG--------DGFVKVARVKVPDSSKARVNMNLSWKACQQE  388

Query  1515  ceedCSCNAYAPPVP--GGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTT  1342
             C  +CSC AYA      GG  C+ W  +L+D       +G   +VR+ +  L   +    
Sbjct  389   CLRNCSCKAYANADERWGGFGCVTWHGDLMDTRTFSN-AGQDFYVRVDAIVLAQYAKSNG  447

Query  1341  iivavsvvaavavlviv--------sIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDF  1186
              +     +A   V V+V        S WL+  RR R + K+R     + + T   +  D 
Sbjct  448   SLSKKGKLAISLVSVLVFLLIVVPISYWLV--RRKR-KGKQRPNKYSSRVTTRSTYFEDS  504

Query  1185  SAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAV  1006
             +A+ D     ++   SD+ FF  ++IAAATD+FSLANKLG+GGFG VYKGVL  G+E+AV
Sbjct  505   TAELD-----ESSMHSDIPFFDLTTIAAATDNFSLANKLGKGGFGSVYKGVLCSGKEVAV  559

Query  1005  KRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFD  826
             KRLS+ SGQG++EF NE+ +IAKLQHRNLVR+LG C++ +EKML+YEY+PNKSLDSF+F+
Sbjct  560   KRLSKHSGQGIEEFKNEIVLIAKLQHRNLVRILGYCVQDEEKMLIYEYVPNKSLDSFIFN  619

Query  825   PAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMA  646
               KR+ L+W  RF II  IARG+LYLH+DSRLRIIHRDLKASN+LLD  M+PKISDFGMA
Sbjct  620   DTKRALLDWTVRFGIIYGIARGILYLHQDSRLRIIHRDLKASNVLLDASMDPKISDFGMA  679

Query  645   RIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTD  466
             RIF G+Q+EANT+RVVGTYGYM+PEYAMEG FSVKSDVYSFGV+LLEIV+GR+N+ +  D
Sbjct  680   RIFRGDQSEANTSRVVGTYGYMSPEYAMEGHFSVKSDVYSFGVILLEIVTGRKNSGYYHD  739

Query  465   DH--SGIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              +  + ++ + W  W EGK + ++DPS+       EV+RCIQ+ LLCVQ+ A  RP MSA
Sbjct  740   KYPDANLVGHVWNLWREGKVLEIVDPSLGELYPVNEVVRCIQIALLCVQEYATDRPTMSA  799

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNE-LPSSNSITMSVIVGR  133
             VV  L   +  +P PR P +   ++R+      + N E   S N +T + +  R
Sbjct  800   VVFMLGNYDAAVPSPRQPAFL--LQRTYAARDPSTNTEGAKSMNDVTCTSVQAR  851



>ref|XP_002889861.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66120.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=820

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/819 (43%), Positives = 494/819 (60%), Gaps = 47/819 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  +++RY GIWYN I  Q+V+WVAN+++P  D +G   ++
Sbjct  37    NDSETIVSSFSTFRFGFFSPVNSTSRYAGIWYNSISVQTVIWVANKDKPTNDSSGVISVS  96

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
              +G  VV DG+       N ++   +++    L ++  L++ +      +  +W+SF  P
Sbjct  97    EDGNLVVTDGQRRVLWSTNISTQAHANSTVAELLDSGNLVLKEASS---DAYLWESFKYP  153

Query  2199  TDTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGE---KR  2038
             TD++LP M V  +A   G +   TSW N  +PSPG ++  +   A P++ I         
Sbjct  154   TDSWLPNMLVGTNARTGGGNVTITSWKNPSDPSPGSYTAALVLAAYPELFIMNNNNNNST  213

Query  2037  YWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
              WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F +D+ G  +
Sbjct  214   VWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYMDYRGSVI  272

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C +Y  CG+FA C+   +    C CI GF P +  +WN 
Sbjct  273   RRDWSEARRNWTVGLQVPATECDIYRRCGEFATCNPRKNPP--CSCIRGFRPRNLIEWNN  330

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NW+GGCTRR PLQC++ N  G     DGF  ++ +KLPDFA   R+  S  +C + C +
Sbjct  331   GNWSGGCTRRVPLQCERQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTCLQ  385

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  K  +  +I   
Sbjct  386   TCSCIAAAHGL--GYGCMIWNGSLVDSQELS-ASGLDLYIRLAHSEIKTKDRRPILIGTS  442

Query  1326  svvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAG  1147
                    V   V +      + R + K RD             +     + +    G  G
Sbjct  443   LAGGIFVVAACVLLARQIVMKKRAKKKGRD-------------AEQIFERVEALAGGNKG  489

Query  1146  ASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQE  967
                +L  F F  +A AT++FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG++E
Sbjct  490   KLKELPLFEFQVLAEATNNFSLRNKLGQGGFGPVYKGKLKEGQEIAVKRLSRASGQGLEE  549

Query  966   FTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRF  787
               NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W+ RF
Sbjct  550   LVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDYYLFDSRRAKLLDWKTRF  609

Query  786   HIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTN  607
             +II  I RGLLYLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN+ EANT 
Sbjct  610   NIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEGEANTR  669

Query  606   RVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQW  427
             RVVGTYGYMAPEYAM GLFS KSDV+S GV+LLEI+SGRRN+      +S ++ Y W  W
Sbjct  670   RVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIISGRRNS------NSTLLAYVWSIW  723

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
             +EG+   L+DP IF     +E+ +CI +GLLCVQ+ A  RP++S V   L ++   +P P
Sbjct  724   NEGEINGLVDPEIFDHLFEKEIHKCIHIGLLCVQEAANDRPSVSTVCSMLSSEIADIPEP  783

Query  246   RPPTYTASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
             + P + +  R +V + +S   ++   S N++T++ + GR
Sbjct  784   KQPAFIS--RNNVPEAESAENSDPKDSINNVTITDVTGR  820



>emb|CDX97949.1| BnaA06g07000D [Brassica napus]
Length=862

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/809 (43%), Positives = 498/809 (62%), Gaps = 37/809 (5%)
 Frame = -3

Query  2517  FVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRERPILDKNGAFGITGNGTFVVLDG  2344
             F  GFF+P  +++R  YVGIWY++I  Q+VVWVANR+ PI D +G   I+ +G  VV DG
Sbjct  77    FRFGFFTPANSTSRLRYVGIWYDKIPVQTVVWVANRDAPINDTSGVVSISDDGNLVVTDG  136

Query  2343  KnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDTFLPGMRV--  2170
             +N SIW+TN +V  +     ++      +   D       IW+SF  P  + LP M +  
Sbjct  137   RNRSIWSTNVTVPVAPNATWVQLMENGNLRLQDNRNNGEIIWESFKHPYSSVLPRMSLLT  196

Query  2169  DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHWDGRVFLGVP  1990
             +   GE+   TSW N  +PS G +++G+     P+++IW+ +   WRSG W+G+VF+G+P
Sbjct  197   NSKTGENIGLTSWRNYTDPSTGNYTVGLVAFPFPELLIWKNKVPQWRSGPWNGQVFIGLP  256

Query  1989  MRTDF--VYGFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQRWNESRKQWIKIQEQ  1816
                    + GF+L  +N        ++ S +  F +D NG   Q+ W+ S   W      
Sbjct  257   DMDSLLNIDGFNLNNDNQGTVSLSYANDSFMYHFNLDPNGAIYQRDWSTSMNDWRVGVRF  316

Query  1815  PADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGCTRRTPLQCQK  1636
             P+  C  Y+ CG +  C+        C CI GF P +  +W+  NW  GC RR PL+C++
Sbjct  317   PSTDCDEYSRCGSYGSCNYREDP--QCKCIQGFVPRNSTEWSGGNWINGCVRRAPLRCER  374

Query  1635  -NNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNAYAPPVPGGIS  1459
               N    G ++D F +V+ +K+P   ++  ++ + + C K C ++CSC AYA     GI 
Sbjct  375   VRNGSSNGGKEDWFLKVQKMKVP--VNVQPSLANAQACPKVCLDNCSCTAYA--YDQGIG  430

Query  1458  CMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaavavlvivsIWL  1279
             CMLW   LVDM     GSG  L++RL  SEL   S +  +I A+ +              
Sbjct  431   CMLWSGSLVDMQSF-LGSGIDLYIRLSHSELKAHSKRAVMITALVLGVVFVSA-------  482

Query  1278  LCSRRARIRAKKRDEIPRTELPTSGEF-------SSDFSAQCDLTVEGKAGASSDLVFFS  1120
             +C   A ++ KKR   P+ +              S D  A   + +E       +L  F 
Sbjct  483   VCFLLACLKLKKRPGEPKKDRSVEQLLKRMEEVNSGDEPASNQVKLE-------ELPLFE  535

Query  1119  FSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELTVIA  940
             F  +A ATD FSL +KLGQGGFG VYKG LP GQEIAVKRLSR SGQG++E  NE+ VI+
Sbjct  536   FQVLATATDDFSLRSKLGQGGFGPVYKGKLPEGQEIAVKRLSRASGQGLEELMNEVVVIS  595

Query  939   KLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEIARG  760
             KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++FDP K+  L+W+ R +I+E I RG
Sbjct  596   KLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLFDPLKQKILDWKTRLNIMEGICRG  655

Query  759   LLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTYGYM  580
             LLYLHRDSRLRIIHRDLKASNILLD  MNPKISDFG+AR+F  N++EANT RVVGTYGYM
Sbjct  656   LLYLHRDSRLRIIHRDLKASNILLDDNMNPKISDFGLARVFLANEDEANTRRVVGTYGYM  715

Query  579   APEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPMNLL  400
             +PEYAMEGLFS KSDV+S GV+LLEI+SG++N S + D++  ++ Y W  W+EG+  +L 
Sbjct  716   SPEYAMEGLFSEKSDVFSLGVILLEIISGKKN-SHKEDNYPNLLAYVWTLWNEGEAASLA  774

Query  399   DPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYTASM  220
             DP++F     +E+ +C+Q+GLLCVQ++A  RPN+S V+  L T+N+ LP P  P +    
Sbjct  775   DPNVFDESFEKEITKCVQIGLLCVQEVADDRPNVSTVIWMLTTENMNLPEPNQPAFITRR  834

Query  219   RRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              +S + +S +Q+++  S N ++++ + GR
Sbjct  835   EKS-EGESSDQSSQKVSINDVSLTSVTGR  862



>ref|XP_008446571.1| PREDICTED: uncharacterized protein LOC103489262 [Cucumis melo]
Length=1667

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/833 (43%), Positives = 520/833 (62%), Gaps = 35/833 (4%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
               D I    +IKD G  I+S+N  F LGFF+P  +++RYVGIW+ +I PQ+VVWVANR+ 
Sbjct  856   GGDTITSTNFIKDPG-TIISSNSVFKLGFFTPSNSTHRYVGIWFEKISPQTVVWVANRDT  914

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsi---wntnssvtssnatmVLRNTSELIILKTDGW  2239
             P+ + +G F I+ +G  VVLD  N+ +     ++SS  ++N    + +T  L++  T   
Sbjct  915   PLNNTSGIFTISNDGNLVVLDSANIILWSSNISSSSSAANNTIAQILDTGNLVLKDTSS-  973

Query  2238  RPNNTIWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQ  2065
                  IW+SF  P+D FL  M++  +    E    TSW +  NPS G F+  +D R  P+
Sbjct  974   --GVIIWESFDHPSDKFLIPMKLMTNKRTNEHVGLTSWNSPSNPSTGNFTFLLDVRNIPE  1031

Query  2064  IVIWEGEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSS--SSDLIMF  1894
              V+  G K YWRSG W+G+ F+G+P M + ++ G+ L  +N    L   ++  S  ++  
Sbjct  1032  AVVLNGGKTYWRSGPWNGQSFIGIPEMYSVYLSGYSLSIQNQTYTLSVATNIESQQIVCL  1091

Query  1893  KVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFN  1714
              +   G   Q+ W++ +KQW      P  +C  Y  CG F  C+  +S    C C+ GF 
Sbjct  1092  FISSQGNFEQRNWDDEKKQWNTSWVSPKTECDFYGTCGAFGICNAKTSPV--CSCLTGFK  1149

Query  1713  PSDWNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSP  1534
             P    +WN  NW+ GC R+T L+C+        A++DGF ++  +K+P FA+      S 
Sbjct  1150  PKQEKEWNQGNWSSGCVRKTTLKCENQLNNNTDAKEDGFLKLGMVKVPFFAEWSNAPVSI  1209

Query  1533  edckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKS  1354
             +DC+ KC  +CSC++YA     GI CM W N+L+D+ Q D G G+ L++R+ S++L   S
Sbjct  1210  DDCRLKCLRNCSCSSYA--FENGI-CMHWINDLIDIQQFD-GVGANLYLRIASADLPTNS  1265

Query  1353  SKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELP-----TSGEFSSD  1189
              +    + +++V  V +++ +    LC +R   R +K+  +  +E       T G+    
Sbjct  1266  VRNKKGIIIAIVIPVTLVIFIIAIFLCWKRKINRQEKKLNMTASEKKKILKQTIGD----  1321

Query  1188  FSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIA  1009
                  D+ +E +     +L  + F  +A AT+ F L NKLGQGGFG VYKG L  GQEIA
Sbjct  1322  -----DIMIEDEIKLK-ELPLYDFEKVAIATNYFDLNNKLGQGGFGPVYKGKLLNGQEIA  1375

Query  1008  VKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVF  829
             VKRLSR S QG +EF NE+ VI+KLQHRNLVRLLGCCIEG+EKML+YEYMPN SLD+++F
Sbjct  1376  VKRLSRASKQGYEEFINEVRVISKLQHRNLVRLLGCCIEGEEKMLIYEYMPNLSLDAWIF  1435

Query  828   DPAKRSELNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGM  649
                +   L+WRKRF+II+ IARGLLYLHRDSRL+IIHRDLK SNILLD ++NPKISDFGM
Sbjct  1436  GSPRHKSLDWRKRFNIIDGIARGLLYLHRDSRLKIIHRDLKVSNILLDKDLNPKISDFGM  1495

Query  648   ARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRT  469
             ARIFGG++ +ANT RVVGTYGYM+PEYAM+G FS KSDV+SFGVLLLEI+SGRRNT F  
Sbjct  1496  ARIFGGDEVQANTVRVVGTYGYMSPEYAMQGQFSEKSDVFSFGVLLLEIISGRRNTGFYL  1555

Query  468   DDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSA  292
              + S  ++ +AW+ W E   + L++P+I+  C   E+ RCI +GLLCVQ+    RPN+S 
Sbjct  1556  HESSISLLGFAWKLWTEDNLIPLIEPTIYEPCYQLEISRCIHVGLLCVQEFINERPNVST  1615

Query  291   VVLFLETDNVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
             ++  L ++ V LP P+ P +      + D +S  +N +  S+N++T++ ++ R
Sbjct  1616  IISMLNSEIVDLPSPKEPGFVGRPHET-DTESSQKNLDQCSTNNVTLTAVIAR  1667


 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/823 (43%), Positives = 512/823 (62%), Gaps = 26/823 (3%)
 Frame = -3

Query  2589  AADKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRER  2410
             + D I    +IK     I+S  + F LG+FSP  ++ +YVGIWY++I  Q++VWVAN++ 
Sbjct  25    STDTITSTDFIKHPS-TIISNADSFELGWFSPPNSTAQYVGIWYHQISIQTLVWVANKDT  83

Query  2409  PILDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPN  2230
             P+ + +G F I+ +G  VVLD  N  IW++N +  ++N T  + ++  L++   +     
Sbjct  84    PLNNTSGIFTISNDGNLVVLDEYNTIIWSSNITSPTANTTARILDSGNLVL---EDPVSG  140

Query  2229  NTIWQSFHQPTDTFLPGMRVDLSA-GESKL-FTSWTNSGNPSPGRFSMGIDPRASPQIVI  2056
               IW+SF  P++  LP M++  +   + KL +TSW    +PS G FS+ +D    P+ V+
Sbjct  141   VFIWESFQHPSNLLLPSMKLITNKRTQQKLQYTSWKTPSDPSKGNFSLALDVINIPEAVV  200

Query  2055  WE--GEKRYWRSGHWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVD  1885
             W   G   YWRSG W+G+ F+G P M + +  GF L+ E+         +S+ L    + 
Sbjct  201   WNNNGGSPYWRSGPWNGQSFIGFPNMISVYHIGFSLMIEDQTYSFSIFYNSNLLYNMVLS  260

Query  1884  WNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
               G   QQ WNES+  W         +C  Y  CG F  C+  ++    C C+ GF P  
Sbjct  261   PEGILEQQFWNESKGNWEVSWSAFRTECDYYGVCGAFGVCNAEATPV--CSCLTGFKPKV  318

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedc  1525
              ++W   NW+ GC R TPLQC+ +      AE+DGF +++ +K+P   +   +  S  DC
Sbjct  319   EDEWKRGNWSNGCVRITPLQCESSARNNSRAEEDGFLKLEMVKVPFLVEWSNSSTSGSDC  378

Query  1524  kkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKT  1345
             K++C E+CSC+AYA     GI CMLW+ EL+D+ +  E  G+ L++RL +++L   +   
Sbjct  379   KQECFENCSCSAYA--YENGIGCMLWKKELIDVQKF-ESLGANLYLRLANADLLKINDVK  435

Query  1344  TiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLT  1165
                  + +   +  ++++ I L      R +A K +E  R          +    + D  
Sbjct  436   RKSKGMVIAIVLPTILVIFIILAIYFWWRWKAYK-NEYSRK--------GNRLKLRTDDM  486

Query  1164  VEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRS  985
             + G      +L  + F  +A ATDSF+L+ KLGQGGFG VYKG L  GQEIA+KRLSR S
Sbjct  487   I-GDKSEFKELPLYDFEKLAIATDSFALSKKLGQGGFGPVYKGTLLDGQEIAIKRLSRAS  545

Query  984   GQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSEL  805
              QG +EF NE+ VI+KLQHRNLV+LLGCCIEG+EKML+YEYMPN SLD+F+F  AK+  L
Sbjct  546   NQGYEEFINEVIVISKLQHRNLVQLLGCCIEGEEKMLIYEYMPNSSLDAFIFGSAKQKLL  605

Query  804   NWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQ  625
             +WRKRF+II  IARGLLYLHRDSRLRIIHRDLKASNILLD +MNPKISDFGMARIFGGN+
Sbjct  606   DWRKRFNIINGIARGLLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFGGNE  665

Query  624   NEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSF-RTDDHSGII  448
              EANT RVVGTYGYM+PEYAM+G FS KSDV+SFGVLLLEI+SG++NT F   +D   ++
Sbjct  666   VEANTIRVVGTYGYMSPEYAMQGQFSEKSDVFSFGVLLLEIISGKKNTGFNHHEDALSLL  725

Query  447   EYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETD  268
             E+AW+ W E   + L+DP+I+      E+LRCIQ+GLLCV++    RPN+  ++  L ++
Sbjct  726   EFAWKLWIEDNLIALIDPTIYELSYHLEILRCIQVGLLCVEESINDRPNIVTILSMLNSE  785

Query  267   NVTLPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIV  139
              V LP+P+ P++ A   +     S    N+  S+NS+T++ ++
Sbjct  786   IVDLPLPKQPSFIARPTQRDSRISQQCVNKY-STNSLTVTSVI  827



>ref|XP_006409430.1| hypothetical protein EUTSA_v10022559mg [Eutrema salsugineum]
 gb|ESQ50883.1| hypothetical protein EUTSA_v10022559mg [Eutrema salsugineum]
Length=825

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/820 (44%), Positives = 508/820 (62%), Gaps = 48/820 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNR--YVGIWYNEIIPQSVVWVANRERPILDKNGAFG  2380
             +D E ++  +  F  GFF+PE ++ R  YVGIWY++I  Q+VVWVAN++ PI D +G   
Sbjct  41    NDSETLLCQSGVFRFGFFTPENSTTRLRYVGIWYDKIPIQTVVWVANKDTPINDTSGIIS  100

Query  2379  ITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQP  2200
             I+ +G  VV DG+N  +W+TN  +  +     ++  +   +   D       +W+SF  P
Sbjct  101   ISNDGNLVVNDGRNRLLWSTNVKIPVAPNVTWVQLMNSGNLRLQDKSNNGEILWESFKHP  160

Query  2199  TDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRS  2026
              ++ LP M +  D   GE+   TSW +  +PSPG ++ G+     P++++W+     WRS
Sbjct  161   YNSLLPRMELGTDARTGENLRLTSWKSYQDPSPGNYTAGLADFTFPELLVWKNNVPIWRS  220

Query  2025  GHWDGRVFLGVPMRTD---FVYGFDLITEND-NLYLEYKSSSSDLIMFKVDWNGKEVQQR  1858
             G W+G+VF+G+P  TD   F+ GF+L ++N   L L Y +  S +  F +D +G   Q+ 
Sbjct  221   GPWNGQVFIGLP-NTDSLLFLDGFNLNSDNQGTLSLSY-TIDSFMYHFNLDPDGALYQRD  278

Query  1857  WNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNW  1678
             W+ S + W      P+  C  Y  CG FA C  SS     C C+ GF P +  +WN  NW
Sbjct  279   WSASMRGWRIGVSIPSTTCDAYGRCGPFAIC--SSREVPPCKCVKGFVPKNNIEWNGGNW  336

Query  1677  TGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCS  1498
             +  C RR PLQC++ +    G ++DGF +++ +K+P  A+  +++ +  +C K C ++CS
Sbjct  337   SNDCVRRAPLQCERQSNASDGGKEDGFLKLQKMKVPISAE--QSLANENNCPKVCLDNCS  394

Query  1497  CNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvv  1318
             C AYA     GI CM+W   LVDM Q D  +G  L++R+  SELD   ++T II A  + 
Sbjct  395   CTAYA--YERGIGCMIWSGSLVDM-QSDLSNGIDLYIRVAHSELDTHRNRTIIIAASVLG  451

Query  1317  aavavlvivsIWLLCSRRARIRAKKRDE-----IPRTELPTSGEFSSDFSAQCDLTVEGK  1153
              A   +V V   L C +  +  A K+D        + E  TSG  S+   A+        
Sbjct  452   VAFIAVVCVL--LACRKLRKHPAPKKDRTAELLFKKMEALTSGNESASNQAK--------  501

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
                  +L  F F  +A +TD+FSL NKLGQGGFG VYKG LP GQEIAVKRLSR SGQG+
Sbjct  502   ---FKELPLFQFQVLATSTDNFSLRNKLGQGGFGPVYKGKLPEGQEIAVKRLSRASGQGL  558

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCIE +E++L+YEYMP KSLD+++FDP K+  LNWR 
Sbjct  559   EELVNEVVVISKLQHRNLVKLLGCCIEDEERLLVYEYMPKKSLDAYLFDPLKQKILNWRT  618

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+I+E I RGLLYLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN++EAN
Sbjct  619   RFNIMEGICRGLLYLHRDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDEAN  678

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYM+PEYAM GLFS KSDV+S GV+LLEIVSGR+N+      +S ++ +AW 
Sbjct  679   TRRVVGTYGYMSPEYAMGGLFSEKSDVFSLGVILLEIVSGRKNS------NSTLLAHAWS  732

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W+EG+   L+DP IF     +E+ +C+ +GLLCVQ+ A  RP+++ V   L +    +P
Sbjct  733   VWNEGEINGLIDPVIFDQVFEKEIRKCVHIGLLCVQEAANDRPSVATVCSMLSSKIADIP  792

Query  252   VPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              P+ P +       +  +  N N+   S N +T++ ++GR
Sbjct  793   EPKQPAF-------ISTNDVNNNDLKASINIVTITDVIGR  825



>emb|CDY20990.1| BnaA08g25350D [Brassica napus]
Length=823

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/821 (43%), Positives = 494/821 (60%), Gaps = 50/821 (6%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E IVS+   F  GFFSP  +++RY GIWYN I  Q+V+WVAN+++PI D +G   ++ 
Sbjct  38    DSETIVSSLRTFRFGFFSPVNSTSRYAGIWYNNIPIQTVIWVANKDKPINDSSGVISLSE  97

Query  2370  NGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
             +G  V+ DG+       N  +   +++    L +T  L+ LK D      T+W+SF  PT
Sbjct  98    DGNLVLADGQRRVLWSTNVTTQARANSTVAELLDTGNLV-LKDDN--SETTLWESFRHPT  154

Query  2196  DTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIW---EGEKRY  2035
             D++LP M V  +A   GE+   TSW +  +PSPG ++  +   A P++ I    +     
Sbjct  155   DSWLPNMVVGTNARASGENITITSWKSPSDPSPGSYTAALVLAAYPELFIMNKDDNNATV  214

Query  2034  WRSGHWDGRVFLGVP-MRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGKEV  1867
             WRSG W+G++F G+P +    ++ F     +D   ++ + Y + S+ L    +D+ G  +
Sbjct  215   WRSGPWNGQMFNGLPDVEPGVIFLFRFTVNDDTNGSVTMSYANDST-LRYLYMDYRGSVI  273

Query  1866  QQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNA  1687
             ++ W+E+R+ W    + PA +C +Y  CG FA C+   +    C C  GF P    +WN 
Sbjct  274   RRDWSEARRNWTVGLQVPASECDIYRRCGPFATCNPRKNPP--CSCFKGFGPRSLVEWNN  331

Query  1686  RNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkcee  1507
              NW+GGCTRRTPLQC++ N  G     DGF  ++ +KLPDFA   R+  S  +C + C  
Sbjct  332   GNWSGGCTRRTPLQCERLNNNGSA---DGFTRLRRMKLPDFAI--RSEASEPECLRTCLR  386

Query  1506  dCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivav  1327
              CSC A A  +  G  CM+W   LVD  +L  G G  L++RL  SE+     +  II + 
Sbjct  387   TCSCIACAHGL--GYGCMIWNGSLVDSQELPAG-GMDLYIRLAHSEIKTPDRRPVIIASS  443

Query  1326  sv--vaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGK  1153
                 +  V    +++  L+  RRAR + +  ++I       +G               G 
Sbjct  444   LAGGILVVVACGLMARRLVMKRRARKKGRDAEQIFNRVEALAG---------------GD  488

Query  1152  AGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGV  973
                  +L  F F  +A AT++FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQG+
Sbjct  489   KAKLKELPLFEFQVLAVATNNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQGL  548

Query  972   QEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRK  793
             +E  NE+ VI+KLQHRNLV+LLGCCI GDE+ML+YE+MP KSLD ++F+P K   L W  
Sbjct  549   EELVNEVVVISKLQHRNLVKLLGCCIAGDERMLVYEFMPKKSLDYYLFNPVKAKLLAWET  608

Query  792   RFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEAN  613
             RF+II  I RGLLYLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN+ EAN
Sbjct  609   RFNIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLVPKISDFGLARIFPGNKGEAN  668

Query  612   TNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWE  433
             T RVVGTYGYM+PEYAM GLFS KSDV+S GV+LLEIVSGRRN+      +S ++ YAW 
Sbjct  669   TRRVVGTYGYMSPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNS------NSTLLAYAWS  722

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W EG+   L+DP IF     +E+ +C+ + LLCVQ+ A  RP+++ +   L ++ V +P
Sbjct  723   IWKEGEITELVDPVIFEQVFEKEIKKCVHIALLCVQEAANDRPSVATMCSMLSSEIVDIP  782

Query  252   VPRPPTY-TASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              P+ P + T ++  S +  S   +    S N++T++ + GR
Sbjct  783   EPKQPAFITRNVVASEEAGSSGNSEPKASINNVTITDVSGR  823



>ref|XP_006304884.1| hypothetical protein CARUB_v10012649mg, partial [Capsella rubella]
 gb|EOA37782.1| hypothetical protein CARUB_v10012649mg, partial [Capsella rubella]
Length=819

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/817 (43%), Positives = 493/817 (60%), Gaps = 52/817 (6%)
 Frame = -3

Query  2553  DDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGIT  2374
             +D E IVS+   F  GFFSP  ++NRY GIWYN I  Q+V+WVAN+++PI D +G   ++
Sbjct  37    NDSETIVSSFRTFRFGFFSPVNSTNRYAGIWYNSISVQTVIWVANKDKPIKDSSGVISVS  96

Query  2373  GNGTFVVLDGKnvs--iwntnssvtssnatmVLRNTSELII--LKTDGWRPNNTIWQSFH  2206
              +G  VV DG+       N ++   +++    L ++  L++    TD +     +W+SF 
Sbjct  97    EDGNLVVTDGQRRVLWSTNVSTQARANSTVAELLDSGNLVLKEANTDAY-----LWESFK  151

Query  2205  QPTDTFLPGMRVDLSA---GESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVI---WEGE  2044
              PTD++LP M V  +A   G +   TSW N  +PSPG ++  +   A P++ I       
Sbjct  152   YPTDSWLPNMLVGTNARSGGGNVTITSWRNPSDPSPGSYTAALILAAYPELFIINNNNNN  211

Query  2043  KRYWRSGHWDGRVFLGVPMRTDFVYGFDLITEND---NLYLEYKSSSSDLIMFKVDWNGK  1873
                WRSG W+G++F G+P     V+ +  I  +D   ++ + Y + S+ L  F +D+ G 
Sbjct  212   STVWRSGPWNGQMFNGLPDVYAGVFLYRFIVNDDTNGSVTMSYANDST-LRYFYMDYRGS  270

Query  1872  EVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQW  1693
              +++ W+E+R+ W    + PA +C +Y  CG+FA C+        C CI GF P +   W
Sbjct  271   VIRRDWSEARRNWTVGLQVPATECDIYRRCGEFATCNPRKKP--PCSCIRGFRPRNLIDW  328

Query  1692  NARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkc  1513
             N  N +GGC RRTPLQC++ N  G     DGF  ++ +KLPDFA   R+  S  +C + C
Sbjct  329   NNGNSSGGCIRRTPLQCERQNNNGSA---DGFLRLRRMKLPDFAR--RSEASEPECLRTC  383

Query  1512  eedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiiv  1333
              + CSC A A  +  G  CM+W   LVD  +L   SG  L++RL  SE+  +  +  +I 
Sbjct  384   LQTCSCIAAAHGL--GYGCMIWNGSLVDSQEL-SASGMDLYIRLAHSEIKTQDRRPILIG  440

Query  1332  avsvvaavavlvivsIWLLCSRR--ARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVE  1159
             A      + V        L +RR   + RAKK+           G  +     + +    
Sbjct  441   ASLAGGILVVAACG----LLARRIVMKKRAKKK-----------GTDAEQIFERVEALAG  485

Query  1158  GKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQ  979
             G  G   +L  F F  +AAATD+FSL NKLGQGGFG VYKG L  GQEIAVKRLSR SGQ
Sbjct  486   GNKGKLKELPLFEFQVLAAATDNFSLRNKLGQGGFGPVYKGKLQEGQEIAVKRLSRASGQ  545

Query  978   GVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNW  799
             G++E  NE+ VI+KLQHRNLV+LLGCCI G+E+ML+YE+MP KSLD ++FD  +   L+W
Sbjct  546   GLEELVNEVVVISKLQHRNLVKLLGCCIAGEERMLVYEFMPKKSLDYYLFDQRRAKLLDW  605

Query  798   RKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNE  619
             + RF+II  I RGL+YLHRDSRLRIIHRDLKASNILLD  + PKISDFG+ARIF GN++E
Sbjct  606   KTRFNIINGICRGLMYLHRDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDE  665

Query  618   ANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYA  439
             ANT RVVGTYGYMAPEYAM GLFS KSDV+S GV+LLEIVSGRRN+      +S ++ Y 
Sbjct  666   ANTRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRNS------NSTLLAYV  719

Query  438   WEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVT  259
             W  W+EG+   L+DP IF     +++ +C+ +GLLCVQ+ A  RP++S V   L ++ V 
Sbjct  720   WSIWNEGEINGLVDPEIFDQLFEKDIHKCVHIGLLCVQEAANDRPSVSTVCSMLSSEIVD  779

Query  258   LPVPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMS  148
             +P P+ P + +         S N +    S N++T+S
Sbjct  780   IPEPKQPAFISRNGVPEAESSENSDPNNASINNVTIS  816



>ref|XP_010317325.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101264400 
[Solanum lycopersicum]
Length=1645

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/831 (45%), Positives = 525/831 (63%), Gaps = 42/831 (5%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             D E +VS +++F+ GFFS E ++NRYVG+ +N + P +VVWVANRERP+ D  G   I+ 
Sbjct  36    DSETLVSNDKRFIFGFFSLENSTNRYVGVMFN-VQPPTVVWVANRERPLQDSRGRVTISD  94

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPTDT  2191
             +G  V+L+ +N SIW++N S    N+T  L +T  LI+  +   R    +W+SF  P+D 
Sbjct  95    DGNLVILNSQNRSIWSSNISPAVRNSTAQLLDTGNLILNDSSNGR---VLWESFRDPSDC  151

Query  2190  FLPGMR--VDLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSGHW  2017
             FL  M+  VD+S   + L  SW +  +PS G FS GI P   PQI IW+  K +WRSG W
Sbjct  152   FLQTMKIGVDVSTNTTNLLKSWISPSDPSVGSFSAGIQPETVPQISIWKNGKPHWRSGPW  211

Query  2016  DGRVFLGVPMRTDF-VYGFDLITEND-NLYLEY-KSSSSDLIMFKVDWNGKEVQQRWNES  1846
             + +VF+GVP  T F + GFDL+ +N   +YL Y  ++  +L+ F ++  G   Q+  + S
Sbjct  212   NKQVFIGVPDMTSFYLNGFDLVNDNKGTVYLTYLYANQVELMYFTLNSTGFLQQKYMDPS  271

Query  1845  RKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGGC  1666
             +  W    E PA +C  Y  CG F  CD +SS    C C+ GF P++  +W   NWT GC
Sbjct  272   KNDWEVTWEFPATECDFYGKCGPFGSCDPTSSP--ICSCLEGFKPTNEEEWRKGNWTRGC  329

Query  1665  TRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPD------FADIDRNMRSPedckkkceed  1504
              R++ L+ ++N++     ++D F +++ +K+PD      F D D        C   C  +
Sbjct  330   NRKSMLESERNSSNLEQGKQDWFLKLQSMKVPDSAIWVPFVDED--------CVNGCLRN  381

Query  1503  CSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavs  1324
              SC AY+     GI CM W   L+D+ +   G G  LF+RL  SE D K  +   ++   
Sbjct  382   TSCIAYS--YYTGIGCMHWEGNLLDVQKFSMG-GVDLFLRLSYSERDQK--REYKVIIAI  436

Query  1323  vvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGA  1144
             +V   ++++ +  ++ C   A+ R  KR  + +  L    E S ++  +  +T +     
Sbjct  437   IVPVGSIILAIFGYISCKYVAKRRGWKR--MSKIFL---SESSPNYYKEDKITEDINQAK  491

Query  1143  SSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEF  964
               +L+ ++F  +A AT++F L++KLGQGGFG VYKG LP GQEIAVKRLS+ SGQG+QEF
Sbjct  492   LEELLVYNFDILANATENFHLSSKLGQGGFGPVYKGKLPDGQEIAVKRLSQSSGQGLQEF  551

Query  963   TNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSE--LNWRKR  790
              NE+ VI+KLQHRNLVRL GCCIE  EKML+YEYMP +SLD+++F   +++E  L+W KR
Sbjct  552   MNEVVVISKLQHRNLVRLFGCCIERGEKMLVYEYMPKRSLDAYLFGSQQQAEEFLDWSKR  611

Query  789   FHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANT  610
               IIE I RGLLYLHRDSRLRIIHRDLKASNILLD  +NPKISDFGMA+IF GNQ++ANT
Sbjct  612   VIIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEYLNPKISDFGMAKIFAGNQDQANT  671

Query  609   NRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHS-GIIEYAWE  433
             +RVVGTYGYMAPEYAMEG FS KSDVYSFGVLLLEI+SGRRNTSF  DD +  ++ +AW+
Sbjct  672   SRVVGTYGYMAPEYAMEGRFSEKSDVYSFGVLLLEIISGRRNTSFHQDDGALSLLAWAWK  731

Query  432   QWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLP  253
              W   K + L+DP I    + +E++RC+Q+GLLCVQ+ A  RPN+S ++  L ++   LP
Sbjct  732   CWIGNKIVELVDPKITELHLGKEIVRCVQVGLLCVQEYAEDRPNVSTILSMLTSEIDNLP  791

Query  252   VPRPPTYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR*YLIL*CTWYI  100
              P+ P +T     S    S +Q     S N++T++++ GR    L C W +
Sbjct  792   SPKQPAFTTRPSFSKKGTSKSQG----SVNNVTVTIMEGRTKAFLHCGWRV  838


 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/808 (44%), Positives = 492/808 (61%), Gaps = 60/808 (7%)
 Frame = -3

Query  2583  DKIQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPI  2404
             D I   ++++D  E +VS N+ F L FF PE ++NRYVGI +N +  QSV+WVANR++P+
Sbjct  849   DSISINEFLQD-SETLVSNNKTFKLVFFCPENSANRYVGIMFN-MKSQSVIWVANRDQPL  906

Query  2403  LDKNGAFGITGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNT  2224
              D +G   I+ +G  V+L+G+  S+W++N S    N+T  L +T  L++      R    
Sbjct  907   QDSSGRVTISEDGNLVILNGQGKSVWSSNISPAVRNSTAQLLDTGNLVLKDNSSER---V  963

Query  2223  IWQSFHQPTDTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWE  2050
             +W+SF   +D++L  M++  D S   + L  SW +  +PS G FS GI     PQI IW+
Sbjct  964   LWESFSDLSDSYLQNMKLGTDKSTNTTNLLKSWRSPVDPSDGSFSAGIQTETIPQIFIWK  1023

Query  2049  GEKRYWRSGHWDGRVFLGVPMRTDFVY-GFDLITENDNL---YLEYKSSSSDLIMFKVDW  1882
                 +WRSG WD +VF+GVP  T F + GF+L+  NDN+   Y  Y     D I++ V  
Sbjct  1024  NGLPHWRSGPWDKQVFIGVPNMTSFYFSGFELV--NDNMGTTYFYYSYYQGDDILYLVLN  1081

Query  1881  NGKEVQQRWNESRK-QWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSD  1705
             +   +QQ++  +RK +W      P+++C  Y  CG F  CD+ SS    C C+ GF P +
Sbjct  1082  STGFLQQKYLYARKNEWEVTWATPSNECDFYRKCGPFGSCDSESSP--ICSCLQGFKPKN  1139

Query  1704  WNQWNARNWTGGCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDF------------A  1561
               +W   NWT GC R+T L+ ++NN+     ++D F +++ +K+PD+            +
Sbjct  1140  QEEWVKGNWTNGCIRKTVLEKERNNSNIEQGKQDWFLKLQSMKVPDYPIWVPSAKEDCES  1199

Query  1560  DIDRNMRSPedckkkceedCSCNAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRL  1381
             D  RN               SC AY+     GI CM W   L+D  +  +G G+ LF+RL
Sbjct  1200  DCFRNF--------------SCIAYS--YYRGIGCMHWEGSLIDSQKFSKG-GADLFIRL  1242

Query  1380  HSSELDNKSSKTTiivavsvvaavavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGE  1201
               +E ++     +     +    + ++      LL   R R R  KR+ + +   P+  +
Sbjct  1243  AYTEQESSHQDHSSNNLHNSHCHLGIISSK---LLAKHRGRKR--KRELLSKKSFPSYYK  1297

Query  1200  FSSDFSAQCDLTVEGKAGASSDLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG  1021
              S    A+ D+          DL  +SF  +A ATD+F L++KLGQGGFG VYKG LP G
Sbjct  1298  LSL---ARDDIN----RVKFEDLPIYSFDMLANATDNFHLSSKLGQGGFGSVYKGKLPEG  1350

Query  1020  QEIAVKRLSRRSGQGVQEFTNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLD  841
             QEIAVKRLS+ SGQG +EF NE+ VI+KLQHRNLVRLLGCCIE  EKML+YEYMP +SLD
Sbjct  1351  QEIAVKRLSQSSGQGQEEFMNEVVVISKLQHRNLVRLLGCCIERGEKMLVYEYMPKRSLD  1410

Query  840   SFVFDPAKRSE--LNWRKRFHIIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPK  667
             +++F      E  L+W KR  IIE I RGLLYLHRDSRLRIIHRDLKASNILLD  +NPK
Sbjct  1411  AYLFGVHIEEEYFLDWSKRVIIIEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEYLNPK  1470

Query  666   ISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRR  487
             ISDFGMARI  GNQ++ANT RVVGTYGYMAPEYAM G FS KSDVYSFGVLLLEI+SGRR
Sbjct  1471  ISDFGMARIIAGNQDQANTIRVVGTYGYMAPEYAMTGRFSEKSDVYSFGVLLLEIISGRR  1530

Query  486   NTSFRTDDHS-GIIEYAWEQWDEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVH  310
             NTSF  +D +  ++ +AW+ W+E K + L+D  I    + +E+ RC+ +GLLCVQ+ A  
Sbjct  1531  NTSFYQEDGALSLLAWAWKLWNENKIVELVDSKIIELQLKKEIHRCVHVGLLCVQEYAED  1590

Query  309   RPNMSAVVLFLETDNVTLPVPRPPTYTA  226
             RPN+S V+  L  +   LP P+ P +T 
Sbjct  1591  RPNVSTVLSMLTREIDDLPSPKQPAFTT  1618



>emb|CDY34650.1| BnaC08g42090D [Brassica napus]
Length=825

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/813 (44%), Positives = 507/813 (62%), Gaps = 35/813 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSN--RYVGIWYNEIIPQSVVWVANRERPILDKNGAFGI  2377
             D E ++S +  F LGF +P  ++   RYVGIWY ++  Q+VVWVAN++ PI D  G   I
Sbjct  41    DSETLLSRSGVFRLGFLTPVNSTVHLRYVGIWYGKVPVQTVVWVANKDTPINDTTGVVSI  100

Query  2376  TGNGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWRPNNTIWQSFHQPT  2197
             + +G  VV  G+N+ +W+TN +V  +     ++      +   D       +W+SF  P 
Sbjct  101   SNDGNLVVTHGRNLLLWSTNLTVPVATNATWVQLMDNGNLRLQDNINNREILWESFEHPY  160

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             ++ LP M +  D  A E+   TSW +  +PSPG ++ G+ P   P+++IW+     WRSG
Sbjct  161   NSLLPRMNLGTDNRARENLKLTSWRSYVDPSPGNYTAGLVPFTFPELLIWKSNVPVWRSG  220

Query  2022  HWDGRVFLGVPMRTDFVYGFDLITENDNLYLEYKSSSSDLIMFK--VDWNGKEVQQRWNE  1849
              W+G+VF+G+P    F+ GF+L   NDN      S ++D  M+   +D NG    + WN 
Sbjct  221   PWNGQVFIGLPDVPLFIDGFNL--NNDNQGTLSMSFANDSFMYHMNLDPNGAMYFRSWNT  278

Query  1848  SRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTGG  1669
             S + W      P+  C VYN CG FA C  S      C CI GF P +  +WN  +W+  
Sbjct  279   STRAWTVDAIIPSTTCDVYNRCGPFASC--SLKEVPLCNCIKGFVPRNNIEWNGGSWSNE  336

Query  1668  CTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMRSPedckkkceedCSCNA  1489
             C RR PLQC+           DGF +++ +K+P  A+ ++++ + ++C K+C ++CSC A
Sbjct  337   CVRRVPLQCKG----------DGFIKMQRMKVP--ANAEQSLANEKNCPKQCIDNCSCTA  384

Query  1488  YAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvvaav  1309
             YA     GI CMLW   LVDM Q    SG  L++R+  SEL   +     I+  + V  V
Sbjct  385   YA--YDRGIGCMLWSGNLVDM-QSSLWSGIDLYIRVAHSELKTHTRSKRAIMITAPVLGV  441

Query  1308  avlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSDLV  1129
             A +  V + L C +  +  A ++D           E +SD  +  +  V+ K     DL 
Sbjct  442   AFVAAVCVILACRKFKKRPAPEKDRSAELLFKKMEELTSDNESASN-QVKLK-----DLP  495

Query  1128  FFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNELT  949
              F F  +A ATDSFS  NKLGQGGFG VYKG LP GQEIAVKRLSR SGQG++E  NE+ 
Sbjct  496   LFEFKVLATATDSFSPGNKLGQGGFGPVYKGKLPEGQEIAVKRLSRASGQGLEELMNEVV  555

Query  948   VIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIEEI  769
             VI+KLQHRNLV+LLGCCIEG+E++L+YEYMP KSLD+++FDP K+  L+WR RF+I+E I
Sbjct  556   VISKLQHRNLVKLLGCCIEGEERLLVYEYMPKKSLDAYLFDPLKQKILDWRTRFNIMEGI  615

Query  768   ARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVGTY  589
              RGLLYLHRDSRL+IIHRDLKASNILLD  +NPKISDFG+AR+F  N++EANT RVVGTY
Sbjct  616   CRGLLYLHRDSRLKIIHRDLKASNILLDDNLNPKISDFGLARVFRANEDEANTRRVVGTY  675

Query  588   GYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSGIIEYAWEQWDEGKPM  409
             GYM+PEYAMEGLFS KSDV+S GVL LEI+SGR+N S + +++  ++ YAW+ W++G+  
Sbjct  676   GYMSPEYAMEGLFSEKSDVFSLGVLFLEIISGRKN-SHKEENNLNLLAYAWKLWNDGEVA  734

Query  408   NLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPPTYT  229
             +L DP +      +E+ +C+ +GLLCVQ++A  RP++S V+  L T+   LP P+ P + 
Sbjct  735   SLADPVVLDESFGKEITKCVHIGLLCVQEIANDRPSVSTVIGMLTTEITNLPEPKQPAFI  794

Query  228   ASMRRSV-DVDSWNQNNELPSSNSITMSVIVGR  133
             A  R  V + +  +Q+++  S N +++S + GR
Sbjct  795   A--RGGVYEAECSDQSSQKVSINDVSLSTVTGR  825



>ref|XP_010928033.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=1213

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/815 (44%), Positives = 512/815 (63%), Gaps = 30/815 (4%)
 Frame = -3

Query  2550  DGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILDKNGAFGITG  2371
             DG+ ++SA   F LGFFSP  ++NRYVGIWY+++   +VVWVANR+ PI +  G+  IT 
Sbjct  420   DGQTLISAGGNFELGFFSPVNSNNRYVGIWYHKVSVPTVVWVANRQHPISEPKGSLSITA  479

Query  2370  NGTFVVLDGKnvsiwntnssvtssnatmVLRNTSELIILKTDGWR--PNNTIWQSFHQPT  2197
             NGT V+ D +N +   ++ S   +N    L ++   I+ +  G    P +  WQSF  PT
Sbjct  480   NGTLVITD-QNSTAVWSSGSSGLTNPVAQLLDSGNFIVKEAKGASNGPGSFAWQSFDYPT  538

Query  2196  DTFLPGMRV--DLSAGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIVIWEGEKRYWRSG  2023
             DT LPGM++  +L++  ++  T+WT++ +P+PG +SM +D    P+I +  G  R WR+G
Sbjct  539   DTLLPGMKLGWNLTSHLNRNLTAWTDASDPAPGYYSMALDVEGDPEIFLLGGAHRLWRTG  598

Query  2022  HWDGRVFLGVP-MRTDFVYGFDLITENDNLYLEYKSSSSDLIMFKVDWNGKEVQQR--WN  1852
              W G+ F G+P M+T  ++ F+ + + D +Y  +      +I  ++  N   V QR  W 
Sbjct  599   PWVGQRFSGIPEMKTYSMFTFNFVMDQDEIYYTFNILDGSVIS-RLIVNQSGVTQRLVWL  657

Query  1851  ESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIVGFNPSDWNQWNARNWTG  1672
             E  + W      P DQC   + CG F  CD  ++N   C C+ GF P     W  R+ + 
Sbjct  658   EQSQAWSIFWFAPKDQCDGVSPCGPFGICD--TNNSPICDCLQGFEPRSPTNWALRDGSD  715

Query  1671  GCTRRTPLQCQKNNTEGGGAEKDGFREVKHIKLPDFADIDRNMR-SPedckkkceedCSC  1495
             GC R+T L C +N T       DGF  V  +KLPD ++   +M  S + C+  C  +CSC
Sbjct  716   GCKRKTALDC-RNGT-------DGFVTVNEVKLPDTSNSTVDMSLSLDQCRAMCLRNCSC  767

Query  1494  NAYAPPVPGGISCMLWRNELVDMMQLDEGSGSTLFVRLHSSELDNKSSKTTiivavsvva  1315
              AYA     G  C++W  E+ D+     G G  L+VRL +++L + S  + +    ++V 
Sbjct  768   TAYASANTSGGGCIIWTAEITDLRVFTFG-GQDLYVRLAAADLGSASKHSHLSRIAAIVV  826

Query  1314  avavlvivsIWLLCSRRARIRAKKRDEIPRTELPTSGEFSSDFSAQCDLTVEGKAGASSD  1135
                +  ++  W+ C    + R ++R +   + L T   F++++        EG  G   D
Sbjct  827   GSVLGTLLLGWIGCCIWNKKRRRRRTKQAMSMLGTI-SFANNY------INEGTEGNELD  879

Query  1134  LVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCGQEIAVKRLSRRSGQGVQEFTNE  955
             L  +   +I AATD+FS+ NKLG+GGFG VYKG L   QEIAVKRL++ S QG+ EF NE
Sbjct  880   LPSYDLGTIVAATDNFSIKNKLGEGGFGPVYKGKLGEEQEIAVKRLAKTSVQGIDEFKNE  939

Query  954   LTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFHIIE  775
             + +IAKLQHRNLV+LLGCCI+G+E+ML+YEYMPNKSLD+F+FD AK + L+W+ R++II 
Sbjct  940   VMLIAKLQHRNLVQLLGCCIQGEERMLIYEYMPNKSLDAFLFDKAKAALLDWQTRYNIIA  999

Query  774   EIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNRVVG  595
              IARGLLYLH+DSRLRIIHRDLKASNILLD EMNPKISDFGMARIFGG++ E NT+RVVG
Sbjct  1000  GIARGLLYLHQDSRLRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDEAEVNTHRVVG  1059

Query  594   TYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTS-FRTDDHSGIIEYAWEQWDEG  418
             TYGYM+PEYAM+G+FSVKSDV+SFGVL+LEI SG++N   + ++ H+ ++ +AW  W EG
Sbjct  1060  TYGYMSPEYAMDGIFSVKSDVFSFGVLVLEITSGKKNRGVYYSNRHTNLLGHAWYLWKEG  1119

Query  417   KPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVPRPP  238
               + L+D SI  S    EVLRCI++ LLCVQ+    RP MS+VVL L +++  LP P+ P
Sbjct  1120  NGLELVDESIGYSFPMAEVLRCIKVALLCVQEHPEDRPTMSSVVLMLGSESACLPYPKQP  1179

Query  237   TYTASMRRSVDVDSWNQNNELPSSNSITMSVIVGR  133
              + A+ +   ++DS +   +  + N ++++V   R
Sbjct  1180  GFVAT-KGPFEIDSSSSKQDSLTVNDLSVTVFEAR  1213


 Score =   370 bits (950),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 185/317 (58%), Positives = 237/317 (75%), Gaps = 11/317 (3%)
 Frame = -3

Query  1137  DLVFFSFSSIAAATDSFSLANKLGQGGFGHVYKGVLPCG--QEIAVKRLSRRSGQGVQEF  964
             +L  F   +I AA ++FS+ NKLG+GGFG       P G  QEIAVKRLS+ S QG  EF
Sbjct  69    ELPLFDLGTIIAAINNFSIENKLGRGGFG-------PLGEEQEIAVKRLSKTSAQGTDEF  121

Query  963   TNELTVIAKLQHRNLVRLLGCCIEGDEKMLLYEYMPNKSLDSFVFDPAKRSELNWRKRFH  784
              NE+T+IAKLQHRNLVRLLGCC +G+E+ML+YEYMPNKSLD+F+FD  +   L+W+ R++
Sbjct  122   MNEVTLIAKLQHRNLVRLLGCCTQGEERMLVYEYMPNKSLDAFLFDKDRGVLLDWQTRYN  181

Query  783   IIEEIARGLLYLHRDSRLRIIHRDLKASNILLDGEMNPKISDFGMARIFGGNQNEANTNR  604
             IIE IA+GLLYLHRDSRLRIIHRDLKASN+LLD +MNPKISDFG+ARIF G++   NT R
Sbjct  182   IIEGIAQGLLYLHRDSRLRIIHRDLKASNVLLDKDMNPKISDFGLARIFRGDEIAINTRR  241

Query  603   VVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVSGRRNTSFRTDDHSG-IIEYAWEQW  427
             VVGTYGYM+PEYAM+G+FSVKSDV+SFGVL+LEI+SG++N      +H G ++ +AW  W
Sbjct  242   VVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISGKKNRGVSVSEHEGNLLAHAWSLW  301

Query  426   DEGKPMNLLDPSIFSSCVPQEVLRCIQLGLLCVQDLAVHRPNMSAVVLFLETDNVTLPVP  247
              EG    L+D SI +S    E + CI++GLLCVQ+    RP MS+VVL L + N +L  P
Sbjct  302   TEGNASELIDKSISNSTSMVEAVNCIKVGLLCVQESPRDRPTMSSVVLMLGSRNASLSDP  361

Query  246   RPPTYTASMRRSVDVDS  196
             + P +   MR   +++S
Sbjct  362   KHPGFF-QMRARSEIES  377



>ref|XP_003593421.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=875

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/829 (44%), Positives = 509/829 (61%), Gaps = 42/829 (5%)
 Frame = -3

Query  2577  IQQGQWIKDDGENIVSANEKFVLGFFSPEGTSNRYVGIWYNEIIPQSVVWVANRERPILD  2398
             I   Q IK   E I S+++ F LGFFSP  T+NRYVGIWY  +   +++WVANRE+PI D
Sbjct  33    ITSSQLIKYS-ETISSSDDAFKLGFFSPVNTTNRYVGIWY--LNQSNIIWVANREKPIQD  89

Query  2397  KNGAFGITGNGTFVVLDGKnvsiw-----ntnssvtssnatmVLRNTSELIILKTDGWRP  2233
              +G   I+ + T +V+  ++  +      ++N + ++SN T  L+NT  LI L+ D    
Sbjct  90    SSGVITISDDNTNLVVLNRHKHVIWSSNVSSNLASSNSNVTAQLQNTGNLI-LQED--TT  146

Query  2232  NNTIWQSFHQPTDTFLPGMRVDLS--AGESKLFTSWTNSGNPSPGRFSMGIDPRASPQIV  2059
              N IW+SF  P+D FLP M +  +   GE   +TSW    +P+ G FS+ ++   SP++ 
Sbjct  147   GNIIWESFKHPSDAFLPNMIISTNQRTGEKVKYTSWKTPLDPAIGNFSLSLERLNSPEVF  206

Query  2058  IWEGEKRYWRSGHWDGRVFLGVPMRTDFVYGFDLIT----ENDNLYLEYKS----SSSDL  1903
             +W   K YWRSG W+G+V +G+P R   +Y  D++T      DN  +   +    +SS  
Sbjct  207   VWNQTKPYWRSGPWNGQVLVGLPSR--LLYASDILTLSIGRKDNGSIVETTYTLLNSSFF  264

Query  1902  IMFKVDWNGKEVQQRWNESRKQWIKIQEQPADQCGVYNHCGQFARCDNSSSNGINCVCIV  1723
              +  V+  GK V   W    +    + ++  ++C +Y  CG    CD   +N   C C+ 
Sbjct  265   AIATVNSEGKLVYTSWMNGHQVGTTVVQE--NECDIYGFCGPNGSCD--LTNSPICTCLK  320

Query  1722  GFNPSDWNQWNARNWTGGCTRRTPLQCQKNNTEGG--GAEKDGFREVKHIKLPDFADIDR  1549
             GF P + ++WN +NW  GC R+  LQC++    G   G + DGF +++  K+PDF  + +
Sbjct  321   GFEPRNVDEWNRQNWISGCARKASLQCERVKYNGSELGGKGDGF