BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22437_g1_i3 len=1860 path=[1985:0-287 1688:288-479 1419:480-567
1984:568-568 1507:569-593 1532:594-687 6117:688-702 116:703-1859]

Length=1860
                                                                      Score     E

ref|XP_006343830.1|  PREDICTED: B2 protein-like                         354   2e-113   
ref|XP_004245501.1|  PREDICTED: B2 protein                              351   5e-112   
ref|XP_009587755.1|  PREDICTED: B2 protein-like                         351   5e-112   
ref|XP_009764746.1|  PREDICTED: B2 protein-like                         347   2e-110   
ref|XP_004244639.1|  PREDICTED: B2 protein-like                         329   1e-103   
ref|XP_006352242.1|  PREDICTED: B2 protein-like                         327   1e-102   
ref|XP_009590115.1|  PREDICTED: B2 protein-like                         322   5e-101   
ref|XP_009803232.1|  PREDICTED: B2 protein-like                         320   2e-100   
ref|XP_011082302.1|  PREDICTED: B2 protein                              317   5e-99    
gb|EPS69727.1|  hypothetical protein M569_05038                         312   3e-97    
ref|XP_010109777.1|  hypothetical protein L484_003137                   301   5e-92    
sp|P37707.1|B2_DAUCA  RecName: Full=B2 protein                          290   3e-90    Daucus carota [carrots]
ref|XP_002518847.1|  n-rich protein, putative                           287   1e-86    Ricinus communis
ref|XP_006439309.1|  hypothetical protein CICLE_v10021060mg             283   6e-86    
ref|XP_008451926.1|  PREDICTED: probable serine/threonine-protein...    284   9e-86    
gb|KDO76587.1|  hypothetical protein CISIN_1g019701mg                   283   9e-86    
gb|KDP25282.1|  hypothetical protein JCGZ_20438                         283   1e-85    
gb|EPS66990.1|  hypothetical protein M569_07785                         282   1e-85    
ref|XP_004148988.1|  PREDICTED: uncharacterized protein LOC101208173    284   1e-85    
gb|KEH21257.1|  DCD (development and cell death) domain protein         281   2e-85    
gb|EYU23311.1|  hypothetical protein MIMGU_mgv1a010649mg                281   2e-85    
ref|XP_010659503.1|  PREDICTED: hybrid signal transduction histid...    283   2e-85    
ref|XP_002266388.1|  PREDICTED: hybrid signal transduction histid...    283   3e-85    Vitis vinifera
ref|XP_006439310.1|  hypothetical protein CICLE_v10021060mg             281   4e-85    
gb|KDO76588.1|  hypothetical protein CISIN_1g019701mg                   281   5e-85    
ref|XP_007040571.1|  DCD domain protein isoform 1                       281   5e-85    
ref|XP_010266556.1|  PREDICTED: B2 protein-like                         280   6e-85    
ref|XP_006476354.1|  PREDICTED: B2 protein-like                         281   7e-85    
gb|KEH21258.1|  DCD (development and cell death) domain protein         278   3e-84    
ref|NP_001242010.1|  uncharacterized protein LOC100796450               278   5e-84    
ref|XP_006584575.1|  PREDICTED: uncharacterized protein LOC100796...    278   6e-84    
ref|XP_007160187.1|  hypothetical protein PHAVU_002G300300g             278   7e-84    
ref|XP_004503595.1|  PREDICTED: B2 protein-like                         278   1e-83    
ref|XP_010667908.1|  PREDICTED: B2 protein                              277   1e-83    
ref|XP_009358635.1|  PREDICTED: putative uncharacterized protein ...    278   1e-83    
ref|XP_010267585.1|  PREDICTED: B2 protein                              277   1e-83    
ref|XP_007209268.1|  hypothetical protein PRUPE_ppa007415mg             278   2e-83    
ref|XP_008239155.1|  PREDICTED: B2 protein                              278   3e-83    
ref|XP_010055887.1|  PREDICTED: B2 protein-like                         275   3e-83    
ref|NP_001239779.1|  uncharacterized protein LOC100808989               275   5e-83    
gb|KHM99883.1|  B2 protein                                              275   5e-83    
ref|XP_010545126.1|  PREDICTED: B2 protein                              276   6e-83    
ref|XP_009341876.1|  PREDICTED: probable serine/threonine-protein...    277   6e-83    
ref|XP_011022478.1|  PREDICTED: probable serine/threonine-protein...    277   8e-83    
ref|XP_002304564.1|  hypothetical protein POPTR_0003s14180g             276   9e-83    Populus trichocarpa [western balsam poplar]
gb|KCW77414.1|  hypothetical protein EUGRSUZ_D01762                     276   1e-82    
ref|XP_007145958.1|  hypothetical protein PHAVU_006G001100g             276   1e-82    
ref|XP_008341772.1|  PREDICTED: LOW QUALITY PROTEIN: B2 protein-like    276   1e-82    
ref|XP_006385800.1|  hypothetical protein POPTR_0003s14180g             276   1e-82    
ref|XP_011026851.1|  PREDICTED: putative uncharacterized protein ...    276   2e-82    
ref|XP_010912158.1|  PREDICTED: B2 protein-like                         274   2e-82    
ref|XP_010924914.1|  PREDICTED: B2 protein-like                         274   2e-82    
ref|XP_010053159.1|  PREDICTED: uncharacterized protein LOC104441671    275   4e-82    
ref|XP_008806498.1|  PREDICTED: B2 protein-like                         273   5e-82    
ref|XP_002297967.2|  hypothetical protein POPTR_0001s10880g             275   6e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010441386.1|  PREDICTED: putative uncharacterized protein ...    274   7e-82    
ref|XP_001752843.1|  predicted protein                                  266   8e-82    
ref|XP_006852609.1|  hypothetical protein AMTR_s00021p00224090          271   8e-82    
ref|XP_009392977.1|  PREDICTED: B2 protein-like                         272   1e-81    
ref|XP_004502070.1|  PREDICTED: B2 protein-like                         272   1e-81    
ref|XP_008437409.1|  PREDICTED: probable serine/threonine-protein...    275   1e-81    
gb|ADE77451.1|  unknown                                                 270   1e-81    
ref|XP_008807233.1|  PREDICTED: B2 protein-like                         271   2e-81    
gb|AFK48098.1|  unknown                                                 271   2e-81    
ref|XP_003542163.1|  PREDICTED: B2 protein-like                         272   2e-81    
gb|KHN23710.1|  B2 protein                                              272   3e-81    
gb|KHN05355.1|  B2 protein                                              272   3e-81    
ref|XP_008437410.1|  PREDICTED: uncharacterized protein LOC103482...    273   3e-81    
dbj|BAB08438.1|  unnamed protein product                                266   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960990.1|  PREDICTED: B2 protein-like                         270   6e-81    
ref|NP_001236375.1|  N-rich protein                                     271   7e-81    
ref|XP_004298923.1|  PREDICTED: uncharacterized protein LOC101295712    271   9e-81    
ref|XP_009784302.1|  PREDICTED: B2 protein                              268   1e-80    
gb|KEH35154.1|  DCD (development and cell death) domain protein         268   1e-80    
ref|XP_010533569.1|  PREDICTED: B2 protein-like                         270   1e-80    
gb|AFA36503.1|  putative GDA2 protein                                   262   2e-80    
ref|XP_004143858.1|  PREDICTED: uncharacterized protein LOC101206530    272   2e-80    
ref|NP_001183616.1|  hypothetical protein                               267   2e-80    
ref|NP_001148917.1|  LOC100282537                                       267   3e-80    Zea mays [maize]
gb|ACU23341.1|  unknown                                                 270   3e-80    Glycine max [soybeans]
emb|CDY27663.1|  BnaUnng00130D                                          266   4e-80    
ref|XP_009597100.1|  PREDICTED: B2 protein                              267   4e-80    
ref|XP_004513311.1|  PREDICTED: B2 protein-like isoform X2              267   4e-80    
emb|CDY68218.1|  BnaCnng58090D                                          266   4e-80    
ref|XP_007161729.1|  hypothetical protein PHAVU_001G093700g             266   5e-80    
ref|XP_009371647.1|  PREDICTED: B2 protein-like                         266   5e-80    
gb|ACL53572.1|  unknown                                                 266   6e-80    Zea mays [maize]
ref|XP_010033420.1|  PREDICTED: B2 protein                              266   6e-80    
ref|XP_002441637.1|  hypothetical protein SORBIDRAFT_09g030740          268   6e-80    Sorghum bicolor [broomcorn]
ref|XP_008341299.1|  PREDICTED: B2 protein                              266   7e-80    
ref|NP_568600.1|  DCD (Development and Cell Death) domain protein       268   7e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDP16694.1|  unnamed protein product                                267   8e-80    
emb|CDY13366.1|  BnaC06g13910D                                          267   8e-80    
dbj|BAJ97532.1|  predicted protein                                      268   8e-80    
ref|XP_006284002.1|  hypothetical protein CARUB_v10005124mg             268   9e-80    
ref|XP_006405279.1|  hypothetical protein EUTSA_v10027832mg             267   1e-79    
ref|XP_006604145.1|  PREDICTED: B2 protein-like                         266   1e-79    
ref|XP_002870594.1|  hypothetical protein ARALYDRAFT_493778             267   1e-79    
ref|XP_010436167.1|  PREDICTED: GATA zinc finger domain-containin...    268   1e-79    
ref|XP_011097287.1|  PREDICTED: B2 protein-like                         266   1e-79    
ref|NP_001239866.1|  uncharacterized protein LOC100775724               265   1e-79    
emb|CDX67527.1|  BnaA07g15670D                                          266   1e-79    
ref|XP_010447060.1|  PREDICTED: asparagine-rich protein-like            267   2e-79    
gb|AFK37025.1|  unknown                                                 266   2e-79    
ref|XP_009125216.1|  PREDICTED: B2 protein                              266   2e-79    
ref|XP_003569184.1|  PREDICTED: B2 protein                              267   2e-79    
ref|XP_009140145.1|  PREDICTED: B2 protein-like                         266   3e-79    
gb|ACU19117.1|  unknown                                                 265   3e-79    Glycine max [soybeans]
gb|EPS70594.1|  hypothetical protein M569_04167                         263   3e-79    
ref|XP_007215754.1|  hypothetical protein PRUPE_ppa009447mg             264   3e-79    
gb|EYU45408.1|  hypothetical protein MIMGU_mgv1a010845mg                264   4e-79    
emb|CAD37200.1|  GDA2 protein                                           261   4e-79    Pisum sativum [garden pea]
ref|XP_006654598.1|  PREDICTED: B2 protein-like                         265   4e-79    
gb|EMT12068.1|  hypothetical protein F775_26567                         266   4e-79    
ref|XP_008365354.1|  PREDICTED: B2 protein-like                         264   5e-79    
ref|XP_009350302.1|  PREDICTED: B2 protein-like                         264   5e-79    
ref|XP_004981020.1|  PREDICTED: B2 protein-like                         265   5e-79    
gb|ACJ84912.1|  unknown                                                 264   5e-79    Medicago truncatula
gb|ACF85858.1|  unknown                                                 265   6e-79    Zea mays [maize]
ref|NP_001150743.1|  gda-1                                              265   6e-79    Zea mays [maize]
ref|XP_011098888.1|  PREDICTED: B2 protein                              264   6e-79    
ref|XP_004303971.1|  PREDICTED: B2 protein-like                         264   6e-79    
ref|XP_010556284.1|  PREDICTED: B2 protein-like                         263   8e-79    
ref|XP_004167610.1|  PREDICTED: LOW QUALITY PROTEIN: B2 protein-like    263   1e-78    
ref|XP_008643677.1|  PREDICTED: LOC100282537 isoform X1                 265   1e-78    
gb|ACN40727.1|  unknown                                                 262   1e-78    Picea sitchensis
gb|ABR18077.1|  unknown                                                 262   1e-78    Picea sitchensis
ref|XP_004145666.1|  PREDICTED: B2 protein-like                         263   1e-78    
ref|XP_004231781.1|  PREDICTED: B2 protein isoform X2                   263   1e-78    
ref|XP_003568175.1|  PREDICTED: B2 protein                              263   1e-78    
ref|XP_004513310.1|  PREDICTED: B2 protein-like isoform X1              263   1e-78    
ref|NP_001043301.1|  Os01g0550300                                       264   1e-78    Oryza sativa Japonica Group [Japonica rice]
gb|KFK32974.1|  hypothetical protein AALP_AA6G313400                    263   2e-78    
ref|NP_001275328.1|  uncharacterized protein LOC102577607               262   2e-78    
ref|XP_001773872.1|  predicted protein                                  258   2e-78    
ref|XP_010112365.1|  hypothetical protein L484_010769                   262   2e-78    
ref|XP_009784806.1|  PREDICTED: B2 protein-like                         262   3e-78    
ref|XP_007031869.1|  DCD domain protein isoform 1                       262   3e-78    
ref|XP_009385975.1|  PREDICTED: B2 protein-like                         262   3e-78    
ref|XP_008450102.1|  PREDICTED: B2 protein                              262   3e-78    
dbj|BAD88058.1|  putative GDA2 protein                                  264   3e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010315914.1|  PREDICTED: B2 protein isoform X1                   263   3e-78    
gb|EEC70863.1|  hypothetical protein OsI_02376                          263   3e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_010248997.1|  PREDICTED: B2 protein-like                         262   3e-78    
ref|XP_009420608.1|  PREDICTED: B2 protein-like                         262   4e-78    
ref|XP_010250724.1|  PREDICTED: B2 protein                              261   5e-78    
gb|AFK39720.1|  unknown                                                 261   5e-78    
ref|XP_010908291.1|  PREDICTED: B2 protein-like                         261   5e-78    
gb|AIZ68175.1|  B2 protein-like protein                                 261   6e-78    
ref|XP_008812426.1|  PREDICTED: B2 protein-like                         261   7e-78    
gb|KGN58174.1|  hypothetical protein Csa_3G585860                       263   7e-78    
ref|XP_002509516.1|  B2 protein, putative                               261   8e-78    Ricinus communis
gb|ACL53056.1|  unknown                                                 259   9e-78    Zea mays [maize]
ref|NP_001055951.1|  Os05g0498700                                       261   9e-78    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90431.1|  predicted protein                                      261   1e-77    
ref|XP_010554108.1|  PREDICTED: B2 protein-like                         260   1e-77    
gb|AFG73687.1|  putative gda-1                                          261   1e-77    
ref|XP_004968944.1|  PREDICTED: B2 protein-like                         262   1e-77    
ref|XP_001752539.1|  predicted protein                                  255   1e-77    
ref|XP_006644279.1|  PREDICTED: B2 protein-like                         262   1e-77    
ref|XP_009620343.1|  PREDICTED: B2 protein-like                         260   1e-77    
ref|XP_002976913.1|  hypothetical protein SELMODRAFT_105781             255   1e-77    
ref|XP_011012345.1|  PREDICTED: B2 protein-like                         260   2e-77    
gb|ABK22365.1|  unknown                                                 259   2e-77    Picea sitchensis
ref|XP_002963637.1|  hypothetical protein SELMODRAFT_26766              254   2e-77    
ref|XP_009394121.1|  PREDICTED: B2 protein-like                         261   3e-77    
ref|XP_002269664.1|  PREDICTED: B2 protein                              259   3e-77    Vitis vinifera
ref|XP_010680131.1|  PREDICTED: B2 protein                              259   4e-77    
ref|XP_006395485.1|  hypothetical protein EUTSA_v10004700mg             259   4e-77    
ref|XP_006447065.1|  hypothetical protein CICLE_v10016061mg             259   4e-77    
ref|XP_008792649.1|  PREDICTED: B2 protein-like                         259   5e-77    
emb|CAA04664.1|  hypothetical protein                                   259   5e-77    Citrus x paradisi [grapefruit]
ref|NP_189345.1|  DCD (Development and Cell Death) domain protein       258   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550203.1|  PREDICTED: B2 protein-like                         258   6e-77    
gb|KDP46281.1|  hypothetical protein JCGZ_10121                         258   6e-77    
gb|AAM64572.1|  gda-1, putative                                         258   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502669.1|  PREDICTED: B2 protein-like                         258   8e-77    
ref|XP_010514392.1|  PREDICTED: B2 protein-like                         258   8e-77    
emb|CDY52398.1|  BnaC07g48970D                                          258   9e-77    
ref|XP_002875357.1|  hypothetical protein ARALYDRAFT_484493             258   9e-77    
ref|XP_009783276.1|  PREDICTED: B2 protein-like                         258   9e-77    
ref|XP_006357194.1|  PREDICTED: B2 protein-like                         258   1e-76    
ref|NP_001130162.1|  uncharacterized LOC100191256                       260   1e-76    Zea mays [maize]
emb|CDY20062.1|  BnaA09g01890D                                          256   1e-76    
ref|XP_009111555.1|  PREDICTED: B2 protein-like                         256   1e-76    
ref|NP_001183805.1|  uncharacterized protein LOC100502398               259   1e-76    
ref|XP_006373229.1|  hypothetical protein POPTR_0017s09910g             258   1e-76    
ref|XP_006291586.1|  hypothetical protein CARUB_v10017741mg             258   1e-76    
ref|XP_010425448.1|  PREDICTED: B2 protein-like                         258   2e-76    
ref|XP_009601168.1|  PREDICTED: B2 protein-like                         257   2e-76    
ref|NP_001150270.1|  N-rich protein                                     259   2e-76    Zea mays [maize]
ref|XP_009151992.1|  PREDICTED: B2 protein                              257   2e-76    
ref|XP_004233294.1|  PREDICTED: B2 protein-like                         257   2e-76    
gb|KDO63935.1|  hypothetical protein CISIN_1g021938mg                   257   2e-76    
ref|XP_009129450.1|  PREDICTED: B2 protein-like                         255   3e-76    
ref|XP_002455781.1|  hypothetical protein SORBIDRAFT_03g025160          258   4e-76    Sorghum bicolor [broomcorn]
emb|CDY28495.1|  BnaC02g36650D                                          256   5e-76    
emb|CDY00168.1|  BnaC09g01330D                                          255   5e-76    
ref|XP_011007442.1|  PREDICTED: B2 protein isoform X2                   256   6e-76    
ref|XP_002300107.1|  hypothetical protein POPTR_0001s33790g             255   9e-76    Populus trichocarpa [western balsam poplar]
ref|XP_011007441.1|  PREDICTED: B2 protein isoform X1                   255   9e-76    
ref|XP_010930192.1|  PREDICTED: B2 protein-like                         258   1e-75    
emb|CDY34179.1|  BnaA02g28610D                                          254   1e-75    
ref|XP_006858170.1|  hypothetical protein AMTR_s00062p00149140          256   1e-75    
emb|CDY13680.1|  BnaA06g32430D                                          257   2e-75    
ref|XP_006399926.1|  hypothetical protein EUTSA_v10014323mg             254   2e-75    
gb|EMT00487.1|  hypothetical protein F775_26486                         255   4e-75    
ref|XP_006441802.1|  hypothetical protein CICLE_v10023823mg             248   4e-75    
gb|KDO51371.1|  hypothetical protein CISIN_1g0260401mg                  250   7e-75    
ref|XP_006478315.1|  PREDICTED: B2 protein-like                         250   7e-75    
ref|XP_006371358.1|  hypothetical protein POPTR_0019s09410g             248   7e-74    
emb|CAN64637.1|  hypothetical protein VITISV_040037                     247   1e-73    Vitis vinifera
ref|XP_002265043.1|  PREDICTED: B2 protein                              246   1e-73    Vitis vinifera
ref|XP_010999500.1|  PREDICTED: B2 protein-like                         248   1e-73    
ref|XP_010420038.1|  PREDICTED: B2 protein-like                         248   3e-73    
ref|XP_010453531.1|  PREDICTED: B2 protein-like                         248   3e-73    
ref|XP_006288387.1|  hypothetical protein CARUB_v10001637mg             247   6e-73    
ref|XP_002871604.1|  predicted protein                                  245   3e-72    
ref|XP_010492213.1|  PREDICTED: B2 protein-like                         245   3e-72    
ref|XP_008237821.1|  PREDICTED: B2 protein-like                         241   6e-72    
ref|NP_001056505.1|  Os05g0594100                                       243   2e-71    Oryza sativa Japonica Group [Japonica rice]
gb|AGV54644.1|  B2 protein-like protein                                 244   2e-71    
gb|EAY99263.1|  hypothetical protein OsI_21227                          243   2e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_006836905.1|  hypothetical protein AMTR_s00099p00128180          241   4e-71    
ref|XP_006655658.1|  PREDICTED: B2 protein-like                         239   2e-70    
ref|XP_007199987.1|  hypothetical protein PRUPE_ppa025043mg             241   2e-70    
emb|CBI34508.3|  unnamed protein product                                223   4e-66    
emb|CDP12181.1|  unnamed protein product                                223   7e-66    
gb|AFK43473.1|  unknown                                                 219   3e-64    
gb|EMS65194.1|  hypothetical protein TRIUR3_05776                       212   6e-62    
emb|CBI21352.3|  unnamed protein product                                208   2e-60    
ref|XP_010456526.1|  PREDICTED: B2 protein-like                         207   6e-60    
gb|EYU34807.1|  hypothetical protein MIMGU_mgv1a023616mg                205   3e-57    
gb|ABR25830.1|  n-rich protein                                          196   5e-56    Oryza sativa Indica Group [Indian rice]
gb|KGN53423.1|  hypothetical protein Csa_4G052730                       204   7e-56    
gb|KDO76589.1|  hypothetical protein CISIN_1g019701mg                   202   9e-56    
ref|XP_007040572.1|  DCD domain protein isoform 2                       197   2e-54    
gb|KEH35155.1|  DCD (development and cell death) domain protein         197   3e-54    
gb|EEE64908.1|  hypothetical protein OsJ_19768                          196   5e-54    Oryza sativa Japonica Group [Japonica rice]
gb|KCW77413.1|  hypothetical protein EUGRSUZ_D01762                     198   5e-54    
ref|XP_006395484.1|  hypothetical protein EUTSA_v10004700mg             192   1e-52    
ref|XP_006288386.1|  hypothetical protein CARUB_v10001637mg             188   5e-51    
gb|KHG29233.1|  Uncharacterized protein F383_15758                      175   2e-46    
ref|XP_010112063.1|  hypothetical protein L484_012649                   163   7e-42    
gb|KHF97500.1|  Uncharacterized protein F383_14816                      159   1e-40    
gb|KHG27774.1|  Uncharacterized protein F383_05528                      157   7e-40    
ref|XP_002968954.1|  hypothetical protein SELMODRAFT_91200              149   1e-38    
ref|XP_002990002.1|  hypothetical protein SELMODRAFT_130815             149   1e-38    
gb|KDO76590.1|  hypothetical protein CISIN_1g019701mg                   149   3e-37    
ref|XP_007040573.1|  DCD domain protein isoform 3                       149   3e-37    
ref|XP_006447063.1|  hypothetical protein CICLE_v10016061mg             143   2e-35    
gb|KDO63936.1|  hypothetical protein CISIN_1g021938mg                   143   2e-35    
gb|KCW53053.1|  hypothetical protein EUGRSUZ_J02349                     143   2e-35    
gb|KEH35156.1|  DCD (development and cell death) domain protein         145   2e-35    
gb|KEH35158.1|  DCD (development and cell death) domain protein         144   5e-35    
gb|KCW77415.1|  hypothetical protein EUGRSUZ_D01762                     144   7e-35    
gb|ACR38081.1|  unknown                                                 140   2e-34    Zea mays [maize]
gb|KHG30353.1|  Uncharacterized protein F383_01974                      139   1e-33    
gb|ACL53185.1|  unknown                                                 138   4e-33    Zea mays [maize]
ref|XP_001770727.1|  predicted protein                                  140   2e-31    
emb|CAA74993.1|  gda-1                                                  130   2e-30    Pisum sativum [garden pea]
gb|KHG04666.1|  Uncharacterized protein F383_02722                      125   1e-29    
gb|AES59370.2|  DCD (development and cell death) domain protein         126   1e-28    
gb|ABD33283.1|  hypothetical protein MtrDRAFT_AC158501g20v2             127   4e-28    Medicago truncatula
ref|XP_003589119.1|  hypothetical protein MTR_1g018690                  127   5e-28    
ref|XP_006828152.1|  hypothetical protein AMTR_s00023p00077180          126   6e-27    
ref|XP_009782881.1|  PREDICTED: kelch-like protein 3                    124   3e-26    
tpg|DAA59029.1|  TPA: hypothetical protein ZEAMMB73_191731              119   4e-26    
ref|XP_010312382.1|  PREDICTED: influenza virus NS1A-binding prot...    122   7e-26    
gb|KHG12821.1|  Influenza virus NS1A-binding A                          123   7e-26    
tpg|DAA49342.1|  TPA: hypothetical protein ZEAMMB73_989403              122   2e-25    
ref|XP_009406902.1|  PREDICTED: uncharacterized protein LOC103989...    120   2e-25    
ref|XP_007208759.1|  hypothetical protein PRUPE_ppa021064mg             121   2e-25    
ref|XP_009406901.1|  PREDICTED: uncharacterized protein LOC103989...    120   2e-25    
ref|XP_008244792.1|  PREDICTED: uncharacterized protein LOC103342905    121   2e-25    
ref|XP_009406905.1|  PREDICTED: uncharacterized protein LOC103989...    121   3e-25    
ref|XP_009406897.1|  PREDICTED: uncharacterized protein LOC103989...    121   3e-25    
ref|XP_007140194.1|  hypothetical protein PHAVU_008G092000g             120   3e-25    
ref|XP_010266727.1|  PREDICTED: uncharacterized protein LOC104604...    120   4e-25    
ref|XP_006379635.1|  hypothetical protein POPTR_0008s07420g             120   5e-25    
ref|XP_007140192.1|  hypothetical protein PHAVU_008G091800g             117   5e-25    
gb|EAZ10671.1|  hypothetical protein OsJ_00501                          120   5e-25    
ref|XP_010266728.1|  PREDICTED: uncharacterized protein LOC104604...    120   5e-25    
ref|XP_010676838.1|  PREDICTED: uncharacterized protein LOC104892570    120   5e-25    
gb|AAQ01199.1|  KEAP1                                                   120   6e-25    
ref|NP_001042109.1|  Os01g0165200                                       120   6e-25    
ref|XP_010921050.1|  PREDICTED: actin-binding protein IPP-like          120   6e-25    
ref|XP_004492505.1|  PREDICTED: uncharacterized protein LOC101507...    120   6e-25    
ref|XP_004492506.1|  PREDICTED: uncharacterized protein LOC101507...    120   6e-25    
ref|XP_011027741.1|  PREDICTED: kelch-like protein 8                    120   7e-25    
gb|KDO63272.1|  hypothetical protein CISIN_1g005735mg                   119   1e-24    
tpg|DAA49446.1|  TPA: hypothetical protein ZEAMMB73_854896              119   1e-24    
gb|KDO63273.1|  hypothetical protein CISIN_1g005735mg                   119   1e-24    
ref|XP_006429497.1|  hypothetical protein CICLE_v10011220mg             119   1e-24    
ref|XP_006481423.1|  PREDICTED: influenza virus NS1A-binding prot...    119   1e-24    
gb|AES86701.2|  DCD (development and cell death) domain protein         114   2e-24    
ref|XP_010653380.1|  PREDICTED: ring canal kelch homolog isoform X2     118   2e-24    
ref|XP_010653382.1|  PREDICTED: uncharacterized protein LOC100267...    118   2e-24    
emb|CBI18099.3|  unnamed protein product                                118   2e-24    
ref|XP_002264808.1|  PREDICTED: uncharacterized protein LOC100267...    118   2e-24    
ref|XP_006654087.1|  PREDICTED: uncharacterized protein LOC102704517    118   3e-24    
ref|XP_002323633.2|  Kelch repeat-containing family protein             117   4e-24    
emb|CDP06421.1|  unnamed protein product                                117   5e-24    
ref|XP_006363630.1|  PREDICTED: uncharacterized protein LOC102596078    115   5e-24    
ref|XP_007026556.1|  Beta-propeller, Kelch repeat type 1, Develop...    117   5e-24    
gb|KHN19168.1|  B2 protein                                              116   5e-24    
ref|XP_009607032.1|  PREDICTED: kelch-like protein 12                   116   6e-24    
ref|XP_006339276.1|  PREDICTED: uncharacterized protein LOC102594377    116   7e-24    
ref|XP_010111454.1|  Kelch-like protein diablo                          116   8e-24    
ref|XP_008442366.1|  PREDICTED: kelch-like protein 40b isoform X2       115   8e-24    
ref|XP_009373092.1|  PREDICTED: uncharacterized protein LOC103962...    116   8e-24    
ref|XP_009373097.1|  PREDICTED: uncharacterized protein LOC103962...    116   9e-24    
gb|KGN58720.1|  hypothetical protein Csa_3G730840                       115   1e-23    
ref|XP_008442365.1|  PREDICTED: influenza virus NS1A-binding prot...    115   1e-23    
ref|XP_010327717.1|  PREDICTED: LOW QUALITY PROTEIN: kelch-like p...    115   1e-23    
ref|XP_004137895.1|  PREDICTED: uncharacterized protein LOC101215663    115   1e-23    
gb|EYU26696.1|  hypothetical protein MIMGU_mgv1a002575mg                115   1e-23    
ref|XP_011015089.1|  PREDICTED: uncharacterized protein LOC105118...    115   2e-23    
ref|XP_011032601.1|  PREDICTED: uncharacterized protein LOC105131...    115   2e-23    
ref|XP_008370201.1|  PREDICTED: uncharacterized protein LOC103433711    115   2e-23    
ref|XP_004160344.1|  PREDICTED: uncharacterized LOC101215663            115   2e-23    
ref|XP_011015088.1|  PREDICTED: uncharacterized protein LOC105118...    115   2e-23    
ref|XP_011032600.1|  PREDICTED: uncharacterized protein LOC105131...    115   2e-23    
ref|XP_008655656.1|  PREDICTED: uncharacterized protein LOC103634...    115   2e-23    
ref|XP_006363629.1|  PREDICTED: uncharacterized protein LOC102595738    114   2e-23    
ref|XP_008655658.1|  PREDICTED: uncharacterized protein LOC103634...    115   2e-23    
gb|AFW80109.1|  hypothetical protein ZEAMMB73_766737                    115   3e-23    
ref|XP_008655659.1|  PREDICTED: kelch-like protein 12 isoform X3        114   3e-23    
ref|XP_003566504.1|  PREDICTED: uncharacterized protein LOC100836442    115   3e-23    
ref|XP_008441488.1|  PREDICTED: uncharacterized protein LOC103485...    114   3e-23    
ref|XP_008441487.1|  PREDICTED: ring canal kelch homolog isoform X1     114   4e-23    
ref|XP_004977131.1|  PREDICTED: gigaxonin-like                          114   4e-23    
ref|XP_007134639.1|  hypothetical protein PHAVU_010G064000g             112   4e-23    
ref|XP_004968296.1|  PREDICTED: uncharacterized protein LOC101780953    114   5e-23    
ref|XP_010038120.1|  PREDICTED: uncharacterized protein LOC104426...    113   7e-23    
ref|XP_010037964.1|  PREDICTED: kelch-like protein 3 isoform X2         113   8e-23    
ref|XP_010037884.1|  PREDICTED: kelch-like protein 3 isoform X1         113   8e-23    
gb|AFW77171.1|  hypothetical protein ZEAMMB73_238089                    113   1e-22    
ref|XP_008649354.1|  PREDICTED: uncharacterized protein LOC103630...    113   1e-22    
ref|XP_008648009.1|  PREDICTED: uncharacterized protein LOC100304...    112   1e-22    
ref|XP_009622509.1|  PREDICTED: uncharacterized protein LOC104113899    112   1e-22    
ref|XP_008649352.1|  PREDICTED: uncharacterized protein LOC103630...    113   1e-22    
ref|XP_011076641.1|  PREDICTED: uncharacterized protein LOC105160...    113   1e-22    
ref|XP_011076642.1|  PREDICTED: uncharacterized protein LOC105160...    113   1e-22    
ref|XP_008649351.1|  PREDICTED: uncharacterized protein LOC103630...    113   1e-22    
ref|XP_008648008.1|  PREDICTED: uncharacterized protein LOC100304...    112   1e-22    
ref|XP_008649356.1|  PREDICTED: uncharacterized protein LOC103630...    112   1e-22    
ref|XP_008649349.1|  PREDICTED: uncharacterized protein LOC103630...    113   1e-22    
ref|XP_008648003.1|  PREDICTED: uncharacterized protein LOC100304...    112   1e-22    
ref|XP_006398595.1|  hypothetical protein EUTSA_v10012920mg             112   1e-22    
gb|EEC78584.1|  hypothetical protein OsI_18588                          113   2e-22    
gb|EEE62456.1|  hypothetical protein OsJ_17249                          112   2e-22    
ref|NP_001054743.1|  Os05g0164900                                       112   2e-22    
emb|CDP13958.1|  unnamed protein product                                112   2e-22    
gb|EMS55401.1|  Kelch-like protein 5                                    112   3e-22    
gb|AAT69627.1|  unknown protein, contains kelch motif, PF01344          112   3e-22    
gb|EMT33864.1|  hypothetical protein F775_04866                         112   3e-22    
emb|CDM81493.1|  unnamed protein product                                111   4e-22    
ref|XP_011077510.1|  PREDICTED: kelch-like protein 1 isoform X1         111   4e-22    
ref|XP_011077514.1|  PREDICTED: kelch-like protein 1 isoform X2         110   4e-22    
emb|CBI25412.3|  unnamed protein product                                110   5e-22    
ref|XP_006287190.1|  hypothetical protein CARUB_v10000362mg             110   6e-22    
ref|XP_002526689.1|  conserved hypothetical protein                     110   6e-22    
emb|CDY62634.1|  BnaCnng40620D                                          110   6e-22    
dbj|BAB33035.1|  CPRD48                                                 100   7e-22    
ref|XP_009122450.1|  PREDICTED: uncharacterized protein LOC103847152    108   7e-22    
ref|XP_010658213.1|  PREDICTED: uncharacterized protein LOC100246...    110   7e-22    
ref|XP_008804154.1|  PREDICTED: uncharacterized protein LOC103717508    110   8e-22    
ref|XP_002273969.1|  PREDICTED: uncharacterized protein LOC100246...    110   8e-22    
ref|XP_010543174.1|  PREDICTED: influenza virus NS1A-binding prot...    110   9e-22    
ref|XP_009610697.1|  PREDICTED: kelch-like protein 1                    110   9e-22    
ref|XP_010543172.1|  PREDICTED: influenza virus NS1A-binding prot...    110   9e-22    
ref|XP_002455139.1|  hypothetical protein SORBIDRAFT_03g004960          110   9e-22    
ref|XP_008388299.1|  PREDICTED: uncharacterized protein LOC103450706    106   1e-21    
gb|EYU20072.1|  hypothetical protein MIMGU_mgv1a002637mg                109   1e-21    
ref|XP_008244790.1|  PREDICTED: uncharacterized protein LOC103342904    107   1e-21    
ref|XP_010464795.1|  PREDICTED: uncharacterized protein LOC104745293    107   1e-21    
ref|XP_009800847.1|  PREDICTED: uncharacterized protein LOC104246679    109   1e-21    
ref|XP_006296753.1|  hypothetical protein CARUB_v10015153mg             107   2e-21    
ref|XP_007015007.1|  Beta-propeller, Kelch repeat type 1, Develop...    109   2e-21    
ref|XP_007015006.1|  Beta-propeller, Kelch repeat type 1, Develop...    109   2e-21    
ref|XP_010486746.1|  PREDICTED: uncharacterized protein LOC104764...    107   2e-21    
ref|XP_010489790.1|  PREDICTED: uncharacterized protein LOC104767436    107   2e-21    
ref|XP_010486747.1|  PREDICTED: uncharacterized protein LOC104764...    107   2e-21    
ref|XP_007015005.1|  Beta-propeller, Kelch repeat type 1, Develop...    109   2e-21    
dbj|BAK03989.1|  predicted protein                                      108   2e-21    
ref|XP_010490523.1|  PREDICTED: influenza virus NS1A-binding prot...    108   2e-21    
ref|XP_010490524.1|  PREDICTED: influenza virus NS1A-binding prot...    108   2e-21    
emb|CDY00986.1|  BnaC05g42140D                                          107   3e-21    
ref|NP_195786.4|  uncharacterized protein                               108   3e-21    
ref|XP_003565377.2|  PREDICTED: uncharacterized protein LOC100833476    108   4e-21    
ref|XP_006645530.1|  PREDICTED: uncharacterized protein LOC102701776    107   4e-21    
ref|XP_006407480.1|  hypothetical protein EUTSA_v10020540mg             106   5e-21    
ref|XP_010543698.1|  PREDICTED: uncharacterized protein LOC104816...    108   5e-21    
ref|XP_010423979.1|  PREDICTED: uncharacterized protein LOC104709...    107   5e-21    
ref|XP_010692908.1|  PREDICTED: uncharacterized protein LOC104905945    107   6e-21    
ref|XP_010423978.1|  PREDICTED: uncharacterized protein LOC104709...    107   6e-21    
gb|KDP44687.1|  hypothetical protein JCGZ_01187                         107   6e-21    
ref|XP_009400961.1|  PREDICTED: uncharacterized protein LOC103985073    107   7e-21    
emb|CDY40301.1|  BnaA10g27670D                                          106   9e-21    
ref|XP_009760486.1|  PREDICTED: kelch-like protein 3 isoform X2         106   1e-20    
emb|CDY08558.1|  BnaA05g27940D                                          105   1e-20    
ref|XP_009146784.1|  PREDICTED: uncharacterized protein LOC103870412    105   1e-20    
ref|XP_009760485.1|  PREDICTED: kelch-like protein 3 isoform X1         106   1e-20    
ref|XP_003623395.1|  Kelch-like protein                                 106   1e-20    
gb|ABL75158.1|  At3g11000                                               105   2e-20    
ref|XP_010922648.1|  PREDICTED: uncharacterized protein LOC105045...    106   2e-20    
ref|XP_010922647.1|  PREDICTED: uncharacterized protein LOC105045...    106   2e-20    
ref|XP_003623398.1|  hypothetical protein MTR_7g070350                  103   2e-20    
gb|AES79616.2|  DCD (development and cell death) domain protein         103   2e-20    
ref|XP_006360826.1|  PREDICTED: kelch-like protein 3-like               105   3e-20    
ref|XP_010325775.1|  PREDICTED: uncharacterized protein LOC101266...    104   3e-20    
ref|NP_187711.3|  DCD (Development and Cell Death) domain protein       103   4e-20    
ref|XP_004246301.1|  PREDICTED: kelch-like protein diablo isoform X1    104   4e-20    
gb|AES79613.2|  DCD (development and cell death) domain protein         104   7e-20    
gb|ABR17347.1|  unknown                                                 102   7e-20    
gb|ABK24657.1|  unknown                                                 102   7e-20    
ref|XP_002882708.1|  hypothetical protein ARALYDRAFT_478446             103   7e-20    
ref|NP_001154604.1|  DCD (Development and Cell Death) domain protein    103   7e-20    
ref|XP_009122855.1|  PREDICTED: influenza virus NS1A-binding prot...    103   8e-20    
ref|XP_003604504.1|  hypothetical protein MTR_4g013760                  100   9e-20    
ref|XP_004302633.1|  PREDICTED: uncharacterized protein LOC101308982    102   1e-19    
gb|KHN40691.1|  Kelch-like protein 1                                    103   2e-19    
ref|XP_009626054.1|  PREDICTED: uncharacterized protein LOC104116...    103   2e-19    
ref|XP_009626053.1|  PREDICTED: uncharacterized protein LOC104116...    102   2e-19    
ref|XP_002520804.1|  conserved hypothetical protein                     102   3e-19    
gb|ABR18000.1|  unknown                                               99.0    6e-19    
ref|XP_006353413.1|  PREDICTED: uncharacterized protein LOC102605...    100   1e-18    
ref|XP_006368350.1|  hypothetical protein POPTR_0001s01890g           98.2    1e-18    
ref|XP_011018482.1|  PREDICTED: uncharacterized protein LOC105121...  98.2    1e-18    
ref|XP_006353412.1|  PREDICTED: uncharacterized protein LOC102605...    100   1e-18    
ref|XP_011018480.1|  PREDICTED: uncharacterized protein LOC105121...  97.8    1e-18    
gb|ACN41172.1|  unknown                                               97.8    1e-18    
ref|XP_010322286.1|  PREDICTED: uncharacterized protein LOC101259848  99.8    2e-18    
ref|XP_008799817.1|  PREDICTED: uncharacterized protein LOC103714378  99.4    2e-18    
emb|CDP16742.1|  unnamed protein product                              95.5    4e-18    
gb|EYU21811.1|  hypothetical protein MIMGU_mgv1a022564mg              95.5    4e-18    
gb|AFW80110.1|  hypothetical protein ZEAMMB73_766737                  98.2    6e-18    
ref|XP_007038147.1|  DCD (Development and Cell Death) domain-like...  93.6    1e-17    
ref|XP_010540670.1|  PREDICTED: uncharacterized protein LOC104814...  95.9    3e-17    
ref|XP_006574211.1|  PREDICTED: uncharacterized protein LOC102660492  94.4    6e-17    
ref|XP_010485279.1|  PREDICTED: uncharacterized protein LOC104763627  93.6    6e-17    
gb|EMS54239.1|  Kelch-like protein 1                                  94.7    7e-17    
ref|XP_010669983.1|  PREDICTED: uncharacterized protein LOC104887094  94.0    9e-17    
ref|XP_002512303.1|  conserved hypothetical protein                   94.0    9e-17    
dbj|BAB08877.1|  unnamed protein product                              94.4    1e-16    
ref|XP_008369626.1|  PREDICTED: uncharacterized protein LOC103433167  92.8    1e-16    
ref|NP_001190590.1|  Development and Cell Death domain-containing...  94.0    2e-16    
ref|XP_010527301.1|  PREDICTED: uncharacterized protein LOC104804658  94.0    2e-16    
ref|NP_974979.1|  Development and Cell Death domain-containing pr...  93.2    2e-16    
ref|XP_002866461.1|  hypothetical protein ARALYDRAFT_496360           93.2    2e-16    
ref|XP_010238817.1|  PREDICTED: kelch-like protein 12                 93.2    2e-16    
ref|NP_200997.2|  Development and Cell Death domain-containing pr...  93.2    2e-16    
ref|XP_006279900.1|  hypothetical protein CARUB_v10025752mg           93.6    2e-16    
ref|XP_007223005.1|  hypothetical protein PRUPE_ppa006802mg           91.3    2e-16    
gb|KHN06101.1|  B2 protein                                            90.9    3e-16    
ref|XP_009796824.1|  PREDICTED: uncharacterized protein LOC104243348  92.8    3e-16    
ref|XP_009353515.1|  PREDICTED: uncharacterized protein LOC103944767  91.7    3e-16    
ref|XP_004240363.1|  PREDICTED: uncharacterized protein LOC101254494  92.4    3e-16    
gb|EPS74016.1|  hypothetical protein M569_00738                       91.3    3e-16    
ref|XP_009359876.1|  PREDICTED: uncharacterized protein LOC103950401  91.7    4e-16    
ref|XP_003059938.1|  predicted protein                                89.4    4e-16    
ref|XP_002879533.1|  hypothetical protein ARALYDRAFT_482479           92.4    5e-16    
ref|XP_009378799.1|  PREDICTED: uncharacterized protein LOC103967249  90.9    5e-16    
ref|XP_006394453.1|  hypothetical protein EUTSA_v10003523mg           92.4    6e-16    
gb|EPS68060.1|  hypothetical protein M569_06712                       86.3    6e-16    
ref|XP_010242576.1|  PREDICTED: protein BONZAI 3                      92.0    6e-16    
ref|XP_004310248.1|  PREDICTED: uncharacterized protein LOC101291205  90.5    7e-16    
ref|XP_010685745.1|  PREDICTED: titin-like                            91.7    7e-16    
ref|XP_003523899.1|  PREDICTED: dentin sialophosphoprotein-like       91.7    8e-16    
ref|XP_011079752.1|  PREDICTED: uncharacterized protein LOC105163194  90.9    9e-16    
ref|XP_010064074.1|  PREDICTED: uncharacterized protein LOC104451...  90.5    9e-16    
gb|EEC82210.1|  hypothetical protein OsI_26354                        91.3    9e-16    
ref|XP_008222246.1|  PREDICTED: uncharacterized protein LOC103322...  90.1    1e-15    
ref|XP_006657799.1|  PREDICTED: uncharacterized protein LOC102715404  90.9    1e-15    
ref|XP_007038149.1|  DCD (Development and Cell Death) domain-like...  87.4    1e-15    
ref|XP_011000184.1|  PREDICTED: uncharacterized protein LOC105107826  90.9    2e-15    
ref|XP_007153510.1|  hypothetical protein PHAVU_003G041800g           90.5    2e-15    
gb|EEE67342.1|  hypothetical protein OsJ_24601                        90.1    2e-15    
ref|XP_004965038.1|  PREDICTED: neurofilament heavy polypeptide-like  90.1    2e-15    
dbj|BAC65044.1|  Kelch-like protein                                   90.1    2e-15    
ref|XP_011073196.1|  PREDICTED: uncharacterized protein LOC105158...  89.4    2e-15    
ref|XP_011073194.1|  PREDICTED: uncharacterized protein LOC105158...  89.4    2e-15    
ref|XP_004977609.1|  PREDICTED: uncharacterized protein LOC101763465  89.7    2e-15    
ref|XP_010109827.1|  hypothetical protein L484_018484                 90.1    3e-15    
ref|XP_008805984.1|  PREDICTED: uncharacterized protein LOC103718...  89.7    3e-15    
gb|KDO58154.1|  hypothetical protein CISIN_1g046426mg                 87.4    3e-15    
tpg|DAA59158.1|  TPA: hypothetical protein ZEAMMB73_888626            89.4    3e-15    
ref|XP_010322628.1|  PREDICTED: uncharacterized protein LOC104648045  89.4    3e-15    
ref|XP_008805985.1|  PREDICTED: uncharacterized protein LOC103718...  89.4    4e-15    
emb|CDX84259.1|  BnaC04g10210D                                        83.2    4e-15    
ref|XP_002322378.2|  hypothetical protein POPTR_0015s15310g           89.7    4e-15    
ref|XP_010244670.1|  PREDICTED: uncharacterized protein LOC104588436  89.4    4e-15    
ref|XP_007209267.1|  hypothetical protein PRUPE_ppa007415mg           85.9    4e-15    
ref|XP_008675561.1|  PREDICTED: uncharacterized protein LOC103651...  89.0    5e-15    
ref|XP_008675560.1|  PREDICTED: uncharacterized protein LOC103651...  89.0    5e-15    
ref|XP_007157777.1|  hypothetical protein PHAVU_002G097900g           89.0    5e-15    
ref|XP_008650986.1|  PREDICTED: uncharacterized protein LOC100216...  89.0    5e-15    
ref|XP_006488340.1|  PREDICTED: uncharacterized protein LOC102621725  88.6    6e-15    
gb|KDO72837.1|  hypothetical protein CISIN_1g037530mg                 88.6    6e-15    



>ref|XP_006343830.1| PREDICTED: B2 protein-like [Solanum tuberosum]
Length=328

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 228/337 (68%), Positives = 260/337 (77%), Gaps = 23/337 (7%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaat  1393
             N QSSFWQFSD+LRLQ N+LANLSLNDSIWS++YGSKRPEERRNF++    D  + A  +
Sbjct  7     NNQSSFWQFSDQLRLQNNNLANLSLNDSIWSSNYGSKRPEERRNFDIRVGGDLNSTANTS  66

Query  1392  atatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf---nkGIYPT  1222
             +          KSNYNLFSNDGWK++D  +  + +       GV   G     NKG+Y +
Sbjct  67    SN---------KSNYNLFSNDGWKIADPSALTAANGGGAAGKGVLGVGLNGGFNKGVY-S  116

Query  1221  PAAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnnn  1042
                +NF SYSKG+NNVAV  KG+N    KK GK  F++EH      S KKN    K++N 
Sbjct  117   NQVLNF-SYSKGTNNVAVGTKGIN----KKFGKGFFEDEHK-----SVKKNNKSVKESNK  166

Query  1041  nnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSV  862
             + N +K N VDKRFKTLPPAE+LPRNETVGGYIFVCNNDTM ENLKR+LFGLP RYRDSV
Sbjct  167   DVNSEKQNGVDKRFKTLPPAESLPRNETVGGYIFVCNNDTMAENLKRELFGLPPRYRDSV  226

Query  861   RQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKV  682
             RQITPGLPLFLYNYSTHQLHGVFEAASFGG+NIDP+AWEDKKN GESRFPAQVRVVTRKV
Sbjct  227   RQITPGLPLFLYNYSTHQLHGVFEAASFGGSNIDPSAWEDKKNPGESRFPAQVRVVTRKV  286

Query  681   CEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             CEPLEEDSFRPILHHYDGPKFRLELNIPE I+ + +F
Sbjct  287   CEPLEEDSFRPILHHYDGPKFRLELNIPEAISLLDIF  323



>ref|XP_004245501.1| PREDICTED: B2 protein [Solanum lycopersicum]
Length=328

 Score =   351 bits (900),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 226/337 (67%), Positives = 262/337 (78%), Gaps = 23/337 (7%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaat  1393
             N QSSFWQFSD+LRLQ N+LANLSLNDSIWS++YGSKRPEERRNF++    D  ++A  +
Sbjct  7     NNQSSFWQFSDQLRLQNNNLANLSLNDSIWSSNYGSKRPEERRNFDIRVGGDLNSIANTS  66

Query  1392  atatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf---nkGIYPT  1222
             +          KSNYNLFSNDGWK++D  +  + +  A    GV   G     NKG+Y +
Sbjct  67    SN---------KSNYNLFSNDGWKIADPSALTAANGGAAAGNGVLGVGLNGGFNKGVY-S  116

Query  1221  PAAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnnn  1042
               A+NF SY+KG+NNVAV  KG+N    KK GK  F++E       S KKN    K++N 
Sbjct  117   NQALNF-SYNKGTNNVAVGTKGIN----KKFGKGFFEDEQK-----SVKKNNKSVKESNK  166

Query  1041  nnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSV  862
             + N +K N VDKRFKTLPPAE+LPRNETVGGYIFVCNNDTM ENLKR+LFGLP RYRDSV
Sbjct  167   DVNSEKQNGVDKRFKTLPPAESLPRNETVGGYIFVCNNDTMAENLKRELFGLPPRYRDSV  226

Query  861   RQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKV  682
             RQITPGLPLFLYNYSTHQLHGVFEAASFGG+NIDP+AWEDKKN GESRFPAQVRVVTRKV
Sbjct  227   RQITPGLPLFLYNYSTHQLHGVFEAASFGGSNIDPSAWEDKKNPGESRFPAQVRVVTRKV  286

Query  681   CEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             CEPLEEDSFRP+LHHYDGPKFRLELN+PE I+ + +F
Sbjct  287   CEPLEEDSFRPVLHHYDGPKFRLELNVPEAISLLDIF  323



>ref|XP_009587755.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis]
Length=335

 Score =   351 bits (900),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 226/338 (67%), Positives = 259/338 (77%), Gaps = 15/338 (4%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaat  1393
             N QSSFWQFSD+LRLQ N+LANLSL+DSIWS +Y SKRPEERRNF++    D    ++  
Sbjct  4     NNQSSFWQFSDQLRLQNNNLANLSLSDSIWSNNYVSKRPEERRNFDIRVGGDINNNSSTA  63

Query  1392  atatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf--nkGIYPTP  1219
             +  +N      KSNYNLFSNDGWK++D  +     S   G   +        NKGIY + 
Sbjct  64    SNNSN------KSNYNLFSNDGWKIADPSAVAGAGSGVSGKGVLDFGLNGGFNKGIY-SN  116

Query  1218  AAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnnnn  1039
              A+NFN YSKG NN+AVN KGV   +NKK GK G ++E  YG+ KS KKN   N   +NN
Sbjct  117   QALNFN-YSKGINNIAVNTKGV---LNKKFGKGGVEDEFGYGNNKSVKKNNKSNNKESNN  172

Query  1038  nngdknna--vdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDS  865
              + +      VDKRFKTLPPAE+LPRNETVGGYIFVCNNDTM ENLKR+LFGLP RYRDS
Sbjct  173   KDVNGEKQNGVDKRFKTLPPAESLPRNETVGGYIFVCNNDTMAENLKRELFGLPPRYRDS  232

Query  864   VRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRK  685
             VRQITPGLPLFLYNYSTHQLHGVFEAASFGG+NIDP+AWEDKKN GESRFPAQVRVVTRK
Sbjct  233   VRQITPGLPLFLYNYSTHQLHGVFEAASFGGSNIDPSAWEDKKNPGESRFPAQVRVVTRK  292

Query  684   VCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             VCEPLEEDSFRPILHHYDGPKFRLELN+PE ++ + +F
Sbjct  293   VCEPLEEDSFRPILHHYDGPKFRLELNVPEALSLLDIF  330



>ref|XP_009764746.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
Length=335

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 261/338 (77%), Gaps = 15/338 (4%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaat  1393
             N QSSFWQFSD+LRLQ N+LANLSLNDSIWS +Y S++PEERRNF++    D    ++  
Sbjct  4     NNQSSFWQFSDQLRLQNNNLANLSLNDSIWSNNYISRKPEERRNFDIRVGGDINNNSSTV  63

Query  1392  atatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf--nkGIYPTP  1219
             +   N      KSNYNLFSNDGWK++D  ++    S   G   +        NKGIY + 
Sbjct  64    SNNPN------KSNYNLFSNDGWKIADPSAATGAGSGVAGKGVLDFGLNGGFNKGIY-SN  116

Query  1218  AAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnnnn  1039
               +NFN YSKG NN+AVN KGV   +NKK GK G ++E  YG+ KS KKN   N   +NN
Sbjct  117   QGLNFN-YSKGINNIAVNTKGV---LNKKFGKGGGEDEFGYGNNKSVKKNNKSNNKESNN  172

Query  1038  nn--gdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDS  865
              +  G+K N VDKRFKTLPPAE+LPRNETVGGYIFVCNNDTM ENLKR+LFGLP RYRDS
Sbjct  173   KDINGEKQNGVDKRFKTLPPAESLPRNETVGGYIFVCNNDTMAENLKRELFGLPPRYRDS  232

Query  864   VRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRK  685
             VRQITPGLPLFLYNYSTHQLHGVFEAASFGG+NIDP+AWEDKKN GESRFPAQVRVVTRK
Sbjct  233   VRQITPGLPLFLYNYSTHQLHGVFEAASFGGSNIDPSAWEDKKNPGESRFPAQVRVVTRK  292

Query  684   VCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             VCEPLEEDSFRPILHHYDGPKFRLELN+PE ++ + +F
Sbjct  293   VCEPLEEDSFRPILHHYDGPKFRLELNVPEALSLLDIF  330



>ref|XP_004244639.1| PREDICTED: B2 protein-like [Solanum lycopersicum]
Length=333

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 245/348 (70%), Gaps = 20/348 (6%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN QSSF+QFSD LRLQ N+L NLS NDSIWS +Y SKRPEERRNF++       ++ +
Sbjct  1     MENNQSSFYQFSDNLRLQTNNLVNLSSNDSIWSNNYVSKRPEERRNFDIRVGGMINSVTS  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf---nkGIY  1228
                +          S+YNLFSNDGWK++D  ++ + +     V G G  G     NKG+Y
Sbjct  61    LNPSKN------LNSDYNLFSNDGWKIADMTAAAAAAGGGSAVKGGGGVGLNGGFNKGVY  114

Query  1227  PTPAAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdn  1048
               P  MNF+       N+ VN KGVN N         F++++ + +    K NK   + N
Sbjct  115   TNP--MNFS-------NIMVNSKGVNNNKRNGKNGV-FEDDYGFVNKFGKKNNKINRESN  164

Query  1047  nnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRD  868
              +    + ++    +FKTLP +E+LP+NETVGGYIFVCNNDTM ENLKR+LFGLP RYRD
Sbjct  165   KDLGANNSSSENK-KFKTLPASESLPKNETVGGYIFVCNNDTMHENLKRELFGLPPRYRD  223

Query  867   SVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTR  688
             SVRQITPGLPLFLYNYSTHQLHG+FEAASFGG+NIDPTAWEDKKN GESRFPAQVRVVTR
Sbjct  224   SVRQITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPTAWEDKKNAGESRFPAQVRVVTR  283

Query  687   KVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLFFPFAHINEL  544
             K+CEPLEEDSFRPILHHYDGPKFRLELNIPE ++ + +F     +N L
Sbjct  284   KICEPLEEDSFRPILHHYDGPKFRLELNIPEALSLLDIFAEKNILNSL  331



>ref|XP_006352242.1| PREDICTED: B2 protein-like [Solanum tuberosum]
Length=332

 Score =   327 bits (837),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 243/347 (70%), Gaps = 19/347 (5%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN QSSF+QFSD LRL  N+L NLS NDSIWS++Y SKRPEERRNF++       ++++
Sbjct  1     MENNQSSFYQFSDNLRLHTNNLVNLSSNDSIWSSNYVSKRPEERRNFDIRVGGMINSVSS  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggf--nkGIYP  1225
                +          S+YNLFSNDGWK++D  ++ +    +    G G+      NKG+Y 
Sbjct  61    LNPSKN------LNSDYNLFSNDGWKIADMAAAAAAGGGSAVKGGGGVGLNGGFNKGVYT  114

Query  1224  TPAAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnn  1045
              P  MNFN       N  VN KGVN N         F +++ + +    K NK   + N 
Sbjct  115   NP--MNFN-------NFVVNSKGVNNNKRNGKNGI-FQDDYGFVNKFGKKNNKINRESNK  164

Query  1044  nnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDS  865
             +    + ++    +FKTLP +E+LP+NETVGGYIFVCNNDTM ENLKR+LFGLP RYRDS
Sbjct  165   DLGANNNSSENK-KFKTLPASESLPKNETVGGYIFVCNNDTMHENLKRELFGLPPRYRDS  223

Query  864   VRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRK  685
             VRQITPGLPLFLYNYSTHQLHG+FEAASFGG+NIDPTAWEDKKN GESRFPAQVRVVTRK
Sbjct  224   VRQITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPTAWEDKKNGGESRFPAQVRVVTRK  283

Query  684   VCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLFFPFAHINEL  544
             +CEPLEEDSFRPILHHYDGPKFRLELNIPE ++ + +F     +N L
Sbjct  284   ICEPLEEDSFRPILHHYDGPKFRLELNIPEALSLLDIFAEKNILNSL  330



>ref|XP_009590115.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis]
Length=317

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 206/356 (58%), Positives = 241/356 (68%), Gaps = 52/356 (15%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN+QSSF+QFSD+LRLQ  +LA LS NDSIWS +Y SK+PEERRNF+            
Sbjct  1     MENSQSSFYQFSDKLRLQTTNLAKLSSNDSIWSNNYVSKKPEERRNFD----IRVGGELI  56

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggfnkGIYPTP  1219
              +  ++N    N  S+YNLFSN G                               +Y  P
Sbjct  57    NSVISSNIPTKNLNSDYNLFSNKG-------------------------------VYTNP  85

Query  1218  AAMNF-----------NSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkk  1072
               +NF           N+ +  +NN+ +N KGV   M K  GKFG++ E+ Y   K GKK
Sbjct  86    --LNFSYSSSSKGSSENNNNNNNNNIVLNSKGV---MKKS-GKFGYEVENGYFVNKFGKK  139

Query  1071  nknvnkdnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLF  892
             N N     +N  + +KN  V+KRFKTLP +E+LPRNETVGGYIFVCNNDTM ENLKR+LF
Sbjct  140   NNNKINRESNYKDENKNIGVEKRFKTLPASESLPRNETVGGYIFVCNNDTMHENLKRELF  199

Query  891   GLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFP  712
             GLP RYRDSVRQITPGLPLFLYNYSTHQLHG+FEAASFGG+NIDPTAWEDKKN GESRFP
Sbjct  200   GLPPRYRDSVRQITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPTAWEDKKNPGESRFP  259

Query  711   AQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLFFPFAHINEL  544
             AQVRVVTRK+CEPLEEDSFRPILHHYDGPKFRLELNIPE I+ + +F     +N L
Sbjct  260   AQVRVVTRKICEPLEEDSFRPILHHYDGPKFRLELNIPEAISLLDIFAEKNILNSL  315



>ref|XP_009803232.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
Length=315

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 204/354 (58%), Positives = 239/354 (68%), Gaps = 50/354 (14%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN QSSF+QFSD+LRLQ N+LANLS NDSIWS +Y  K+PEER+NF++    +      
Sbjct  1     MENNQSSFYQFSDKLRLQTNNLANLSSNDSIWSNNYVPKKPEERKNFDIRVGGEVINSVI  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggfnkGIYPTP  1219
             ++     N      S+YNLFSN G                               +Y  P
Sbjct  61    SSNMPKKN----LNSDYNLFSNKG-------------------------------VYTNP  85

Query  1218  AAMNF---------NSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknk  1066
               +NF         +  +  +NN+ VN KGV     KK GK G+++E  Y   K GKKN 
Sbjct  86    --LNFCYSSSSKGSSENNNNNNNIVVNSKGVI----KKSGKIGYEDESGYFMNKFGKKNN  139

Query  1065  nvnkdnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGL  886
             N     +N  + +KN  V+KRFKTLP +E+LPRNETVGGYIFVCNNDTM ENLKR+LFGL
Sbjct  140   NKINRESNYKDENKNIGVEKRFKTLPASESLPRNETVGGYIFVCNNDTMHENLKRELFGL  199

Query  885   PARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQ  706
             P RYRDSVRQITPGLPLFLYNYSTHQLHG+FEAASFGG+NIDPTAWEDKKN GESRFPAQ
Sbjct  200   PPRYRDSVRQITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPTAWEDKKNTGESRFPAQ  259

Query  705   VRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLFFPFAHINEL  544
             VRVVTRK+CEPLEEDSFRPILHHYDGPKFRLELNIPE I+ + +F     +N L
Sbjct  260   VRVVTRKICEPLEEDSFRPILHHYDGPKFRLELNIPEAISLLDIFAEKNILNSL  313



>ref|XP_011082302.1| PREDICTED: B2 protein [Sesamum indicum]
Length=334

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 243/337 (72%), Gaps = 18/337 (5%)
 Frame = -1

Query  1566  QSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRP-EERRNFEvnsvndnaalaaata  1390
             QSSFWQFSD LRLQ NSLANLSLNDSIWST+Y +KRP EERRNF+  S  +  +      
Sbjct  6     QSSFWQFSDNLRLQTNSLANLSLNDSIWSTNYAAKRPAEERRNFDFRSGGEGGSAFGGPV  65

Query  1389  tatnnqvnNFKSNYNL-FSNDGWkvsdeissisgssaakgvfgvglnggf-nkGIYPTPA  1216
                       KS++NL F+ND WK     S  S  + +    G     G  NKGIY +P+
Sbjct  66    ND-------LKSDFNLGFNNDVWKAPINDSLSSNVNYSGFGSGASGLNGGFNKGIYSSPS  118

Query  1215  AMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHAYGHgksgkknknvnkdnnnnn  1036
              ++FNSYSKG             N   +      DE+H    GK  K NK+ N+DNN NN
Sbjct  119   -LSFNSYSKGKGFANNVVVNGKVNKGGR-----NDEDHGGKSGKKNKGNKDSNRDNNGNN  172

Query  1035  ngdk--nnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSV  862
             NG+     AVDKRFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSV
Sbjct  173   NGNGEGKAAVDKRFKTLPPAESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSV  232

Query  861   RQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKV  682
             R ITPGLPLFLYNYSTHQLHG+FEAASFGGTNIDP+AWEDKKN GESRFPAQVRVVTRKV
Sbjct  233   RAITPGLPLFLYNYSTHQLHGIFEAASFGGTNIDPSAWEDKKNPGESRFPAQVRVVTRKV  292

Query  681   CEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             CEPLEEDSFRPILHHYDGPKFRLELNIPE ++ + +F
Sbjct  293   CEPLEEDSFRPILHHYDGPKFRLELNIPEALSLLDIF  329



>gb|EPS69727.1| hypothetical protein M569_05038, partial [Genlisea aurea]
Length=330

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 237/341 (70%), Gaps = 23/341 (7%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKR--PEERRNFEvnsvndnaalaa  1399
             N QSSFWQFSD LR+Q+ +LANLSLNDSIWST+Y + +   EERRNF+  S        +
Sbjct  2     NNQSSFWQFSDNLRIQSGNLANLSLNDSIWSTNYAAAKRSAEERRNFDFRSSGSGEDSGS  61

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvgl---nggfnkGIY  1228
                +  +    +      ++SND WK         G + +    G G    NGGFNKGIY
Sbjct  62    FGGSEIDRSDVDV-----VYSNDIWKAPINDVVGPGVNYSGYGAGSGSPGLNGGFNKGIY  116

Query  1227  PTPAAMNFNSYSKGSNNVAVNGKGVNFNMNKKLGKFGFDEEHA--YGHgksgkknknvnk  1054
                 + NFN Y+KG   V       N  +NK     G +EE A  +G    G    N+  
Sbjct  117   SGGPSFNFNGYTKGRGFVK------NVMINK-----GRNEEDAGKFGKKNKGSSKDNLKD  165

Query  1053  dnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARY  874
             +   N NG+  +A+DKRFKTLPPAEALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RY
Sbjct  166   NGAGNANGESKSAIDKRFKTLPPAEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRY  225

Query  873   RDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVV  694
             RDSVR ITPGLPLFLYNYSTHQLHG+FEAASFGGTNID TAWEDKKN GESRFPAQVRV+
Sbjct  226   RDSVRAITPGLPLFLYNYSTHQLHGIFEAASFGGTNIDSTAWEDKKNPGESRFPAQVRVI  285

Query  693   TRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             TRK+C+PLEEDSFRPILHHYDGPKFRLELNIPEV++ + +F
Sbjct  286   TRKICDPLEEDSFRPILHHYDGPKFRLELNIPEVLSLLDVF  326



>ref|XP_010109777.1| hypothetical protein L484_003137 [Morus notabilis]
 gb|EXC24695.1| hypothetical protein L484_003137 [Morus notabilis]
Length=405

 Score =   301 bits (772),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 228/349 (65%), Gaps = 35/349 (10%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             M+N  + F QFSD+LR QA+SLANLSLNDSIW +SY +KRP ERRNF++         A+
Sbjct  1     MDNNNNQFLQFSDQLRHQASSLANLSLNDSIWGSSYATKRPYERRNFDIRVGGGVNCPAS  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggfnkGIYPTP  1219
                +  N          +LF NDGW       S   S                      P
Sbjct  61    NNLSPNNGVGG--GVGGDLF-NDGWNSFKPGGSDFNSFKDSWSSL-------------KP  104

Query  1218  AAMNFNSY----SKGSNNVAVNG---KGV------NFNMN-----KKLGKFGFDEE-HAY  1096
              A +FNS+    S G  ++ VNG   KG+      N N+N     K   K G +E+ H  
Sbjct  105   KASDFNSFNDWKSPGDASLGVNGGFNKGIYSKSLNNHNINNDFSLKSHKKGGKNEDVHGG  164

Query  1095  GHgksgkknknvnkdnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQ  916
               GK        +   +NN+N +  +A +KRFKTLPP+E+LPRNETVGGYIFVCNNDTMQ
Sbjct  165   KSGKKNGNGNKKSNGESNNDNKESRSASEKRFKTLPPSESLPRNETVGGYIFVCNNDTMQ  224

Query  915   ENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKK  736
             ENLKRQLFGLP RYRDSVR ITPGLPLFLYNYSTHQLHG+FEAASFGG+NIDP AWEDKK
Sbjct  225   ENLKRQLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIFEAASFGGSNIDPMAWEDKK  284

Query  735   NQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVI  589
               GESRFPAQVRVVTRK+CEPLEEDSFRPILHHYDGPKFRLELN+PE +
Sbjct  285   CPGESRFPAQVRVVTRKICEPLEEDSFRPILHHYDGPKFRLELNVPEAV  333



>sp|P37707.1|B2_DAUCA RecName: Full=B2 protein [Daucus carota]
 emb|CAA51078.1| B2 protein [Daucus carota]
Length=207

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNETVGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  58    RFKTLPPAESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  117

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  118   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVMTRKICEPLEEDSFRPI  177

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE I+ + +F
Sbjct  178   LHHYDGPKFRLELNIPEAISLLDIF  202



>ref|XP_002518847.1| n-rich protein, putative [Ricinus communis]
 gb|EEF43380.1| n-rich protein, putative [Ricinus communis]
Length=396

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  247   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  306

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  307   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  366

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPEV++ + +F
Sbjct  367   LHHYDGPKFRLELNIPEVLSLLDIF  391


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SF QFSD+LR+Q ++LANLSLNDSIWS SYGSKRP+ERRNF+
Sbjct  1     MENNQQSFRQFSDQLRVQTSNLANLSLNDSIWSNSYGSKRPDERRNFD  48



>ref|XP_006439309.1| hypothetical protein CICLE_v10021060mg [Citrus clementina]
 gb|ESR52549.1| hypothetical protein CICLE_v10021060mg [Citrus clementina]
Length=334

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  185   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  244

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  245   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  304

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE I+ + +F
Sbjct  305   LHHYDGPKFRLELNVPEAISLLDIF  329


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>ref|XP_008451926.1| PREDICTED: probable serine/threonine-protein kinase clkA [Cucumis 
melo]
Length=371

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLP+FLY
Sbjct  222   RFKTLPPSESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPIFLY  281

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVR+VTRK+C+PLEEDSFRPI
Sbjct  282   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKTPGESRFPAQVRIVTRKICDPLEEDSFRPI  341

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  342   LHHYDGPKFRLELNIPEALSLLDIF  366


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SF QFSD+LR+Q  +LANLSLNDSIWS SY SK+PEERRNF+
Sbjct  1     MENNPQSFRQFSDQLRVQTGNLANLSLNDSIWSNSYVSKKPEERRNFD  48



>gb|KDO76587.1| hypothetical protein CISIN_1g019701mg [Citrus sinensis]
Length=337

 Score =   283 bits (724),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  188   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  247

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  248   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  307

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE I+ + +F
Sbjct  308   LHHYDGPKFRLELNVPEAISLLDIF  332


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>gb|KDP25282.1| hypothetical protein JCGZ_20438 [Jatropha curcas]
Length=345

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  196   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  255

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRP+
Sbjct  256   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRKICEPLEEDSFRPV  315

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  316   LHHYDGPKFRLELNIPEALSLLDIF  340


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN QS F+QFSD+LRLQA++LANLSLNDSIWS SY SKRP+ERRNF+
Sbjct  1     MENNQS-FYQFSDQLRLQASNLANLSLNDSIWSNSYVSKRPDERRNFD  47



>gb|EPS66990.1| hypothetical protein M569_07785, partial [Genlisea aurea]
Length=321

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  173   RFKTLPPAEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  232

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAA FGGTNIDP+AWEDKKN GESRFPAQV VVTRK+C+PLEEDSFRPI
Sbjct  233   NYSTHQLHGIFEAAGFGGTNIDPSAWEDKKNPGESRFPAQVPVVTRKICDPLEEDSFRPI  292

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  293   LHHYDGPKFRLELNIPEALSLLDIF  317



>ref|XP_004148988.1| PREDICTED: uncharacterized protein LOC101208173 [Cucumis sativus]
 ref|XP_004162682.1| PREDICTED: uncharacterized LOC101208173 [Cucumis sativus]
Length=371

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLP+FLY
Sbjct  222   RFKTLPPSESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPIFLY  281

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVR+VTRK+C+PLEEDSFRPI
Sbjct  282   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKTPGESRFPAQVRIVTRKICDPLEEDSFRPI  341

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  342   LHHYDGPKFRLELNIPEALSLLDIF  366


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SF QFSD+LR+Q  +LANLSLNDSIWS SY SKRPEERRNF+
Sbjct  1     MENNPQSFRQFSDQLRVQTGNLANLSLNDSIWSNSYVSKRPEERRNFD  48



>gb|KEH21257.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=322

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  163   RFKTLPPAESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  222

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRP+
Sbjct  223   NYTTHQLHGVFEAASFGGTNIDPTAWEDKKCAGESRFPAQVRVLTRKTCEPLEEDSFRPV  282

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  283   LHHYDGPKFRLELNVPEALSLLDIF  307



>gb|EYU23311.1| hypothetical protein MIMGU_mgv1a010649mg [Erythranthe guttata]
Length=306

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  164   RFKTLPPAESLPRNETIGGYIFVCNNDTMSENLKRELFGLPPRYRDSVRAITPGLPLFLY  223

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP+AWEDKKN GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  224   NYSTHQLHGVFEAASFGGTNIDPSAWEDKKNPGESRFPAQVRVVTRKICEPLEEDSFRPI  283

Query  645   LHHYDGPKFRLELNIPEV  592
             LHHYDGPKFRLELNIPEV
Sbjct  284   LHHYDGPKFRLELNIPEV  301



>ref|XP_010659503.1| PREDICTED: hybrid signal transduction histidine kinase M isoform 
X2 [Vitis vinifera]
Length=364

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  215   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  274

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEP+EEDSFRP+
Sbjct  275   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPMEEDSFRPV  334

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  335   LHHYDGPKFRLELNVPEALSLLDIF  359


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             ME  Q SFWQFSD+LR+Q ++LANLSLN+SIWS+ Y +KR +ERRNF+
Sbjct  1     MEGNQQSFWQFSDQLRVQTSNLANLSLNESIWSSPY-TKRQDERRNFD  47



>ref|XP_002266388.1| PREDICTED: hybrid signal transduction histidine kinase A isoform 
X1 [Vitis vinifera]
Length=389

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  240   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  299

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEP+EEDSFRP+
Sbjct  300   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPMEEDSFRPV  359

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  360   LHHYDGPKFRLELNVPEALSLLDIF  384


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             ME  Q SFWQFSD+LR+Q ++LANLSLN+SIWS+ Y +KR +ERRNF+
Sbjct  1     MEGNQQSFWQFSDQLRVQTSNLANLSLNESIWSSPY-TKRQDERRNFD  47



>ref|XP_006439310.1| hypothetical protein CICLE_v10021060mg [Citrus clementina]
 gb|ESR52550.1| hypothetical protein CICLE_v10021060mg [Citrus clementina]
Length=323

 Score =   281 bits (718),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  185   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  244

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  245   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  304

Query  645   LHHYDGPKFRLELNIPEVI  589
             LHHYDGPKFRLELN+PEVI
Sbjct  305   LHHYDGPKFRLELNVPEVI  323


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>gb|KDO76588.1| hypothetical protein CISIN_1g019701mg [Citrus sinensis]
Length=326

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  188   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  247

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  248   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  307

Query  645   LHHYDGPKFRLELNIPEVI  589
             LHHYDGPKFRLELN+PEVI
Sbjct  308   LHHYDGPKFRLELNVPEVI  326


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>ref|XP_007040571.1| DCD domain protein isoform 1 [Theobroma cacao]
 gb|EOY25072.1| DCD domain protein isoform 1 [Theobroma cacao]
Length=326

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  172   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRAITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQV+V+TRK+CEPLEEDSFRPI
Sbjct  232   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVMTRKICEPLEEDSFRPI  291

Query  645   LHHYDGPKFRLELNIPEVINYITLFF  568
             LHHYDGPKFRLELN+PE ++ + +F+
Sbjct  292   LHHYDGPKFRLELNVPEALSLLDIFY  317


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 9/85 (11%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN Q SFWQFSD+LR+Q ++LANLSLNDSIWS SY SKRP+ERRNF++    +  ++  
Sbjct  1     MENNQQSFWQFSDQLRVQNSNLANLSLNDSIWSNSYVSKRPDERRNFDIRVGGEVNSVNN  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGW  1324
                           S++N F+NDGW
Sbjct  61    LKPKV---------SDFNSFNNDGW  76



>ref|XP_010266556.1| PREDICTED: B2 protein-like [Nelumbo nucifera]
Length=306

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNE +GGYIFVCNNDTMQENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  157   RFKTLPPSESLPRNEAIGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRAITPGLPLFLY  216

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKKN GESRFPAQVRVVTRK CEPLEEDSFRPI
Sbjct  217   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKNPGESRFPAQVRVVTRKNCEPLEEDSFRPI  276

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE +  + +F
Sbjct  277   LHHYDGPKFRLELNVPEALALLDIF  301


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             M+N Q SFWQFSD+LRLQ+++LANLSLNDSIW  S+ +KRPEERRNF+
Sbjct  1     MDNNQQSFWQFSDQLRLQSSNLANLSLNDSIWGNSFTAKRPEERRNFD  48



>ref|XP_006476354.1| PREDICTED: B2 protein-like [Citrus sinensis]
Length=337

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPR+ET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  188   RFKTLPPSEALPRHETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  247

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+CEPLEEDSFRPI
Sbjct  248   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPLEEDSFRPI  307

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE I+ + +F
Sbjct  308   LHHYDGPKFRLELNVPEAISLLDIF  332


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ERRNF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERRNFD  48



>gb|KEH21258.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=303

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  163   RFKTLPPAESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  222

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRP+
Sbjct  223   NYTTHQLHGVFEAASFGGTNIDPTAWEDKKCAGESRFPAQVRVLTRKTCEPLEEDSFRPV  282

Query  645   LHHYDGPKFRLELNIPEVIN  586
             LHHYDGPKFRLELN+PEV +
Sbjct  283   LHHYDGPKFRLELNVPEVFD  302



>ref|NP_001242010.1| uncharacterized protein LOC100796450 [Glycine max]
 gb|ACU17761.1| unknown [Glycine max]
Length=328

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  169   RFKTLPPAESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  228

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+N+DP+AWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  229   NYSTHQLHGIFEAASFGGSNVDPSAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  288

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  289   LHHYDGPKFRLELNVPEALSLLDIF  313


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LRLQA++LANLSLNDSIWS SY SKR +ER NF+
Sbjct  1     MENNNQSFWQFSDQLRLQASNLANLSLNDSIWSNSYISKRRDERINFD  48



>ref|XP_006584575.1| PREDICTED: uncharacterized protein LOC100796450 isoform X1 [Glycine 
max]
 gb|KHN16725.1| B2 protein [Glycine soja]
Length=327

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  168   RFKTLPPAESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  227

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDP+AWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  228   NYSTHQLHGIFEAASFGGSNIDPSAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  287

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  288   LHHYDGPKFRLELNVPEALSLLDIF  312


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LRLQA++LANLSLNDSIWS SY SKR +ER NF+
Sbjct  1     MENNNQSFWQFSDQLRLQASNLANLSLNDSIWSNSYISKRRDERINFD  48



>ref|XP_007160187.1| hypothetical protein PHAVU_002G300300g [Phaseolus vulgaris]
 gb|ESW32181.1| hypothetical protein PHAVU_002G300300g [Phaseolus vulgaris]
Length=333

 Score =   278 bits (710),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  174   RFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  233

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAA FGGTNIDPTAWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  234   NYSTHQLHGIFEAAGFGGTNIDPTAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  293

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  294   LHHYDGPKFRLELNVPEALSLLDIF  318


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN QS FWQFSD+LRLQ  +LANLSLNDSIWS++Y SKR +ER NF+
Sbjct  1     MENNQS-FWQFSDQLRLQTPNLANLSLNDSIWSSNYVSKRRDERINFD  47



>ref|XP_004503595.1| PREDICTED: B2 protein-like [Cicer arietinum]
Length=346

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  186   RFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRAITPGLPLFLY  245

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  246   NYTTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  305

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  306   LHHYDGPKFRLELNVPEALSLLDIF  330



>ref|XP_010667908.1| PREDICTED: B2 protein [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPR+ETVGGYIFVCNNDTM+ENLKRQLFGLP RYRDSVRQITPGLPLFLY
Sbjct  187   RFKTLPPSEALPRDETVGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRQITPGLPLFLY  246

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNIDPTAWEDKKN GESRFPAQVRV TR++CEPL+ED+FRPI
Sbjct  247   NYSTHQLHGIYEAASFGGTNIDPTAWEDKKNAGESRFPAQVRVQTRQLCEPLDEDAFRPI  306

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  307   LHHYDGPKFRLELSVPEALSLLDIF  331



>ref|XP_009358635.1| PREDICTED: putative uncharacterized protein DDB_G0282133 [Pyrus 
x bretschneideri]
Length=372

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  223   RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  282

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DP+AWEDKK  GESRFPAQVRV TRKVCEPLEEDSFRPI
Sbjct  283   NYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI  342

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  343   LHHYDGPKFRLELSVPEALSLLDIF  367


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LR+Q ++ ANL++NDSIWS SY SKRP+ERRNF+
Sbjct  1     MENNNQSFWQFSDQLRVQGSNFANLNINDSIWSNSY-SKRPDERRNFD  47



>ref|XP_010267585.1| PREDICTED: B2 protein [Nelumbo nucifera]
Length=338

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR E VGGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  189   RFKTLPPSESLPRFEAVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  248

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDP AWEDKKN GESRFPAQVRVVTRK CEPLEEDSFRPI
Sbjct  249   NYSTHQLHGIFEAASFGGTNIDPAAWEDKKNPGESRFPAQVRVVTRKNCEPLEEDSFRPI  308

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE +  + +F
Sbjct  309   LHHYDGPKFRLELNIPEALALLDIF  333


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 10/85 (12%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN Q SFWQFSD+LRLQ+ +LANLSLNDSIW  S+ SKRPEER+NF++    D ++ A 
Sbjct  1     MENNQHSFWQFSDQLRLQSTNLANLSLNDSIWGNSFTSKRPEERKNFDIRVGGDRSSSAN  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGW  1324
                           S+YN+F NDGW
Sbjct  61    LKQKG---------SDYNVF-NDGW  75



>ref|XP_007209268.1| hypothetical protein PRUPE_ppa007415mg [Prunus persica]
 gb|EMJ10467.1| hypothetical protein PRUPE_ppa007415mg [Prunus persica]
Length=368

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  219   RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  278

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DPTAWEDKK  GESRFPAQVRV TRKVCEPLEEDSFRPI
Sbjct  279   NYSTHQLHGIFEAASFGGTNFDPTAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI  338

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  339   LHHYDGPKFRLELSVPEALSLLDIF  363


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -1

Query  1572  NTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             N   SFWQFSD+LR+Q  + ANL++NDSIWS SY SKRP+ERRNF+
Sbjct  4     NNNQSFWQFSDQLRVQGTNFANLTVNDSIWSNSY-SKRPDERRNFD  48



>ref|XP_008239155.1| PREDICTED: B2 protein [Prunus mume]
Length=369

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  220   RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  279

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DPTAWEDKK  GESRFPAQVRV TRKVCEPLEEDSFRPI
Sbjct  280   NYSTHQLHGIFEAASFGGTNFDPTAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI  339

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  340   LHHYDGPKFRLELSVPEALSLLDIF  364


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -1

Query  1581  EMENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             E  N   SFWQFSD+LR+Q  + ANL++NDSIWS SY SKRP+ERRNF+
Sbjct  2     ENNNNNQSFWQFSDQLRVQGTNFANLTVNDSIWSNSY-SKRPDERRNFD  49



>ref|XP_010055887.1| PREDICTED: B2 protein-like [Eucalyptus grandis]
 gb|KCW72440.1| hypothetical protein EUGRSUZ_E00886 [Eucalyptus grandis]
Length=311

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNE VGGYIFVCNNDTM ENL+R+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  162   RFKTLPPSESLPRNEAVGGYIFVCNNDTMHENLQRELFGLPPRYRDSVRQITPGLPLFLY  221

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRKVC PLEEDSFRP+
Sbjct  222   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRKVCNPLEEDSFRPV  281

Query  645   LHHYDGPKFRLELNIPEVINYITLFF  568
             LHHYDGPKFRLELN+PE ++ + +F 
Sbjct  282   LHHYDGPKFRLELNVPEALSLLDIFL  307



>ref|NP_001239779.1| uncharacterized protein LOC100808989 [Glycine max]
 gb|ACU18902.1| unknown [Glycine max]
Length=330

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR+ET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  171   RFKTLPPSESLPRDETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  230

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  231   NYSTHQLHGIFEAASFGGTNIDPSAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  290

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  291   LHHYDGPKFRLELNVPEALSLLDIF  315


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LRLQA++LANLSLNDSIWS +Y SKR +ER NF+
Sbjct  1     MENNNQSFWQFSDQLRLQASNLANLSLNDSIWSNNYISKRRDERINFD  48



>gb|KHM99883.1| B2 protein [Glycine soja]
Length=330

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR+ET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  171   RFKTLPPSESLPRDETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  230

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRK CEPLEEDSFRPI
Sbjct  231   NYSTHQLHGIFEAASFGGTNIDPSAWEDKKCPGESRFPAQVRVITRKTCEPLEEDSFRPI  290

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  291   LHHYDGPKFRLELNVPEALSLLDIF  315


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LRLQA++LANLSLNDSIWS +Y SKR +ER NF+
Sbjct  1     MENNNQSFWQFSDQLRLQASNLANLSLNDSIWSNNYISKRRDERINFD  48



>ref|XP_010545126.1| PREDICTED: B2 protein [Tarenaya hassleriana]
Length=362

 Score =   276 bits (707),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  213   RFKTLPPSEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  272

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNIDP AWEDKK  GESRFPAQVR +TRKVCEPLEEDSFRPI
Sbjct  273   NYSTHQLHGIYEAASFGGTNIDPKAWEDKKCPGESRFPAQVRAITRKVCEPLEEDSFRPI  332

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  333   LHHYDGPKFRLELSVPEALSLLDIF  357


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LRL  ++LANLSLNDSIWST+Y SK P++RRNF+
Sbjct  1     MENNQQSFWQFSDQLRLHTSNLANLSLNDSIWSTNYVSKHPDQRRNFD  48



>ref|XP_009341876.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0282963 
[Pyrus x bretschneideri]
Length=384

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTMQENLKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  235   RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRELFGLPPRYRDSVRAITPGLPLFLY  294

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DP+AWEDKK  GESRFPAQVRV TRKVCEPLEEDSFRPI
Sbjct  295   NYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI  354

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  355   LHHYDGPKFRLELSVPEALSLLDIF  379


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++ ANL++NDSIWS SY SKRP+ERRNF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNFANLNINDSIWSNSY-SKRPDERRNFD  47



>ref|XP_011022478.1| PREDICTED: probable serine/threonine-protein kinase clkA [Populus 
euphratica]
Length=390

 Score =   277 bits (708),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR ET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  241   RFKTLPPSESLPRYETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRQITPGLPLFLY  300

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRKVCEPLEEDSFRP+
Sbjct  301   NYSTHQLHGVFEAASFGGTNIDPSAWEDKKCPGESRFPAQVRVMTRKVCEPLEEDSFRPV  360

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  361   LHHYDGPKFRLELNIPEALSLLDIF  385


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN + SF+QFSD+LR+Q  +LANLSLNDSIWS SYGSKRP++RRNF+
Sbjct  1     MENNRQSFYQFSDQLRVQTPNLANLSLNDSIWSNSYGSKRPDQRRNFD  48



>ref|XP_002304564.1| hypothetical protein POPTR_0003s14180g [Populus trichocarpa]
 gb|EEE79543.1| hypothetical protein POPTR_0003s14180g [Populus trichocarpa]
Length=364

 Score =   276 bits (706),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR ET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  215   RFKTLPPSESLPRYETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRQITPGLPLFLY  274

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRKVCEPLEEDSFRP+
Sbjct  275   NYSTHQLHGVFEAASFGGTNIDPSAWEDKKCLGESRFPAQVRVMTRKVCEPLEEDSFRPV  334

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  335   LHHYDGPKFRLELNIPEALSLLDIF  359


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN + SF+QFSD+LR+Q  +L NLSLNDSIWS S+GSKRP++RRNF+
Sbjct  1     MENNRQSFYQFSDQLRVQTPNLGNLSLNDSIWSNSFGSKRPDQRRNFD  48



>gb|KCW77414.1| hypothetical protein EUGRSUZ_D01762 [Eucalyptus grandis]
Length=379

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LP+ ETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVRQITPGLP+FLY
Sbjct  231   RFKTLPPSESLPKYETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRQITPGLPIFLY  290

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+N+DPTAWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  291   NYSTHQLHGIFEAASFGGSNLDPTAWEDKKCPGESRFPAQVRVITRKICEPLEEDSFRPI  350

Query  645   LHHYDGPKFRLELNIPEVINYIT  577
             LHHYDGPKFRLELN+PEV++Y +
Sbjct  351   LHHYDGPKFRLELNVPEVLSYFS  373



>ref|XP_007145958.1| hypothetical protein PHAVU_006G001100g [Phaseolus vulgaris]
 gb|ESW17952.1| hypothetical protein PHAVU_006G001100g [Phaseolus vulgaris]
Length=361

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPPAE+LP+NET+GGYIFVCNNDTM ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  202   KFKTLPPAESLPKNETIGGYIFVCNNDTMAENLKRQIFGLPPRYRDSVRTITPGLPLFLY  261

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  262   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  321

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  322   LHHYDGPKFRLELSVPEALSLLDIF  346



>ref|XP_008341772.1| PREDICTED: LOW QUALITY PROTEIN: B2 protein-like [Malus domestica]
Length=386

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAE+LPRNET+GGYIFVCNNDTMQENLKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  237   RFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRELFGLPPRYRDSVRAITPGLPLFLY  296

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DP+AWEDKK  GESRFPAQVRV TRKVCEPLEEDSFRPI
Sbjct  297   NYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSFRPI  356

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  357   LHHYDGPKFRLELSVPEALSLLDIF  381


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+Q ++ ANL++NDSIWS SY SKRP+ERRNF+
Sbjct  1     MENNQQSFWQFSDQLRVQGSNFANLNINDSIWSNSY-SKRPDERRNFD  47



>ref|XP_006385800.1| hypothetical protein POPTR_0003s14180g [Populus trichocarpa]
 gb|ABK95892.1| unknown [Populus trichocarpa]
 gb|ERP63597.1| hypothetical protein POPTR_0003s14180g [Populus trichocarpa]
Length=390

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR ET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  241   RFKTLPPSESLPRYETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRQITPGLPLFLY  300

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRKVCEPLEEDSFRP+
Sbjct  301   NYSTHQLHGVFEAASFGGTNIDPSAWEDKKCLGESRFPAQVRVMTRKVCEPLEEDSFRPV  360

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  361   LHHYDGPKFRLELNIPEALSLLDIF  385


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN + SF+QFSD+LR+Q  +L NLSLNDSIWS S+GSKRP++RRNF+
Sbjct  1     MENNRQSFYQFSDQLRVQTPNLGNLSLNDSIWSNSFGSKRPDQRRNFD  48



>ref|XP_011026851.1| PREDICTED: putative uncharacterized protein DDB_G0286901 [Populus 
euphratica]
Length=390

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR ET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  241   RFKTLPPSESLPRYETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRQITPGLPLFLY  300

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP+AWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  301   NYSTHQLHGVFEAASFGGTNIDPSAWEDKKCPGESRFPAQVRVMTRKICEPLEEDSFRPI  360

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE +  + +F
Sbjct  361   LHHYDGPKFRLELNIPEALCLLDIF  385


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SF++FSD+LR+Q ++LANLSLNDSIWS SYGSKRP+ERRNF+
Sbjct  1     MENNQQSFYKFSDQLRVQTSNLANLSLNDSIWSNSYGSKRPDERRNFD  48



>ref|XP_010912158.1| PREDICTED: B2 protein-like [Elaeis guineensis]
Length=317

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNE VGGYIFVCNNDTM+ENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  167   RFKTLPPSEALPRNEAVGGYIFVCNNDTMEENLRRQLFGLPPRYRDSVRAITPGLPLFLY  226

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNID TAWEDKK  GESRFPAQVRV+TRKVCEPLEED+FRPI
Sbjct  227   NYSTHQLHGIFEAASFGGTNIDRTAWEDKKCPGESRFPAQVRVMTRKVCEPLEEDAFRPI  286

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE +  + +F
Sbjct  287   LHHYDGPKFRLELNVPEALALLDIF  311



>ref|XP_010924914.1| PREDICTED: B2 protein-like [Elaeis guineensis]
Length=319

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNE VGGYIFVCNNDTM+ENL+RQLFGLP+RYRDSVR ITPGLPLFLY
Sbjct  170   RFKTLPPSESLPRNEAVGGYIFVCNNDTMEENLRRQLFGLPSRYRDSVRAITPGLPLFLY  229

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAW DKK  GESRFPAQVRVVTRKVC+PLEED+FRPI
Sbjct  230   NYSTHQLHGIFEAASFGGTNIDPTAWGDKKCPGESRFPAQVRVVTRKVCDPLEEDAFRPI  289

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE +  + +F
Sbjct  290   LHHYDGPKFRLELSVPEALALLDIF  314



>ref|XP_010053159.1| PREDICTED: uncharacterized protein LOC104441671 [Eucalyptus grandis]
 gb|KCW77412.1| hypothetical protein EUGRSUZ_D01762 [Eucalyptus grandis]
Length=392

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LP+ ETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVRQITPGLP+FLY
Sbjct  231   RFKTLPPSESLPKYETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRQITPGLPIFLY  290

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+N+DPTAWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  291   NYSTHQLHGIFEAASFGGSNLDPTAWEDKKCPGESRFPAQVRVITRKICEPLEEDSFRPI  350

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  351   LHHYDGPKFRLELNVPEALSLLDIF  375



>ref|XP_008806498.1| PREDICTED: B2 protein-like [Phoenix dactylifera]
Length=319

 Score =   273 bits (697),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNE VGGYIFVCNNDTM+ENL+RQLFGLP+RYRDSVR ITPGLPLFLY
Sbjct  170   RFKTLPPSESLPRNEAVGGYIFVCNNDTMEENLRRQLFGLPSRYRDSVRAITPGLPLFLY  229

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAW DKK  GESRFPAQVRV+TRKVC+PLEEDSFRPI
Sbjct  230   NYSTHQLHGIFEAASFGGTNIDPTAWGDKKCPGESRFPAQVRVMTRKVCDPLEEDSFRPI  289

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  290   LHHYDGPKFRLELSVPEALSLLDIF  314



>ref|XP_002297967.2| hypothetical protein POPTR_0001s10880g [Populus trichocarpa]
 gb|EEE82772.2| hypothetical protein POPTR_0001s10880g [Populus trichocarpa]
Length=390

 Score =   275 bits (702),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPR ET+GGYIFVCNNDTM ENLKR+LFGLP RYRDSVRQITPGLPLFLY
Sbjct  241   RFKTLPPSESLPRYETIGGYIFVCNNDTMAENLKRELFGLPPRYRDSVRQITPGLPLFLY  300

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDP AWEDKK  GESRFPAQVRV+TRK+C PLEEDSFRPI
Sbjct  301   NYSTHQLHGVFEAASFGGTNIDPAAWEDKKCPGESRFPAQVRVMTRKICAPLEEDSFRPI  360

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  361   LHHYDGPKFRLELNIPEALSLLDIF  385


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SF+QFSD+LR+Q ++LANLSLNDSIWS SYGSKRP+ERRNF+
Sbjct  1     MENNQQSFYQFSDQLRVQTSNLANLSLNDSIWSNSYGSKRPDERRNFD  48



>ref|XP_010441386.1| PREDICTED: putative uncharacterized protein DDB_G0286901 [Camelina 
sativa]
Length=364

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 221/350 (63%), Gaps = 26/350 (7%)
 Frame = -1

Query  1557  FWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaatatatn  1378
             FWQFSD+LR+Q  +LANLSLN+SIWST+   K   ERRN ++   N+N +          
Sbjct  15    FWQFSDQLRVQTPNLANLSLNESIWSTNSVFK---ERRNLDIADKNNNNSQIDYYLNQNQ  71

Query  1377  nqvnNFKSNYNLFSNDGWkvsdeissisgssaakgvfgvglnggfnkGIYPTPAAMNFNS  1198
              +     SN++  S+ G    +         +   V              P      FNS
Sbjct  72    KKKAGSDSNWSWKSSSGPNNDNMGLGFGPVGSKSAVLVGSNPIDRFNT--PFNDTWKFNS  129

Query  1197  YSKGSNNV-----AVNG---KGVNFNMNK--------KLGK---FGFDEEHAY--GHgks  1081
              +  +N       AVNG   KGV  +MNK        K G     G DE+H +   H   
Sbjct  130   VNVNANGYTPPSGAVNGDFNKGVYTSMNKYGYNVNLIKQGNNKDKGVDEDHHHPNHHQVQ  189

Query  1080  gkknknvnkdnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKR  901
                 KN   ++  N +   NN +DKRFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKR
Sbjct  190   KGGKKNRKNNSQRNEDDKINNGLDKRFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKR  249

Query  900   QLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGES  721
             QLFGLP RYRDSVR ITPGLPLFLYNYSTHQLHG++EAASFGGTNI+  A+EDKK  GES
Sbjct  250   QLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGES  309

Query  720   RFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             RFPAQVR +TRKVC PLEEDSFRPILHHYDGPKFRLEL++PEV++ + +F
Sbjct  310   RFPAQVRAITRKVCLPLEEDSFRPILHHYDGPKFRLELSVPEVLSLLDIF  359



>ref|XP_001752843.1| predicted protein [Physcomitrella patens]
 gb|EDQ82347.1| predicted protein [Physcomitrella patens]
Length=174

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LPPAE LPRN T+GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR I PGLPLFLY
Sbjct  20    RFKSLPPAEILPRNTTLGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRTIQPGLPLFLY  79

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG++EAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK C+PLEEDSFRPI
Sbjct  80    NYTTHQLHGIYEAASFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKQCKPLEEDSFRPI  139

Query  645   LHHYDGPKFRLELNIPEVINYITLFFPFAHINELH  541
             LHHYDGPKFRL+L+IPEVI+ + +FF  +  N L 
Sbjct  140   LHHYDGPKFRLQLSIPEVIDSVRVFFNNSRCNTLQ  174



>ref|XP_006852609.1| hypothetical protein AMTR_s00021p00224090 [Amborella trichopoda]
 gb|ERN14076.1| hypothetical protein AMTR_s00021p00224090 [Amborella trichopoda]
Length=286

 Score =   271 bits (692),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNE +GGYIFVCNNDTMQ++L+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  137   RFKTLPPSESLPRNEKLGGYIFVCNNDTMQDDLRRQLFGLPQRYRDSVRAITPGLPLFLY  196

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTR  C+PLEEDSFRPI
Sbjct  197   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRMSCKPLEEDSFRPI  256

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRL+LNIPE +  + +F
Sbjct  257   LHHYDGPKFRLQLNIPEALALLDIF  281



>ref|XP_009392977.1| PREDICTED: B2 protein-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNE +GGYIFVCNNDTM+ENL+RQLFGLP+RYRDSVR ITPGLPLFLY
Sbjct  179   RFKTLPPSEALPRNEAIGGYIFVCNNDTMEENLRRQLFGLPSRYRDSVRAITPGLPLFLY  238

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FE+ASFGGTNIDPTAWEDKK  GESRFPAQVRVVTRK+ EPLEEDSFRPI
Sbjct  239   NYSTHQLHGIFESASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKLYEPLEEDSFRPI  298

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+ E +  + +F
Sbjct  299   LHHYDGPKFRLELNVEEALKLLDIF  323



>ref|XP_004502070.1| PREDICTED: B2 protein-like [Cicer arietinum]
Length=329

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  170   KFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRQIFGLPPRYRDSVRTITPGLPLFLY  229

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  230   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  289

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  290   LHHYDGPKFRLELSVSEALSLLDIF  314



>ref|XP_008437409.1| PREDICTED: probable serine/threonine-protein kinase clkA isoform 
X1 [Cucumis melo]
Length=424

 Score =   275 bits (703),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AEALPRNE +GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  275   RFKTLPAAEALPRNERIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  334

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TR++CEPLEEDSFRPI
Sbjct  335   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRQICEPLEEDSFRPI  394

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE I+ + + 
Sbjct  395   LHHYDGPKFRLELSVPEAISLLDVL  419



>gb|ADE77451.1| unknown [Picea sitchensis]
Length=294

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTMQ++LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  144   RFKTLPPSESLPRNETLGGYIFVCNNDTMQDDLKRQLFGLPQRYRDSVRAITPGLPLFLY  203

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGGTNIDPTAWEDKK QGESRFPAQVR+ TRK+C+ LEED+FRP+
Sbjct  204   NYTTHQLHGIFEAASFGGTNIDPTAWEDKKCQGESRFPAQVRIRTRKLCKALEEDAFRPV  263

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRL+LN+PE +  + +
Sbjct  264   LHHYDGPKFRLQLNVPETLALMDI  287



>ref|XP_008807233.1| PREDICTED: B2 protein-like [Phoenix dactylifera]
Length=314

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPR+E VGGYIFVCNNDTM+ENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  165   RFKTLPPSEALPRSEAVGGYIFVCNNDTMEENLRRQLFGLPPRYRDSVRAITPGLPLFLY  224

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGT+ID TAWEDKK  GESRFP+QVRVVTRKVCEPLEED+FRPI
Sbjct  225   NYSTHQLHGIFEAASFGGTHIDRTAWEDKKCPGESRFPSQVRVVTRKVCEPLEEDAFRPI  284

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE +  + +F
Sbjct  285   LHHYDGPKFRLELNIPEALALLDIF  309



>gb|AFK48098.1| unknown [Medicago truncatula]
 gb|KEH35153.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=331

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  172   KFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRQIFGLPPRYRDSVRTITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  232   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  291

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  292   LHHYDGPKFRLELSVSEALSLLDIF  316



>ref|XP_003542163.1| PREDICTED: B2 protein-like [Glycine max]
Length=363

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LP+NET+GGYIFVCNNDTM ENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  204   KFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPLFLY  263

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  264   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  323

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  324   LHHYDGPKFRLELSVPEALSLLDIF  348



>gb|KHN23710.1| B2 protein [Glycine soja]
Length=363

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LP+NET+GGYIFVCNNDTM ENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  204   KFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPLFLY  263

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  264   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  323

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  324   LHHYDGPKFRLELSVPEALSLLDIF  348



>gb|KHN05355.1| B2 protein [Glycine soja]
Length=368

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LP+NET+GGYIFVCNNDTM ENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  209   KFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPLFLY  268

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  269   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  328

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  329   LHHYDGPKFRLELSVPEALSLLDIF  353



>ref|XP_008437410.1| PREDICTED: uncharacterized protein LOC103482833 isoform X2 [Cucumis 
melo]
Length=405

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AEALPRNE +GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  256   RFKTLPAAEALPRNERIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  315

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQVRV+TR++CEPLEEDSFRPI
Sbjct  316   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRQICEPLEEDSFRPI  375

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE I+ + + 
Sbjct  376   LHHYDGPKFRLELSVPEAISLLDVL  400



>dbj|BAB08438.1| unnamed protein product [Arabidopsis thaliana]
Length=204

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  55    RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  114

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  115   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  174

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  175   LHHYDGPKFRLELSVPEVLSLLDIF  199



>ref|XP_004960990.1| PREDICTED: B2 protein-like [Setaria italica]
Length=339

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LP +EALPR E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  189   RFKSLPASEALPRGEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  248

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQVRV TRK+C+PLEED+FRPI
Sbjct  249   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVRVATRKICDPLEEDAFRPI  308

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  309   LHHYDGPKFRLELSVPEALSLLDIF  333



>ref|NP_001236375.1| N-rich protein [Glycine max]
 emb|CAI44933.1| N-rich protein [Glycine max]
Length=368

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LP+NET+GGYIFVCNNDTM ENL+RQLFGLP RYRDSVR ITPGLP+FLY
Sbjct  209   KFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPIFLY  268

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  269   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  328

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  329   LHHYDGPKFRLELSVPEALSLLDIF  353



>ref|XP_004298923.1| PREDICTED: uncharacterized protein LOC101295712 [Fragaria vesca 
subsp. vesca]
Length=384

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LPRNET+GGYIFVCNNDTMQENLKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  228   KFKTLPPSESLPRNETIGGYIFVCNNDTMQENLKRELFGLPPRYRDSVRAITPGLPLFLY  287

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTN DP+AWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  288   NYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVKVLTRKVCEPLEEDSFRPI  347

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ +  F
Sbjct  348   LHHYDGPKFRLELSVPEALSLLDKF  372


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SFWQFSD+LR+Q ++LANLS+NDSIWS SYGSKRP+ RRNF+
Sbjct  1     MENNNQSFWQFSDQLRVQTSNLANLSVNDSIWSNSYGSKRPDARRNFD  48



>ref|XP_009784302.1| PREDICTED: B2 protein [Nicotiana sylvestris]
Length=297

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  148   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  207

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK+C+PLEED+FRP+
Sbjct  208   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRTCVRKICKPLEEDAFRPV  267

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  268   LHHYDGPKFRLELSIPETLDLLDL  291



>gb|KEH35154.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=309

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  172   KFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRQIFGLPPRYRDSVRTITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  232   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  291

Query  645   LHHYDGPKFRLELNIPEV  592
             LHHYDGPKFRLEL++ EV
Sbjct  292   LHHYDGPKFRLELSVSEV  309



>ref|XP_010533569.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
Length=347

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNN+TM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  198   RFKTLPPAEALPRNETIGGYIFVCNNETMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  257

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNIDP AWEDKK  GESRFPAQVR + RK CE LEEDSFRPI
Sbjct  258   NYSTHQLHGIYEAASFGGTNIDPKAWEDKKCPGESRFPAQVRAIRRKACEALEEDSFRPI  317

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  318   LHHYDGPKFRLELSVPEALSLLDVF  342


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LRLQ +++ANLSLNDSIWS++Y SKRP++RRNF+
Sbjct  1     MENNQQSFWQFSDQLRLQTSNMANLSLNDSIWSSNYVSKRPDQRRNFD  48



>gb|AFA36503.1| putative GDA2 protein, partial [Lolium perenne]
Length=147

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPRNE +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  4     RFKTLPASEALPRNEPIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  63

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG NIDP AWEDKK  GESRFPAQVRV TRK+C+PLEED+FRPI
Sbjct  64    NYSTHQLHGIFEAASFGGANIDPAAWEDKKCHGESRFPAQVRVATRKICDPLEEDAFRPI  123

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + +
Sbjct  124   LHHYDGPKFRLELSITEALSLLDI  147



>ref|XP_004143858.1| PREDICTED: uncharacterized protein LOC101206530 [Cucumis sativus]
 ref|XP_004165776.1| PREDICTED: uncharacterized LOC101206530 [Cucumis sativus]
 gb|KGN50007.1| hypothetical protein Csa_5G148780 [Cucumis sativus]
Length=425

 Score =   272 bits (695),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AEALPRNE +GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  276   RFKTLPAAEALPRNERIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  335

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFPAQV+V+TR++C PLEEDSFRPI
Sbjct  336   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVITRQICVPLEEDSFRPI  395

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL+IPE I+ + + 
Sbjct  396   LHHYDGPKFRLELSIPEAISLLDVL  420



>ref|NP_001183616.1| hypothetical protein [Zea mays]
 gb|ACR37763.1| unknown [Zea mays]
 gb|AFW81348.1| hypothetical protein ZEAMMB73_956415 [Zea mays]
Length=297

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LP AEALPR E +GGYIFVCNNDTM+ENLKR+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  143   RFKSLPAAEALPRGEAIGGYIFVCNNDTMEENLKRRLFGLPSRYRDSVRAIRPGLPLFLY  202

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDP AWEDKK  GESRFPAQVRV TRK+C PLEED+FRPI
Sbjct  203   NYSTHQLHGIFEAASFGGSNIDPAAWEDKKCPGESRFPAQVRVATRKICSPLEEDAFRPI  262

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  263   LHHYDGPKFRLELSVPEALSLLDIF  287



>ref|NP_001148917.1| LOC100282537 [Zea mays]
 gb|ACG33465.1| gda-1 [Zea mays]
Length=301

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  152   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  211

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  212   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRICIRKLCKPLEEDSFRPV  271

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  272   LHHYDGPKFRLELSIAETLSLLDL  295



>gb|ACU23341.1| unknown [Glycine max]
Length=368

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 3/157 (2%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LP+NET+GGYIFVCNNDTM ENL+RQLFGLP RYRDSVR ITPGLP+FLY
Sbjct  209   KFKTLPPSESLPKNETIGGYIFVCNNDTMAENLQRQLFGLPPRYRDSVRTITPGLPIFLY  268

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV+V+TRKVCEPLEEDSFRPI
Sbjct  269   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQVQVITRKVCEPLEEDSFRPI  328

Query  645   LHHYDGPKFRLELNIPEVINYITLFFPFAHINELHAI  535
              HHYDGPKFRLEL++PE + ++ +   FA+ N L  I
Sbjct  329   FHHYDGPKFRLELSVPEALFFLDI---FANQNSLDDI  362



>emb|CDY27663.1| BnaUnng00130D [Brassica napus]
Length=275

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGY+FVCNNDTM+ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  126   RFKTLPPAEALPRNETIGGYVFVCNNDTMEENLKRQVFGLPPRYRDSVRAITPGLPLFLY  185

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR VTRKVC PLEEDSFRPI
Sbjct  186   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAVTRKVCLPLEEDSFRPI  245

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  246   LHHYDGPKFRLELSVPEVLSLLDVF  270



>ref|XP_009597100.1| PREDICTED: B2 protein [Nicotiana tomentosiformis]
Length=297

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  148   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  207

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK+C+PLEED+FRP+
Sbjct  208   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRTRVRKICKPLEEDAFRPV  267

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  268   LHHYDGPKFRLELSIPETLDLLDL  291



>ref|XP_004513311.1| PREDICTED: B2 protein-like isoform X2 [Cicer arietinum]
Length=298

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  147   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  206

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC+ LEEDSFRP+
Sbjct  207   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCKALEEDSFRPV  266

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  267   LHHYDGPKFRLELSVPETLDLMDL  290



>emb|CDY68218.1| BnaCnng58090D [Brassica napus]
Length=273

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGY+FVCNNDTM+ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  124   RFKTLPPAEALPRNETIGGYVFVCNNDTMEENLKRQVFGLPPRYRDSVRAITPGLPLFLY  183

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR VTRKVC PLEEDSFRPI
Sbjct  184   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAVTRKVCLPLEEDSFRPI  243

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  244   LHHYDGPKFRLELSVPEVLSLLDVF  268



>ref|XP_007161729.1| hypothetical protein PHAVU_001G093700g [Phaseolus vulgaris]
 gb|ESW33723.1| hypothetical protein PHAVU_001G093700g [Phaseolus vulgaris]
Length=302

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  211   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDSFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  271   LHHYDGPKFRLELSVPETLDLLDL  294



>ref|XP_009371647.1| PREDICTED: B2 protein-like [Pyrus x bretschneideri]
Length=293

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  142   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  201

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  202   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  261

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +N + L
Sbjct  262   LHHYDGPKFRLELSVPETLNLLDL  285



>gb|ACL53572.1| unknown [Zea mays]
Length=302

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  213   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRICIRKLCKPLEEDSFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  273   LHHYDGPKFRLELSIAETLSLLDL  296



>ref|XP_010033420.1| PREDICTED: B2 protein [Eucalyptus grandis]
 gb|KCW53052.1| hypothetical protein EUGRSUZ_J02349 [Eucalyptus grandis]
Length=299

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  148   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  207

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  208   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKALEEDSFRPV  267

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +N + L
Sbjct  268   LHHYDGPKFRLELSVPETLNLLDL  291



>ref|XP_002441637.1| hypothetical protein SORBIDRAFT_09g030740 [Sorghum bicolor]
 gb|EES20067.1| hypothetical protein SORBIDRAFT_09g030740 [Sorghum bicolor]
Length=353

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LP +EALPR E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  203   RFKSLPASEALPRGEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  262

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDP AWEDKK  GESRFPAQVRV TRK+C+PLEED+FRPI
Sbjct  263   NYSTHQLHGIFEAASFGGSNIDPKAWEDKKCPGESRFPAQVRVATRKICDPLEEDAFRPI  322

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + +F
Sbjct  323   LHHYDGPKFRLELSVPEALSLLDIF  347



>ref|XP_008341299.1| PREDICTED: B2 protein [Malus domestica]
 ref|XP_008341300.1| PREDICTED: B2 protein [Malus domestica]
Length=293

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  142   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  201

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  202   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  261

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +N + L
Sbjct  262   LHHYDGPKFRLELSVPETLNLLDL  285



>ref|NP_568600.1| DCD (Development and Cell Death) domain protein [Arabidopsis 
thaliana]
 gb|AAL87257.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45105.1| unknown protein [Arabidopsis thaliana]
 gb|AAM66001.1| unknown [Arabidopsis thaliana]
 gb|AED94759.1| DCD (Development and Cell Death) domain protein [Arabidopsis 
thaliana]
Length=349

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  200   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  259

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  260   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  319

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  320   LHHYDGPKFRLELSVPEVLSLLDIF  344



>emb|CDP16694.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  184   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  243

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAA+FGG+NIDPTAWEDKK +GESRFPAQVR+ TRKVC+PLEED+FRP+
Sbjct  244   NYTTHQLHGIFEAATFGGSNIDPTAWEDKKCKGESRFPAQVRIHTRKVCKPLEEDAFRPV  303

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  304   LHHYDGPKFRLELSIPETLDLLDL  327



>emb|CDY13366.1| BnaC06g13910D [Brassica napus]
Length=333

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  184   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  243

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+++AASFGGTNI+ TA+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  244   NYSTHQLHGIYQAASFGGTNIELTAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  303

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL +PEV++ + +F
Sbjct  304   LHHYDGPKFRLELTVPEVLSLLDIF  328



>dbj|BAJ97532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPRNE +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  209   RFKTLPASEALPRNEPIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  268

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG NIDP AWEDKK  GESRFPAQVRV TRK+C+PLEED+FRPI
Sbjct  269   NYSTHQLHGIFEAASFGGANIDPAAWEDKKCNGESRFPAQVRVATRKICDPLEEDAFRPI  328

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL+I E ++ + +F
Sbjct  329   LHHYDGPKFRLELSITEALSLLDIF  353



>ref|XP_006284002.1| hypothetical protein CARUB_v10005124mg [Capsella rubella]
 gb|EOA16900.1| hypothetical protein CARUB_v10005124mg [Capsella rubella]
Length=357

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  208   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  267

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  268   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  327

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV+  + +F
Sbjct  328   LHHYDGPKFRLELSVPEVLALLDIF  352



>ref|XP_006405279.1| hypothetical protein EUTSA_v10027832mg [Eutrema salsugineum]
 gb|ESQ46732.1| hypothetical protein EUTSA_v10027832mg [Eutrema salsugineum]
Length=335

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  186   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  245

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+++AASFGGTNI+ +A++DKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  246   NYSTHQLHGIYQAASFGGTNIELSAFQDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  305

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL +PEV++ + +F
Sbjct  306   LHHYDGPKFRLELTVPEVLSLLDIF  330



>ref|XP_006604145.1| PREDICTED: B2 protein-like [Glycine max]
 gb|KHN40960.1| B2 protein [Glycine soja]
Length=303

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  152   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  211

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  212   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDSFRPV  271

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  272   LHHYDGPKFRLELSVPETLDLLDL  295



>ref|XP_002870594.1| hypothetical protein ARALYDRAFT_493778 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46853.1| hypothetical protein ARALYDRAFT_493778 [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  191   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  250

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  251   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  310

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  311   LHHYDGPKFRLELSVPEVLSLLDIF  335



>ref|XP_010436167.1| PREDICTED: GATA zinc finger domain-containing protein 14-like 
[Camelina sativa]
Length=368

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  219   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  278

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  279   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  338

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  339   LHHYDGPKFRLELSVPEVLSLLDIF  363



>ref|XP_011097287.1| PREDICTED: B2 protein-like [Sesamum indicum]
Length=303

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPR+E +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPAAEMLPRSEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGGTNIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  214   NYTTHQLHGIFEAASFGGTNIDPTAWEDKKCKGESRFPAQVRIRVRKICKPLEEDAFRPV  273

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  274   LHHYDGPKFRLELSVPETLDLLDL  297



>ref|NP_001239866.1| uncharacterized protein LOC100775724 [Glycine max]
 gb|ACU23991.1| unknown [Glycine max]
 gb|KHN09935.1| B2 protein [Glycine soja]
Length=298

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  147   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  206

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  207   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDSFRPV  266

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  267   LHHYDGPKFRLELSVPETLDLLDL  290



>emb|CDX67527.1| BnaA07g15670D [Brassica napus]
Length=329

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  180   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  239

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+++AASFGGTNI+ +A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  240   NYSTHQLHGIYQAASFGGTNIELSAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  299

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL +PEV++ + +F
Sbjct  300   LHHYDGPKFRLELTVPEVLSLLDIF  324



>ref|XP_010447060.1| PREDICTED: asparagine-rich protein-like [Camelina sativa]
Length=358

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 172/230 (75%), Gaps = 18/230 (8%)
 Frame = -1

Query  1212  MNFNSYSKGSNNVAVNG---KGVNFNMNK--------KLGK---FGFDEEHA--YGHgks  1081
             +N N Y+  S   AVNG   KGV  +MNK        K G     G DE+H   + H   
Sbjct  126   VNVNGYAPPSG--AVNGDFNKGVYTSMNKYGYNVNLIKQGNNKDKGVDEDHPNHHHHQVQ  183

Query  1080  gkknknvnkdnnnnnngdknnavdKRFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKR  901
                 KN   ++  N +   NN +DKRFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKR
Sbjct  184   KGGKKNRKNNSQRNEDDKINNGLDKRFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKR  243

Query  900   QLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGES  721
             QLFGLP RYRDSVR ITPGLPLFLYNYSTHQLHG++EAASFGGTNI+  A+EDKK  GES
Sbjct  244   QLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGES  303

Query  720   RFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             RFPAQVR +TRKVC PLEEDSFRPILHHYDGPKFRLEL++PEV++ + +F
Sbjct  304   RFPAQVRAITRKVCLPLEEDSFRPILHHYDGPKFRLELSVPEVLSLLDIF  353



>gb|AFK37025.1| unknown [Lotus japonicus]
Length=340

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E+LPRNETVGGYIFVCNNDTM ENL+RQ FGLP RYRDSVR ITPGLPLFLY
Sbjct  181   RFKTLPQSESLPRNETVGGYIFVCNNDTMAENLRRQFFGLPPRYRDSVRSITPGLPLFLY  240

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V+TRK+CEPLEEDSFRPI
Sbjct  241   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCIGESRFPAQVQVITRKICEPLEEDSFRPI  300

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLE ++ E ++ + +F
Sbjct  301   LHHYDGPKFRLEPSVAEALSLLDIF  325


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 3/51 (6%)
 Frame = -1

Query  1578  MENTQS---SFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             M+N  S   SFWQFSD+LR+QA+ LANLSLNDSIWS +Y SKRP++RRNF+
Sbjct  1     MDNNNSNEQSFWQFSDQLRVQASGLANLSLNDSIWSNNYTSKRPDQRRNFD  51



>ref|XP_009125216.1| PREDICTED: B2 protein [Brassica rapa]
Length=333

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  184   RFKTLPPAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  243

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+++AASFGGTNI+ +A+EDKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  244   NYSTHQLHGIYQAASFGGTNIELSAFEDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  303

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL +PEV++ + +F
Sbjct  304   LHHYDGPKFRLELTVPEVLSLLDIF  328



>ref|XP_003569184.1| PREDICTED: B2 protein [Brachypodium distachyon]
Length=365

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPRNE +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  214   RFKTLPASEALPRNEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  273

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG NIDP AWEDKK  GESRFPAQVRV TRK+C PLEED+FRPI
Sbjct  274   NYSTHQLHGIFEAASFGGANIDPAAWEDKKCPGESRFPAQVRVATRKICNPLEEDAFRPI  333

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL+I E ++ + +F
Sbjct  334   LHHYDGPKFRLELSITEALSLLDVF  358



>ref|XP_009140145.1| PREDICTED: B2 protein-like [Brassica rapa]
Length=342

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPPAEALPRNET+GGY+FVCNNDTM+ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  193   RFKTLPPAEALPRNETIGGYVFVCNNDTMEENLKRQVFGLPPRYRDSVRAITPGLPLFLY  252

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+  A+EDKK  GESRFPAQVR VTRKVC PLEEDSFRPI
Sbjct  253   NYSTHQLHGIYEAASFGGTNIELNAFEDKKCPGESRFPAQVRAVTRKVCLPLEEDSFRPI  312

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PEV++ + +F
Sbjct  313   LHHYDGPKFRLELSVPEVLSLLDVF  337



>gb|ACU19117.1| unknown [Glycine max]
Length=303

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  152   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  211

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK C+ LEEDSFRP+
Sbjct  212   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKFCKALEEDSFRPV  271

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  272   LHHYDGPKFRLELSVPETLDLLDL  295



>gb|EPS70594.1| hypothetical protein M569_04167 [Genlisea aurea]
Length=275

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  125   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  184

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAA+FGG+NID TAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRPI
Sbjct  185   NYTTHQLHGIFEAATFGGSNIDSTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPI  244

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  245   LHHYDGPKFRLELSIPETLDLLDL  268



>ref|XP_007215754.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 ref|XP_007215755.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 ref|XP_007215756.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 ref|XP_007215757.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 ref|XP_008231116.1| PREDICTED: B2 protein [Prunus mume]
 ref|XP_008231118.1| PREDICTED: B2 protein [Prunus mume]
 ref|XP_008231119.1| PREDICTED: B2 protein [Prunus mume]
 ref|XP_008231120.1| PREDICTED: B2 protein [Prunus mume]
 gb|EMJ16953.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 gb|EMJ16954.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 gb|EMJ16955.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
 gb|EMJ16956.1| hypothetical protein PRUPE_ppa009447mg [Prunus persica]
Length=292

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  141   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  200

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  201   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  260

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  261   LHHYDGPKFRLELSIPETLDLLDL  284



>gb|EYU45408.1| hypothetical protein MIMGU_mgv1a010845mg [Erythranthe guttata]
Length=300

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAA+FGG NIDPTAWEDKK +GESRFPAQVR+  RK+C PLEED+FRP+
Sbjct  211   NYTTHQLHGIFEAATFGGANIDPTAWEDKKCKGESRFPAQVRIRIRKICNPLEEDAFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  271   LHHYDGPKFRLELSVPETLDLLDL  294



>emb|CAD37200.1| GDA2 protein [Pisum sativum]
Length=213

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  62    RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  121

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA  FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  122   NYTTHQLHGIFEATCFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  181

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  182   LHHYDGPKFRLELSVPETLDLMDL  205



>ref|XP_006654598.1| PREDICTED: B2 protein-like [Oryza brachyantha]
Length=314

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  165   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  224

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  225   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKPLEEDAFRPV  284

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  285   LHHYDGPKFRLELSIAETLSLLDL  308



>gb|EMT12068.1| hypothetical protein F775_26567 [Aegilops tauschii]
Length=350

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPRNE +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  201   RFKTLPASEALPRNEPIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  260

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG NIDP AWEDKK  GESRFPAQVRV TRK+C PLEED+FRPI
Sbjct  261   NYSTHQLHGIFEAASFGGANIDPAAWEDKKCNGESRFPAQVRVATRKICGPLEEDAFRPI  320

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL+I E ++ + +F
Sbjct  321   LHHYDGPKFRLELSITEALSLLDIF  345



>ref|XP_008365354.1| PREDICTED: B2 protein-like [Malus domestica]
 ref|XP_008365355.1| PREDICTED: B2 protein-like [Malus domestica]
Length=293

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  142   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  201

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  202   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRICVRKICKALEEDAFRPV  261

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +  + L
Sbjct  262   LHHYDGPKFRLELSVPETLELLDL  285



>ref|XP_009350302.1| PREDICTED: B2 protein-like [Pyrus x bretschneideri]
 ref|XP_009350304.1| PREDICTED: B2 protein-like [Pyrus x bretschneideri]
 ref|XP_009350306.1| PREDICTED: B2 protein-like [Pyrus x bretschneideri]
Length=293

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  142   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  201

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  202   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  261

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +  + L
Sbjct  262   LHHYDGPKFRLELSVPETLALLDL  285



>ref|XP_004981020.1| PREDICTED: B2 protein-like [Setaria italica]
Length=314

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  165   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  224

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  225   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKPLEEDSFRPV  284

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  285   LHHYDGPKFRLELSIAETLSLLDL  308



>gb|ACJ84912.1| unknown [Medicago truncatula]
 gb|AFK44066.1| unknown [Medicago truncatula]
 gb|KEH22023.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=302

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R +C+ LEEDSFRP+
Sbjct  211   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRNICKALEEDSFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  271   LHHYDGPKFRLELSVPETLDLMDL  294



>gb|ACF85858.1| unknown [Zea mays]
 tpg|DAA52538.1| TPA: gda-1 isoform 1 [Zea mays]
 tpg|DAA52539.1| TPA: gda-1 isoform 2 [Zea mays]
Length=322

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP+NE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  173   RFKTLPTSEMLPKNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  232

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  233   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDSFRPV  292

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  293   LHHYDGPKFRLELSIAETLSLLDL  316



>ref|NP_001150743.1| gda-1 [Zea mays]
 gb|ACG35147.1| gda-1 [Zea mays]
 gb|ACG40178.1| gda-1 [Zea mays]
Length=323

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP+NE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  174   RFKTLPTSEMLPKNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  233

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  234   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDSFRPV  293

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  294   LHHYDGPKFRLELSIAETLSLLDL  317



>ref|XP_011098888.1| PREDICTED: B2 protein [Sesamum indicum]
 ref|XP_011098889.1| PREDICTED: B2 protein [Sesamum indicum]
Length=302

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  213   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  273   LHHYDGPKFRLELSVPETLDLLDL  296



>ref|XP_004303971.1| PREDICTED: B2 protein-like [Fragaria vesca subsp. vesca]
Length=300

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  209   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|XP_010556284.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
Length=292

 Score =   263 bits (672),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  142   RFKTLPASEILPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  201

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGGTNIDPTAWEDKK +GESRFPAQVR+  RKVC  LEED+FRP+
Sbjct  202   NYTTHQLHGIFEATSFGGTNIDPTAWEDKKCKGESRFPAQVRIRVRKVCNALEEDAFRPV  261

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  262   LHHYDGPKFRLELSVPETLDLLDL  285



>ref|XP_004167610.1| PREDICTED: LOW QUALITY PROTEIN: B2 protein-like [Cucumis sativus]
Length=304

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C  LEEDSFRP+
Sbjct  213   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCRALEEDSFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  273   LHHYDGPKFRLELSIPETLDLLDL  296



>ref|XP_008643677.1| PREDICTED: LOC100282537 isoform X1 [Zea mays]
 gb|AFW66961.1| gda-1 [Zea mays]
Length=365

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  216   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  275

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEEDSFRP+
Sbjct  276   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRICIRKLCKPLEEDSFRPV  335

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  336   LHHYDGPKFRLELSIAETLSLLDL  359



>gb|ACN40727.1| unknown [Picea sitchensis]
Length=282

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  133   RFKTLPSTEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRAITPGLPLFLY  192

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  193   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  252

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRL+L+IPE +  + L
Sbjct  253   LHHYDGPKFRLQLSIPETLALMDL  276



>gb|ABR18077.1| unknown [Picea sitchensis]
Length=282

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  133   RFKTLPSTEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRAITPGLPLFLY  192

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  193   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  252

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRL+L+IPE +  + L
Sbjct  253   LHHYDGPKFRLQLSIPETLALMDL  276



>ref|XP_004145666.1| PREDICTED: B2 protein-like [Cucumis sativus]
Length=304

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C  LEEDSFRP+
Sbjct  213   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCRALEEDSFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  273   LHHYDGPKFRLELSIPETLDLLDL  296



>ref|XP_004231781.1| PREDICTED: B2 protein isoform X2 [Solanum lycopersicum]
 ref|XP_004231782.1| PREDICTED: B2 protein isoform X2 [Solanum lycopersicum]
 ref|XP_010315916.1| PREDICTED: B2 protein isoform X2 [Solanum lycopersicum]
Length=298

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LP+NE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRLLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC PLEED+FRP+
Sbjct  209   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCNPLEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  269   LHHYDGPKFRLELSIPETLDLLDL  292



>ref|XP_003568175.1| PREDICTED: B2 protein [Brachypodium distachyon]
 ref|XP_010231208.1| PREDICTED: B2 protein [Brachypodium distachyon]
Length=310

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  221   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKICKALEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  281   LHHYDGPKFRLELSIAETLSLLDL  304



>ref|XP_004513310.1| PREDICTED: B2 protein-like isoform X1 [Cicer arietinum]
Length=320

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  147   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  206

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC+ LEEDSFRP+
Sbjct  207   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCKALEEDSFRPV  266

Query  645   LHHYDGPKFRLELNIPEV  592
             LHHYDGPKFRLEL++PEV
Sbjct  267   LHHYDGPKFRLELSVPEV  284



>ref|NP_001043301.1| Os01g0550300 [Oryza sativa Japonica Group]
 dbj|BAD88059.1| putative GDA2 protein [Oryza sativa Japonica Group]
 dbj|BAD88119.1| putative GDA2 protein [Oryza sativa Japonica Group]
 dbj|BAF05215.1| Os01g0550300 [Oryza sativa Japonica Group]
Length=328

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR+E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  178   RFKTLPASEALPRDEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  237

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V TRK+ +PLEED+FRPI
Sbjct  238   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVATRKIYDPLEEDAFRPI  297

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  298   LHHYDGPKFRLELSVAEALSLLDIF  322



>gb|KFK32974.1| hypothetical protein AALP_AA6G313400 [Arabis alpina]
Length=326

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AEALPRNET+GGYIFVCNNDTM+ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  176   RFKTLPAAEALPRNETIGGYIFVCNNDTMEENLKRQLFGLPPRYRDSVRAITPGLPLFLY  235

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EAASFGGTNI+ +A++DKK  GESRFPAQVR +TRKVC PLEEDSFRPI
Sbjct  236   NYSTHQLHGIYEAASFGGTNIELSAFQDKKCPGESRFPAQVRAITRKVCLPLEEDSFRPI  295

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL +PEV++ + +F
Sbjct  296   LHHYDGPKFRLELTVPEVLSLLDIF  320



>ref|NP_001275328.1| uncharacterized protein LOC102577607 [Solanum tuberosum]
 ref|XP_006338696.1| PREDICTED: B2 protein [Solanum tuberosum]
 gb|ABB16967.1| unknown [Solanum tuberosum]
Length=298

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LP+NE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRLLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC PLEED+FRP+
Sbjct  209   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCNPLEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|XP_001773872.1| predicted protein [Physcomitrella patens]
 gb|EDQ61362.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LP AE LPRN T+GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR I PGLPLFLY
Sbjct  27    RFKSLPSAEVLPRNVTLGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRTIQPGLPLFLY  86

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK C+PLEEDSFRP+
Sbjct  87    NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCRGESRFPAQVRTRIRKQCKPLEEDSFRPV  146

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRL+L++PE +  + LF
Sbjct  147   LHHYDGPKFRLQLSVPEAVELLDLF  171



>ref|XP_010112365.1| hypothetical protein L484_010769 [Morus notabilis]
 gb|EXC33360.1| hypothetical protein L484_010769 [Morus notabilis]
Length=302

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  211   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKALEEDAFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  271   LHHYDGPKFRLELSVPETLDLLDL  294



>ref|XP_009784806.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
 ref|XP_009784874.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
 ref|XP_009784932.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
Length=298

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LP+NE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRLLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC+PLEED+FRP+
Sbjct  209   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCKPLEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|XP_007031869.1| DCD domain protein isoform 1 [Theobroma cacao]
 ref|XP_007031870.1| DCD domain protein isoform 1 [Theobroma cacao]
 gb|EOY02795.1| DCD domain protein isoform 1 [Theobroma cacao]
 gb|EOY02796.1| DCD domain protein isoform 1 [Theobroma cacao]
Length=304

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  214   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKALEEDAFRPV  273

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  274   LHHYDGPKFRLELSVPETLDLLDL  297



>ref|XP_009385975.1| PREDICTED: B2 protein-like [Musa acuminata subsp. malaccensis]
Length=311

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  162   RFKTLPATEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRSITPGLPLFLY  221

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  222   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  281

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E +  + L
Sbjct  282   LHHYDGPKFRLELSVTETLQLLDL  305



>ref|XP_008450102.1| PREDICTED: B2 protein [Cucumis melo]
 ref|XP_008450103.1| PREDICTED: B2 protein [Cucumis melo]
Length=304

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C  LEEDSFRP+
Sbjct  213   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCRALEEDSFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  273   LHHYDGPKFRLELSIPETLDLLDL  296



>dbj|BAD88058.1| putative GDA2 protein [Oryza sativa Japonica Group]
 dbj|BAD88118.1| putative GDA2 protein [Oryza sativa Japonica Group]
 dbj|BAG90462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97603.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54784.1| hypothetical protein OsJ_02182 [Oryza sativa Japonica Group]
Length=352

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR+E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  202   RFKTLPASEALPRDEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  261

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V TRK+ +PLEED+FRPI
Sbjct  262   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVATRKIYDPLEEDAFRPI  321

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  322   LHHYDGPKFRLELSVAEALSLLDIF  346



>ref|XP_010315914.1| PREDICTED: B2 protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LP+NE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  180   RFKTLPAAETLPKNEVLGGYIFVCNNDTMQEDLKRLLFGLPPRYRDSVRAITPGLPLFLY  239

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC PLEED+FRP+
Sbjct  240   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCNPLEEDAFRPV  299

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  300   LHHYDGPKFRLELSIPETLDLLDL  323



>gb|EEC70863.1| hypothetical protein OsI_02376 [Oryza sativa Indica Group]
Length=351

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR+E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  201   RFKTLPASEALPRDEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  260

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V TRK+ +PLEED+FRPI
Sbjct  261   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVATRKIYDPLEEDAFRPI  320

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  321   LHHYDGPKFRLELSVAEALSLLDIF  345



>ref|XP_010248997.1| PREDICTED: B2 protein-like [Nelumbo nucifera]
Length=310

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPSTETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  221   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +  + L
Sbjct  281   LHHYDGPKFRLELSVPETLALLDL  304



>ref|XP_009420608.1| PREDICTED: B2 protein-like [Musa acuminata subsp. malaccensis]
Length=310

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPSTEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  221   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E +  + L
Sbjct  281   LHHYDGPKFRLELSISETLQLLDL  304



>ref|XP_010250724.1| PREDICTED: B2 protein [Nelumbo nucifera]
Length=305

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  156   RFKTLPSTETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  215

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  216   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  275

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE +  + L
Sbjct  276   LHHYDGPKFRLELSVPETLALLDL  299



>gb|AFK39720.1| unknown [Lotus japonicus]
Length=301

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKR+LFGLP RYRDSVR ITPGLPLFLY
Sbjct  150   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRRLFGLPPRYRDSVRAITPGLPLFLY  209

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R +C+ LEEDSFRP+
Sbjct  210   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRTICKALEEDSFRPV  269

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  270   LHHYDGPKFRLELSVPETLDLLDL  293



>ref|XP_010908291.1| PREDICTED: B2 protein-like [Elaeis guineensis]
 ref|XP_010908292.1| PREDICTED: B2 protein-like [Elaeis guineensis]
 ref|XP_010908293.1| PREDICTED: B2 protein-like [Elaeis guineensis]
Length=310

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPSTEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  221   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKICKPLEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E ++ + L
Sbjct  281   LHHYDGPKFRLELSMAETLSLLDL  304



>gb|AIZ68175.1| B2 protein-like protein [Galtonia saundersiae]
Length=306

 Score =   261 bits (668),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  157   RFKTLPSTEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  216

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  217   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  276

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  277   LHHYDGPKFRLELSIAETLSLLDL  300



>ref|XP_008812426.1| PREDICTED: B2 protein-like [Phoenix dactylifera]
Length=308

 Score =   261 bits (667),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  159   RFKTLPSTEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  218

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  219   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  278

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E ++ + L
Sbjct  279   LHHYDGPKFRLELSVAETLSLLDL  302



>gb|KGN58174.1| hypothetical protein Csa_3G585860 [Cucumis sativus]
Length=373

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  222   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  281

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C  LEEDSFRP+
Sbjct  282   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCRALEEDSFRPV  341

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  342   LHHYDGPKFRLELSIPETLDLLDL  365



>ref|XP_002509516.1| B2 protein, putative [Ricinus communis]
 gb|EEF50903.1| B2 protein, putative [Ricinus communis]
Length=304

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  153   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  212

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  213   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  272

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  273   LHHYDGPKFRLELSIPETLDLLDL  296



>gb|ACL53056.1| unknown [Zea mays]
Length=247

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR + +GGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  97    RFKTLPASEALPRGQAIGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  156

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  157   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  216

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  217   LHHYDGPKFRLELSVTEALALLDIF  241



>ref|NP_001055951.1| Os05g0498700 [Oryza sativa Japonica Group]
 gb|AAT44288.1| putative B2 protein [Oryza sativa Japonica Group]
 gb|AAT93853.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17865.1| Os05g0498700 [Oryza sativa Japonica Group]
 gb|EEC79468.1| hypothetical protein OsI_20486 [Oryza sativa Indica Group]
 gb|EEE64243.1| hypothetical protein OsJ_19076 [Oryza sativa Japonica Group]
 gb|AGT42309.1| B2 protein [Oryza sativa Japonica Group]
Length=314

 Score =   261 bits (667),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR I PGLPLFLY
Sbjct  165   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAIIPGLPLFLY  224

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  225   NYTTHQLHGVFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKPLEEDAFRPV  284

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  285   LHHYDGPKFRLELSIAETLSLLDL  308



>dbj|BAJ90431.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  160   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  219

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R++C+ LEED+FRP+
Sbjct  220   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRRLCKALEEDAFRPV  279

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  280   LHHYDGPKFRLELSIAETLSLLDL  303



>ref|XP_010554108.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
Length=291

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGY+FVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  141   RFKTLPASEILPRNEVLGGYVFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  200

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGGTNIDPTAWEDKK +GESRFPAQVR+  R +C+ LEED+FRP+
Sbjct  201   NYTTHQLHGIFEATSFGGTNIDPTAWEDKKCKGESRFPAQVRIRVRNICKALEEDAFRPV  260

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  261   LHHYDGPKFRLELSVPETLDLLDL  284



>gb|AFG73687.1| putative gda-1 [Triticum urartu]
 gb|EMS62005.1| hypothetical protein TRIUR3_22557 [Triticum urartu]
Length=310

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGVFEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R++C+ LEED+FRP+
Sbjct  221   NYTTHQLHGVFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRRLCKALEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+I E ++ + L
Sbjct  281   LHHYDGPKFRLELSIAETLSLLDL  304



>ref|XP_004968944.1| PREDICTED: B2 protein-like [Setaria italica]
Length=349

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR E VGGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  199   RFKTLPASEALPRGEAVGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  258

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  259   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  318

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  319   LHHYDGPKFRLELSVTEALALLDIF  343



>ref|XP_001752539.1| predicted protein [Physcomitrella patens]
 gb|EDQ82778.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFK+LP AE LPRN T+GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR I PGLPLFLY
Sbjct  27    RFKSLPSAEVLPRNVTLGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRTIQPGLPLFLY  86

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK C+PLEEDSFRP+
Sbjct  87    NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCRGESRFPAQVRTRIRKQCKPLEEDSFRPV  146

Query  645   LHHYDGPKFRLELNIPEVI  589
             LHHYDGPKFRL+L++PEV+
Sbjct  147   LHHYDGPKFRLQLSVPEVV  165



>ref|XP_006644279.1| PREDICTED: B2 protein-like [Oryza brachyantha]
Length=350

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR+E +GGYIFVCNNDTM+ENLKRQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  200   RFKTLPASEALPRDEAIGGYIFVCNNDTMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLY  259

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV+V TR++ +PLEED+FRPI
Sbjct  260   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVKVATRRIYDPLEEDAFRPI  319

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  320   LHHYDGPKFRLELSVAEALSLLDIF  344



>ref|XP_009620343.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis]
 ref|XP_009620344.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis]
Length=300

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LP+NE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPSAETLPKNEVLGGYIFVCNNDTMQEDLKRLLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  R+VC+PLEED+FRP+
Sbjct  209   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVREVCKPLEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|XP_002976913.1| hypothetical protein SELMODRAFT_105781, partial [Selaginella 
moellendorffii]
 ref|XP_002980634.1| hypothetical protein SELMODRAFT_112819, partial [Selaginella 
moellendorffii]
 gb|EFJ18285.1| hypothetical protein SELMODRAFT_112819, partial [Selaginella 
moellendorffii]
 gb|EFJ22023.1| hypothetical protein SELMODRAFT_105781, partial [Selaginella 
moellendorffii]
Length=164

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E LPRNET+GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR I PGLPLFLY
Sbjct  14    RFKTLPPSEMLPRNETLGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRAIQPGLPLFLY  73

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHGV+EAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R   +PLEED+FRP+
Sbjct  74    NYTTHQLHGVYEAASFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRMNYKPLEEDAFRPV  133

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRL+L++PE +  + LF
Sbjct  134   LHHYDGPKFRLQLSVPETLMLLDLF  158



>ref|XP_011012345.1| PREDICTED: B2 protein-like [Populus euphratica]
Length=302

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDT QE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPATETLPRNEVLGGYIFVCNNDTRQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  211   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLCKALEEDAFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  271   LHHYDGPKFRLELSVPETLDLLDL  294



>gb|ABK22365.1| unknown [Picea sitchensis]
Length=273

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  124   RFKTLPSSEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRAITPGLPLFLY  183

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG ++A SFGG+NIDPTAWEDKK +GESRFPAQVR+  +KVC+PLEED+FRPI
Sbjct  184   NYTTHQLHGTYQAISFGGSNIDPTAWEDKKCKGESRFPAQVRIRVKKVCKPLEEDAFRPI  243

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRL+L++PE +  + LF
Sbjct  244   LHHYDGPKFRLQLSVPETLALLDLF  268



>ref|XP_002963637.1| hypothetical protein SELMODRAFT_26766, partial [Selaginella moellendorffii]
 ref|XP_002974725.1| hypothetical protein SELMODRAFT_16563, partial [Selaginella moellendorffii]
 gb|EFJ24245.1| hypothetical protein SELMODRAFT_16563, partial [Selaginella moellendorffii]
 gb|EFJ35508.1| hypothetical protein SELMODRAFT_26766, partial [Selaginella moellendorffii]
Length=157

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E LPR+E +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR I PGLPLFLY
Sbjct  10    RFKTLPPSETLPRSEVLGGYIFVCNNDTMQEDLKRQLFGLPQRYRDSVRAIQPGLPLFLY  69

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG++EA SFGG+NID TAWEDKK +GESRFPAQVR   RK C+ LEED+FRPI
Sbjct  70    NYSTHQLHGIYEATSFGGSNIDATAWEDKKCRGESRFPAQVRTRVRKACKALEEDAFRPI  129

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRL+L++PE +  + LF
Sbjct  130   LHHYDGPKFRLQLSVPETLKLLDLF  154



>ref|XP_009394121.1| PREDICTED: B2 protein-like [Musa acuminata subsp. malaccensis]
Length=344

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP EALPRNE +GGYIFVCNN+TM ENL RQLFGLP+RYRDSVR I PGLPLFLY
Sbjct  194   RFKTLPPGEALPRNEAIGGYIFVCNNETMPENLTRQLFGLPSRYRDSVRAIKPGLPLFLY  253

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQL+G+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRVVTR++ +PLEED+FRPI
Sbjct  254   NYSTHQLYGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRRIYDPLEEDAFRPI  313

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+ E +  + +F
Sbjct  314   LHHYDGPKFRLELNVEEALKLLDIF  338



>ref|XP_002269664.1| PREDICTED: B2 protein [Vitis vinifera]
Length=302

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  152   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  211

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  R +C+ LEED+FRP+
Sbjct  212   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRNLCKALEEDAFRPV  271

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  272   LHHYDGPKFRLELSVPETLDLLDL  295



>ref|XP_010680131.1| PREDICTED: B2 protein [Beta vulgaris subsp. vulgaris]
 ref|XP_010680132.1| PREDICTED: B2 protein [Beta vulgaris subsp. vulgaris]
 ref|XP_010680133.1| PREDICTED: B2 protein [Beta vulgaris subsp. vulgaris]
 ref|XP_010680134.1| PREDICTED: B2 protein [Beta vulgaris subsp. vulgaris]
Length=300

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  151   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA+SFGG+NIDPTAWEDKK +GESRFPAQVR+  R +C+ LEED+FRP+
Sbjct  211   NYTTHQLHGIFEASSFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRSLCKALEEDAFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E +  + L
Sbjct  271   LHHYDGPKFRLELSVSETLELLDL  294



>ref|XP_006395485.1| hypothetical protein EUTSA_v10004700mg [Eutrema salsugineum]
 gb|ESQ32771.1| hypothetical protein EUTSA_v10004700mg [Eutrema salsugineum]
Length=294

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  144   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRHLFGLPPRYRDSVRAITPGLPLFLY  203

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  204   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  263

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  264   LHHYDGPKFRLELSVPETLDLLDL  287



>ref|XP_006447065.1| hypothetical protein CICLE_v10016061mg [Citrus clementina]
 ref|XP_006447066.1| hypothetical protein CICLE_v10016061mg [Citrus clementina]
 ref|XP_006470065.1| PREDICTED: B2 protein-like isoform X1 [Citrus sinensis]
 ref|XP_006470066.1| PREDICTED: B2 protein-like isoform X2 [Citrus sinensis]
 gb|ESR60305.1| hypothetical protein CICLE_v10016061mg [Citrus clementina]
 gb|ESR60306.1| hypothetical protein CICLE_v10016061mg [Citrus clementina]
Length=305

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA  FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  214   NYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  273

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  274   LHHYDGPKFRLELSVPETLDLMDL  297



>ref|XP_008792649.1| PREDICTED: B2 protein-like [Phoenix dactylifera]
Length=310

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  161   RFKTLPSTEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  220

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  221   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  280

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E ++ + L
Sbjct  281   LHHYDGPKFRLELSMTETLSLLDL  304



>emb|CAA04664.1| hypothetical protein [Citrus x paradisi]
 gb|KDO63931.1| hypothetical protein CISIN_1g021938mg [Citrus sinensis]
 gb|KDO63932.1| hypothetical protein CISIN_1g021938mg [Citrus sinensis]
 gb|KDO63933.1| hypothetical protein CISIN_1g021938mg [Citrus sinensis]
 gb|KDO63934.1| hypothetical protein CISIN_1g021938mg [Citrus sinensis]
Length=305

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA  FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  214   NYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  273

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  274   LHHYDGPKFRLELSVPETLDLMDL  297



>ref|NP_189345.1| DCD (Development and Cell Death) domain protein [Arabidopsis 
thaliana]
 dbj|BAB01090.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24231.1| AT3g27090/MOJ10_18 [Arabidopsis thaliana]
 gb|AAM65351.1| AT3g27090/MOJ10_18 [Arabidopsis thaliana]
 gb|AEE77265.1| DCD (Development and Cell Death) domain protein [Arabidopsis 
thaliana]
Length=296

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  146   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  205

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  206   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  265

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  266   LHHYDGPKFRLELSVPETLDLLDL  289



>ref|XP_010550203.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
 ref|XP_010550204.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
 ref|XP_010550205.1| PREDICTED: B2 protein-like [Tarenaya hassleriana]
Length=278

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  126   RFKTLPASECLPRNEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  185

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  186   NYTTHQLHGIFEATSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  245

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE +  + L
Sbjct  246   LHHYDGPKFRLELSIPETLALMDL  269



>gb|KDP46281.1| hypothetical protein JCGZ_10121 [Jatropha curcas]
Length=306

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E L RNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  155   RFKTLPATETLRRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  214

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  215   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  274

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  275   LHHYDGPKFRLELSVPETLDLLDL  298



>gb|AAM64572.1| gda-1, putative [Arabidopsis thaliana]
Length=296

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  146   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  205

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  206   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  265

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  266   LHHYDGPKFRLELSVPETLDLLDL  289



>ref|XP_010502669.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=305

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  155   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  214

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  215   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  274

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  275   LHHYDGPKFRLELSVPETLDLLDL  298



>ref|XP_010514392.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=305

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  155   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  214

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  215   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  274

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  275   LHHYDGPKFRLELSVPETLDLLDL  298



>emb|CDY52398.1| BnaC07g48970D [Brassica napus]
Length=295

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  145   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRHLFGLPPRYRDSVRAITPGLPLFLY  204

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  205   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  264

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  265   LHHYDGPKFRLELSVPETLDLLDL  288



>ref|XP_002875357.1| hypothetical protein ARALYDRAFT_484493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51616.1| hypothetical protein ARALYDRAFT_484493 [Arabidopsis lyrata subsp. 
lyrata]
Length=295

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  145   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  204

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  205   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  264

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  265   LHHYDGPKFRLELSVPETLDLLDL  288



>ref|XP_009783276.1| PREDICTED: B2 protein-like [Nicotiana sylvestris]
Length=294

 Score =   258 bits (658),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  145   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  204

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQL+G FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ +PLEED+FRP+
Sbjct  205   NYTTHQLYGTFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLGKPLEEDAFRPV  264

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  265   LHHYDGPKFRLELSVPETLDLLDL  288



>ref|XP_006357194.1| PREDICTED: B2 protein-like [Solanum tuberosum]
Length=298

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RY+DSVR ITPGLPLFLY
Sbjct  149   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYKDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+
Sbjct  209   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKLGKALEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|NP_001130162.1| uncharacterized LOC100191256 [Zea mays]
 gb|ACF78301.1| unknown [Zea mays]
 gb|ACF85148.1| unknown [Zea mays]
 gb|ACF88332.1| unknown [Zea mays]
 gb|ACF88393.1| unknown [Zea mays]
 gb|ACL53144.1| unknown [Zea mays]
 gb|ACN33596.1| unknown [Zea mays]
 tpg|DAA59031.1| TPA: N-rich protein [Zea mays]
Length=365

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR + +GGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  215   RFKTLPASEALPRGQAIGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  274

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  275   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  334

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  335   LHHYDGPKFRLELSVTEALALLDIF  359



>emb|CDY20062.1| BnaA09g01890D [Brassica napus]
Length=265

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQ++LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  115   RFKTLPASETLPRNEVLGGYIFVCNNDTMQDDLKRHLFGLPPRYRDSVRAITPGLPLFLY  174

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  175   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  234

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL +PE ++ + L
Sbjct  235   LHHYDGPKFRLELTVPETLDLLDL  258



>ref|XP_009111555.1| PREDICTED: B2 protein-like [Brassica rapa]
Length=265

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQ++LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  115   RFKTLPASETLPRNEVLGGYIFVCNNDTMQDDLKRHLFGLPPRYRDSVRAITPGLPLFLY  174

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  175   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  234

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL +PE ++ + L
Sbjct  235   LHHYDGPKFRLELTVPETLDLLDL  258



>ref|NP_001183805.1| uncharacterized protein LOC100502398 [Zea mays]
 gb|ACR38363.1| unknown [Zea mays]
 gb|AFW82985.1| hypothetical protein ZEAMMB73_457417 [Zea mays]
Length=342

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR E +GGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  192   RFKTLPASEALPRGEAIGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  251

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+F+AASFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  252   NYSTHQLHGIFKAASFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  311

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  312   LHHYDGPKFRLELSVAETLALLDIF  336



>ref|XP_006373229.1| hypothetical protein POPTR_0017s09910g [Populus trichocarpa]
 gb|ERP51026.1| hypothetical protein POPTR_0017s09910g [Populus trichocarpa]
Length=300

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  149   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+
Sbjct  209   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRKLYKALEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  269   LHHYDGPKFRLELSVPETLDLLDL  292



>ref|XP_006291586.1| hypothetical protein CARUB_v10017741mg [Capsella rubella]
 gb|EOA24484.1| hypothetical protein CARUB_v10017741mg [Capsella rubella]
Length=296

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  146   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDMKRNLFGLPPRYRDSVRAITPGLPLFLY  205

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  206   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  265

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE I  + L
Sbjct  266   LHHYDGPKFRLELSVPETIQLLDL  289



>ref|XP_010425448.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=304

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE++KR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDMKRHLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  214   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  273

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  274   LHHYDGPKFRLELSVPETLDLLDL  297



>ref|XP_009601168.1| PREDICTED: B2 protein-like [Nicotiana tomentosiformis]
Length=295

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  146   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  205

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQL+G FEAASFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ +PLEED+FRP+
Sbjct  206   NYTTHQLYGTFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLGKPLEEDAFRPV  265

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  266   LHHYDGPKFRLELSVPETLDLLDL  289



>ref|NP_001150270.1| N-rich protein [Zea mays]
 gb|ACG38454.1| N-rich protein [Zea mays]
Length=363

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR + +GGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  213   RFKTLPASEALPRGQAIGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  272

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  273   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  332

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  333   LHHYDGPKFRLELSVTEALALLDIF  357



>ref|XP_009151992.1| PREDICTED: B2 protein [Brassica rapa]
Length=294

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  144   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRCLFGLPPRYRDSVRAITPGLPLFLY  203

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  204   NYTTHQLHGIFEATTFGGTNIDATAWEDKKVKGESRFPAQVRIRVRKICKALEEDSFRPV  263

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  264   LHHYDGPKFRLELSVPETLDLLDL  287



>ref|XP_004233294.1| PREDICTED: B2 protein-like [Solanum lycopersicum]
Length=302

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RY+DSVR ITPGLPLFLY
Sbjct  149   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYKDSVRAITPGLPLFLY  208

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGG+NIDPTAWEDKK +GESRFPAQV++  RK+   LEED+FRP+
Sbjct  209   NYTTHQLHGIFEATSFGGSNIDPTAWEDKKCKGESRFPAQVKIRIRKLGRALEEDAFRPV  268

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++PE ++ + LF
Sbjct  269   LHHYDGPKFRLELSVPETLDLMDLF  293



>gb|KDO63935.1| hypothetical protein CISIN_1g021938mg [Citrus sinensis]
Length=292

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  154   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  213

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA  FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ LEED+FRP+
Sbjct  214   NYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAFRPV  273

Query  645   LHHYDGPKFRLELNIPEV  592
             LHHYDGPKFRLEL++PEV
Sbjct  274   LHHYDGPKFRLELSVPEV  291



>ref|XP_009129450.1| PREDICTED: B2 protein-like [Brassica rapa]
Length=262

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTM+E+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  112   RFKTLPASETLPRNEVLGGYIFVCNNDTMEEDLKRHLFGLPPRYRDSVRAITPGLPLFLY  171

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID  AWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  172   NYTTHQLHGIFEATTFGGTNIDAMAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  231

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  232   LHHYDGPKFRLELSVPETLDLLDL  255



>ref|XP_002455781.1| hypothetical protein SORBIDRAFT_03g025160 [Sorghum bicolor]
 gb|EES00901.1| hypothetical protein SORBIDRAFT_03g025160 [Sorghum bicolor]
Length=367

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +EALPR + +GGYIFVCNNDTM ENL+R+LFGLP+RYRDSVR I PGLPLFLY
Sbjct  217   RFKTLPASEALPRGQAIGGYIFVCNNDTMDENLRRELFGLPSRYRDSVRAIRPGLPLFLY  276

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEA SFGGTNIDPTAWEDKK  GESRFPAQVRV TRK+ +PLEED+FRPI
Sbjct  277   NYSTHQLHGIFEAVSFGGTNIDPTAWEDKKCPGESRFPAQVRVATRKIYDPLEEDAFRPI  336

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E +  + +F
Sbjct  337   LHHYDGPKFRLELSVTEALALLDIF  361



>emb|CDY28495.1| BnaC02g36650D [Brassica napus]
Length=283

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTM+E+LKR LFGLP RY+DSVR ITPGLPLFLY
Sbjct  133   RFKTLPASETLPRNEVLGGYIFVCNNDTMEEDLKRHLFGLPPRYKDSVRAITPGLPLFLY  192

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  193   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  252

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  253   LHHYDGPKFRLELSVPETLDLLDL  276



>emb|CDY00168.1| BnaC09g01330D [Brassica napus]
Length=271

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPR+E +GGYIFVCNNDTMQ++LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  121   RFKTLPASETLPRDEVLGGYIFVCNNDTMQDDLKRHLFGLPPRYRDSVRAITPGLPLFLY  180

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  181   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  240

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL +PE ++ + L
Sbjct  241   LHHYDGPKFRLELTVPETLDLLDL  264



>ref|XP_011007442.1| PREDICTED: B2 protein isoform X2 [Populus euphratica]
 ref|XP_011007443.1| PREDICTED: B2 protein isoform X2 [Populus euphratica]
Length=299

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  148   RFKTLPATEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  207

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK+ + L+ED+FRP+
Sbjct  208   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRTRIRKLYKALDEDAFRPV  267

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  268   LHHYDGPKFRLELSVPETLDLLDL  291



>ref|XP_002300107.1| hypothetical protein POPTR_0001s33790g [Populus trichocarpa]
 gb|EEE84912.1| hypothetical protein POPTR_0001s33790g [Populus trichocarpa]
Length=299

 Score =   255 bits (652),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  148   RFKTLPATEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  207

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK+ + L+ED+FRP+
Sbjct  208   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRTRIRKLYKALDEDAFRPV  267

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  268   LHHYDGPKFRLELSVPETLDLLDL  291



>ref|XP_011007441.1| PREDICTED: B2 protein isoform X1 [Populus euphratica]
Length=303

 Score =   255 bits (652),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  152   RFKTLPATEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  211

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEAASFGG+NIDPTAWEDKK +GESRFPAQVR   RK+ + L+ED+FRP+
Sbjct  212   NYTTHQLHGIFEAASFGGSNIDPTAWEDKKCKGESRFPAQVRTRIRKLYKALDEDAFRPV  271

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  272   LHHYDGPKFRLELSVPETLDLLDL  295



>ref|XP_010930192.1| PREDICTED: B2 protein-like [Elaeis guineensis]
Length=395

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  246   RFKTLPSTEMLPRNEILGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPLFLY  305

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+PLEED+FRP+
Sbjct  306   NYTTHQLHGIFEAVSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKPLEEDAFRPV  365

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++ E ++ + L
Sbjct  366   LHHYDGPKFRLELSVAETLSLLDL  389



>emb|CDY34179.1| BnaA02g28610D [Brassica napus]
Length=264

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +G YIFVCNNDTM+E+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  114   RFKTLPASETLPRNEVLGRYIFVCNNDTMEEDLKRHLFGLPPRYRDSVRAITPGLPLFLY  173

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  174   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  233

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  234   LHHYDGPKFRLELSVPETLDLLDL  257



>ref|XP_006858170.1| hypothetical protein AMTR_s00062p00149140 [Amborella trichopoda]
 gb|ERN19637.1| hypothetical protein AMTR_s00062p00149140 [Amborella trichopoda]
Length=321

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPR+ T+GGYIFVCNNDTMQE+LK+QLFGLP RYRDSVR ITPGLPLFLY
Sbjct  172   RFKTLPSTEMLPRDATLGGYIFVCNNDTMQEDLKKQLFGLPQRYRDSVRAITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA SFGG+NIDPTAWEDKK +GESRFPAQVR+  RK+C+ L+ED+FRP+
Sbjct  232   NYTTHQLHGIFEATSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALDEDAFRPV  291

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE +  + L
Sbjct  292   LHHYDGPKFRLELSIPETLALLDL  315



>emb|CDY13680.1| BnaA06g32430D [Brassica napus]
Length=373

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  223   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRCLFGLPPRYRDSVRAITPGLPLFLY  282

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQVR+  RK+C+ LEEDSFRP+
Sbjct  283   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVRIRVRKICKALEEDSFRPV  342

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL++PE ++ + L
Sbjct  343   LHHYDGPKFRLELSVPETLDLLDL  366



>ref|XP_006399926.1| hypothetical protein EUTSA_v10014323mg [Eutrema salsugineum]
 gb|ESQ41379.1| hypothetical protein EUTSA_v10014323mg [Eutrema salsugineum]
Length=282

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  132   RFKTLPATECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRTITPGLPLFLY  191

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  RKVC+ LEED+FRP+
Sbjct  192   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKVCKALEEDAFRPV  251

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  252   LHHYDGPKFRLELTIPETLALLDL  275



>gb|EMT00487.1| hypothetical protein F775_26486 [Aegilops tauschii]
Length=335

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 5/149 (3%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPARYRDSVR ITPGLPLFLY
Sbjct  181   RFKTLPTSEMLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPARYRDSVRAITPGLPLFLY  240

Query  825   NYSTHQLHGVFE-----AASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEED  661
             NY+THQLHGVFE     AASFGG+NIDPTAWEDKK +GESRFPAQVR+  R++C+ LEED
Sbjct  241   NYTTHQLHGVFEIFLSQAASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRRLCKALEED  300

Query  660   SFRPILHHYDGPKFRLELNIPEVINYITL  574
             +FRP+LHHYDGPKFRLEL+I E ++ + L
Sbjct  301   AFRPVLHHYDGPKFRLELSIAETLSLLDL  329



>ref|XP_006441802.1| hypothetical protein CICLE_v10023823mg [Citrus clementina]
 gb|ESR55042.1| hypothetical protein CICLE_v10023823mg [Citrus clementina]
Length=159

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             +KTLPP E LPRNE +GGYIFVCNN+TMQE+L+RQLFGLP +Y+DSVR ITPGLPLFLYN
Sbjct  11    YKTLPPGEMLPRNEVLGGYIFVCNNETMQEDLRRQLFGLPQKYKDSVRAITPGLPLFLYN  70

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y++HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQVR+  +K+C+PLEED+FRPIL
Sbjct  71    YTSHQLHGVFQAVSFGGSNIDPTAWEDKKCRGESRFPAQVRIRIKKICKPLEEDAFRPIL  130

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  131   YHYDGPKFRLQLSVPEALALLDLF  154



>gb|KDO51371.1| hypothetical protein CISIN_1g0260401mg, partial [Citrus sinensis]
Length=225

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             +KTLPP E LPRNE +GGYIFVCNN+TMQE+L+RQLFGLP +Y+DSVR ITPGLPLFLYN
Sbjct  77    YKTLPPGEMLPRNEVLGGYIFVCNNETMQEDLRRQLFGLPQKYKDSVRAITPGLPLFLYN  136

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y++HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQVR+  +K+C+PLEED+FRPIL
Sbjct  137   YTSHQLHGVFQAVSFGGSNIDPTAWEDKKCRGESRFPAQVRIRIKKICKPLEEDAFRPIL  196

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  197   YHYDGPKFRLQLSVPEALALLDLF  220



>ref|XP_006478315.1| PREDICTED: B2 protein-like [Citrus sinensis]
Length=213

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             +KTLPP E LPRNE +GGYIFVCNN+TMQE+L+RQLFGLP +Y+DSVR ITPGLPLFLYN
Sbjct  65    YKTLPPGEMLPRNEVLGGYIFVCNNETMQEDLRRQLFGLPQKYKDSVRAITPGLPLFLYN  124

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y++HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQVR+  +K+C+PLEED+FRPIL
Sbjct  125   YTSHQLHGVFQAVSFGGSNIDPTAWEDKKCRGESRFPAQVRIRIKKICKPLEEDAFRPIL  184

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  185   YHYDGPKFRLQLSVPEALALLDLF  208



>ref|XP_006371358.1| hypothetical protein POPTR_0019s09410g [Populus trichocarpa]
 gb|ERP49155.1| hypothetical protein POPTR_0019s09410g [Populus trichocarpa]
Length=244

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             +KTLPPAE LPRNE +GGYIFVCNN+TMQE+L+RQLFGLP +YRDSVR ITPGLPLFLYN
Sbjct  96    YKTLPPAELLPRNEVMGGYIFVCNNETMQEDLRRQLFGLPHKYRDSVRAITPGLPLFLYN  155

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y+ HQLHGVF+A SFGG+NI+PTAWEDKK +GESRFPAQVR+  +K C+PLEED+FRPIL
Sbjct  156   YTCHQLHGVFQAVSFGGSNIEPTAWEDKKCKGESRFPAQVRIGFKKKCKPLEEDAFRPIL  215

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  216   YHYDGPKFRLQLSVPEALALLDLF  239



>emb|CAN64637.1| hypothetical protein VITISV_040037 [Vitis vinifera]
Length=217

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             ++TLPP+E LPRNE +GGYIFVCNNDTMQE+L+RQLFGLP +Y+DSVR ITPGLPLFLYN
Sbjct  69    YRTLPPSEMLPRNEALGGYIFVCNNDTMQEDLRRQLFGLPQKYKDSVRAITPGLPLFLYN  128

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y+ HQLHGV++A SFGG+NIDPTAWEDKK +GESRFPAQVR+ T+K C+PL+ED+FRPIL
Sbjct  129   YTAHQLHGVYQAMSFGGSNIDPTAWEDKKCRGESRFPAQVRIRTKKKCKPLDEDAFRPIL  188

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  189   YHYDGPKFRLQLSVPEALALLDLF  212



>ref|XP_002265043.1| PREDICTED: B2 protein [Vitis vinifera]
 emb|CBI16975.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             ++TLPP+E LPRNE +GGYIFVCNNDTMQE+L+RQLFGLP +Y+DSVR ITPGLPLFLYN
Sbjct  67    YRTLPPSEMLPRNEALGGYIFVCNNDTMQEDLRRQLFGLPQKYKDSVRAITPGLPLFLYN  126

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y+ HQLHGV++A SFGG+NIDPTAWEDKK +GESRFPAQVR+ T+K C+PL+ED+FRPIL
Sbjct  127   YTAHQLHGVYQAMSFGGSNIDPTAWEDKKCRGESRFPAQVRIRTKKKCKPLDEDAFRPIL  186

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  187   YHYDGPKFRLQLSVPEALALLDLF  210



>ref|XP_010999500.1| PREDICTED: B2 protein-like [Populus euphratica]
Length=243

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  1002  FKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYN  823
             +KTLPPAE LPRNE +GGYIFVCNN+TMQE+L+RQLFGLP +YRDSVR ITPGLPLFLYN
Sbjct  95    YKTLPPAELLPRNEVMGGYIFVCNNETMQEDLRRQLFGLPHKYRDSVRAITPGLPLFLYN  154

Query  822   YSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPIL  643
             Y+ HQLHGVF+A SFGG+NI+PTAWEDKK +GESRFPAQVR+  +K C+PLEED+FRPIL
Sbjct  155   YTCHQLHGVFQAVSFGGSNIEPTAWEDKKCKGESRFPAQVRIGFKKKCKPLEEDAFRPIL  214

Query  642   HHYDGPKFRLELNIPEVINYITLF  571
             +HYDGPKFRL+L++PE +  + LF
Sbjct  215   YHYDGPKFRLQLSVPEALALLDLF  238



>ref|XP_010420038.1| PREDICTED: B2 protein-like [Camelina sativa]
 ref|XP_010420039.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=280

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  130   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRTITPGLPLFLY  189

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+
Sbjct  190   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLYKALEEDAFRPV  249

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  250   LHHYDGPKFRLELTIPETLALLDL  273



>ref|XP_010453531.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=283

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  133   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRTITPGLPLFLY  192

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+
Sbjct  193   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLYKALEEDAFRPV  252

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  253   LHHYDGPKFRLELTIPETLALLDL  276



>ref|XP_006288387.1| hypothetical protein CARUB_v10001637mg [Capsella rubella]
 gb|EOA21285.1| hypothetical protein CARUB_v10001637mg [Capsella rubella]
Length=286

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR+ITPGLPLFLY
Sbjct  136   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRKITPGLPLFLY  195

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  R++ + LEED+FRP+
Sbjct  196   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRELYKALEEDAFRPV  255

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  256   LHHYDGPKFRLELTIPETLALLDL  279



>ref|XP_002871604.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47863.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LK QLFGLP RYRDSVR ITPGLPLFLY
Sbjct  132   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKHQLFGLPPRYRDSVRTITPGLPLFLY  191

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+
Sbjct  192   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCRGESRFPAQVRIRVRKLYKALEEDAFRPV  251

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  252   LHHYDGPKFRLELTIPETLALLDL  275



>ref|XP_010492213.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=286

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  136   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRTITPGLPLFLY  195

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA +FGG+NIDP AWEDKK +GESRFPAQVR+  RK+ + LEEDSFRP+
Sbjct  196   NYTTHQLHGIFEATTFGGSNIDPFAWEDKKCKGESRFPAQVRIRVRKLYKALEEDSFRPV  255

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL IPE +  + L
Sbjct  256   LHHYDGPKFRLELTIPEKLALLDL  279



>ref|XP_008237821.1| PREDICTED: B2 protein-like [Prunus mume]
Length=176

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -1

Query  999  KTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNY  820
            K+LP AE LPRNE +GGYIFVCNN+TMQE+L RQLFGLP +Y+DSVR ITPGLPLFLYNY
Sbjct  29   KSLPQAEMLPRNEVLGGYIFVCNNETMQEDLHRQLFGLPQKYKDSVRAITPGLPLFLYNY  88

Query  819  STHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILH  640
            + HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQV++  ++ C+PLEED+FRPIL+
Sbjct  89   TAHQLHGVFQAVSFGGSNIDPTAWEDKKCKGESRFPAQVKIRVKERCKPLEEDAFRPILY  148

Query  639  HYDGPKFRLELNIPEVINYITLF  571
            HYDGPKFRL+L++PE +  + LF
Sbjct  149  HYDGPKFRLQLSVPEALALLDLF  171



>ref|NP_001056505.1| Os05g0594100 [Oryza sativa Japonica Group]
 gb|AAV59376.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18419.1| Os05g0594100 [Oryza sativa Japonica Group]
 dbj|BAG97591.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  993  LPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYST  814
            LP +E++P+ E +GGYIFVCNN+TM+ENLKRQLFGLP+RYRDSVR I PGLPLFLYNYST
Sbjct  130  LPASESVPKEEAIGGYIFVCNNETMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLYNYST  189

Query  813  HQLHGVFEAASFGGTNIDPTAWEDKKNQ-GESRFPAQVRVVTRKVCEPLEEDSFRPILHH  637
            HQLHG+FEA SFGG+NIDP AWED K   GESRFPAQVRV TRK+CEPLEED+FRP+LHH
Sbjct  190  HQLHGIFEATSFGGSNIDPGAWEDSKCPGGESRFPAQVRVATRKICEPLEEDAFRPVLHH  249

Query  636  YDGPKFRLELNIPEVINYITLF  571
            YDGPKFRLEL + E ++ + +F
Sbjct  250  YDGPKFRLELTVAEALSLLDIF  271



>gb|AGV54644.1| B2 protein-like protein [Phaseolus vulgaris]
Length=302

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP AE LPRNE +GGYIFVCNNDTMQE+LKRQLFGLP RYR+SVR ITPG+PLFLY
Sbjct  151   RFKTLPAAETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRNSVRAITPGVPLFLY  210

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NY+THQLHG+FEA  FGG+NIDPTAW DKK +GE RFPAQ R+  RK+C+ LE+DSFRP+
Sbjct  211   NYTTHQLHGIFEAPGFGGSNIDPTAWGDKKCKGEKRFPAQGRIRVRKLCKALEKDSFRPV  270

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LH YDGPKFRLEL++P+ ++ + L
Sbjct  271   LHLYDGPKFRLELSVPKTLDLLGL  294



>gb|EAY99263.1| hypothetical protein OsI_21227 [Oryza sativa Indica Group]
Length=277

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  993  LPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYST  814
            LP +E++P+ E +GGYIFVCNN+TM+ENLKRQLFGLP+RYRDSVR I PGLPLFLYNYST
Sbjct  130  LPASESVPKEEAIGGYIFVCNNETMEENLKRQLFGLPSRYRDSVRAIRPGLPLFLYNYST  189

Query  813  HQLHGVFEAASFGGTNIDPTAWEDKKNQ-GESRFPAQVRVVTRKVCEPLEEDSFRPILHH  637
            HQLHG+FEA SFGG+NIDP AWED K   GESRFPAQVRV TRK+CEPLEED+FRP+LHH
Sbjct  190  HQLHGIFEATSFGGSNIDPGAWEDSKCPGGESRFPAQVRVATRKICEPLEEDAFRPVLHH  249

Query  636  YDGPKFRLELNIPEVINYITLF  571
            YDGPKFRLEL + E ++ + +F
Sbjct  250  YDGPKFRLELTVAEALSLLDIF  271



>ref|XP_006836905.1| hypothetical protein AMTR_s00099p00128180 [Amborella trichopoda]
 gb|ERM99758.1| hypothetical protein AMTR_s00099p00128180 [Amborella trichopoda]
Length=239

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  999  KTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNY  820
            KTLP +E LPR+E +GGYIFVCNNDTMQE+L+R LFGLP RY+DSVR+ITPGLPLFLYNY
Sbjct  87   KTLPASEMLPRSERLGGYIFVCNNDTMQEDLRRHLFGLPQRYKDSVREITPGLPLFLYNY  146

Query  819  STHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILH  640
            ++HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQVR+  ++ C PL ED+FRP+LH
Sbjct  147  TSHQLHGVFQADSFGGSNIDPTAWEDKKCKGESRFPAQVRIRVKRRCRPLTEDAFRPVLH  206

Query  639  HYDGPKFRLELNIPEVINYITLF  571
            HYDGPKFRL+L+I E +  + LF
Sbjct  207  HYDGPKFRLQLSIKEALALLDLF  229



>ref|XP_006655658.1| PREDICTED: B2 protein-like [Oryza brachyantha]
Length=249

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             R K L  +E+L + E +GGYIFVCN +TM+ENLKRQLFGLP+RYR+SVR I PGLPLFLY
Sbjct  100   RLKRLAASESLAKEEAMGGYIFVCNKETMEENLKRQLFGLPSRYRESVRAIRPGLPLFLY  159

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
             NYSTHQLHG+FEAASFGG+NIDPTAWED   + +SRFPAQVRV TRK+CEPLEED+FRP+
Sbjct  160   NYSTHQLHGIFEAASFGGSNIDPTAWEDDDTK-QSRFPAQVRVATRKICEPLEEDAFRPV  218

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLEL++ E ++ + +F
Sbjct  219   LHHYDGPKFRLELSVAEAVSLLDIF  243



>ref|XP_007199987.1| hypothetical protein PRUPE_ppa025043mg [Prunus persica]
 gb|EMJ01186.1| hypothetical protein PRUPE_ppa025043mg [Prunus persica]
Length=306

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  999  KTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNY  820
            K+LP AE LPRNE +GGYIFVCNN+TMQE+L RQLFGLP +Y+DSVR ITPGLPLFLYNY
Sbjct  132  KSLPQAEMLPRNEVLGGYIFVCNNETMQEDLHRQLFGLPQKYKDSVRAITPGLPLFLYNY  191

Query  819  STHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILH  640
            + HQLHGVF+A SFGG+NIDPTAWEDKK +GESRFPAQVR+  ++ C+PLEED+FRPIL+
Sbjct  192  TAHQLHGVFQAVSFGGSNIDPTAWEDKKCRGESRFPAQVRIRVKERCKPLEEDAFRPILY  251

Query  639  HYDGPKFRLELNIPEVI  589
            HYDGPKFRL+L++PE+I
Sbjct  252  HYDGPKFRLQLSVPELI  268



>emb|CBI34508.3| unnamed protein product [Vitis vinifera]
Length=122

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  921  MQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  742
            MQENLKRQLFGLP RYRDSVR ITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED
Sbjct  1    MQENLKRQLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  60

Query  741  KKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
            KK  GESRFPAQVRVVTRK+CEP+EEDSFRP+LHHYDGPKFRLELN+PE ++ + +F
Sbjct  61   KKCPGESRFPAQVRVVTRKICEPMEEDSFRPVLHHYDGPKFRLELNVPEALSLLDIF  117



>emb|CDP12181.1| unnamed protein product [Coffea canephora]
Length=121

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  921  MQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  742
            MQENLKRQLFGLP RYRDSVR ITPGLPLFLYNYSTHQLHG+FEAASFGGTNIDP+AWED
Sbjct  1    MQENLKRQLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIFEAASFGGTNIDPSAWED  60

Query  741  KKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
            KKN GESRFPAQVRV+TRK+CEP+EEDSFRPILHHYDGPKFRLEL++PE ++ + +F
Sbjct  61   KKNPGESRFPAQVRVMTRKICEPMEEDSFRPILHHYDGPKFRLELSVPEALSLLDIF  117



>gb|AFK43473.1| unknown [Medicago truncatula]
Length=132

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  921  MQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  742
            M ENLKRQLFGLP RYRDSVR ITPGLPLFLYNY+THQLHGVFEAASFGGTNIDPTAWED
Sbjct  1    MAENLKRQLFGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGVFEAASFGGTNIDPTAWED  60

Query  741  KKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
            KK  GESRFPAQVRV+TRK CEPLEEDSFRP+LHHYDGPKFRLELN+PE +  + +F
Sbjct  61   KKCAGESRFPAQVRVLTRKTCEPLEEDSFRPVLHHYDGPKFRLELNVPEALFLLDIF  117



>gb|EMS65194.1| hypothetical protein TRIUR3_05776 [Triticum urartu]
Length=123

 Score =   212 bits (540),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  921  MQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  742
            M+ENLKRQLFGLP+RYRDSVR I PGLPLFLYNYSTHQLHG+FEAASFGG NIDP AWED
Sbjct  1    MEENLKRQLFGLPSRYRDSVRAIRPGLPLFLYNYSTHQLHGIFEAASFGGANIDPAAWED  60

Query  741  KKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
            KK  GESRFPAQVRV TRK+C+PLEED+FRPILHHYDGPKFRLEL+I E ++ + +F
Sbjct  61   KKCNGESRFPAQVRVATRKICDPLEEDAFRPILHHYDGPKFRLELSITEALSLLDIF  117



>emb|CBI21352.3| unnamed protein product [Vitis vinifera]
Length=123

 Score =   208 bits (529),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  921  MQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED  742
            MQE+LKRQLFGLP RYRDSVR ITPGLPLFLYNY+THQLHG+FEAASFGG+NIDPTAWED
Sbjct  1    MQEDLKRQLFGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGIFEAASFGGSNIDPTAWED  60

Query  741  KKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITL  574
            KK +GESRFPAQVR+  R +C+ LEED+FRP+LHHYDGPKFRLEL++PE ++ + L
Sbjct  61   KKCKGESRFPAQVRIRVRNLCKALEEDAFRPVLHHYDGPKFRLELSVPETLDLLDL  116



>ref|XP_010456526.1| PREDICTED: B2 protein-like [Camelina sativa]
Length=138

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  963  ETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAA  784
            E +  Y+   NNDTM E+LKRQLFGLP RYRDSVR ITPGLPLFLYNY+THQLHG+FEA 
Sbjct  2    EVLRVYVSDXNNDTMLEDLKRQLFGLPPRYRDSVRTITPGLPLFLYNYTTHQLHGIFEAT  61

Query  783  SFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELN  604
            +FGG+NIDPTAWEDKK +GESRFPAQVR+  RK+ + LEED+FRP+LHHYDGPKFRLEL 
Sbjct  62   TFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLYKALEEDAFRPVLHHYDGPKFRLELT  121

Query  603  IPEVINYITL  574
            IPE +  + L
Sbjct  122  IPETLALLDL  131



>gb|EYU34807.1| hypothetical protein MIMGU_mgv1a023616mg [Erythranthe guttata]
Length=268

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 114/151 (75%), Gaps = 17/151 (11%)
 Frame = -1

Query  975  LPRNETVGGYIFVCNNDTMQENLKRQLFG-----LPARYRDSVRQITPGLPLFLYNYSTH  811
            LPR+E +GGYIFVCNNDTM E+LKRQLF        ++Y D VR I PGLPLFLYNY+TH
Sbjct  100  LPRDEVLGGYIFVCNNDTMHEDLKRQLFANYINFFYSKYSDYVRAIIPGLPLFLYNYTTH  159

Query  810  QLHGVFEAA------------SFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLE  667
            QLHG+FE +             FGG+NIDPTAWEDKK +GESRFP QVR   RK+C+PLE
Sbjct  160  QLHGIFEVSESMSMCILLVHSGFGGSNIDPTAWEDKKCKGESRFPPQVRTRVRKLCKPLE  219

Query  666  EDSFRPILHHYDGPKFRLELNIPEVINYITL  574
            ED+FRP+LHHYDGPKF LEL++PE ++ + L
Sbjct  220  EDAFRPVLHHYDGPKFHLELSMPETLDLLDL  250



>gb|ABR25830.1| n-rich protein [Oryza sativa Indica Group]
Length=120

 Score =   196 bits (499),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -1

Query  909  LKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKK-N  733
            LKRQLFGLP+RYRDSVR I PGLPLFLYNYSTHQLHG+FEA SFGG+NIDP AWED K  
Sbjct  1    LKRQLFGLPSRYRDSVRAIRPGLPLFLYNYSTHQLHGIFEATSFGGSNIDPGAWEDSKCP  60

Query  732  QGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPEVINYITLF  571
             GESRFPAQVRV TRK+CEPLEED+FRP+LHHYDGPKFRLEL + E ++ + +F
Sbjct  61   GGESRFPAQVRVATRKICEPLEEDAFRPVLHHYDGPKFRLELTVAEALSLLDIF  114



>gb|KGN53423.1| hypothetical protein Csa_4G052730 [Cucumis sativus]
Length=344

 Score =   204 bits (518),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 108/145 (74%), Gaps = 27/145 (19%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNET+GGYIFVCNNDTMQENLKRQLFG                     
Sbjct  222   RFKTLPPSESLPRNETIGGYIFVCNNDTMQENLKRQLFGS--------------------  261

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
                      +  AASFGGTNIDPTAWEDKK  GESRFPAQVR+VTRK+C+PLEEDSFRPI
Sbjct  262   -------FNMLIAASFGGTNIDPTAWEDKKTPGESRFPAQVRIVTRKICDPLEEDSFRPI  314

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELNIPE ++ + +F
Sbjct  315   LHHYDGPKFRLELNIPEALSLLDIF  339


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN   SF QFSD+LR+Q  +LANLSLNDSIWS SY SKRPEERRNF+
Sbjct  1     MENNPQSFRQFSDQLRVQTGNLANLSLNDSIWSNSYVSKRPEERRNFD  48



>gb|KDO76589.1| hypothetical protein CISIN_1g019701mg [Citrus sinensis]
Length=296

 Score =   202 bits (513),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  188   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  247

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVT  691
             NYSTHQLHG+FEAASFGGTNIDPTAWEDKK  GESRFPAQV  ++
Sbjct  248   NYSTHQLHGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVIFIS  292


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>ref|XP_007040572.1| DCD domain protein isoform 2 [Theobroma cacao]
 gb|EOY25073.1| DCD domain protein isoform 2 [Theobroma cacao]
Length=272

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  172   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRAITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQV  703
             NYSTHQLHGVFEAASFGGTNIDPTAWEDKK  GESRFP ++
Sbjct  232   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPEEI  272


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 9/85 (11%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN Q SFWQFSD+LR+Q ++LANLSLNDSIWS SY SKRP+ERRNF++    +  ++  
Sbjct  1     MENNQQSFWQFSDQLRVQNSNLANLSLNDSIWSNSYVSKRPDERRNFDIRVGGEVNSVNN  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGW  1324
                           S++N F+NDGW
Sbjct  61    LKPKV---------SDFNSFNNDGW  76



>gb|KEH35155.1| DCD (development and cell death) domain protein [Medicago truncatula]
Length=272

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             +FKTLPP+E+LPRNET+GGYIFVCNNDTM ENLKRQ+FGLP RYRDSVR ITPGLPLFLY
Sbjct  172   KFKTLPPSESLPRNETIGGYIFVCNNDTMAENLKRQIFGLPPRYRDSVRTITPGLPLFLY  231

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQV  703
             NYSTHQLHG+FEAASFGG+NIDPTAWEDKK  GESRFPAQV
Sbjct  232   NYSTHQLHGIFEAASFGGSNIDPTAWEDKKCPGESRFPAQV  272



>gb|EEE64908.1| hypothetical protein OsJ_19768 [Oryza sativa Japonica Group]
Length=258

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 20/142 (14%)
 Frame = -1

Query  993  LPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYST  814
            LP +E++P+ E +GGYIFVCNN+TM+ENLKRQLFGLP+RYRDS                 
Sbjct  130  LPASESVPKEEAIGGYIFVCNNETMEENLKRQLFGLPSRYRDS-----------------  172

Query  813  HQLHGVFEAASFGGTNIDPTAWEDKKNQG-ESRFPAQVRVVTRKVCEPLEEDSFRPILHH  637
              LHG+FEA SFGG+NIDP AWED K  G ESRFPAQVRV TRK+CEPLEED+FRP+LHH
Sbjct  173  --LHGIFEATSFGGSNIDPGAWEDSKCPGGESRFPAQVRVATRKICEPLEEDAFRPVLHH  230

Query  636  YDGPKFRLELNIPEVINYITLF  571
            YDGPKFRLEL + E ++ + +F
Sbjct  231  YDGPKFRLELTVAEALSLLDIF  252



>gb|KCW77413.1| hypothetical protein EUGRSUZ_D01762 [Eucalyptus grandis]
Length=333

 Score =   198 bits (504),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LP+ ETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVRQITPGLP+FLY
Sbjct  231   RFKTLPPSESLPKYETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRQITPGLPIFLY  290

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRV  697
             NYSTHQLHG+FEAASFGG+N+DPTAWEDKK  GESRFPAQ+R+
Sbjct  291   NYSTHQLHGIFEAASFGGSNLDPTAWEDKKCPGESRFPAQIRI  333



>ref|XP_006395484.1| hypothetical protein EUTSA_v10004700mg [Eutrema salsugineum]
 gb|ESQ32770.1| hypothetical protein EUTSA_v10004700mg [Eutrema salsugineum]
Length=254

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LPRNE +GGYIFVCNNDTMQE+LKR LFGLP RYRDSVR ITPGLPLFLY
Sbjct  144   RFKTLPASETLPRNEVLGGYIFVCNNDTMQEDLKRHLFGLPPRYRDSVRAITPGLPLFLY  203

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVV  694
             NY+THQLHG+FEA +FGGTNID TAWEDKK +GESRFPAQV++ 
Sbjct  204   NYTTHQLHGIFEATTFGGTNIDATAWEDKKCKGESRFPAQVKLT  247



>ref|XP_006288386.1| hypothetical protein CARUB_v10001637mg [Capsella rubella]
 gb|EOA21284.1| hypothetical protein CARUB_v10001637mg [Capsella rubella]
Length=260

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP +E LP++E +GGYIFVCNNDTM E+LKRQLFGLP RYRDSVR+ITPGLPLFLY
Sbjct  136   RFKTLPASECLPKSEVLGGYIFVCNNDTMLEDLKRQLFGLPPRYRDSVRKITPGLPLFLY  195

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQV  703
             NY+THQLHG+FEA +FGG+NIDPTAWEDKK +GESRFPAQV
Sbjct  196   NYTTHQLHGIFEATTFGGSNIDPTAWEDKKCKGESRFPAQV  236



>gb|KHG29233.1| Uncharacterized protein F383_15758 [Gossypium arboreum]
Length=270

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 97/144 (67%), Gaps = 35/144 (24%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLP  E LPRNE +GGYIFVCNNDTMQE+LKRQLF                      
Sbjct  155   RFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLF----------------------  192

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
                          ASFGG+NIDPTAWEDKK +GESRFPAQVR+  R +C+ LEED+FRP+
Sbjct  193   -------------ASFGGSNIDPTAWEDKKCKGESRFPAQVRIRIRTLCKALEEDAFRPV  239

Query  645   LHHYDGPKFRLELNIPEVINYITL  574
             LHHYDGPKFRLEL+IPE ++ + L
Sbjct  240   LHHYDGPKFRLELSIPETLDLLDL  263



>ref|XP_010112063.1| hypothetical protein L484_012649 [Morus notabilis]
 gb|EXC32482.1| hypothetical protein L484_012649 [Morus notabilis]
Length=279

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = -1

Query  912  NLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKN  733
            N  ++   LP +Y+D VR I PGLPLFLYNY+THQLHGV++A SFGG+NIDPTAW+DKK 
Sbjct  60   NYHQKRHSLPPKYKDPVRAIMPGLPLFLYNYTTHQLHGVYQAVSFGGSNIDPTAWQDKKC  119

Query  732  -QGESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPKFRLELNIPE  595
              G SRFPAQVR+ T+K C+PLEED+FRP L+HYDGPKFRL+L++PE
Sbjct  120  PLGGSRFPAQVRIRTKKKCKPLEEDAFRPFLYHYDGPKFRLQLSVPE  166



>gb|KHF97500.1| Uncharacterized protein F383_14816 [Gossypium arboreum]
Length=263

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 90/145 (62%), Gaps = 50/145 (34%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNETVGGYIF                                      
Sbjct  164   RFKTLPPSEALPRNETVGGYIF--------------------------------------  185

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
                         AASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  186   ------------AASFGGTNIDPTAWEDKKCPGESRFPAQVRVLTRKICEPLEEDSFRPI  233

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             LHHYDGPKFRLELN+PE ++ + +F
Sbjct  234   LHHYDGPKFRLELNVPEALSLLDIF  258


 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 9/85 (11%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN Q SFW FSD+LR+Q ++LANLSLNDSIWS SY SKRP+ERRNF++    +  ++  
Sbjct  1     MENNQQSFWHFSDQLRIQNSNLANLSLNDSIWSNSYVSKRPDERRNFDIRVGGEVNSVNN  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGW  1324
                           S++N F+NDGW
Sbjct  61    LKPKV---------SDFNSFNNDGW  76



>gb|KHG27774.1| Uncharacterized protein F383_05528 [Gossypium arboreum]
Length=272

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 90/145 (62%), Gaps = 50/145 (34%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIF                                      
Sbjct  169   RFKTLPPSESLPRNETVGGYIF--------------------------------------  190

Query  825   NYSTHQLHGVFEAASFGGTNIDPTAWEDKKNQGESRFPAQVRVVTRKVCEPLEEDSFRPI  646
                         AASFGGTNIDPTAWEDKK  GESRFPAQVRV+TRK+CEPLEEDSFRPI
Sbjct  191   ------------AASFGGTNIDPTAWEDKKCPGESRFPAQVRVITRKICEPLEEDSFRPI  238

Query  645   LHHYDGPKFRLELNIPEVINYITLF  571
             L+HYDGPKFRLELNIPE ++ + +F
Sbjct  239   LYHYDGPKFRLELNIPEALSLLDIF  263


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 9/85 (11%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaa  1399
             MEN Q SFWQFSD+LR+Q ++LANLSLNDSIWS+ Y SKRP+ERRNF++    +  ++ +
Sbjct  1     MENNQQSFWQFSDQLRVQNSNLANLSLNDSIWSSGYVSKRPDERRNFDIRVGGELNSVNS  60

Query  1398  atatatnnqvnNFKSNYNLFSNDGW  1324
                           +++N FSNDGW
Sbjct  61    LKPKV---------TDFNSFSNDGW  76



>ref|XP_002968954.1| hypothetical protein SELMODRAFT_91200 [Selaginella moellendorffii]
 gb|EFJ30070.1| hypothetical protein SELMODRAFT_91200 [Selaginella moellendorffii]
Length=159

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = -1

Query  972  PRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVF  793
            P  + +GG+IF CN++TM E+ +R LFGLP  + DSV+ I  GLPLFLYNYS   LHGVF
Sbjct  25   PHEQPLGGFIFFCNDETMPEDFERCLFGLPRSFIDSVKGIRKGLPLFLYNYSNRCLHGVF  84

Query  792  EAASFGGTNIDPTAWEDKKNQG---ESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPK  622
            EA+S GG NI+P AW +K  +     SR+PAQVRV  R+   PLEED+FRP+L HY+  K
Sbjct  85   EASSDGGLNIEPDAWINKDARSGVDVSRYPAQVRVRIRENRAPLEEDAFRPVLFHYEAKK  144

Query  621  FRLELNIPEVI  589
            FRLEL++ EV+
Sbjct  145  FRLELSMSEVL  155



>ref|XP_002990002.1| hypothetical protein SELMODRAFT_130815 [Selaginella moellendorffii]
 gb|EFJ09015.1| hypothetical protein SELMODRAFT_130815 [Selaginella moellendorffii]
Length=159

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = -1

Query  972  PRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLYNYSTHQLHGVF  793
            P  + +GG+IF CN++TM E+ +R LFGLP  + DSV+ I  GLPLFLYNYS   LHGVF
Sbjct  25   PHEQPLGGFIFFCNDETMPEDFERCLFGLPRSFIDSVKGIRKGLPLFLYNYSNRCLHGVF  84

Query  792  EAASFGGTNIDPTAWEDKKNQG---ESRFPAQVRVVTRKVCEPLEEDSFRPILHHYDGPK  622
            EA+S GG NI+P AW +K  +     SR+PAQVRV  R+   PLEED+FRP+L HY+  K
Sbjct  85   EASSDGGLNIEPDAWINKDARSGVDVSRYPAQVRVRIRENRAPLEEDAFRPVLFHYEAKK  144

Query  621  FRLELNIPEVI  589
            FRLEL++ EV+
Sbjct  145  FRLELSMSEVL  155



>gb|KDO76590.1| hypothetical protein CISIN_1g019701mg [Citrus sinensis]
 gb|KDO76591.1| hypothetical protein CISIN_1g019701mg [Citrus sinensis]
Length=277

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+EALPRNET+GGYIFVCNNDTM ENLKRQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  188   RFKTLPPSEALPRNETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY  247

Query  825   NYSTHQLHGVFEAASF  778
             NYSTHQLHG+FE  +F
Sbjct  248   NYSTHQLHGIFEVCNF  263


 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1578  MENTQSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFE  1435
             MEN Q SFWQFSD+LR+QA++LANLSLNDSIWS +YGSKRP+ER+NF+
Sbjct  1     MENNQQSFWQFSDQLRVQASNLANLSLNDSIWSNNYGSKRPDERKNFD  48



>ref|XP_007040573.1| DCD domain protein isoform 3, partial [Theobroma cacao]
 gb|EOY25074.1| DCD domain protein isoform 3, partial [Theobroma cacao]
Length=251

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -1

Query  1005  RFKTLPPAEALPRNETVGGYIFVCNNDTMQENLKRQLFGLPARYRDSVRQITPGLPLFLY  826
             RFKTLPP+E+LPRNETVGGYIFVCNNDTMQENL+RQLFGLP RYRDSVR ITPGLPLFLY
Sbjct  169   RFKTLPPSESLPRNETVGGYIFVCNNDTMQENLRRQLFGLPPRYRDSVRAITPGLPLFLY  228

Query  825   NYSTHQLHGVFEAAS  781
             NYSTHQLHGVFE  +
Sbjct  229   NYSTHQLHGVFEVCT  243


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = -1

Query  1566  QSSFWQFSDELRLQanslanlslNDSIWSTSYGSKRPEERRNFEvnsvndnaalaaatat  1387
             Q SFWQFSD+LR+Q ++LANLSLNDSIWS SY SKRP+ERRNF++    +  ++      
Sbjct  2     QQSFWQFSDQLRVQNSNLANLSLNDSIWSNSYVSKRPDERRNFDIRVGGEVNSVNNLKPK  61

Query  1386  atnnqvnNFKSNYNLFSNDGW  1324
                       S++N F+NDGW
Sbjct  62    V---------SDFNSFNNDGW  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5474489051310