BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22430_g3_i2 len=1411 path=[4008:0-625 4633:626-712 8435:713-914
4720:915-960 2452:961-997 2691:998-1410]

Length=1411
                                                                      Score     E

ref|XP_011091944.1|  PREDICTED: remorin-like                            114   5e-26   
ref|XP_006652568.1|  PREDICTED: remorin-like                            109   3e-24   
ref|NP_001053409.1|  Os04g0533300                                       109   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001159012.1|  remorin                                            107   2e-23   Zea mays [maize]
ref|XP_004976344.1|  PREDICTED: remorin-like                            107   2e-23   
ref|XP_002448229.1|  hypothetical protein SORBIDRAFT_06g023630          107   2e-23   Sorghum bicolor [broomcorn]
gb|EYU32085.1|  hypothetical protein MIMGU_mgv1a014760mg                106   2e-23   
ref|NP_001147227.1|  remorin                                            107   3e-23   Zea mays [maize]
ref|XP_008661880.1|  PREDICTED: remorin isoform X1                      107   3e-23   
emb|CAN75437.1|  hypothetical protein VITISV_000833                     106   3e-23   Vitis vinifera
ref|XP_009779197.1|  PREDICTED: remorin-like                            105   3e-23   
ref|XP_009629650.1|  PREDICTED: remorin-like                            105   4e-23   
ref|XP_002270914.1|  PREDICTED: uncharacterized protein At3g61260       106   4e-23   Vitis vinifera
ref|XP_002511833.1|  Remorin, putative                                  105   4e-23   Ricinus communis
ref|XP_003580217.1|  PREDICTED: remorin-like                            105   1e-22   
ref|XP_003569966.1|  PREDICTED: remorin-like isoform X1                 104   1e-22   
ref|XP_008438060.1|  PREDICTED: uncharacterized protein At3g61260       103   2e-22   
ref|XP_010235770.1|  PREDICTED: remorin-like isoform X2                 103   2e-22   
gb|EMT30253.1|  hypothetical protein F775_30825                         104   3e-22   
dbj|BAJ90231.1|  predicted protein                                      103   4e-22   
ref|XP_004133871.1|  PREDICTED: uncharacterized protein At3g61260...    102   7e-22   
gb|KHG12669.1|  Remorin                                                 102   8e-22   
ref|NP_001047554.1|  Os02g0642200                                       102   9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007051855.1|  Remorin family protein                             102   9e-22   
ref|XP_006345628.1|  PREDICTED: remorin-like                            100   1e-21   
ref|XP_006648879.1|  PREDICTED: uncharacterized protein At3g61260...    102   1e-21   
ref|XP_004240109.1|  PREDICTED: remorin                                 100   2e-21   
ref|NP_001235181.1|  uncharacterized protein LOC100305679               101   2e-21   
emb|CDX71754.1|  BnaC08g31200D                                          100   3e-21   
ref|XP_010523734.1|  PREDICTED: uncharacterized protein At3g61260       100   4e-21   
ref|XP_009116785.1|  PREDICTED: uncharacterized protein At3g61260       100   4e-21   
emb|CDY48933.1|  BnaA09g39040D                                          100   4e-21   
gb|KDO86097.1|  hypothetical protein CISIN_1g028704mg                 99.8    5e-21   
ref|XP_006445086.1|  hypothetical protein CICLE_v10022286mg             100   6e-21   
ref|XP_006445087.1|  hypothetical protein CICLE_v10022286mg             100   6e-21   
ref|XP_009587316.1|  PREDICTED: remorin-like                          99.8    7e-21   
gb|EMS55630.1|  hypothetical protein TRIUR3_02968                       100   8e-21   
ref|XP_009409422.1|  PREDICTED: remorin-like                            100   8e-21   
gb|KHN29375.1|  Remorin                                               99.4    9e-21   
gb|KDP28652.1|  hypothetical protein JCGZ_14423                       99.8    1e-20   
ref|XP_002320784.1|  DNA-binding family protein                       99.4    1e-20   Populus trichocarpa [western balsam poplar]
gb|KFK37371.1|  hypothetical protein AALP_AA4G248100                  99.4    2e-20   
gb|KDO60012.1|  hypothetical protein CISIN_1g028549mg                 99.0    2e-20   
ref|XP_011023368.1|  PREDICTED: remorin-like                          98.6    3e-20   
ref|XP_009794056.1|  PREDICTED: remorin-like                          97.8    3e-20   
ref|XP_010473801.1|  PREDICTED: uncharacterized protein At3g61260     95.5    6e-20   
ref|XP_006292649.1|  hypothetical protein CARUB_v10018892mg           96.7    6e-20   
emb|CDY37068.1|  BnaA04g26460D                                        97.4    7e-20   
ref|XP_009778200.1|  PREDICTED: remorin-like isoform X2               97.4    7e-20   
ref|XP_009142370.1|  PREDICTED: remorin                               97.4    7e-20   
ref|XP_006490378.1|  PREDICTED: remorin-like                          97.4    7e-20   
ref|XP_011035931.1|  PREDICTED: remorin                               97.4    7e-20   
ref|XP_010053688.1|  PREDICTED: remorin-like                          96.3    8e-20   
ref|XP_010676488.1|  PREDICTED: remorin                               97.4    8e-20   
ref|XP_009778199.1|  PREDICTED: remorin-like isoform X1               97.4    8e-20   
emb|CDY06318.1|  BnaA09g48850D                                        97.1    9e-20   
ref|XP_006421909.1|  hypothetical protein CICLE_v10005899mg           97.4    9e-20   
gb|AEK94319.1|  remorin                                               97.1    9e-20   
ref|XP_009615469.1|  PREDICTED: remorin-like                          97.1    1e-19   
ref|XP_003528866.1|  PREDICTED: remorin-like                          96.7    1e-19   
emb|CDY05883.1|  BnaC08g20600D                                        94.7    1e-19   
ref|XP_002510796.1|  Remorin, putative                                96.3    1e-19   Ricinus communis
ref|XP_004953259.1|  PREDICTED: remorin-like isoform X1               96.3    1e-19   
ref|XP_006402501.1|  hypothetical protein EUTSA_v10006246mg           96.7    1e-19   
gb|AFK39071.1|  unknown                                               96.3    1e-19   
gb|AII99828.1|  remorin 1                                             96.7    1e-19   
ref|XP_009590953.1|  PREDICTED: remorin-like                          96.7    2e-19   
ref|XP_010055168.1|  PREDICTED: remorin-like                          96.3    2e-19   
ref|XP_009408139.1|  PREDICTED: remorin                               95.9    2e-19   
ref|XP_006295053.1|  hypothetical protein CARUB_v10024121mg           95.9    2e-19   
ref|XP_006397772.1|  hypothetical protein EUTSA_v10001646mg           95.9    2e-19   
ref|XP_006291850.1|  hypothetical protein CARUB_v10018025mg           96.3    2e-19   
ref|XP_010934733.1|  PREDICTED: remorin                               95.9    3e-19   
ref|XP_009757254.1|  PREDICTED: remorin-like                          94.0    3e-19   
ref|XP_010469049.1|  PREDICTED: uncharacterized protein At3g61260...  95.9    3e-19   
ref|XP_010512460.1|  PREDICTED: uncharacterized protein At3g61260...  95.9    3e-19   
emb|CDY27356.1|  BnaC04g50490D                                        95.5    3e-19   
ref|XP_006339544.1|  PREDICTED: remorin-like                          95.1    3e-19   
ref|XP_008336972.1|  PREDICTED: LOW QUALITY PROTEIN: remorin-like     96.3    4e-19   
ref|XP_010413437.1|  PREDICTED: uncharacterized protein At3g61260...  95.9    4e-19   
ref|XP_004306803.1|  PREDICTED: uncharacterized protein At3g61260...  95.5    4e-19   
ref|XP_007135038.1|  hypothetical protein PHAVU_010G096300g           95.5    4e-19   
gb|EYU35080.1|  hypothetical protein MIMGU_mgv1a0150192mg             93.2    4e-19   
gb|KFK35323.1|  hypothetical protein AALP_AA5G269500                  95.1    5e-19   
ref|XP_006404199.1|  hypothetical protein EUTSA_v10011156mg           94.4    6e-19   
ref|XP_011084412.1|  PREDICTED: remorin-like                          94.7    6e-19   
ref|XP_010518225.1|  PREDICTED: remorin                               94.7    7e-19   
ref|XP_007218451.1|  hypothetical protein PRUPE_ppa011776mg           94.7    7e-19   
ref|XP_003534573.1|  PREDICTED: remorin-like                          94.4    7e-19   
ref|XP_010506561.1|  PREDICTED: remorin-like                          94.4    7e-19   
emb|CDY71834.1|  BnaAnng38930D                                        94.0    7e-19   
ref|XP_010508104.1|  PREDICTED: remorin-like                          94.4    7e-19   
ref|XP_008376024.1|  PREDICTED: remorin-like                          94.7    7e-19   
ref|XP_002267609.1|  PREDICTED: remorin                               94.4    8e-19   Vitis vinifera
ref|XP_008377346.1|  PREDICTED: remorin-like isoform X1               95.1    8e-19   
ref|NP_001234238.1|  remorin 2                                        94.0    9e-19   
ref|XP_008232793.1|  PREDICTED: remorin                               94.4    9e-19   
ref|XP_006827693.1|  hypothetical protein AMTR_s00009p00257810        94.0    1e-18   
ref|NP_191685.1|  remorin family protein                              94.4    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143176.1|  PREDICTED: remorin-like                          94.0    1e-18   
gb|KHG21181.1|  Remorin                                               93.6    2e-18   
ref|XP_009340014.1|  PREDICTED: remorin-like                          94.0    2e-18   
ref|XP_002878373.1|  hypothetical protein ARALYDRAFT_486603           94.0    2e-18   
ref|XP_008465865.1|  PREDICTED: remorin                               93.2    2e-18   
ref|NP_001274989.1|  remorin                                          93.2    2e-18   
ref|NP_001234231.1|  remorin 1                                        93.2    2e-18   
ref|XP_010105965.1|  hypothetical protein L484_017313                 94.0    2e-18   
ref|XP_009149781.1|  PREDICTED: remorin                               92.4    2e-18   
ref|XP_002882035.1|  hypothetical protein ARALYDRAFT_483720           92.8    3e-18   
ref|XP_010908427.1|  PREDICTED: remorin-like isoform X2               92.8    3e-18   
ref|XP_008376569.1|  PREDICTED: remorin-like                          93.2    3e-18   
ref|NP_197764.1|  Remorin family protein                              92.8    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377354.1|  PREDICTED: remorin-like isoform X2               93.2    3e-18   
ref|NP_974824.1|  Remorin family protein                              92.8    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273101.1|  PREDICTED: remorin-like                          92.8    3e-18   
gb|KDP22286.1|  hypothetical protein JCGZ_26117                       92.8    3e-18   
gb|AAM63910.1|  remorin                                               92.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KCW78048.1|  hypothetical protein EUGRSUZ_D02272                   89.7    4e-18   
ref|XP_010544719.1|  PREDICTED: remorin-like isoform X1               92.0    4e-18   
emb|CDY18898.1|  BnaC04g04520D                                        92.4    4e-18   
ref|XP_010544720.1|  PREDICTED: remorin-like isoform X2               92.0    4e-18   
ref|XP_002302576.1|  DNA-binding family protein                       92.4    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010426396.1|  PREDICTED: remorin-like                          91.7    5e-18   
ref|XP_003623893.1|  Remorin                                          90.9    5e-18   
ref|XP_010503539.1|  PREDICTED: remorin-like                          91.7    5e-18   
ref|XP_004170221.1|  PREDICTED: remorin-like                          90.9    6e-18   
ref|XP_008439225.1|  PREDICTED: remorin-like                          92.0    6e-18   
ref|XP_004510806.1|  PREDICTED: remorin-like                          91.7    7e-18   
ref|XP_007218390.1|  hypothetical protein PRUPE_ppa011367mg           92.0    8e-18   
ref|XP_004148376.1|  PREDICTED: remorin-like                          90.5    8e-18   
ref|XP_010493498.1|  PREDICTED: remorin-like                          91.7    9e-18   
ref|NP_182106.1|  Remorin family protein                              91.3    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010412645.1|  PREDICTED: remorin-like                          91.3    9e-18   
ref|XP_009382381.1|  PREDICTED: remorin-like                          91.3    1e-17   
gb|AFK34355.1|  unknown                                               91.7    1e-17   
ref|XP_010421184.1|  PREDICTED: remorin-like                          91.7    1e-17   
gb|KEH18895.1|  carboxy-terminal region remorin                       91.7    1e-17   
ref|XP_010519484.1|  PREDICTED: remorin-like isoform X1               90.9    1e-17   
ref|XP_004492710.1|  PREDICTED: uncharacterized protein At3g61260...  90.9    1e-17   
ref|XP_002874146.1|  hypothetical protein ARALYDRAFT_489237           91.3    1e-17   
ref|XP_004165762.1|  PREDICTED: remorin-like                          90.9    1e-17   
ref|XP_006288585.1|  hypothetical protein CARUB_v10001880mg           91.7    1e-17   
ref|XP_003521134.1|  PREDICTED: remorin-like                          90.9    1e-17   
ref|XP_006358926.1|  PREDICTED: remorin-like                          90.5    2e-17   
gb|KHG20032.1|  Remorin                                               90.5    2e-17   
ref|XP_010107439.1|  hypothetical protein L484_015780                 90.9    2e-17   
gb|EMS52426.1|  hypothetical protein TRIUR3_02712                     90.1    2e-17   
ref|XP_010905109.1|  PREDICTED: remorin-like                          90.5    2e-17   
ref|XP_006394639.1|  hypothetical protein EUTSA_v10004940mg           90.5    2e-17   
ref|XP_010454663.1|  PREDICTED: remorin-like                          90.5    3e-17   
ref|XP_009150904.1|  PREDICTED: remorin-like                          90.5    3e-17   
ref|XP_004240737.1|  PREDICTED: remorin                               90.1    3e-17   
gb|AAA57124.1|  DNA-binding protein                                   90.1    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404201.1|  hypothetical protein EUTSA_v10010917mg           87.4    3e-17   
ref|XP_010255442.1|  PREDICTED: remorin-like                          89.7    4e-17   
ref|XP_010667563.1|  PREDICTED: remorin-like                          89.7    4e-17   
ref|XP_007040179.1|  Remorin family protein                           90.9    5e-17   
gb|EYU19543.1|  hypothetical protein MIMGU_mgv1a014270mg              89.0    7e-17   
gb|EMT04985.1|  hypothetical protein F775_31239                       89.0    7e-17   
ref|XP_008234255.1|  PREDICTED: remorin-like                          89.4    7e-17   
ref|XP_007152285.1|  hypothetical protein PHAVU_004G116700g           89.0    8e-17   
ref|NP_190463.1|  Remorin-like protein                                88.2    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076174.1|  PREDICTED: remorin-like                          88.6    9e-17   
ref|XP_003618987.1|  Remorin                                          85.9    1e-16   
ref|XP_002452858.1|  hypothetical protein SORBIDRAFT_04g033660        88.6    1e-16   Sorghum bicolor [broomcorn]
gb|EEC74277.1|  hypothetical protein OsI_09516                        87.8    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001048576.1|  Os02g0824500                                     87.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010035130.1|  PREDICTED: remorin-like isoform X2               88.6    2e-16   
dbj|BAJ98923.1|  predicted protein                                    88.2    2e-16   
gb|KCW46422.1|  hypothetical protein EUGRSUZ_K00253                   88.2    2e-16   
ref|XP_004140777.1|  PREDICTED: remorin-like                          87.8    2e-16   
ref|XP_002318224.2|  remorin family protein                           87.8    2e-16   Populus trichocarpa [western balsam poplar]
gb|KCW46423.1|  hypothetical protein EUGRSUZ_K00253                   86.7    2e-16   
ref|XP_008643815.1|  PREDICTED: remorin isoform X1                    87.4    2e-16   
ref|XP_009392263.1|  PREDICTED: remorin-like                          86.7    2e-16   
gb|AGB07445.1|  remorin                                               87.4    2e-16   
ref|XP_004954460.1|  PREDICTED: remorin-like                          86.3    3e-16   
ref|XP_009400595.1|  PREDICTED: remorin-like                          87.0    3e-16   
ref|XP_011030102.1|  PREDICTED: remorin-like isoform X1               87.4    3e-16   
ref|XP_010550763.1|  PREDICTED: remorin-like isoform X2               87.0    3e-16   
ref|XP_011030103.1|  PREDICTED: remorin-like isoform X2               87.4    3e-16   
ref|XP_011048714.1|  PREDICTED: remorin isoform X3                    87.0    3e-16   
ref|XP_004496578.1|  PREDICTED: remorin-like                          87.4    3e-16   
ref|XP_008806887.1|  PREDICTED: remorin                               88.2    3e-16   
ref|XP_011048712.1|  PREDICTED: remorin isoform X1                    87.0    3e-16   
ref|XP_010550762.1|  PREDICTED: remorin-like isoform X1               87.0    3e-16   
ref|XP_006363315.1|  PREDICTED: remorin                               86.7    4e-16   
ref|XP_011048713.1|  PREDICTED: remorin isoform X2                    87.0    4e-16   
ref|XP_010519485.1|  PREDICTED: remorin-like isoform X2               86.7    4e-16   
ref|XP_002877638.1|  remorin family protein                           86.3    4e-16   
ref|XP_009766651.1|  PREDICTED: remorin-like                          86.7    4e-16   
gb|AFK41243.1|  unknown                                               87.0    4e-16   
ref|XP_008794187.1|  PREDICTED: remorin-like isoform X2               86.7    5e-16   
ref|XP_008794544.1|  PREDICTED: remorin-like                          86.7    5e-16   
ref|XP_002322467.1|  remorin family protein                           86.7    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009371326.1|  PREDICTED: remorin-like                          87.0    5e-16   
ref|XP_007038675.1|  Remorin family protein                           89.7    5e-16   
ref|XP_008794186.1|  PREDICTED: remorin-like isoform X1               86.7    6e-16   
ref|XP_010035132.1|  PREDICTED: remorin-like isoform X4               86.3    7e-16   
ref|NP_001274955.1|  putative remorin a3b4                            86.3    7e-16   
ref|NP_001236279.1|  uncharacterized protein LOC100305501             85.9    7e-16   
gb|EYU25090.1|  hypothetical protein MIMGU_mgv1a014261mg              85.9    8e-16   
emb|CDP08838.1|  unnamed protein product                              85.5    9e-16   
gb|EYU25089.1|  hypothetical protein MIMGU_mgv1a014261mg              85.9    9e-16   
gb|ABK95953.1|  unknown                                               82.4    1e-15   Populus trichocarpa [western balsam poplar]
emb|CDY69344.1|  BnaAnng30100D                                        84.0    1e-15   
gb|AGR88905.1|  remorin 1                                             85.9    1e-15   
emb|CDP05208.1|  unnamed protein product                              85.5    1e-15   
ref|NP_001275297.1|  putative remorin a4-e8                           85.1    2e-15   
ref|XP_009349347.1|  PREDICTED: remorin-like                          85.5    2e-15   
dbj|BAJ88188.1|  predicted protein                                    82.0    2e-15   
gb|EPS60307.1|  hypothetical protein M569_14497                       84.7    2e-15   
gb|EPS59685.1|  hypothetical protein M569_15119                       83.2    2e-15   
gb|AFK45936.1|  unknown                                               84.7    3e-15   
ref|XP_010035129.1|  PREDICTED: remorin-like isoform X1               84.7    3e-15   
ref|XP_010908426.1|  PREDICTED: remorin-like isoform X1               84.3    3e-15   
ref|XP_009141736.1|  PREDICTED: remorin-like isoform X2               84.0    4e-15   
gb|AGG82489.1|  remorin 2                                             84.0    4e-15   
ref|XP_009141722.1|  PREDICTED: remorin-like isoform X1               84.0    4e-15   
emb|CDX87157.1|  BnaC09g04720D                                        84.0    4e-15   
ref|XP_011022731.1|  PREDICTED: remorin-like                          83.6    4e-15   
ref|XP_003638357.1|  Remorin                                          84.0    5e-15   
ref|XP_011072399.1|  PREDICTED: remorin                               82.4    7e-15   
emb|CDP09770.1|  unnamed protein product                              83.6    7e-15   
gb|EPS61469.1|  hypothetical protein M569_13328                       81.6    8e-15   
ref|XP_006649189.1|  PREDICTED: remorin-like                          83.2    8e-15   
ref|XP_003556104.1|  PREDICTED: remorin-like                          82.8    1e-14   
ref|XP_007139893.1|  hypothetical protein PHAVU_008G067400g           82.8    1e-14   
ref|XP_010035131.1|  PREDICTED: remorin-like isoform X3               82.8    1e-14   
emb|CDX80385.1|  BnaC07g30590D                                        85.1    1e-14   
gb|ABK23302.1|  unknown                                               82.0    2e-14   Picea sitchensis
ref|XP_009770981.1|  PREDICTED: remorin-like                          81.6    2e-14   
ref|NP_001048722.1|  Os03g0111200                                     81.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KDO60014.1|  hypothetical protein CISIN_1g028549mg                 82.0    2e-14   
ref|XP_009383123.1|  PREDICTED: remorin-like                          81.6    2e-14   
ref|XP_002304484.1|  hypothetical protein POPTR_0003s12450g           81.6    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007143402.1|  hypothetical protein PHAVU_007G069500g           81.6    2e-14   
ref|XP_008353990.1|  PREDICTED: remorin-like                          80.5    3e-14   
ref|XP_009390477.1|  PREDICTED: remorin-like                          80.9    5e-14   
ref|XP_009400417.1|  PREDICTED: remorin-like                          80.5    5e-14   
gb|AFN53683.1|  hypothetical protein                                  83.6    5e-14   
ref|NP_001151679.1|  remorin                                          80.5    6e-14   Zea mays [maize]
ref|XP_004986023.1|  PREDICTED: remorin-like                          80.5    6e-14   
gb|EPS69897.1|  hypothetical protein M569_04866                       79.3    1e-13   
gb|KHN31817.1|  Remorin                                               79.7    1e-13   
ref|NP_001238396.1|  uncharacterized protein LOC100500457             79.7    1e-13   
ref|XP_004308093.1|  PREDICTED: remorin-like isoform 2                79.3    1e-13   
ref|XP_009627101.1|  PREDICTED: remorin-like                          79.3    2e-13   
ref|XP_006649253.1|  PREDICTED: remorin-like                          79.0    2e-13   
ref|NP_001238565.1|  uncharacterized protein LOC100499700             79.3    2e-13   
ref|XP_004308092.1|  PREDICTED: remorin-like isoform 1                79.3    2e-13   
ref|XP_002465999.1|  hypothetical protein SORBIDRAFT_01g049810        78.2    3e-13   Sorghum bicolor [broomcorn]
ref|XP_010061098.1|  PREDICTED: remorin-like isoform X4               79.0    4e-13   
gb|AFW72526.1|  hypothetical protein ZEAMMB73_338346                  75.1    4e-13   
gb|KCW90710.1|  hypothetical protein EUGRSUZ_A02793                   79.0    4e-13   
ref|XP_010061086.1|  PREDICTED: remorin-like isoform X2               79.0    4e-13   
ref|XP_010061093.1|  PREDICTED: remorin-like isoform X3               79.0    4e-13   
ref|XP_010061078.1|  PREDICTED: remorin-like isoform X1               79.0    4e-13   
ref|XP_008437238.1|  PREDICTED: uncharacterized protein At3g61260...  76.6    5e-13   
ref|XP_006341797.1|  PREDICTED: remorin-like                          77.4    6e-13   
ref|XP_010672021.1|  PREDICTED: uncharacterized protein At3g61260...  77.0    8e-13   
ref|XP_003558995.1|  PREDICTED: remorin-like                          77.0    8e-13   
ref|XP_010672012.1|  PREDICTED: remorin-like isoform X1               77.0    1e-12   
ref|XP_004511589.1|  PREDICTED: remorin-like isoform X2               77.0    1e-12   
ref|XP_004511588.1|  PREDICTED: remorin-like isoform X1               77.0    1e-12   
ref|XP_010236880.1|  PREDICTED: remorin                               75.9    1e-12   
ref|XP_008437236.1|  PREDICTED: remorin isoform X1                    76.6    2e-12   
ref|XP_008437237.1|  PREDICTED: remorin isoform X2                    76.6    2e-12   
ref|XP_002271460.1|  PREDICTED: remorin                               75.9    2e-12   Vitis vinifera
ref|XP_006590251.1|  PREDICTED: uncharacterized protein LOC100305...  75.9    3e-12   
ref|NP_001235241.1|  uncharacterized protein LOC100305683             75.5    3e-12   
ref|XP_004159960.1|  PREDICTED: uncharacterized protein At3g61260...  74.7    3e-12   
ref|XP_010055616.1|  PREDICTED: remorin-like                          75.1    4e-12   
ref|NP_001151703.1|  LOC100285339                                     74.7    4e-12   Zea mays [maize]
tpg|DAA42886.1|  TPA: remorin                                         74.7    5e-12   
gb|KCW90714.1|  hypothetical protein EUGRSUZ_A02795                   73.6    5e-12   
gb|KHN35009.1|  Remorin                                               74.7    6e-12   
ref|XP_004143923.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  73.9    7e-12   
gb|KHG24102.1|  Remorin                                               74.7    7e-12   
ref|XP_004248633.1|  PREDICTED: remorin-like                          73.6    1e-11   
ref|XP_010061121.1|  PREDICTED: remorin-like                          73.2    2e-11   
gb|KHN25717.1|  Remorin                                               72.0    2e-11   
ref|XP_009398011.1|  PREDICTED: remorin-like                          72.8    2e-11   
ref|XP_006573768.1|  PREDICTED: remorin-like isoform X2               72.4    3e-11   
ref|XP_003516694.1|  PREDICTED: remorin-like isoform X1               72.4    4e-11   
ref|XP_010089139.1|  Pollen-specific protein SF3                      75.1    4e-11   
gb|AFK42693.1|  unknown                                               72.0    5e-11   
ref|XP_003611121.1|  Remorin                                          72.0    5e-11   
gb|KHN23661.1|  Remorin                                               70.5    6e-11   
gb|KHN16839.1|  Remorin                                               69.7    1e-10   
gb|AGC39091.1|  remorin-5 protein                                     70.5    1e-10   
ref|XP_006439558.1|  hypothetical protein CICLE_v10023664mg           69.7    1e-10   
ref|XP_002298047.1|  hypothetical protein POPTR_0001s09090g           70.5    2e-10   
gb|AEX20500.1|  symbiotic remorin 1                                   70.5    2e-10   
gb|KEH21043.1|  carboxy-terminal region remorin                       70.1    2e-10   
ref|XP_010061111.1|  PREDICTED: remorin-like                          70.1    2e-10   
ref|XP_006584533.1|  PREDICTED: uncharacterized protein LOC100527...  69.7    2e-10   
ref|NP_001237267.1|  uncharacterized protein LOC100527523             69.7    3e-10   
ref|XP_008392620.1|  PREDICTED: remorin-like                          69.7    3e-10   
ref|XP_006476581.1|  PREDICTED: uncharacterized protein At3g61260...  68.9    4e-10   
gb|AFK48724.1|  unknown                                               69.3    4e-10   
ref|XP_006476580.1|  PREDICTED: uncharacterized protein At3g61260...  68.9    4e-10   
gb|KDO76204.1|  hypothetical protein CISIN_1g025589mg                 69.7    4e-10   
ref|XP_006476579.1|  PREDICTED: uncharacterized protein At3g61260...  69.3    5e-10   
ref|XP_009375800.1|  PREDICTED: remorin-like                          68.9    6e-10   
ref|XP_010544382.1|  PREDICTED: remorin                               66.6    7e-10   
ref|XP_007158480.1|  hypothetical protein PHAVU_002G155800g           68.2    8e-10   
ref|XP_011029230.1|  PREDICTED: remorin                               68.2    9e-10   
gb|KFK30806.1|  hypothetical protein AALP_AA6G028300                  67.8    9e-10   
ref|NP_001276162.1|  remorin-like                                     67.4    1e-09   
gb|EYU38364.1|  hypothetical protein MIMGU_mgv1a022944mg              65.5    1e-09   
ref|XP_008238876.1|  PREDICTED: remorin-like                          66.2    2e-09   
ref|XP_010053297.1|  PREDICTED: uncharacterized protein At3g61260...  66.6    2e-09   
gb|AFK38814.1|  unknown                                               65.5    2e-09   
ref|XP_008238894.1|  PREDICTED: remorin                               67.0    2e-09   
ref|XP_010053296.1|  PREDICTED: remorin-like isoform X1               66.2    3e-09   
ref|XP_002509770.1|  Remorin, putative                                65.1    3e-09   
dbj|BAJ86538.1|  predicted protein                                    65.5    6e-09   
gb|EMS64123.1|  hypothetical protein TRIUR3_18094                     65.5    6e-09   
gb|ADK98520.1|  hypothetical protein                                  65.5    6e-09   
ref|XP_007208846.1|  hypothetical protein PRUPE_ppa025568mg           63.2    1e-08   
ref|XP_004300775.1|  PREDICTED: uncharacterized protein At3g61260...  64.3    1e-08   
ref|XP_008238896.1|  PREDICTED: uncharacterized protein LOC103337510  66.6    1e-08   
ref|XP_009375798.1|  PREDICTED: remorin-like                          63.5    2e-08   
gb|KDP25465.1|  hypothetical protein JCGZ_20621                       62.8    3e-08   
ref|XP_009350653.1|  PREDICTED: remorin-like                          62.4    4e-08   
ref|XP_009369043.1|  PREDICTED: remorin-like                          62.4    4e-08   
ref|XP_008392618.1|  PREDICTED: remorin-like                          62.0    5e-08   
gb|KCW78049.1|  hypothetical protein EUGRSUZ_D02273                   60.1    1e-07   
ref|XP_001778856.1|  predicted protein                                61.2    1e-07   
ref|XP_008346635.1|  PREDICTED: remorin-like                          60.8    1e-07   
ref|XP_001753894.1|  predicted protein                                60.5    1e-07   
ref|XP_009111464.1|  PREDICTED: uncharacterized protein At3g61260...  60.1    2e-07   
ref|XP_009111463.1|  PREDICTED: uncharacterized protein At3g61260...  60.1    2e-07   
gb|AAX95710.1|  Remorin, C-terminal region, putative                  60.5    2e-07   
ref|XP_010545839.1|  PREDICTED: remorin                               59.7    4e-07   
ref|XP_010456255.1|  PREDICTED: remorin-like                          58.9    6e-07   
ref|XP_010419618.1|  PREDICTED: remorin-like                          58.9    6e-07   
gb|AFK49332.1|  unknown                                               58.9    8e-07   
gb|AAC13631.1|  F6N23.13 gene product                                 58.2    9e-07   
gb|KDO86098.1|  hypothetical protein CISIN_1g028704mg                 57.8    1e-06   
ref|NP_191976.2|  Remorin family protein                              57.4    2e-06   
ref|XP_010427301.1|  PREDICTED: remorin-like                          57.4    2e-06   
emb|CAD29780.1|  putative remorin 1 protein                           58.2    2e-06   
ref|XP_007211079.1|  hypothetical protein PRUPE_ppa016787mg           57.4    2e-06   
ref|XP_006396263.1|  hypothetical protein EUTSA_v10029075mg           57.0    2e-06   
gb|KDO60016.1|  hypothetical protein CISIN_1g028549mg                 56.6    4e-06   
ref|XP_002464410.1|  hypothetical protein SORBIDRAFT_01g017740        55.8    6e-06   
ref|XP_001761208.1|  predicted protein                                58.9    8e-06   
gb|EMT11441.1|  hypothetical protein F775_30732                       55.5    1e-05   
gb|ABF93597.1|  Remorin, C-terminal region family protein, expressed  54.3    1e-05   
gb|EMS51879.1|  hypothetical protein TRIUR3_21382                     55.5    1e-05   
emb|CDY51146.1|  BnaA09g51810D                                        57.4    1e-05   
emb|CDX74343.1|  BnaA03g27040D                                        54.7    2e-05   
ref|XP_006421908.1|  hypothetical protein CICLE_v10005899mg           54.7    2e-05   
emb|CDX91900.1|  BnaC03g32020D                                        54.3    2e-05   
gb|KGN50121.1|  hypothetical protein Csa_5G154830                     54.3    3e-05   
ref|NP_001176230.1|  Os10g0503800                                     52.4    3e-05   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                  54.7    4e-05   
ref|XP_009134540.1|  PREDICTED: uncharacterized protein At3g61260...  52.4    7e-05   
ref|XP_006662494.1|  PREDICTED: remorin-like                          52.8    9e-05   
tpg|DAA36693.1|  TPA: hypothetical protein ZEAMMB73_296478            51.6    2e-04   
ref|XP_002969762.1|  hypothetical protein SELMODRAFT_92364            51.2    2e-04   
emb|CDY07204.1|  BnaCnng02190D                                        52.8    2e-04   
ref|XP_002989677.1|  hypothetical protein SELMODRAFT_27771            49.7    3e-04   
gb|ABR25395.1|  remorin                                               48.9    4e-04   



>ref|XP_011091944.1| PREDICTED: remorin-like [Sesamum indicum]
Length=186

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKLADV +WEN+KKA++E++LKKIEEQLEKKKAEYAEKM NK ALVHK+AEEKR+++
Sbjct  93    KAQKKLADVAAWENSKKASLESQLKKIEEQLEKKKAEYAEKMKNKVALVHKQAEEKRAMV  152

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK EEMAAK+RATGQ PKKAFGC G
Sbjct  153   EARRGEEILKAEEMAAKYRATGQAPKKAFGCLG  185


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 23/102 (23%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNF  738
            A+VP      P +   SKGSLDRD+ALAK+ED+KR+SFIKAWEESEK+KVEN+       
Sbjct  46   AIVPE-----PAEKKSSKGSLDRDVALAKLEDEKRLSFIKAWEESEKTKVENK-------  93

Query  739  FFILASNMNLLDVILWFSS------SLHVRVNTRLELSRISF  846
                 +   L DV  W +S      S   ++  +LE  +  +
Sbjct  94   -----AQKKLADVAAWENSKKASLESQLKKIEEQLEKKKAEY  130



>ref|XP_006652568.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=202

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A+VHKEAEEKR+++
Sbjct  109   KASKKLSAILSWENTKKANIEAELKKIEEQLEKKKAEYAEKMKNKVAIVHKEAEEKRAMV  168

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  169   EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  201


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 35/121 (29%)
 Frame = +1

Query  538  KDVSPEKAVVP-----HKNP---------------DPPLKTAGSKGSLDRDIALAKIEDD  657
            KDV+ EKAV+P      K P               +PP +     GS DRDIALAK+E +
Sbjct  30   KDVAEEKAVIPAPAEEEKPPVDDSKALAIVEKVADEPPAEKPAKGGSNDRDIALAKVESE  89

Query  658  KRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSSSLHVRVNTRLELSR  837
            KR S IKAWEE+EK+K EN+            ++  L  ++ W ++    + N   EL +
Sbjct  90   KRNSLIKAWEENEKTKAENK------------ASKKLSAILSWENTK---KANIEAELKK  134

Query  838  I  840
            I
Sbjct  135  I  135



>ref|NP_001053409.1| Os04g0533300 [Oryza sativa Japonica Group]
 emb|CAE04574.1| OSJNBb0039L24.13 [Oryza sativa Japonica Group]
 dbj|BAF15323.1| Os04g0533300 [Oryza sativa Japonica Group]
 gb|EAY94960.1| hypothetical protein OsI_16768 [Oryza sativa Indica Group]
 gb|EAZ31446.1| hypothetical protein OsJ_15583 [Oryza sativa Japonica Group]
 dbj|BAG96338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89383.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A+VHKEAEEKR+++
Sbjct  113   KASKKLSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKVAIVHKEAEEKRAMV  172

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  173   EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  205


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            A+V     +PP +     GS DRD+ALA++E +KR S IKAWEE+EK+K EN+
Sbjct  61   AIVEKVADEPPAEKPAQGGSNDRDVALARVETEKRNSLIKAWEENEKTKAENK  113



>ref|NP_001159012.1| remorin [Zea mays]
 gb|ACF88153.1| unknown [Zea mays]
 gb|ACG36146.1| remorin [Zea mays]
 tpg|DAA36691.1| TPA: Remorin isoform 1 [Zea mays]
 tpg|DAA36692.1| TPA: Remorin isoform 2 [Zea mays]
Length=199

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A++HKEAEEKR+++
Sbjct  106   KAAKKVSAILSWENTKKANIEAELKKIEEQLEKKKAEYAEKMKNKVAMIHKEAEEKRAMV  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  166   EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  198


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS DRD+ALA++E +KR S IKAWEE+EK+K EN+
Sbjct  72   GSNDRDLALARVETEKRNSLIKAWEENEKTKAENK  106



>ref|XP_004976344.1| PREDICTED: remorin-like [Setaria italica]
Length=212

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA+LKKIEE+LEKKKAEYAEKM NK A++HKEAEEKR+++
Sbjct  119   KAAKKISAILSWENTKKANIEAQLKKIEEELEKKKAEYAEKMKNKVAIIHKEAEEKRAMV  178

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  179   EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  211



>ref|XP_002448229.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
 gb|EES12557.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
Length=212

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A++HKEAEEKR+++
Sbjct  119   KAAKKVSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKVAMIHKEAEEKRAMV  178

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  179   EAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  211


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 26/85 (31%)
 Frame = +1

Query  541  DVSPEKAVVPHKNP-----------------------DP-PLKTAGSK--GSLDRDIALA  642
            DV+ EKAV+P   P                       +P P K A  K  GS DRD+ALA
Sbjct  35   DVAEEKAVIPATEPPAAEEKPPADDSKALAIVEKVADEPAPEKPAAEKQGGSNDRDLALA  94

Query  643  KIEDDKRVSFIKAWEESEKSKVENR  717
            ++E +KR S IKAWEE+EK+K EN+
Sbjct  95   RVETEKRNSLIKAWEENEKTKAENK  119



>gb|EYU32085.1| hypothetical protein MIMGU_mgv1a014760mg [Erythranthe guttata]
Length=179

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL++V +WEN+KKA++E+ LKKIEEQ+EKKKAEYAEKM NK AL+HK+AEEKR+++
Sbjct  87    KAQKKLSEVSAWENSKKASLESDLKKIEEQVEKKKAEYAEKMKNKIALIHKQAEEKRAMV  146

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE+AAK+R TGQVPKKAFGC G
Sbjct  147   EAKRGEDLLKAEELAAKYRVTGQVPKKAFGCLG  179


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  595  KTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            K +  +GSLDR +A AK+EDDKR+SF+KAWEESEK+KVEN+
Sbjct  47   KKSSKQGSLDRGVAFAKLEDDKRLSFVKAWEESEKTKVENK  87



>ref|NP_001147227.1| remorin [Zea mays]
 gb|ACG26230.1| remorin [Zea mays]
 gb|AFW58967.1| remorin [Zea mays]
Length=202

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA++KKIEEQLEKKKAEYAEKM NK A++H+EAEEKR+++
Sbjct  109   KATKKVSVILSWENTKKANIEAEMKKIEEQLEKKKAEYAEKMKNKVAMIHREAEEKRAMV  168

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  169   EAKRGEEVLKAEEMAAKYRATGHAPKKPIGCFG  201



>ref|XP_008661880.1| PREDICTED: remorin isoform X1 [Zea mays]
Length=200

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA++KKIEEQLEKKKAEYAEKM NK A++H+EAEEKR+++
Sbjct  107   KATKKVSVILSWENTKKANIEAEMKKIEEQLEKKKAEYAEKMKNKVAMIHREAEEKRAMV  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  167   EAKRGEEVLKAEEMAAKYRATGHAPKKPIGCFG  199



>emb|CAN75437.1| hypothetical protein VITISV_000833 [Vitis vinifera]
Length=196

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+DV +WEN+KKA +EA LKKIEE+LEKKKAEYAEKM NK AL+HK+AEEK+++I
Sbjct  103   KAQKKLSDVCAWENSKKAAVEAXLKKIEEELEKKKAEYAEKMKNKVALIHKQAEEKKAMI  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+ LK EEMAAKFRATGQ PKK  GCFG
Sbjct  163   EARRGEEFLKAEEMAAKFRATGQTPKKVLGCFG  195


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 28/100 (28%)
 Frame = +1

Query  541  DVSPEKAVVP---------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFI  675
            DV+ EK+VVP                K PD   K   S GS +RD+ALA +E +K++SFI
Sbjct  31   DVALEKSVVPPPEVKADESKALAVVEKTPDSAAKKT-SGGSFERDVALANLEKEKQLSFI  89

Query  676  KAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            +AWEESEKSKV+N+            +   L DV  W +S
Sbjct  90   RAWEESEKSKVDNK------------AQKKLSDVCAWENS  117



>ref|XP_009779197.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=153

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EAKLKK+EE+LE+KKAEYAEKM N+ AL+HKEAEEK++++
Sbjct  61    KAQKKLSKVAAWENSKKAHLEAKLKKLEERLEQKKAEYAEKMKNRAALIHKEAEEKKAMV  120

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R EQ+LKTEEMAAK+RATGQ PKK  GC G
Sbjct  121   EAKRGEQILKTEEMAAKYRATGQTPKKLLGCVG  153


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 4/48 (8%)
 Frame = +1

Query  586  PPLKT----AGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            PP KT      SKGSLDRD ALA++ +DK+ +FIKAWEESEKS+V+N+
Sbjct  14   PPQKTNPSTKNSKGSLDRDTALAQLNNDKKSAFIKAWEESEKSRVDNK  61



>ref|XP_009629650.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=153

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ V +WEN+KKA++EAKLKK+EE+LE+KKAEYAEKM N+ AL+HKEAEEK+++
Sbjct  60    NKAQKKLSKVAAWENSKKAHLEAKLKKLEERLEQKKAEYAEKMKNRAALIHKEAEEKKAM  119

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + ++R EQ+LKTEEMAAK+RATGQ PKK  GC G
Sbjct  120   VNAKRGEQILKTEEMAAKYRATGQTPKKLLGCVG  153


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 4/48 (8%)
 Frame = +1

Query  586  PPLKT----AGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            PP KT      SKGSLDRD ALA++ +DK+ +FIKAWEESEKS+V+N+
Sbjct  14   PPQKTNPSTKNSKGSLDRDTALAQLNNDKKSAFIKAWEESEKSRVDNK  61



>ref|XP_002270914.1| PREDICTED: uncharacterized protein At3g61260 [Vitis vinifera]
 emb|CBI40326.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+DV +WEN+KKA +EA LKKIEE+LEKKKAEYAEKM NK AL+HK+AEEK+++I
Sbjct  103   KAQKKLSDVCAWENSKKAAVEANLKKIEEELEKKKAEYAEKMKNKVALIHKQAEEKKAMI  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+ LK EEMAAKFRATGQ PKK  GCFG
Sbjct  163   EARRGEEFLKAEEMAAKFRATGQTPKKVLGCFG  195


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 28/100 (28%)
 Frame = +1

Query  541  DVSPEKAVVP---------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFI  675
            DV+ EK+VVP                K PD   K   S GS +RD+ALA +E +K++SFI
Sbjct  31   DVALEKSVVPPPEVKADESKALAVVEKTPDSAAKKT-SGGSFERDVALANLEKEKQLSFI  89

Query  676  KAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            +AWEESEKSKV+N+            +   L DV  W +S
Sbjct  90   RAWEESEKSKVDNK------------AQKKLSDVCAWENS  117



>ref|XP_002511833.1| Remorin, putative [Ricinus communis]
 gb|EEF50502.1| Remorin, putative [Ricinus communis]
Length=188

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA +EAKL+KIEEQLEKKKAEYAEKM NK ALVHK+AEEKR+++
Sbjct  97    KAQKKLSSVTAWENSKKAALEAKLRKIEEQLEKKKAEYAEKMKNKVALVHKQAEEKRAMV  156

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR E+VLK EEMAAK+RATGQ PKK  GCF
Sbjct  157   EAQRGEEVLKAEEMAAKYRATGQTPKKLLGCF  188


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 18/75 (24%)
 Frame = +1

Query  541  DVSPEKAVVP--HKNPD--------------PPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            DV+ +KA VP   + PD               P KT+G  GSLDRDIALA++E +KR SF
Sbjct  25   DVAHDKATVPTPEEKPDDSKALAVVEKVPESGPKKTSG--GSLDRDIALAEVEKEKRNSF  82

Query  673  IKAWEESEKSKVENR  717
            IKAWE+SEKSK EN+
Sbjct  83   IKAWEDSEKSKAENK  97



>ref|XP_003580217.1| PREDICTED: remorin-like [Brachypodium distachyon]
Length=207

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA+L+KIEEQLEKKKAEYAEKM NK A++HKEAEEK++++
Sbjct  114   KAAKKVSAILSWENTKKANIEAQLRKIEEQLEKKKAEYAEKMKNKAAMIHKEAEEKKAMV  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  174   EAKRGEEVLKAEEMAAKYRATGNSPKKTMGCFG  206


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 22/82 (27%)
 Frame = +1

Query  538  KDVSPEKAVVPH---KNPDPPL-------------------KTAGSKGSLDRDIALAKIE  651
            KDV+ EKAV+P    +   PP+                   + A   GS DRDIALA++E
Sbjct  33   KDVTEEKAVIPAPAAEEEKPPVDDSKALVVVEKVADEKPADEKAAHGGSNDRDIALARVE  92

Query  652  DDKRVSFIKAWEESEKSKVENR  717
             +KR S IKAWEE+EK+K EN+
Sbjct  93   TEKRNSLIKAWEENEKTKAENK  114



>ref|XP_003569966.1| PREDICTED: remorin-like isoform X1 [Brachypodium distachyon]
Length=193

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             +A +LSWENT+KANI+A+LK+ EE+LEKKKAEYAEKM NK A+VHKEAEEKR+++V++R 
Sbjct  105   IASILSWENTRKANIDAQLKRKEEELEKKKAEYAEKMKNKKAIVHKEAEEKRAMVVARRG  164

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E VLK EEMAA++RATG  PKK  GCFG
Sbjct  165   EDVLKAEEMAARYRATGLAPKKVLGCFG  192



>ref|XP_008438060.1| PREDICTED: uncharacterized protein At3g61260 [Cucumis melo]
Length=183

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ VL+WEN+KKAN+EAKLKKIEE LEKKKAEY EKM NK AL+HKEAEEK++ +
Sbjct  92    KAQKKLSSVLAWENSKKANLEAKLKKIEEDLEKKKAEYGEKMKNKVALIHKEAEEKKATV  151

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR+E++LK EE AAKFRATG +PKK  GCF
Sbjct  152   EAQRSEELLKAEETAAKFRATGTIPKKFLGCF  183


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = +1

Query  553  EKAVVP----HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            EKA+V     +K  + P+    S GS+DRDIALA++E +KR SFIKAWE+SEKSK EN+
Sbjct  34   EKAMVTVPIVNKTKEDPVPKKASGGSIDRDIALAEVEKEKRFSFIKAWEDSEKSKAENK  92



>ref|XP_010235770.1| PREDICTED: remorin-like isoform X2 [Brachypodium distachyon]
Length=177

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             +A +LSWENT+KANI+A+LK+ EE+LEKKKAEYAEKM NK A+VHKEAEEKR+++V++R 
Sbjct  89    IASILSWENTRKANIDAQLKRKEEELEKKKAEYAEKMKNKKAIVHKEAEEKRAMVVARRG  148

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E VLK EEMAA++RATG  PKK  GCFG
Sbjct  149   EDVLKAEEMAARYRATGLAPKKVLGCFG  176



>gb|EMT30253.1| hypothetical protein F775_30825 [Aegilops tauschii]
Length=214

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A++HKEAEEKR+++
Sbjct  121   KATKKVSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKAAMIHKEAEEKRAMV  180

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              +++ E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  181   EAKKGEELLKAEEMAAKYRATGHSPKKVMGCFG  213


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 28/99 (28%)
 Frame = +1

Query  505  AVAAPQNMGPTKDVSPEKAVVP----------------------HKNPDPPL------KT  600
            AV A +   P KDV+ EKAV+P                       K  D P+      + 
Sbjct  23   AVPAAEPEAPAKDVTEEKAVIPAPEPAAEEEKPPADDSKALVVVEKVADEPVAEKPTDEK  82

Query  601  AGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            A   GS DRD+ALA++E +KR S IKAWEE+EK+K EN+
Sbjct  83   AAHGGSNDRDLALARVESEKRNSLIKAWEENEKTKAENK  121



>dbj|BAJ90231.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KK++ +LSWENTKKANIEA+LKKIEEQLEKKKAEYAEKM NK A++HKEAEEKR++
Sbjct  117   NKATKKVSAILSWENTKKANIEAQLKKIEEQLEKKKAEYAEKMKNKAAMIHKEAEEKRAM  176

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + +++ E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  177   VEAKKGEELLKAEEMAAKYRATGNSPKKVMGCFG  210


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = +1

Query  562  VVPHKNPDPPL------KTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            VV  K  D P+      + A   GS DRD+ALA++E +KR S IKAWEE+EK+K EN+
Sbjct  61   VVVEKVADEPVAEKLTDEKAAHGGSNDRDLALARVESEKRNSLIKAWEENEKTKAENK  118



>ref|XP_004133871.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 ref|XP_004155821.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 gb|KGN56525.1| hypothetical protein Csa_3G122490 [Cucumis sativus]
Length=183

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ VL+WEN+KKAN+EAKLKKIEE LEKKKAEY EKM NK  L+HKEAEEK++ +
Sbjct  92    KAQKKLSSVLAWENSKKANLEAKLKKIEEDLEKKKAEYGEKMKNKVVLIHKEAEEKKATV  151

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR+E++LK EE AAKFRATG +PKK  GCF
Sbjct  152   EAQRSEELLKAEETAAKFRATGTIPKKFLGCF  183


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P K +G  GS+DRDIALA++E +KR SFIKAWE+SEKSK EN+
Sbjct  52   PKKASG--GSIDRDIALAEVEKEKRFSFIKAWEDSEKSKAENK  92



>gb|KHG12669.1| Remorin [Gossypium arboreum]
Length=190

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKKL+ +++WEN+KKA++EAKLKKIEEQLEKKKAEYAEKM NK AL+HKEAEEKR+++
Sbjct  99    KSQKKLSAIVAWENSKKASLEAKLKKIEEQLEKKKAEYAEKMKNKVALLHKEAEEKRAMV  158

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E+VLK EEMAAK+RATGQ PKK  GCF
Sbjct  159   EAKQGEEVLKAEEMAAKYRATGQTPKKVLGCF  190


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (61%), Gaps = 15/79 (19%)
 Frame = +1

Query  562  VVPHKNPDP-PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNF  738
            VV  K P+P P K +G  GS DRDIALA++E  KR+SFIKAWEESEK+K EN+       
Sbjct  49   VVVEKAPEPEPKKISG--GSHDRDIALAEVEKAKRLSFIKAWEESEKTKAENK-------  99

Query  739  FFILASNMNLLDVILWFSS  795
                 S   L  ++ W +S
Sbjct  100  -----SQKKLSAIVAWENS  113



>ref|NP_001047554.1| Os02g0642200 [Oryza sativa Japonica Group]
 dbj|BAD25231.1| putative remorin 1 [Oryza sativa Japonica Group]
 dbj|BAF09468.1| Os02g0642200 [Oryza sativa Japonica Group]
 gb|EAY86855.1| hypothetical protein OsI_08239 [Oryza sativa Indica Group]
 gb|EAZ23964.1| hypothetical protein OsJ_07690 [Oryza sativa Japonica Group]
 dbj|BAG97133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL D++SWENTKKA I+ +LKK EE+LE+KKAEYAEK  NK A+VHKEAEEKR+++
Sbjct  110   RASKKLLDIISWENTKKAVIKTQLKKKEEELERKKAEYAEKAKNKEAIVHKEAEEKRAMV  169

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             +++R E+V+K EE+AAK+RATG  PKK  GCFG
Sbjct  170   MARRGEEVIKAEEIAAKYRATGVTPKKHIGCFG  202


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 13/70 (19%)
 Frame = +1

Query  616  SLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            S DRDIALAK+E DKR S IKAWEE+EK+K ENR            ++  LLD+I W ++
Sbjct  77   SNDRDIALAKVETDKRESLIKAWEENEKAKAENR------------ASKKLLDIISWENT  124

Query  796  SLHVRVNTRL  825
               V + T+L
Sbjct  125  KKAV-IKTQL  133



>ref|XP_007051855.1| Remorin family protein [Theobroma cacao]
 gb|EOX96012.1| Remorin family protein [Theobroma cacao]
Length=192

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ +++WEN+KKA +EAKL+KIEEQLEKKKAEYAE M NK AL+HKEAEEKR+++
Sbjct  101   KAQKKLSSIVAWENSKKAALEAKLRKIEEQLEKKKAEYAENMKNKVALLHKEAEEKRAMV  160

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EEMAAK+RATGQ PKK  GCF
Sbjct  161   EAKRGEEVLKAEEMAAKYRATGQTPKKLLGCF  192


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = +1

Query  565  VPHKNPDP-PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V  K P+P P K +G  GS DRDIALA++E +KR+SF++AWE+SEK+K EN+
Sbjct  52   VVEKAPEPAPKKISG--GSHDRDIALAEVEKEKRLSFVRAWEDSEKTKAENK  101



>ref|XP_006345628.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=146

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN +KA+++AKLKK+E +LE+KKAEYAEKM NK ALVHKEAEEK++ +
Sbjct  54    KAQKKLSKVAAWENKQKAHLDAKLKKLEVRLEQKKAEYAEKMKNKEALVHKEAEEKKATV  113

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R EQ+L+TEEMAAK+RATGQ PKK  GC G
Sbjct  114   EAKRGEQILRTEEMAAKYRATGQNPKKLLGCVG  146


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P     SKGS++RD ALA++ +DK+ +F+KAWEESEKSKV+N+
Sbjct  12   PSSMKSSKGSVERDTALAQLNNDKKSAFVKAWEESEKSKVDNK  54



>ref|XP_006648879.1| PREDICTED: uncharacterized protein At3g61260-like [Oryza brachyantha]
Length=204

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL D++SWENTKKA I+ +L+K EE+LE+KKAEY EK  NK A+VH+EAEEKR+++
Sbjct  111   RASKKLLDIISWENTKKAVIKTQLRKKEEELERKKAEYGEKAKNKEAIVHREAEEKRAMV  170

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             +++R E+V+K EEMAAK+RATG  PKK  GCFG
Sbjct  171   MARRGEEVIKAEEMAAKYRATGVTPKKNLGCFG  203


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 43/80 (54%), Gaps = 19/80 (24%)
 Frame = +1

Query  568  PHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFI  747
            PH    PP        S DR +ALAK+E DKR S IKAWE++EK+K ENR          
Sbjct  69   PHAEKAPPT-------SNDRAVALAKVETDKRESLIKAWEDNEKAKAENR----------  111

Query  748  LASNMNLLDVILWFSSSLHV  807
              ++  LLD+I W ++   V
Sbjct  112  --ASKKLLDIISWENTKKAV  129



>ref|XP_004240109.1| PREDICTED: remorin [Solanum lycopersicum]
Length=153

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ V +WEN KKA+++AKLKK+E +LE+KKAEYAEK+ NK AL+HKEAEEK+++
Sbjct  60    NKAQKKLSKVAAWENKKKAHLDAKLKKLEVRLEQKKAEYAEKLKNKEALIHKEAEEKKAM  119

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + ++R EQ+LKTE+MAAK+RATGQ PKK  GC G
Sbjct  120   VEAKRGEQILKTEDMAAKYRATGQNPKKLLGCVG  153


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             +P +N +P      SKGS +RD ALA++ +DK+ +F+KAWEESEKSKV+N+
Sbjct  11   TLPPQNTNPST-NKSSKGSAERDTALAQLSNDKKSAFVKAWEESEKSKVDNK  61



>ref|NP_001235181.1| uncharacterized protein LOC100305679 [Glycine max]
 gb|ACU13488.1| unknown [Glycine max]
 gb|KHM99397.1| Remorin [Glycine soja]
Length=183

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQK L+ + +WEN+KKA +EA+LKK+EEQLEKKKAEY EKM NK ALVHKEAEEKR++I
Sbjct  92    RAQKHLSAIAAWENSKKAALEAELKKLEEQLEKKKAEYGEKMKNKVALVHKEAEEKRAMI  151

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++L+TEEMAAK+RATG  PKK  GCF
Sbjct  152   EAKRGEEILQTEEMAAKYRATGTTPKKTIGCF  183


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V  K P P  K + S+GS+DRDIALA++E +K++S++KAWEESEK+K ENR
Sbjct  43   VSEKTPVPANKQS-SRGSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENR  92



>emb|CDX71754.1| BnaC08g31200D [Brassica napus]
Length=180

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KK++D+L+WEN+KKA +EA+LKKIEEQLE KKAEYAEKM NK A +HKEAEE+R++I
Sbjct  89    KAEKKISDILAWENSKKAAVEAQLKKIEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMI  148

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAKFRATG VPK   GCF
Sbjct  149   EAKRGEDVLKAEEMAAKFRATGIVPKATCGCF  180



>ref|XP_010523734.1| PREDICTED: uncharacterized protein At3g61260 [Tarenaya hassleriana]
Length=201

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK +DVL+WEN+KKA IEA+LKKIEEQLEKKKAEYAEKM NK A +HKEAEEKR++
Sbjct  109   NKAQKKTSDVLAWENSKKAAIEAELKKIEEQLEKKKAEYAEKMKNKVAAIHKEAEEKRAM  168

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  169   VEAKRGEEILKAEEMAAKYRATGNVPKATCGCF  201


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 13/76 (17%)
 Frame = +1

Query  529  GPTKDVSPEKAVVPHKNPDPPLKTAG-------------SKGSLDRDIALAKIEDDKRVS  669
            G +KDV+ EK   P  + D P  +                  S+DRD+ALA +E +KR+S
Sbjct  35   GVSKDVAEEKIQNPPPHEDKPDDSKALTVIEKPVEPEPKKSSSMDRDVALADLEKEKRLS  94

Query  670  FIKAWEESEKSKVENR  717
            FI+AWE++EK+K EN+
Sbjct  95   FIRAWEDNEKTKAENK  110



>ref|XP_009116785.1| PREDICTED: uncharacterized protein At3g61260 [Brassica rapa]
Length=194

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KK++D+L+WEN+KKA +EA+LKKIEEQLE KKAEYAEKM NK A +HKEAEE+R++I
Sbjct  103   KAEKKISDILAWENSKKAAVEAQLKKIEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMI  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAKFRATG VPK   GCF
Sbjct  163   EAKRGEDVLKAEEMAAKFRATGIVPKATCGCF  194


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 13/72 (18%)
 Frame = +1

Query  580  PDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASN  759
            PD P K++ S GS DRD+ LA +  +K ++++KAWE+SEKSK EN+            + 
Sbjct  59   PDAPKKSSSS-GSQDRDVKLADLSKEKTLAYVKAWEDSEKSKAENK------------AE  105

Query  760  MNLLDVILWFSS  795
              + D++ W +S
Sbjct  106  KKISDILAWENS  117



>emb|CDY48933.1| BnaA09g39040D [Brassica napus]
Length=194

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KK++D+L+WEN+KKA +EA+LKKIEEQLE KKAEYAEKM NK A +HKEAEE+R++I
Sbjct  103   KAEKKISDILAWENSKKAAVEAQLKKIEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMI  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAKFRATG VPK   GCF
Sbjct  163   EAKRGEDVLKAEEMAAKFRATGIVPKATCGCF  194


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 13/72 (18%)
 Frame = +1

Query  580  PDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASN  759
            PD P K++ S GS DRD+ LA +  +K ++++KAWE+SEKSK EN+            + 
Sbjct  59   PDAPKKSSSS-GSQDRDVKLADLSKEKTLAYVKAWEDSEKSKAENK------------AE  105

Query  760  MNLLDVILWFSS  795
              + D++ W +S
Sbjct  106  KKISDILAWENS  117



>gb|KDO86097.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=167

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EAKLKKIEEQLE+KKAEYAEKM NK ALVHKEAEEKR+++
Sbjct  76    KAQKKLSAVAAWENSKKASLEAKLKKIEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMV  135

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EE+AAK+RATG  PKK  GCF
Sbjct  136   EARRGEDVLKAEEIAAKYRATGTTPKKLLGCF  167


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS DRD+ALA++E +KR SFIKAWEESEK+K EN+
Sbjct  42   GSHDRDVALAEVEKEKRESFIKAWEESEKTKAENK  76



>ref|XP_006445086.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 ref|XP_006491066.1| PREDICTED: remorin-like isoform X2 [Citrus sinensis]
 gb|ESR58326.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 gb|KDO86095.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=183

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ V +WEN+KKA++EAKLKKIEEQLE+KKAEYAEKM NK ALVHKEAEEKR++
Sbjct  91    NKAQKKLSAVAAWENSKKASLEAKLKKIEEQLERKKAEYAEKMKNKVALVHKEAEEKRAM  150

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E VLK EE+AAK+RATG  PKK  GCF
Sbjct  151   VEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF  183


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +1

Query  541  DVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            DV+ EKAV    + + P+  + +   +D  +ALA++E +KR SFIKAWEESEK+K EN+
Sbjct  35   DVAEEKAVTQLHDQEKPVDDSKALAVVDH-VALAEVEKEKRESFIKAWEESEKTKAENK  92



>ref|XP_006445087.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 ref|XP_006491065.1| PREDICTED: remorin-like isoform X1 [Citrus sinensis]
 gb|ESR58327.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 gb|KDO86096.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=205

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ V +WEN+KKA++EAKLKKIEEQLE+KKAEYAEKM NK ALVHKEAEEKR++
Sbjct  113   NKAQKKLSAVAAWENSKKASLEAKLKKIEEQLERKKAEYAEKMKNKVALVHKEAEEKRAM  172

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E VLK EE+AAK+RATG  PKK  GCF
Sbjct  173   VEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF  205


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 46/80 (58%), Gaps = 21/80 (26%)
 Frame = +1

Query  541  DVSPEKAVVPHKNPDPPL------------------KTAGSK---GSLDRDIALAKIEDD  657
            DV+ EKAV    + + P+                  K +G K   GS DRD+ALA++E +
Sbjct  35   DVAEEKAVTQLHDQEKPVDDSKALAVVDQTPDSAKKKISGEKKISGSHDRDVALAEVEKE  94

Query  658  KRVSFIKAWEESEKSKVENR  717
            KR SFIKAWEESEK+K EN+
Sbjct  95   KRESFIKAWEESEKTKAENK  114



>ref|XP_009587316.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
 gb|AII99827.1| remorin 2 [Nicotiana tabacum]
Length=174

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKKL+ V +WENTKKAN+EAKLKK+EEQLE+KKAEYAEK+ N+ A VHKEA+EKR+++
Sbjct  81    RAQKKLSAVGTWENTKKANLEAKLKKLEEQLEEKKAEYAEKIKNRVASVHKEADEKRAMV  140

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              +++ E++LK +EMAAK+RATGQ PKK  GC G
Sbjct  141   EARKGEELLKADEMAAKYRATGQAPKKLLGCLG  173


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  514  APQNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEES  693
            +P  M    D S   A VP    D   K+  SKGSLDRDIALA +E +KR S+IKAWEES
Sbjct  16   SPAAMATKADDSKALATVPPPKTDSSTKS--SKGSLDRDIALAHLETEKRNSYIKAWEES  73

Query  694  EKSKVENR  717
            EKSKVENR
Sbjct  74   EKSKVENR  81



>gb|EMS55630.1| hypothetical protein TRIUR3_02968 [Triticum urartu]
Length=193

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             L+ +LSWENTKKA I+A+LK+ EE+LEKKKAEYAEKM N+ A+ H+EAEEKR+++V++R 
Sbjct  105   LSSILSWENTKKATIDAQLKRKEEELEKKKAEYAEKMKNRKAIAHREAEEKRAMVVARRG  164

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  165   EEVLKAEEMAAKYRATGLAPKKLLGCFG  192



>ref|XP_009409422.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=192

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ +L+WENTKKA +EA+L++ EE+LEK+KAEYAEKM NK AL+HKEAEEKR++I
Sbjct  99    KAVKKLSSILAWENTKKAAVEAELRRKEEELEKRKAEYAEKMKNKVALLHKEAEEKRAMI  158

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK +E+AAK+RATG  PKK  GCFG
Sbjct  159   EARRGEELLKADEVAAKYRATGLAPKKLLGCFG  191


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 19/89 (21%)
 Frame = +1

Query  535  TKDVSPEKAVVP----------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRV  666
             KDV+ EKA VP                 K  DPP + + S GS +RD  LA++E +KR+
Sbjct  24   VKDVAEEKASVPPPAEEKPDDSKALAIVEKVEDPPAEKS-SGGSTERDAVLARLETEKRL  82

Query  667  SFIKAWEESEKSKVENR*AIVFNFFFILA  753
            S IKAWEE+EK+K EN+   V     ILA
Sbjct  83   SLIKAWEENEKTKAENK--AVKKLSSILA  109



>gb|KHN29375.1| Remorin [Glycine soja]
Length=183

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQK+L+ + +WEN+KKA +EA+LKKIEEQLEKKKAE+ E+M NK ALVHKEAEEKR++I
Sbjct  92    RAQKQLSAIAAWENSKKATLEAELKKIEEQLEKKKAEHGERMKNKVALVHKEAEEKRAMI  151

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R E+VLKTEEMAAK+RATG  PKK  GCF
Sbjct  152   EANRCEEVLKTEEMAAKYRATGTTPKKTIGCF  183


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V   K P P  K + S+GS+DRDIALA++E +K++S++KAWEESEK+K ENR
Sbjct  42   VASEKTPVPENKQS-SRGSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENR  92



>gb|KDP28652.1| hypothetical protein JCGZ_14423 [Jatropha curcas]
Length=194

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK + V +WEN+KKA +EAKL+KIEEQLEKKKAEYAEKM NK ALVHK+AEEKR+++
Sbjct  103   KAQKKKSAVEAWENSKKAALEAKLRKIEEQLEKKKAEYAEKMKNKIALVHKQAEEKRAIV  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR E++LK EEMAAK+RATGQ P+K  GCF
Sbjct  163   EAQRGEEMLKAEEMAAKYRATGQTPRKLLGCF  194


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 47/75 (63%), Gaps = 18/75 (24%)
 Frame = +1

Query  541  DVSPEKAVVP--HKNPD--------------PPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            DV+ EK VVP   + PD               P K +G  GSLDRDIALA++E +KR SF
Sbjct  31   DVAQEKTVVPPPEEKPDESKALAVVEKIPESAPKKISG--GSLDRDIALAEVEKEKRNSF  88

Query  673  IKAWEESEKSKVENR  717
            IKAWE+SEKSK EN+
Sbjct  89   IKAWEDSEKSKAENK  103



>ref|XP_002320784.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE99099.1| DNA-binding family protein [Populus trichocarpa]
Length=193

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKKL+ V++WEN+KKA +EA L+K+EE+LEK+KAEYAEKM NK AL+HK+AEE+R+++
Sbjct  102   KSQKKLSAVVAWENSKKAALEATLRKMEEKLEKQKAEYAEKMKNKVALIHKDAEEQRAMV  161

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EEMAAK+RATGQ PKK  GCF
Sbjct  162   EAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF  193


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 15/79 (19%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNF  738
            AVV    P P  K +G  GS+DRDIALA +E +KR+SFIKAWE+SEK+K EN+       
Sbjct  53   AVVEKTEPAPK-KISG--GSIDRDIALADLEKEKRLSFIKAWEDSEKTKAENK-------  102

Query  739  FFILASNMNLLDVILWFSS  795
                 S   L  V+ W +S
Sbjct  103  -----SQKKLSAVVAWENS  116



>gb|KFK37371.1| hypothetical protein AALP_AA4G248100 [Arabis alpina]
Length=200

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WENTKKA  EA+L+K+EE+LE+KKAEY EKM NK A +HK+AEEKR+++
Sbjct  109   KAQKKISDVLAWENTKKAETEAQLRKMEEKLERKKAEYGEKMKNKVAAIHKQAEEKRAMV  168

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK RATG VPK   GCF
Sbjct  169   EAKRGEEILKAEEMAAKHRATGIVPKATCGCF  200


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 12/61 (20%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVIL  783
             S GS+DRD+ LA +E +K+ SFIKAWEESEK+K EN+            +   + DV+ 
Sbjct  72   SSSGSVDRDVILADLEKEKKSSFIKAWEESEKAKAENK------------AQKKISDVLA  119

Query  784  W  786
            W
Sbjct  120  W  120



>gb|KDO60012.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=207

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ ++SWEN++KA +EA+LKKIEEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  114   RAHKKLSSIVSWENSRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE+AAK+RATG  PKK   CFG
Sbjct  174   EAKRGEDLLKAEELAAKYRATGSAPKKLLSCFG  206


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVEN  714
            +PP     ++GS++RD  LA++E +KR+S I+AWEESEKS+ EN
Sbjct  69   EPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAEN  112



>ref|XP_011023368.1| PREDICTED: remorin-like [Populus euphratica]
Length=196

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKKL+ V +WEN+KKA +EAKL+KIEE+LEK+KAEYAEKM NK AL+HKEAEEK++++
Sbjct  105   KSQKKLSAVAAWENSKKAALEAKLRKIEEKLEKQKAEYAEKMKNKIALIHKEAEEKKAIV  164

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK  E AAK+RATGQ PKK FGCF
Sbjct  165   EAKRGEEVLKAGEAAAKYRATGQTPKKLFGCF  196


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            AVV    P P  K +G  GS+DRD+ALA +E +KR+SFIKAWE+SEKSK EN+
Sbjct  56   AVVEKIEPAPK-KVSG--GSIDRDVALADLEKEKRLSFIKAWEDSEKSKAENK  105



>ref|XP_009794056.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=176

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK + V +WENTKKAN+EAKLKK+EEQL++KKAEYAEK+ N+ A VHKEA+EKR+++
Sbjct  83    RAQKKFSAVGTWENTKKANLEAKLKKLEEQLKEKKAEYAEKIKNRVAAVHKEADEKRAMV  142

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              +++ E++LK +EMAAK+RATGQ PKK  GC G
Sbjct  143   EARKGEELLKADEMAAKYRATGQAPKKLLGCLG  175


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GSLDRDIALA +E +KR S+IKAWEESEKSKVENR
Sbjct  49   GSLDRDIALAHLETEKRNSYIKAWEESEKSKVENR  83



>ref|XP_010473801.1| PREDICTED: uncharacterized protein At3g61260, partial [Camelina 
sativa]
Length=114

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++I
Sbjct  23    KAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMI  82

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  83    EAKRGEDILKAEETAAKYRATGIVPKATCGCF  114



>ref|XP_006292649.1| hypothetical protein CARUB_v10018892mg [Capsella rubella]
 gb|EOA25547.1| hypothetical protein CARUB_v10018892mg [Capsella rubella]
Length=168

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA+IEA+LKKIEEQL KKKAEYAEKM NK A +HKEAEEKR++ 
Sbjct  77    KAQKKLSSVGAWENSKKASIEAELKKIEEQLIKKKAEYAEKMKNKIAQIHKEAEEKRAMA  136

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FGCF
Sbjct  137   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGCF  168



>emb|CDY37068.1| BnaA04g26460D [Brassica napus]
Length=195

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN++KA +EA+L+KIEE+LEKKKAEY EKM NK A +HKEAEEKR+++
Sbjct  104   KAQKKVSDVLAWENSQKAAVEAQLRKIEEKLEKKKAEYGEKMKNKVAAIHKEAEEKRAMV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  164   EAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 12/64 (19%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVIL  783
             S GS+DRD+ LA +E +K+ SFIKAWEESEKSK EN+            +   + DV+ 
Sbjct  67   SSSGSIDRDVKLADLEKEKKTSFIKAWEESEKSKAENK------------AQKKVSDVLA  114

Query  784  WFSS  795
            W +S
Sbjct  115  WENS  118



>ref|XP_009778200.1| PREDICTED: remorin-like isoform X2 [Nicotiana sylvestris]
Length=204

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK++ + +WEN+KKAN+EA+LKK+EEQLEKKKAEY EKM NK AL+HKEAEEKR++
Sbjct  112   NKAQKKVSAIAAWENSKKANLEAELKKMEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAM  171

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE+AAK+RATG  PKK  GCF
Sbjct  172   IEAKRGEDLLKAEELAAKYRATGTAPKKLLGCF  204


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+DRD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  79   GSIDRDAVLARVATEKRLSLIKAWEESEKSKAENK  113



>ref|XP_009142370.1| PREDICTED: remorin [Brassica rapa]
Length=195

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN++KA +EA+L+KIEE+LEKKKAEY EKM NK A +HKEAEEKR+++
Sbjct  104   KAQKKVSDVLAWENSQKAAVEAQLRKIEEKLEKKKAEYGEKMKNKVAAIHKEAEEKRAMV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  164   EAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 12/64 (19%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVIL  783
             S GS+DRD+ LA +E +K+ SFIKAWEESEKSK EN+            +   + DV+ 
Sbjct  67   SSSGSVDRDVKLADLEKEKKTSFIKAWEESEKSKAENK------------AQKKVSDVLA  114

Query  784  WFSS  795
            W +S
Sbjct  115  WENS  118



>ref|XP_006490378.1| PREDICTED: remorin-like [Citrus sinensis]
Length=207

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ ++SWEN++KA +EA+LKKIEEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  114   KAHKKLSSIVSWENSRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE+AAK+RATG  PKK   CFG
Sbjct  174   EAKRGEDLLKAEELAAKYRATGSAPKKLLSCFG  206


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            +PP     ++GS++RD  LA++E +KR+S I+AWEESEKS+ EN+
Sbjct  70   EPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAENK  114



>ref|XP_011035931.1| PREDICTED: remorin [Populus euphratica]
Length=193

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKKL+ V++WEN+KKA +EA L+K+EE+LEK+KAEYAEKM NK AL+HK AEE+R+++
Sbjct  102   KSQKKLSAVVAWENSKKAALEATLRKMEEKLEKQKAEYAEKMKNKVALIHKVAEEQRAMV  161

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EEMAAK+RATGQ PKK  GCF
Sbjct  162   EAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF  193


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 15/79 (19%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNF  738
            AVV    P P  K +G  GS+DRDIALA +E +KR+SFIKAWE+SEK+K EN+       
Sbjct  53   AVVEKTEPAPK-KISG--GSIDRDIALADLEKEKRLSFIKAWEDSEKTKAENK-------  102

Query  739  FFILASNMNLLDVILWFSS  795
                 S   L  V+ W +S
Sbjct  103  -----SQKKLSAVVAWENS  116



>ref|XP_010053688.1| PREDICTED: remorin-like [Eucalyptus grandis]
Length=162

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ V SWEN+KKA  EA L+K EE LEKKKAE+ EKM NK AL+HK+AEEKR+VI
Sbjct  71    KAQKKMSIVTSWENSKKATKEADLRKTEEGLEKKKAEHGEKMKNKVALIHKQAEEKRAVI  130

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG +PKK  GCF
Sbjct  131   QAKRGEEILKAEEVAAKYRATGYMPKKFLGCF  162


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+GS DRD+ALAK+E +K+++FIKAWEESEK+K +N+
Sbjct  34   GSRGSADRDLALAKVEKEKKLTFIKAWEESEKTKADNK  71



>ref|XP_010676488.1| PREDICTED: remorin [Beta vulgaris subsp. vulgaris]
Length=196

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+DV SWEN+KKANIEA+L+KIEE+LEKKKAEYAEKM NK A VHK A+EKR++I
Sbjct  105   KACKKLSDVTSWENSKKANIEAQLRKIEEKLEKKKAEYAEKMKNKVAEVHKLAQEKRAMI  164

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
               Q+ E+VLK EE AAK+RATG VPKK  GCF
Sbjct  165   ECQKGEEVLKAEECAAKYRATGHVPKKFLGCF  196


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = +1

Query  553  EKAVVPHKNPDP---PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            EKA+VP   P P   P K     GSLDRDI  A +E +K V+ +KAWEESEKSK EN+
Sbjct  48   EKAIVPVTTPAPAPEPEKKKALGGSLDRDIVFANVEKEKTVALVKAWEESEKSKAENK  105



>ref|XP_009778199.1| PREDICTED: remorin-like isoform X1 [Nicotiana sylvestris]
Length=207

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK++ + +WEN+KKAN+EA+LKK+EEQLEKKKAEY EKM NK AL+HKEAEEKR++
Sbjct  115   NKAQKKVSAIAAWENSKKANLEAELKKMEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAM  174

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE+AAK+RATG  PKK  GCF
Sbjct  175   IEAKRGEDLLKAEELAAKYRATGTAPKKLLGCF  207


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  517  PQNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESE  696
            P+ +    D S    VV  K  +P       +GS+DRD  LA++  +KR+S IKAWEESE
Sbjct  52   PEEVKEKSDDSKALVVVEDKAAEPA--EEKKEGSIDRDAVLARVATEKRLSLIKAWEESE  109

Query  697  KSKVENR  717
            KSK EN+
Sbjct  110  KSKAENK  116



>emb|CDY06318.1| BnaA09g48850D [Brassica napus]
Length=195

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN++KA IEA+L+KIEE+LEKKKAEY EKM NK A +HKEAEEKR+++
Sbjct  104   KAQKKVSDVLAWENSQKAAIEARLRKIEEKLEKKKAEYGEKMKNKVAAIHKEAEEKRAMV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  164   EAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 13/74 (18%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVIL  783
             S GS+DRD+ LA +E +K+ SFIKAWEESEKSK EN+            +   + DV+ 
Sbjct  67   SSSGSIDRDVKLADLEKEKKTSFIKAWEESEKSKAENK------------AQKKVSDVLA  114

Query  784  WFSSSLHVRVNTRL  825
            W  +S    +  RL
Sbjct  115  W-ENSQKAAIEARL  127



>ref|XP_006421909.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|ESR35149.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|KDO60013.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=206

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ ++SWEN++KA +EA+LKKIEEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  113   KAHKKLSSIVSWENSRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMI  172

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE+AAK+RATG  PKK   CFG
Sbjct  173   EAKRGEDLLKAEELAAKYRATGSAPKKLLSCFG  205


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            +PP     ++GS++RD  LA++E +KR+S I+AWEESEKS+ EN+
Sbjct  69   EPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAENK  113



>gb|AEK94319.1| remorin [Pyrus x bretschneideri]
Length=198

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+DV +WE+++KA +EAKL+ IEEQLEKKKA+YAEKM NK AL+HK+A+EKR+++
Sbjct  107   KAQKKLSDVTAWESSRKAAVEAKLRSIEEQLEKKKAQYAEKMQNKVALLHKQADEKRAMV  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             ++Q+ E++LK +E AAK+RATG +PKK  GCF
Sbjct  167   LAQKGEELLKADETAAKYRATGSIPKKFLGCF  198


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 12/64 (19%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVIL  783
             S GS+DRDIALA++E +K +SF++AWEESEK+K EN+            +   L DV  
Sbjct  70   ASGGSIDRDIALAQLEKEKSMSFVRAWEESEKAKAENK------------AQKKLSDVTA  117

Query  784  WFSS  795
            W SS
Sbjct  118  WESS  121



>ref|XP_009615469.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=201

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ V  WENT+KA +EAK KK+EEQLE KKAEYAEK+ NK AL+HKEA EKR++
Sbjct  109   NKAQKKLSAVARWENTRKAKLEAKPKKLEEQLEHKKAEYAEKIKNKVALIHKEANEKRAM  168

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R +++LK EEMAAK+RATGQ PKK  GCF
Sbjct  169   VDARRGKEILKAEEMAAKYRATGQTPKKFLGCF  201


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            +P +  DP L    SKGSLDRD+ALA++E +KR SF+KAWEESEKSKV+N+
Sbjct  61   IPMQKTDP-LSKRSSKGSLDRDVALAQLETEKRSSFVKAWEESEKSKVDNK  110



>ref|XP_003528866.1| PREDICTED: remorin-like [Glycine max]
Length=198

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQK+L+ V +WEN+KKA +EA+L+KIEEQLEKKKAEY EKM NK ALVHK+AEEKR+++
Sbjct  107   KAQKQLSAVAAWENSKKAALEAQLRKIEEQLEKKKAEYGEKMKNKIALVHKQAEEKRAMV  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK RATG  PKKAFGCF
Sbjct  167   EAKRGEEILKAEEIAAKHRATGTSPKKAFGCF  198


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P+K   S GSLDRDIALA+IE +KR+S +KAWEESEKSK EN+
Sbjct  65   PVKKNASGGSLDRDIALAEIEKEKRLSNVKAWEESEKSKAENK  107



>emb|CDY05883.1| BnaC08g20600D [Brassica napus]
Length=120

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA  EA+LKKIE+QL KKKAEYAE+M NK A +HKEAEEKR++ 
Sbjct  29    KAQKKLSSVGAWENSKKAYAEAELKKIEQQLIKKKAEYAEQMKNKIAQIHKEAEEKRAMT  88

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG  P K FGCF
Sbjct  89    EAKRGEEILKAEEMAAKYRATGTAPTKLFGCF  120



>ref|XP_002510796.1| Remorin, putative [Ricinus communis]
 gb|EEF51398.1| Remorin, putative [Ricinus communis]
Length=182

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ ++SWEN+KKA++EA+LK++EE+LEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  91    KAHKKLSAIVSWENSKKASVEAELKQMEEKLEKKKAEYVEKMKNKIALIHKEAEEKRAMI  150

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE AAK+RATG  PKK  GCF
Sbjct  151   EAKRGEDLLKAEETAAKYRATGTAPKKLLGCF  182


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 19/78 (24%)
 Frame = +1

Query  532  PTKDVSPEKAVVPHKNPDPPLKTA----------------GSKGSLDRDIALAKIEDDKR  663
            P KDV+ EK+ +P   P P  K +                 ++GS++RD  LA++E +KR
Sbjct  17   PPKDVAEEKSAIP---PPPQEKASDDSKALVAVEKSVEEKSTEGSVNRDAVLARVETEKR  73

Query  664  VSFIKAWEESEKSKVENR  717
            VS I+AWEESEKSK EN+
Sbjct  74   VSLIRAWEESEKSKAENK  91



>ref|XP_004953259.1| PREDICTED: remorin-like isoform X1 [Setaria italica]
Length=183

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  941   VLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRNEQV  1120
             +LSWENTKK+ +EA+LKK EE+LEKKKAEYAEKM NK A++H+ AEEKR+++++QR E+V
Sbjct  98    ILSWENTKKSVVEAQLKKKEEELEKKKAEYAEKMKNKKAIIHRRAEEKRAMVMAQRGEEV  157

Query  1121  LKTEEMAAKFRATGQVPKKAFGCFG  1195
             LK EEMAAK+RATG  PKK  GCFG
Sbjct  158   LKAEEMAAKYRATGLAPKKFLGCFG  182



>ref|XP_006402501.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
 gb|ESQ43954.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
Length=197

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAEKM NK A +HKEAEE+R++
Sbjct  105   NKAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAEKMKNKVAAIHKEAEERRAM  164

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  165   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  197


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 12/92 (13%)
 Frame = +1

Query  520  QNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEK  699
            QN  P ++    KA+   + P  P     S GSLDRD+ LA +  +K++SF+KAWE+SEK
Sbjct  41   QNPPPEQNSDDSKALAVVEKPVEPETKKSSSGSLDRDVKLADLSKEKKMSFVKAWEDSEK  100

Query  700  SKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            SK EN+            +   + DV+ W +S
Sbjct  101  SKAENK------------AEKKISDVLAWENS  120



>gb|AFK39071.1| unknown [Lotus japonicus]
Length=187

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQK L+DV++WEN+KKA +EA+L+KIEE+LEKKKAEY EKM NK ALVHKEAEE+R++I
Sbjct  95    KAQKNLSDVVAWENSKKAALEAQLRKIEERLEKKKAEYGEKMKNKIALVHKEAEERRAMI  154

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
              ++R E +LK EE+AAKFRATG  PKK   GCF
Sbjct  155   EAKRGEDLLKAEELAAKFRATGTTPKKPVLGCF  187


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 59/101 (58%), Gaps = 19/101 (19%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFF  741
            VVP K P P  K + SKGSLDRD+ALA++E +KR+S++KAWEESEKSK EN+        
Sbjct  45   VVPEKTPVPENKPS-SKGSLDRDVALAELEKEKRLSYVKAWEESEKSKTENK--------  95

Query  742  FILASNMNLLDVILWFSSSLHV------RVNTRLELSRISF  846
                +  NL DV+ W +S          ++  RLE  +  +
Sbjct  96   ----AQKNLSDVVAWENSKKAALEAQLRKIEERLEKKKAEY  132



>gb|AII99828.1| remorin 1 [Nicotiana tabacum]
Length=205

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN+KKAN+EA+LKK+EEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  114   KAQKKVSAIGAWENSKKANLEAELKKMEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RATG  PKK  GCF
Sbjct  174   EAKRGEDLLKAEELAAKYRATGTAPKKLLGCF  205



>ref|XP_009590953.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=205

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN+KKAN+EA+LKK+EEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  114   KAQKKVSAIGAWENSKKANLEAELKKMEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RATG  PKK  GCF
Sbjct  174   EAKRGEDLLKAEELAAKYRATGTAPKKLLGCF  205


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  517  PQNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESE  696
            P+ +    D S    VV  K  +P       +GS+DRD  LA++   KR+S IKAWEESE
Sbjct  50   PEQVKEKTDDSKALVVVEDKAAEPA--EEKKEGSIDRDAVLARVATQKRLSLIKAWEESE  107

Query  697  KSKVENR  717
            KSK EN+
Sbjct  108  KSKAENK  114



>ref|XP_010055168.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW71646.1| hypothetical protein EUGRSUZ_E00174 [Eucalyptus grandis]
Length=186

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V SWEN+KKA  EAKL+K+EE LEKKKA+YAE+M NK +L+HKEAEEK++++
Sbjct  95    KAQKKLSAVTSWENSKKAAAEAKLRKMEEVLEKKKAQYAEQMKNKVSLIHKEAEEKKAMV  154

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK +EMAAK RATG VPKK  GCF
Sbjct  155   EARRKEEILKAQEMAAKHRATGNVPKKFLGCF  186


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            VV  K PD   K   S GS+DRDIALA++E +KR+SFIKAWE+SEK+K EN+
Sbjct  45   VVADKAPDAAEKKI-SGGSIDRDIALAEVEKEKRMSFIKAWEDSEKTKAENK  95



>ref|XP_009408139.1| PREDICTED: remorin [Musa acuminata subsp. malaccensis]
Length=171

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKKL+ + SWEN+KKA +EA+LKKIEE++E +KAEYAEKM NK A++HK AEEK++++
Sbjct  78    KSQKKLSAITSWENSKKATLEAELKKIEEKIENQKAEYAEKMKNKIAMIHKAAEEKKALV  137

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK EE AAK+RATGQ PKK F CF 
Sbjct  138   EAKRGEELLKAEETAAKYRATGQAPKKGFSCFS  170


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V  K+     K+ GS  S+DRD+ALA++E +K++S IKAWEESEK+K EN+
Sbjct  30   VVEKSASQETKSVGS--SIDRDVALAQVETEKKLSLIKAWEESEKTKAENK  78



>ref|XP_006295053.1| hypothetical protein CARUB_v10024121mg [Capsella rubella]
 gb|EOA27951.1| hypothetical protein CARUB_v10024121mg [Capsella rubella]
Length=191

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK++DV +WEN+KKA +EA+L+KIEE+LEKKKA Y EKM NK A +HKEAEEKR+++
Sbjct  100   RAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKALYGEKMKNKVAAIHKEAEEKRAMV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  160   EAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 50/95 (53%), Gaps = 23/95 (24%)
 Frame = +1

Query  496  TSVAVAAPQNMGPTKDVSP----EKAVVPHKNPDP-----------------PLKTAGSK  612
            + V V +P  + PTK+ +P    E A     NP P                 P KT  S 
Sbjct  8    SKVDVESPAVVAPTKEAAPPAPVEVAEEKVHNPPPVESKALAVVEKPIEEHTPKKT--SS  65

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS DRD+ LA +E +K+ SFIKAWEESEKSK +NR
Sbjct  66   GSADRDVILADLEKEKKTSFIKAWEESEKSKADNR  100



>ref|XP_006397772.1| hypothetical protein EUTSA_v10001646mg [Eutrema salsugineum]
 gb|ESQ39225.1| hypothetical protein EUTSA_v10001646mg [Eutrema salsugineum]
Length=195

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN+KKA  EA+L+KIEE+LEKKKAEY EKM NK A +HK AEEKR+++
Sbjct  104   KAQKKISDVLAWENSKKAATEAQLRKIEEKLEKKKAEYGEKMKNKVAAIHKLAEEKRAMV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  164   EAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 35/123 (28%)
 Frame = +1

Query  496  TSVAVAAPQNMGPTKDVSP-----EKAVVPHK--NPDPPLKTAG----------------  606
            T V V +P  + P K+ +P      K V   K   P PP+++                  
Sbjct  8    TKVDVESPAVLAPAKEPTPAPVEASKDVAEEKIHTPPPPVESKALAVVEKPIEEHTPKKS  67

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILW  786
            S GS DRD+ LA +E +K+ SFIKAWEESEKSK EN+            +   + DV+ W
Sbjct  68   SSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENK------------AQKKISDVLAW  115

Query  787  FSS  795
             +S
Sbjct  116  ENS  118



>ref|XP_006291850.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
 gb|EOA24748.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
Length=208

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  116   NKAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAL  175

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  176   VEAKRGEDILKAEETAAKYRATGTVPKATCGCF  208


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 12/71 (17%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNM  762
            + P  T  S  SLDRD+ LA +  +KR+SF++AWE+SEKSK EN+            +  
Sbjct  73   EEPAPTKSSSASLDRDVKLADLSKEKRLSFVRAWEDSEKSKAENK------------AEK  120

Query  763  NLLDVILWFSS  795
             + DV+ W +S
Sbjct  121  KISDVLAWENS  131



>ref|XP_010934733.1| PREDICTED: remorin [Elaeis guineensis]
Length=195

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ ++SWENTKKA +EA+LKKIEE LE KKAEY+EKM NK A++HK AEEKR+++
Sbjct  102   KAQKKMSSIVSWENTKKAAVEAELKKIEEALEMKKAEYSEKMKNKIAMIHKAAEEKRAIV  161

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK EE AAK+RATG  PKK  GCF 
Sbjct  162   EAKRGEEILKAEESAAKYRATGLYPKKVCGCFS  194


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            VV  K  D P     S GS +RD  LA++  +K++S IKAWEESEK+K EN+
Sbjct  51   VVVEKVADSPPPEKSSAGSTNRDAVLARVATEKKMSLIKAWEESEKTKAENK  102



>ref|XP_009757254.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=132

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V  WENT+KA  EAKLKK+EEQLE KKA+YAEK+ NK AL+HKEA EKR+++
Sbjct  41    KAQKKLSAVARWENTQKAKFEAKLKKLEEQLEHKKADYAEKIKNKVALIHKEANEKRAMV  100

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R +++LK EEMAAK+RATG+ PKK  GCF
Sbjct  101   DARRGKEILKAEEMAAKYRATGKAPKKFLGCF  132


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  601  AGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            + SKGSLDRD+ALA++E +KR SF+KAWEESEKSKV+N+
Sbjct  3    SSSKGSLDRDVALAQLETEKRSSFVKAWEESEKSKVDNK  41



>ref|XP_010469049.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=213

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  121   NKAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAM  180

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  181   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  213


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 12/92 (13%)
 Frame = +1

Query  520  QNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEK  699
            QN  P       KA+   + P  P  T  S  SLDRD+ LA +  +KR+SF++AWE+SEK
Sbjct  57   QNPSPEHITDDSKALTVVEKPIEPEPTKSSSASLDRDVKLADLSKEKRLSFVRAWEDSEK  116

Query  700  SKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            SK EN+            +   + DV+ W +S
Sbjct  117  SKAENK------------AEKKISDVLAWENS  136



>ref|XP_010512460.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=216

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  124   NKAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAM  183

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  184   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  216


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 51/101 (50%), Gaps = 26/101 (26%)
 Frame = +1

Query  535  TKDVSPEKAVVPH--------------KNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            TKDV+ EK   P               + P  P  T  S  SLDRD+ LA + ++KR+SF
Sbjct  51   TKDVTEEKVQTPSPEHITDDSKALTVVEKPIEPEPTKSSSASLDRDVKLADLSNEKRLSF  110

Query  673  IKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  795
            ++AWE+SEKSK EN+            +   + DV+ W +S
Sbjct  111  VRAWEDSEKSKAENK------------AEKKISDVLAWENS  139



>emb|CDY27356.1| BnaC04g50490D [Brassica napus]
Length=195

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN++KA IEA+L+KIEE+LEKKKAEY EKM NK A +HK+AEEKR+++
Sbjct  104   KAQKKVSDVLAWENSQKAAIEARLRKIEEKLEKKKAEYGEKMKNKVAAIHKQAEEKRAMV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  164   EAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 33/120 (28%)
 Frame = +1

Query  514  APQNMGPTKDVSPEKAVVPHKNPDPPLKTAG----------------SKGSLDRDIALAK  645
            AP  +  +KDV+ EK      +P PP+++                  S GSLDRD+ LA 
Sbjct  25   APAPVEASKDVAEEKV----HDPPPPVESKALTVVEKPIEEPAPKKSSSGSLDRDVKLAD  80

Query  646  IEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSSSLHVRVNTRL  825
            +E +K+ SFIKAWEESEK+K EN+            +   + DV+ W  +S    +  RL
Sbjct  81   LEKEKKTSFIKAWEESEKTKAENK------------AQKKVSDVLAW-ENSQKAAIEARL  127



>ref|XP_006339544.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=174

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ V +WENTKKANIEAKLKK+EEQLE+KKAEYAEK+ N+ A VH EAEEKR+++
Sbjct  82    KAEKKLSSVGTWENTKKANIEAKLKKLEEQLEQKKAEYAEKIKNRVAAVHMEAEEKRAMV  141

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK EEMAAK+RATGQ PKK  GC G
Sbjct  142   EARRGEELLKAEEMAAKYRATGQAPKK-IGCLG  173


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  619  LDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            LDRD+ALA +E +K+ S+IKAWEESEKSKV N+
Sbjct  50   LDRDVALAHLETEKKNSYIKAWEESEKSKVNNK  82



>ref|XP_008336972.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
 ref|XP_008362621.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
Length=240

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+DV +WE+++KA +EAKL+ IEEQLEKKKA+YAEKM NK AL+HK+A+EKR+++
Sbjct  107   KAQKKLSDVTAWESSRKAAVEAKLRSIEEQLEKKKAQYAEKMQNKVALLHKQADEKRAMV  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             ++Q+ E++LK +E AAK+RATG +PKK  GCF
Sbjct  167   LAQKGEELLKADETAAKYRATGSIPKKFLGCF  198


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 12/68 (18%)
 Frame = +1

Query  592  LKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLL  771
            L+   S GS+DRDIALA++E +K +SFI+AWEESEK+K EN+            +   L 
Sbjct  66   LEKKASGGSIDRDIALAQLEKEKSMSFIRAWEESEKAKAENK------------AQKKLS  113

Query  772  DVILWFSS  795
            DV  W SS
Sbjct  114  DVTAWESS  121



>ref|XP_010413437.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=223

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK++DVL+WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  131   NKAEKKISDVLAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAM  190

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  191   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  223


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 12/80 (15%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFN  735
            KA+   + P  P  T  S  SLDRD+ LA +  +KR+SF++AWE+SEKSK EN+      
Sbjct  79   KALTVVEKPIEPEPTKSSSASLDRDVKLADLSKEKRLSFVRAWEDSEKSKAENK------  132

Query  736  FFFILASNMNLLDVILWFSS  795
                  +   + DV+ W +S
Sbjct  133  ------AEKKISDVLAWENS  146



>ref|XP_004306803.1| PREDICTED: uncharacterized protein At3g61260-like [Fragaria vesca 
subsp. vesca]
Length=196

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+K+L+ V +WENTKKA IEAKL+ +EE+LEKKKA+YAEKM N+ AL+HK+A+EKR++I
Sbjct  105   KAEKRLSTVTAWENTKKAAIEAKLRSMEEKLEKKKAQYAEKMKNQIALLHKQADEKRAMI  164

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R +++LK EEMAAK+RATG VPKK  GCF
Sbjct  165   QAERGQELLKAEEMAAKYRATGGVPKKFLGCF  196


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +1

Query  529  GPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKV  708
            G   D      V P K P+   K   S GS DRD+ALA +E +K +SF++AWE+SEK K 
Sbjct  44   GAVDDSKALAVVEPEKVPETIAKKP-SGGSHDRDVALANLEKEKSMSFVRAWEDSEKDKA  102

Query  709  ENR  717
            EN+
Sbjct  103  ENK  105



>ref|XP_007135038.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
 gb|AGV54511.1| remorin family protein [Phaseolus vulgaris]
 gb|ESW07032.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
Length=198

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQK L+ V +WEN+KKA +EA+L+KIEEQLEKKKAEY EKM NK ALVHK+AEEKR+ +
Sbjct  107   KAQKHLSAVAAWENSKKAALEAQLRKIEEQLEKKKAEYGEKMKNKIALVHKQAEEKRATV  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++L  EE AAK+RATG  PKKAFGCF
Sbjct  167   EAKRGEEILNAEESAAKYRATGTTPKKAFGCF  198


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  553  EKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            EK     K P  P+K   + GSLDRDIALA+IE +KR S +KAWEESEKSK EN+
Sbjct  53   EKEKESEKTPPEPVKKKATGGSLDRDIALAEIEKEKRFSNVKAWEESEKSKAENK  107



>gb|EYU35080.1| hypothetical protein MIMGU_mgv1a0150192mg, partial [Erythranthe 
guttata]
Length=122

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQK+ A V SWEN+KKA++EA+LKKI+EQLE+KKAEYAEKM NK A +HK AEEKR+ +
Sbjct  29    KAQKRQAKVSSWENSKKASLEAQLKKIQEQLERKKAEYAEKMKNKAAQIHKHAEEKRATV  88

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK  EMAAK+RATGQ+PK  F CF
Sbjct  89    EARKGEELLKASEMAAKYRATGQIPKSGFACF  120



>gb|KFK35323.1| hypothetical protein AALP_AA5G269500 [Arabis alpina]
Length=196

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK +DV +WEN+KKAN+EA+L+KIEEQLEKKK EYAEKM NK A +HKEAEE+R++
Sbjct  104   NKAEKKTSDVHAWENSKKANVEAQLRKIEEQLEKKKGEYAEKMKNKVAAIHKEAEERRAM  163

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  164   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  196


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  520  QNMGPTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEK  699
            +N+ P K     KA+V  + P  P     S  SLDRD+ LA +  +K +SFIKAWE+SEK
Sbjct  40   ENLSPEKVSDDSKALVLVEKPVEPEVKKSSSASLDRDVKLADLSKEKTLSFIKAWEDSEK  99

Query  700  SKVENR  717
            SK EN+
Sbjct  100  SKAENK  105



>ref|XP_006404199.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
 gb|ESQ45652.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
Length=176

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EA+LKKIEEQL KKKAEY E+M NK A +HKEAEEKR++ 
Sbjct  85    KAQKKLSSVGAWENSKKASVEAELKKIEEQLIKKKAEYTEQMKNKIAQIHKEAEEKRAMT  144

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FGCF
Sbjct  145   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGCF  176


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E +KR+S IKAWEE+EKSKVEN+
Sbjct  51   GSVYRDAVLTRLETEKRISLIKAWEEAEKSKVENK  85



>ref|XP_011084412.1| PREDICTED: remorin-like [Sesamum indicum]
Length=192

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN+KKA++EA+LKKIEEQLEKKKAEY EKM NK ALVHK AEEKR++I
Sbjct  101   KAQKKISAIAAWENSKKASLEAELKKIEEQLEKKKAEYIEKMKNKVALVHKAAEEKRAMI  160

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EEMAAK+RATG  PKK  GCF
Sbjct  161   EAKRGEDLLKAEEMAAKYRATGTGPKKLLGCF  192


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 15/75 (20%)
 Frame = +1

Query  538  KDVSPEKAVVP---------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            KDVS EK VVP                + P+   +    +GS+DRD  LA++  +KR+S 
Sbjct  27   KDVSEEKIVVPPPAEEKADESKALVVVEKPEAAAEEKKPEGSIDRDAVLARVATEKRLSL  86

Query  673  IKAWEESEKSKVENR  717
            IKAWEESEKSK EN+
Sbjct  87   IKAWEESEKSKAENK  101



>ref|XP_010518225.1| PREDICTED: remorin [Camelina sativa]
Length=191

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK +DV +WEN+KKA +EA+L+KIEE+LEKKKA Y EKM NK A +HKEAEEKR+++
Sbjct  100   RAQKKTSDVHAWENSKKAAVEAQLRKIEEKLEKKKALYGEKMKNKVAAIHKEAEEKRAMV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  160   EAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  63   ASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  100



>ref|XP_007218451.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
 gb|EMJ19650.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
Length=197

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+D+ +WEN++KA  EAKL+++EE+LEKKK +YAEKM N+ AL+HK+A+EKR++ 
Sbjct  106   KAQKKLSDITAWENSRKAAAEAKLRRMEEKLEKKKTQYAEKMKNQVALLHKQADEKRALT  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             ++ R E+ LK +E AAK+RATG +PKK  GCF
Sbjct  166   IANRGEEFLKADETAAKYRATGSIPKKFLGCF  197


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 20/78 (26%)
 Frame = +1

Query  541  DVSPEKAVVP-------------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKR  663
            D++ EKAVVP                    K P+  +K   S GS+DRD+AL+ +E +K 
Sbjct  30   DLAEEKAVVPPPREVDVKGVDDTKALAVVEKAPETEVKKP-SGGSIDRDVALSHLEKEKS  88

Query  664  VSFIKAWEESEKSKVENR  717
            +SFI+AWEESEK+K EN+
Sbjct  89   LSFIRAWEESEKAKAENK  106



>ref|XP_003534573.1| PREDICTED: remorin-like [Glycine max]
Length=183

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQK+L+ + +WEN+KKA +EA+LKKIEEQLEKKKAE+ E+M NK ALVHKEA EKR++I
Sbjct  92    RAQKQLSAIAAWENSKKATLEAELKKIEEQLEKKKAEHGERMKNKVALVHKEAGEKRAMI  151

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R E+VLKTEE+AAK+RATG  PKK  GCF
Sbjct  152   EANRCEEVLKTEEVAAKYRATGTTPKKTIGCF  183


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V   K P P  K + S+GS+DRDIALA++E +K++S++KAWEESEK+K ENR
Sbjct  42   VASEKTPVPENKQS-SRGSIDRDIALAEVEKEKKLSYVKAWEESEKAKAENR  92



>ref|XP_010506561.1| PREDICTED: remorin-like [Camelina sativa]
Length=191

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK +DV +WEN+KKA +EA+L+KIEE+LEKKKA Y EKM NK A +HKEAEEKR+++
Sbjct  100   RAQKKTSDVHAWENSKKAAVEAQLRKIEEKLEKKKALYGEKMKNKVAAIHKEAEEKRAMV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  160   EAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  63   ASAGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  100



>emb|CDY71834.1| BnaAnng38930D [Brassica napus]
Length=176

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA+ EA+LKKIEEQL KKKAEYAE+M NK   +HKEAEEKR++ 
Sbjct  85    KAQKKLSSVGAWENSKKASAEAELKKIEEQLIKKKAEYAEQMKNKIVQIHKEAEEKRAMT  144

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R E++LK EEMAAK+RATG  P K FGCF
Sbjct  145   EANRGEEILKAEEMAAKYRATGTAPTKLFGCF  176



>ref|XP_010508104.1| PREDICTED: remorin-like [Camelina sativa]
Length=191

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK +DV +WEN+KKA +EA+L+KIEE+LEKKKA Y EKM NK A +HKEAEEKR+++
Sbjct  100   RAQKKTSDVHAWENSKKAAVEAQLRKIEEKLEKKKALYGEKMKNKVAAIHKEAEEKRAMV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  160   EAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  63   ASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  100



>ref|XP_008376024.1| PREDICTED: remorin-like [Malus domestica]
Length=204

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+DV +WE+++KA +EAKL+ IEEQLEKKKA+YAEKM NK AL+ K+A+EKR+++
Sbjct  113   KAQKKLSDVTAWESSRKAAVEAKLRSIEEQLEKKKAQYAEKMKNKVALLQKQADEKRAMV  172

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             ++Q+ E++LK EE AAK+RATG +PKK  GCF
Sbjct  173   LAQKGEELLKAEETAAKYRATGSIPKKFLGCF  204


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 13/77 (17%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFF  744
            V +K P+  +K A S GS+DRDIALA +E +K +SFI+AWEESEK+K EN+         
Sbjct  64   VVNKVPETLVKKA-SGGSIDRDIALAGLEKEKSMSFIRAWEESEKTKAENK---------  113

Query  745  ILASNMNLLDVILWFSS  795
               +   L DV  W SS
Sbjct  114  ---AQKKLSDVTAWESS  127



>ref|XP_002267609.1| PREDICTED: remorin [Vitis vinifera]
 emb|CAN73187.1| hypothetical protein VITISV_041529 [Vitis vinifera]
 emb|CBI22753.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+   +WEN++KA++EA+LKKIEE LE+KKAEY EKM NK A++HKEAEEKR++I
Sbjct  105   KAQKKLSATEAWENSQKASVEAELKKIEENLERKKAEYVEKMKNKIAIIHKEAEEKRAMI  164

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EEMAAK+RATG  PKK  GCF
Sbjct  165   EARRGEDLLKAEEMAAKYRATGSAPKKLLGCF  196


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 18/78 (23%)
 Frame = +1

Query  538  KDVSPEKAVVP------------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKR  663
            KDV+ EKAV+P                   K P+P  +     GS++RD  LA++  +KR
Sbjct  28   KDVTEEKAVIPPAPPPEEKPDETKALAIVEKVPEPIEEKGSEGGSVNRDTVLARVATEKR  87

Query  664  VSFIKAWEESEKSKVENR  717
            +S I+AWEESEK K EN+
Sbjct  88   LSLIRAWEESEKCKAENK  105



>ref|XP_008377346.1| PREDICTED: remorin-like isoform X1 [Malus domestica]
Length=229

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWENTKKA +EA+LKKIEEQLEKKKAEY E+M NK AL+HK AEEKR+VI
Sbjct  136   RAHKKLSAIGSWENTKKATVEAELKKIEEQLEKKKAEYVEQMKNKIALIHKAAEEKRAVI  195

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE AAK+RATG  PKK  GCF
Sbjct  196   EAKRGEDLLKAEETAAKYRATGYAPKKLLGCF  227



>ref|NP_001234238.1| remorin 2 [Solanum lycopersicum]
 gb|AAD28507.2|AF123266_1 remorin 2 [Solanum lycopersicum]
Length=174

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ V +WENTKKANIEAKLKK+EEQLE+KKAEYAEK+ NK A VH EAEEKR+++
Sbjct  82    KAEKKLSSVGTWENTKKANIEAKLKKLEEQLEQKKAEYAEKIKNKVAAVHMEAEEKRAMV  141

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E++LK EE+AAK+RATGQ PKK  GC G
Sbjct  142   EARRGEELLKAEEIAAKYRATGQAPKK-IGCLG  173


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  619  LDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             DRD+ALA +E++KR S+IKAWEESEKSKV N+
Sbjct  50   FDRDVALAHLEEEKRNSYIKAWEESEKSKVNNK  82



>ref|XP_008232793.1| PREDICTED: remorin [Prunus mume]
Length=198

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+D+ +WEN++KA  EAKL+ +EE+LEKKK +YAEKM N+ AL+HK+A+EKR++ 
Sbjct  107   KAQKKLSDITAWENSRKAAAEAKLRSMEEKLEKKKTQYAEKMKNQVALLHKQADEKRALA  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             ++ R E+ LK +E AAK+RATG +PKK  GCF
Sbjct  167   IANRGEEFLKADETAAKYRATGTIPKKFLGCF  198


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 19/78 (24%)
 Frame = +1

Query  541  DVSPEKAVVP-------------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKR  663
            D++ EKAV+P                    K P+  +    S GS+DRD+AL+ +E +K 
Sbjct  30   DLAEEKAVLPPPREVDVKGVDDTKALAVVEKAPEETVVKKPSGGSIDRDVALSHLEKEKS  89

Query  664  VSFIKAWEESEKSKVENR  717
            +SFI+AWEESEK+K EN+
Sbjct  90   LSFIRAWEESEKAKAENK  107



>ref|XP_006827693.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
 gb|ERM95109.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
Length=187

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  926   KKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQ  1105
             KKL+ + SWEN+KKA +EA+L+KIEE+LE++KAEYAEKM NK AL+HKEAEEKR++  ++
Sbjct  97    KKLSSIGSWENSKKAAVEAELRKIEEKLERQKAEYAEKMKNKIALIHKEAEEKRAMTEAK  156

Query  1106  RNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             R E++LK EE AAK+RATG  PKK  GCFG
Sbjct  157   RGEELLKAEETAAKYRATGLAPKKLIGCFG  186


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 50/98 (51%), Gaps = 30/98 (31%)
 Frame = +1

Query  502  VAVAAPQNMGPTKDVSPEKAVVPHKNPDPPL--------------------------KTA  603
            + V   + MG   DV+ EK V+P  N  PP+                          K+ 
Sbjct  1    MGVEEAKAMGG--DVAEEKTVIPRTNETPPVPAPQDDSKALAVVEKVADPVPSLDVEKSI  58

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            G  GS+DRD  LAK+E +KR+S I+AWEESEK+K EN+
Sbjct  59   G--GSIDRDAVLAKVESEKRMSLIRAWEESEKTKAENK  94



>ref|NP_191685.1| remorin family protein [Arabidopsis thaliana]
 sp|Q9M2D8.1|Y3126_ARATH RecName: Full=Uncharacterized protein At3g61260 [Arabidopsis 
thaliana]
 gb|AAK44161.1|AF370346_1 putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB71056.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAL34151.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM65607.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE80180.1| remorin family protein [Arabidopsis thaliana]
Length=212

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK+ADV +WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  120   NKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAM  179

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E VLK EE AAK+RATG VPK   GCF
Sbjct  180   IEAKRGEDVLKAEETAAKYRATGIVPKATCGCF  212


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             SLDRD+ LA +  +KR+SF++AWEESEKSK EN+
Sbjct  87   ASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENK  121



>ref|XP_009143176.1| PREDICTED: remorin-like [Brassica rapa]
 emb|CDX74768.1| BnaA05g05140D [Brassica napus]
Length=192

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN+KKA  EA+L+KIEE+LEKKKA Y EKM NK A +HK+AEEKR+++
Sbjct  101   KAQKKISDVLAWENSKKAATEAQLRKIEEKLEKKKAVYGEKMKNKVAAIHKQAEEKRAMV  160

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EE AAK+RATG VPK   GCF
Sbjct  161   EAKKGEELLKAEETAAKYRATGVVPKATCGCF  192


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 20/90 (22%)
 Frame = +1

Query  532  PTKDVSPEKAVV--PHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSK  705
            P  D S   AVV  P ++P P       KGS DRD+ LA +E +K+ SFIKAWEESEKSK
Sbjct  44   PPPDESKALAVVEKPIEDPTP------KKGSADRDVILADLEKEKKSSFIKAWEESEKSK  97

Query  706  VENR*AIVFNFFFILASNMNLLDVILWFSS  795
             EN+            +   + DV+ W +S
Sbjct  98   AENK------------AQKKISDVLAWENS  115



>gb|KHG21181.1| Remorin [Gossypium arboreum]
Length=191

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL+ + +WENTKKA IEA+LK+IEE+L+K+KAEY EKM NK AL+HKEAEEK+++
Sbjct  99    NKAQKKLSSIAAWENTKKAAIEAELKRIEEKLDKQKAEYVEKMKNKAALIHKEAEEKKAI  158

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGC  1189
             + ++R E VLK EE+AAK+RATG  P K  GC
Sbjct  159   VEAKRGEDVLKAEELAAKYRATGTTPNKTVGC  190



>ref|XP_009340014.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=211

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWENTKKAN+EA+LKKIEEQLEKKKAEY E+M NK AL+HK AEEKR+ I
Sbjct  118   KAHKKLSAIGSWENTKKANVEAELKKIEEQLEKKKAEYVEQMKNKIALIHKAAEEKRATI  177

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  178   EAKRGEDLLKAEETAAKYRATGYAPKKLLGCFS  210



>ref|XP_002878373.1| hypothetical protein ARALYDRAFT_486603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54632.1| hypothetical protein ARALYDRAFT_486603 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KK+ADV +WEN+KKA +EA+LKKIEEQLEKKKAEYAE+M NK A +HKEAEE+R++
Sbjct  122   NKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAM  181

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG VPK   GCF
Sbjct  182   IEAKRGEDILKAEETAAKYRATGIVPKATCGCF  214


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            + P     S  SLDRD+ LA +  +KR+SF++AWEESEKSK EN+
Sbjct  79   EEPAPVKSSSASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENK  123



>ref|XP_008465865.1| PREDICTED: remorin [Cucumis melo]
Length=193

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V +WEN+KKA++EA+LKKIEE LEKKK EY EKM NK AL+HK AEEKR++I
Sbjct  100   KAHKKLSSVAAWENSKKASVEAELKKIEESLEKKKGEYIEKMKNKIALLHKSAEEKRAII  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  160   EAKRGEDLLKAEETAAKYRATGTAPKKLLGCFS  192


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 21/78 (27%)
 Frame = +1

Query  538  KDVSPEKAVVPHKNPDPPLKTAGSK------------------GSLDRDIALAKIEDDKR  663
            KDV+ EK+V+P   P P  KT  SK                  GS++RD  LAK+  +KR
Sbjct  26   KDVAEEKSVIP---PPPEDKTDDSKALVLVEKVPEVADPKSTEGSVNRDAVLAKVATEKR  82

Query  664  VSFIKAWEESEKSKVENR  717
            +S IKAWEESEKSK EN+
Sbjct  83   LSLIKAWEESEKSKAENK  100



>ref|NP_001274989.1| remorin [Solanum tuberosum]
 sp|P93788.1|REMO_SOLTU RecName: Full=Remorin; AltName: Full=pp34 [Solanum tuberosum]
 gb|AAB49425.1| remorin [Solanum tuberosum]
Length=198

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN+KKAN+EA+LKK+EEQLEKKKAEY EKM NK AL+HKEAEEKR++I
Sbjct  107   KAQKKVSAIGAWENSKKANLEAELKKMEEQLEKKKAEYTEKMKNKIALLHKEAEEKRAMI  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RATG  PKK  G F
Sbjct  167   EAKRGEDLLKAEELAAKYRATGTAPKKILGIF  198


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            VV  K P+P       +GS+DRD  LA++  +KRVS IKAWEESEKSK EN+
Sbjct  58   VVETKAPEPA--DEKKEGSIDRDAVLARVATEKRVSLIKAWEESEKSKAENK  107



>ref|NP_001234231.1| remorin 1 [Solanum lycopersicum]
 gb|AAD28506.1|AF123265_1 remorin 1 [Solanum lycopersicum]
Length=197

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN+KKAN+E++LKK+EEQLEKKKA Y EKM NK AL+HKEAEEKR++I
Sbjct  106   KAQKKVSAIGAWENSKKANLESELKKMEEQLEKKKAIYTEKMKNKIALLHKEAEEKRAMI  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RATG  PKK  G F
Sbjct  166   EAKRGEDLLKAEELAAKYRATGTAPKKILGIF  197


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KA+V  +N          +GS+DRD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  53   KALVVVENKAEEAADEKKEGSIDRDAVLARVATEKRLSLIKAWEESEKSKAENK  106



>ref|XP_010105965.1| hypothetical protein L484_017313 [Morus notabilis]
 gb|EXC06847.1| hypothetical protein L484_017313 [Morus notabilis]
Length=233

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +2

Query  911   FGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRS  1090
               RAQKKL+ V ++EN+KKA +EAKL+K EE+LEKKKAEYAEKM NK AL+HKEAEEKR+
Sbjct  140   INRAQKKLSSVGAYENSKKAALEAKLRKKEEELEKKKAEYAEKMKNKVALIHKEAEEKRA  199

Query  1091  VIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + + R E++LK EE+AAK+RATG  PKK  GCF
Sbjct  200   AVEAIRREELLKAEELAAKYRATGNTPKKFLGCF  233


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFF  741
            V  K P+P +K   S GS+DRDIALA++E +KR+S+IKAWEESEK+K EN   ++  FF
Sbjct  51   VVEKTPEPLVKKP-SGGSIDRDIALAEVEKEKRLSYIKAWEESEKTKAENN--LLAAFF  106



>ref|XP_009149781.1| PREDICTED: remorin [Brassica rapa]
Length=175

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA+ EA+LKKIEEQL KKKAEYAE+M NK   +HKEAEEKR++ 
Sbjct  84    KAQKKLSSVGAWENSKKASAEAELKKIEEQLIKKKAEYAEQMKNKIVQIHKEAEEKRAMT  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EEMAA +RATG  P K FGCF
Sbjct  144   EAKRGEEILKAEEMAANYRATGTAPTKLFGCF  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LAK+E +KR+S IKAWEE+EKSKVEN+
Sbjct  50   GSVNRDDVLAKLETEKRMSLIKAWEEAEKSKVENK  84



>ref|XP_002882035.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58294.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK++DV +WENTKKA +EA+L+KIEE+LEKKKA+Y EKM NK A +HK AEEKR+++
Sbjct  99    RAQKKISDVHAWENTKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMV  158

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEM AK+RATG VPK   GCF
Sbjct  159   EAKKGEELLKAEEMGAKYRATGVVPKATCGCF  190


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P KT  S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  59   PKKT--SSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  99



>ref|XP_010908427.1| PREDICTED: remorin-like isoform X2 [Elaeis guineensis]
Length=193

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K+++ + +WEN+KKA  EA+LK  EE+LEKKKAEYAEKM NK A++HK AEEKR+++
Sbjct  100   KAAKQMSSITAWENSKKAATEAELKAKEEELEKKKAEYAEKMKNKVAMIHKTAEEKRAIV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++  E +LK EEMAAK+R+TG  PKK FGCFG
Sbjct  160   EAKCGEDILKAEEMAAKYRSTGLAPKKLFGCFG  192


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 19/78 (24%)
 Frame = +1

Query  535  TKDVSPEKAVVP----------------HKNPDPPL-KTAGSKGSLDRDIALAKIEDDKR  663
            TKDV+ EKAV+P                 K  D P  K+ G  GS +R   L ++E +KR
Sbjct  25   TKDVAEEKAVIPPPSEEKADDSKALDVVEKVADTPTEKSRG--GSTERVAQLTRLETEKR  82

Query  664  VSFIKAWEESEKSKVENR  717
            +S I+AWEE+EK KVEN+
Sbjct  83   MSLIRAWEENEKVKVENK  100



>ref|XP_008376569.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376570.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376572.1| PREDICTED: remorin-like [Malus domestica]
Length=211

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ + SWENT+KA +EA+LKKIEE+LEK+KAEY E+M NK AL+HK AEEKR+V+
Sbjct  120   KAQKKLSAIGSWENTRKAIVEAELKKIEEKLEKQKAEYMEQMKNKIALIHKAAEEKRAVV  179

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE AAK+RATG+ PKK  GCF
Sbjct  180   EAKRGEDLLKAEEAAAKYRATGKTPKKLLGCF  211



>ref|NP_197764.1| Remorin family protein [Arabidopsis thaliana]
 gb|AAK62451.1|AF387006_1 Unknown protein [Arabidopsis thaliana]
 dbj|BAB10048.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN15335.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93207.1| Remorin family protein [Arabidopsis thaliana]
Length=202

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E+M NK A +HKEAEEKR++I
Sbjct  111   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVEQMKNKIAQIHKEAEEKRAMI  170

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  171   EAKRGEEILKAEELAAKYRATGTAPKKLFGCM  202


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  111



>ref|XP_008377354.1| PREDICTED: remorin-like isoform X2 [Malus domestica]
Length=211

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWENTKKA +EA+LKKIEEQLEKKKAEY E+M NK AL+HK AEEKR+VI
Sbjct  118   KAHKKLSAIGSWENTKKATVEAELKKIEEQLEKKKAEYVEQMKNKIALIHKAAEEKRAVI  177

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE AAK+RATG  PKK  GCF
Sbjct  178   EAKRGEDLLKAEETAAKYRATGYAPKKLLGCF  209



>ref|NP_974824.1| Remorin family protein [Arabidopsis thaliana]
 gb|AED93208.1| Remorin family protein [Arabidopsis thaliana]
Length=201

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E+M NK A +HKEAEEKR++I
Sbjct  110   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVEQMKNKIAQIHKEAEEKRAMI  169

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  170   EAKRGEEILKAEELAAKYRATGTAPKKLFGCM  201


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KA+VP     P ++    +GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  60   KAIVP---VVPKVEEEKKEGSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  110



>ref|XP_010273101.1| PREDICTED: remorin-like [Nelumbo nucifera]
Length=194

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWEN+KKA++EA+L+K+EEQ EKKKA YAEKM NK A VHKEAEEKR+++
Sbjct  103   KADKKLSAIGSWENSKKASVEAQLRKVEEQYEKKKAGYAEKMKNKIAQVHKEAEEKRAMV  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EEMAAK+RA G  PKK  GCF
Sbjct  163   EAKRGEDLLKAEEMAAKYRAKGIAPKKLLGCF  194


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            SKGS DRDI LA++E +K +S IKAWEESEK+K  N+
Sbjct  67   SKGSADRDIVLARVEKEKTLSLIKAWEESEKAKAGNK  103



>gb|KDP22286.1| hypothetical protein JCGZ_26117 [Jatropha curcas]
Length=203

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ ++SWEN+KKA +EA+LK+IEE+LEK+KAEYAEKM NK AL+HK AEEKR++
Sbjct  111   NKAHKKLSAIVSWENSKKALVEAELKQIEEKLEKQKAEYAEKMKNKIALIHKAAEEKRAI  170

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK RATG  PKK  GCF
Sbjct  171   IEAKRGEDLLKAEETAAKCRATGTAPKKLLGCF  203


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 17/78 (22%)
 Frame = +1

Query  532  PTKDVSPEKAVVP----------------HKNPDPPLKTAGSKGSLDRDIALAKIEDDKR  663
            P KDV+ EK+++P                 K P+P  +T  S+GS++RD  LA++E  KR
Sbjct  36   PPKDVAEEKSIIPPPSEEKTEESKELVPVEKTPEPA-ETKSSEGSVNRDAVLARVETQKR  94

Query  664  VSFIKAWEESEKSKVENR  717
            +S I+AWEESEKSK EN+
Sbjct  95   LSLIRAWEESEKSKAENK  112



>gb|AAM63910.1| remorin [Arabidopsis thaliana]
Length=202

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EE LEKKKAEY E+M NK A +HKEAEEKR++I
Sbjct  111   KAEKKLSSIGSWENNKKAAVEAELKKMEEHLEKKKAEYVEQMKNKIAQIHKEAEEKRAMI  170

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  171   EAKRGEEILKAEELAAKYRATGTAPKKLFGCM  202


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  111



>gb|KCW78048.1| hypothetical protein EUGRSUZ_D02272 [Eucalyptus grandis]
Length=87

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             ++ V SWEN+KKA  EA L+K EE LEKKKAE+ EKM NK AL+HK+AEEKR+VI ++R 
Sbjct  1     MSIVTSWENSKKATKEADLRKTEEGLEKKKAEHGEKMKNKVALIHKQAEEKRAVIQAKRG  60

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             E++LK EE+AAK+RATG +PKK  GCF
Sbjct  61    EEILKAEEVAAKYRATGYMPKKFLGCF  87



>ref|XP_010544719.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=175

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ VL+WEN+KKA IEA+LKKIEEQLEKKKAEY E+M NK A +HKEAEEKR++ 
Sbjct  84    KAQKKISAVLAWENSKKAAIEAELKKIEEQLEKKKAEYGERMKNKVAAIHKEAEEKRAMA  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EEMAAK+RATG +PK   GCF
Sbjct  144   EAKRGEEKLKAEEMAAKYRATGNIPKATCGCF  175


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +1

Query  502  VAVAAPQNMGPTKDVSPE--KAV-VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            V   +P    P ++  P+  KA+ V  K  +P  K + S GS+DRD+ LA +E +KR+SF
Sbjct  10   VEAESPAATAPAEEKKPDDSKALAVIEKPEEPEQKKSSSGGSIDRDVVLADLEKEKRLSF  69

Query  673  IKAWEESEKSKVENR  717
            IKAWE+SEK+K EN+
Sbjct  70   IKAWEDSEKTKAENK  84



>emb|CDY18898.1| BnaC04g04520D [Brassica napus]
Length=192

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++DVL+WEN+KKA  EA+L KIEE+LEKKKA Y EKM NK A +HK+AEEKR+++
Sbjct  101   KAQKKISDVLAWENSKKAATEAQLSKIEEKLEKKKAVYGEKMKNKVAAIHKQAEEKRAMV  160

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EE AAK RATG VPK   GCF
Sbjct  161   EAKKGEELLKAEETAAKHRATGVVPKATCGCF  192


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 15/75 (20%)
 Frame = +1

Query  610  KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWF  789
            KGS+DRD+ LA +E +K+ SFIKAWEESEKSK EN+            +   + DV+ W 
Sbjct  66   KGSVDRDVILADLEKEKKSSFIKAWEESEKSKAENK------------AQKKISDVLAWE  113

Query  790  SSSLHVRVNTRLELS  834
            +S    +  T  +LS
Sbjct  114  NSK---KAATEAQLS  125



>ref|XP_010544720.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=175

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ VL+WEN+KKA IEA+LKKIEEQLEKKKAEY E+M NK A +HKEAEEKR++ 
Sbjct  84    KAQKKISAVLAWENSKKAAIEAELKKIEEQLEKKKAEYGERMKNKVAAIHKEAEEKRAMA  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EEMAAK+RATG +PK   GCF
Sbjct  144   EAKRGEEKLKAEEMAAKYRATGNIPKATCGCF  175


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +1

Query  502  VAVAAPQNMGPTKDVSPE--KAV-VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSF  672
            V   +P    P ++  P+  KA+ V  K  +P  K + S GS+DRD+ LA +E +KR+SF
Sbjct  10   VEAESPAATAPAEEKKPDDSKALAVIEKPEEPEQKKSSSGGSIDRDVVLADLEKEKRLSF  69

Query  673  IKAWEESEKSKVENR  717
            IKAWE+SEK+K EN+
Sbjct  70   IKAWEDSEKTKAENK  84



>ref|XP_002302576.1| DNA-binding family protein [Populus trichocarpa]
 gb|ABK92585.1| unknown [Populus trichocarpa]
 gb|EEE81849.1| DNA-binding family protein [Populus trichocarpa]
Length=196

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QK  + V +WEN+KKA +EAKL+K+EE+LEK+KAEYAEKM NK AL+HKEAEEK++++
Sbjct  105   KSQKNFSAVAAWENSKKAALEAKLRKMEEKLEKQKAEYAEKMKNKIALIHKEAEEKKAIV  164

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK  E AAK+RATGQ PKK  GCF
Sbjct  165   EAKRGEEVLKAGETAAKYRATGQTPKKLLGCF  196


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 15/79 (19%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNF  738
            AVV    P P  K +G  GS+DRD+ALA +E +KR+SFIKAWE+SEK+K EN+       
Sbjct  56   AVVEKTEPAPK-KVSG--GSIDRDVALADLEKEKRLSFIKAWEDSEKTKAENK-------  105

Query  739  FFILASNMNLLDVILWFSS  795
                 S  N   V  W +S
Sbjct  106  -----SQKNFSAVAAWENS  119



>ref|XP_010426396.1| PREDICTED: remorin-like [Camelina sativa]
Length=176

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EA+LKKIEEQL KKKAEYAEKM NK A +HKEAEEKR++ 
Sbjct  85    KAQKKLSYVGAWENSKKASVEAELKKIEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMA  144

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FG F
Sbjct  145   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGLF  176


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E  KR+S IKAWEE+EKSKVEN+
Sbjct  51   GSVHRDAVLVRLEQGKRISLIKAWEEAEKSKVENK  85



>ref|XP_003623893.1| Remorin [Medicago truncatula]
 gb|AES80111.1| carboxy-terminal region remorin [Medicago truncatula]
Length=133

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K ++ + +WE++KKA +EA+LKKIEEQLE+KKA Y E M NK ALVHKEAEEKR++I
Sbjct  42    KAHKHISSIAAWEDSKKAALEAELKKIEEQLERKKARYGEIMRNKIALVHKEAEEKRAMI  101

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK +EMAAK+RATG  PKK  GCF
Sbjct  102   EAKRGEEVLKVQEMAAKYRATGTTPKKTIGCF  133



>ref|XP_010503539.1| PREDICTED: remorin-like [Camelina sativa]
Length=175

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EA+LKKIEEQL KKKAEYAEKM NK A +HKEAEEKR++ 
Sbjct  84    KAQKKLSYVGAWENSKKASVEAELKKIEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMA  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FG F
Sbjct  144   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGLF  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E DKR+S IKAWEE+EKSKVEN+
Sbjct  50   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENK  84



>ref|XP_004170221.1| PREDICTED: remorin-like [Cucumis sativus]
Length=142

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWEN+KKA +EA+LK++EE+ EKKK E+ EKM NK AL+HK+AEEK++VI
Sbjct  51    RAHKKLSAIGSWENSKKAAVEAELKQMEEKFEKKKGEHIEKMKNKIALIHKKAEEKKAVI  110

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EE+AAK RATG  PKK FGCF
Sbjct  111   EAKRGEEKLKAEEIAAKHRATGTAPKKIFGCF  142



>ref|XP_008439225.1| PREDICTED: remorin-like [Cucumis melo]
Length=202

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWEN+KKA +EA+LK+IEE+LEKKK EY EKM NK AL+HK AEEK++VI
Sbjct  109   RAHKKLSAIGSWENSKKAAVEAELKQIEEKLEKKKGEYIEKMKNKIALIHKTAEEKKAVI  168

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EE+AAK RATG  PKK FGCF
Sbjct  169   EAKRGEEKLKAEEIAAKHRATGTAPKKIFGCF  200


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++  +KR+S IKAWEESEKSK ENR
Sbjct  75   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENR  109



>ref|XP_004510806.1| PREDICTED: remorin-like [Cicer arietinum]
Length=194

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQK+L+ V +WEN+KKA IEA+L+KIEEQLEKKKAEY EKM NK A+VHK+AEEKR++
Sbjct  102   NKAQKQLSSVAAWENSKKAAIEAQLRKIEEQLEKKKAEYGEKMKNKIAMVHKQAEEKRAI  161

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R+E++LK EEMAAK+ AT   PKK  GCF
Sbjct  162   VEAKRSEEILKAEEMAAKYNATRTTPKKLLGCF  194


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            AVV ++    P++   + GSLDRDIALA+IE +KR+S +KAWEESEK+K  N+
Sbjct  51   AVVENEKTPVPVQKKATGGSLDRDIALAEIEKEKRLSNVKAWEESEKTKANNK  103



>ref|XP_007218390.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
 gb|EMJ19589.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
Length=214

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V SWENTKKA +EA+LKKIEE+LEKKKAEY E+M NK AL+HK AEEKR+ I
Sbjct  121   KAHKKLSAVGSWENTKKATVEAELKKIEEKLEKKKAEYVEQMKNKIALIHKAAEEKRAAI  180

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  181   EAKRGEDLLKAEETAAKYRATGNAPKKLLGCFS  213


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 16/86 (19%)
 Frame = +1

Query  508  VAAPQNMGPTKDVS-------PE-KAVVPH--------KNPDPPLKTAGSKGSLDRDIAL  639
            V AP++  PTKD S       PE KA   H        K  +P  +    +GS++RD  L
Sbjct  36   VEAPKDPQPTKDKSETPPPPAPEHKAEADHSKVLAIVEKPSEPAAEEKSKEGSVNRDAVL  95

Query  640  AKIEDDKRVSFIKAWEESEKSKVENR  717
            A++  +KR+S I+AWEESEKSK EN+
Sbjct  96   ARVATEKRLSLIRAWEESEKSKAENK  121



>ref|XP_004148376.1| PREDICTED: remorin-like [Cucumis sativus]
Length=157

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V +WEN++KA++EA LKKIEE LEKKKA+Y E+M NK AL+HK AEEKR++I
Sbjct  64    KAHKKLSSVAAWENSQKASVEADLKKIEESLEKKKAKYIEQMKNKIALLHKSAEEKRAII  123

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  124   EAKRGEDLLKAEETAAKYRATGTAPKKLLGCFS  156


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            ++GS++RD  LAK+  +KR+S +KAWEESEKSK EN+
Sbjct  28   TEGSVNRDAVLAKVATEKRLSLVKAWEESEKSKAENK  64



>ref|XP_010493498.1| PREDICTED: remorin-like [Camelina sativa]
Length=206

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HKEAEEKR++I
Sbjct  115   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVELMKNKIAQIHKEAEEKRAMI  174

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  175   EAKRGEEILKAEELAAKYRATGTAPKKLFGCI  206


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  81   GSVNRDAVLARVEIEKRMSLIKAWEEAEKCKVENK  115



>ref|NP_182106.1| Remorin family protein [Arabidopsis thaliana]
 sp|O80837.1|REMO_ARATH RecName: Full=Remorin; AltName: Full=DNA-binding protein [Arabidopsis 
thaliana]
 gb|AAC28542.1| remorin [Arabidopsis thaliana]
 gb|AAK76670.1| putative remorin protein [Arabidopsis thaliana]
 gb|AAL85060.1| putative remorin protein [Arabidopsis thaliana]
 gb|AEC10605.1| Remorin family protein [Arabidopsis thaliana]
Length=190

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK++DV +WEN+KKA +EA+L+KIEE+LEKKKA+Y EKM NK A +HK AEEKR+++
Sbjct  99    RAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMV  158

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++LK EEM AK+RATG VPK   GCF
Sbjct  159   EAKKGEELLKAEEMGAKYRATGVVPKATCGCF  190


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  62   ASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  99



>ref|XP_010412645.1| PREDICTED: remorin-like [Camelina sativa]
Length=186

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA++EA+LKKIEEQL KKKAEYAEKM NK A +HKEAEEKR++ 
Sbjct  95    KAQKKLSYVGAWENSKKASVEAELKKIEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMA  154

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FG F
Sbjct  155   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGLF  186


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E DKR+S IKAWEE+EKSKVEN+
Sbjct  61   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENK  95



>ref|XP_009382381.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=196

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK+A + +WEN+KKA +EA+LK  EE LEKKKAEY EKM NK A++HK AEEK++++
Sbjct  103   KAAKKMASITAWENSKKAALEAELKMKEEALEKKKAEYVEKMKNKIAMLHKAAEEKKAMV  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E+ LK EEMAAK+R TG  PKK FGCFG
Sbjct  163   EAKRGEEFLKAEEMAAKYRVTGFTPKKLFGCFG  195


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +1

Query  595  KTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KT+G  GS+DRD  LA++E +KR S IKAWEE+EK+K +N+
Sbjct  65   KTSG--GSIDRDAVLARVETEKRESMIKAWEENEKTKAQNK  103



>gb|AFK34355.1| unknown [Medicago truncatula]
Length=200

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQK+L+ V +WEN+KKA +EA+L+KIEEQLEKKKAEY EK+ NK A+VHK+AEEKR++
Sbjct  108   NKAQKQLSTVAAWENSKKAALEAQLRKIEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAI  167

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + +QR E +LK EE+AAK  ATG VPKK  GCF
Sbjct  168   VEAQRAEAILKAEEIAAKHNATGTVPKKLLGCF  200


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = +1

Query  571  HKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             K P+P  K A    SLDRDIALA+I  +KR+S +KAWE+SEK+K EN+
Sbjct  65   EKIPEPVKKNA----SLDRDIALAEIGKEKRLSNVKAWEDSEKTKAENK  109



>ref|XP_010421184.1| PREDICTED: remorin-like [Camelina sativa]
Length=214

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HKEAEEKR++I
Sbjct  123   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVELMKNKIAQIHKEAEEKRAMI  182

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  183   EAKRGEEILKAEELAAKYRATGTAPKKLFGCI  214


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  610  KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            +GS++RD  LA++E +KR+S IKAWEE+EK K+EN+
Sbjct  88   QGSVNRDAVLARVETEKRMSLIKAWEEAEKCKIENK  123



>gb|KEH18895.1| carboxy-terminal region remorin [Medicago truncatula]
Length=200

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQK+L+ V +WEN+KKA +EA+L+KIEEQLEKKKAEY EK+ NK A+VHK+AEEKR++
Sbjct  108   NKAQKQLSTVAAWENSKKAALEAQLRKIEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAI  167

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + +QR E +LK EE+AAK  ATG VPKK  GCF
Sbjct  168   VEAQRAEAILKAEEIAAKHNATGTVPKKLLGCF  200


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 13/81 (16%)
 Frame = +1

Query  502  VAVAAPQNMGPTKDVSP------EKAVVPHKN---PDPPLKTAGSKGSLDRDIALAKIED  654
            +A A P N+   K V+P       KA+V   N   P+P  K A    SLDRDIALA+I  
Sbjct  33   LAEAPPVNVVEKKAVAPPPVADDTKALVVVDNEKIPEPVKKNA----SLDRDIALAEIGK  88

Query  655  DKRVSFIKAWEESEKSKVENR  717
            +KR+S +KAWE+SEK+K EN+
Sbjct  89   EKRLSNVKAWEDSEKTKAENK  109



>ref|XP_010519484.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=188

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ + +WEN+KKA++EA LKKIEEQLEK+KAEYAEKM NK A + +EA+EKR++I
Sbjct  97    KAQKKLSAIGAWENSKKASVEADLKKIEEQLEKQKAEYAEKMKNKIAEIQREAQEKRAMI  156

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+ ATG  PKK FGCF
Sbjct  157   EARRGEEVLKAEELAAKYGATGTAPKKLFGCF  188


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  616  SLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            S+DRD  LA++E +KR+S IKAWEE+EKSKV+N+
Sbjct  64   SVDRDAVLARVETEKRMSLIKAWEEAEKSKVDNK  97



>ref|XP_004492710.1| PREDICTED: uncharacterized protein At3g61260-like [Cicer arietinum]
Length=185

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +2

Query  902   LKRFGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEE  1081
             +K   +AQK  + + +WEN+KKA +EA+LKKIEE LE+KKA+Y E+M NK A++HKEAEE
Sbjct  88    VKADNKAQKHFSSIAAWENSKKAALEAELKKIEEHLERKKAQYGEEMKNKIAIIHKEAEE  147

Query  1082  KRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK-AFGCF  1192
             KR+VI ++R E VLK EEMAAK+RATG  PKK   GCF
Sbjct  148   KRAVIEAKRGEMVLKVEEMAAKYRATGTTPKKTTIGCF  185


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P K   S+GSLDRD+ALA++  +K++S++KAWEESEK K +N+
Sbjct  51   PSKKLASRGSLDRDVALAEVAKEKKLSYVKAWEESEKVKADNK  93



>ref|XP_002874146.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50405.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EE LEKKKAEY E M NK A +HKEAEEKR++I
Sbjct  119   KAEKKLSSIGSWENNKKAAVEAELKKMEEHLEKKKAEYVELMKNKIAQIHKEAEEKRAMI  178

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  179   EAKRGEEILKAEELAAKYRATGTAPKKLFGCI  210


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  85   GSVHRDAVLARVETEKRMSLIKAWEEAEKCKVENK  119



>ref|XP_004165762.1| PREDICTED: remorin-like [Cucumis sativus]
 gb|KGN60481.1| hypothetical protein Csa_3G915100 [Cucumis sativus]
Length=189

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ V +WEN++KA++EA LKKIEE LEKKKA+Y E+M NK AL+HK AEEKR++
Sbjct  95    NKAHKKLSSVAAWENSQKASVEADLKKIEESLEKKKAKYIEQMKNKIALLHKSAEEKRAI  154

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             I ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  155   IEAKRGEDLLKAEETAAKYRATGTAPKKLLGCFS  188


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 45/78 (58%), Gaps = 21/78 (27%)
 Frame = +1

Query  538  KDVSPEKAVVPHKNPDPPLKTAGSK------------------GSLDRDIALAKIEDDKR  663
            KDV+ EK+V+P   P P  KT  SK                  GS++RD  LAK+  +KR
Sbjct  22   KDVTEEKSVIP---PPPEHKTDDSKALVLVEKVPEVADPKTTEGSVNRDAVLAKVATEKR  78

Query  664  VSFIKAWEESEKSKVENR  717
            +S +KAWEESEKSK EN+
Sbjct  79   LSLVKAWEESEKSKAENK  96



>ref|XP_006288585.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
 gb|EOA21483.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
Length=230

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HKEAEEKR++I
Sbjct  139   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVEVMKNKIAQIHKEAEEKRAMI  198

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  199   EAKRGEEILKAEELAAKYRATGTAPKKLFGCI  230


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  105  GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  139



>ref|XP_003521134.1| PREDICTED: remorin-like [Glycine max]
Length=200

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+K L+ V +WEN+K A +EA+L+KIEEQ+EKKKAEY EKM NK  LVHK+AEEKR+++
Sbjct  109   KAEKHLSAVAAWENSKIAALEAQLRKIEEQMEKKKAEYGEKMKNKIVLVHKQAEEKRAMV  168

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK RATG  PKKAFGCF
Sbjct  169   EAKRGEEILKAEEIAAKHRATGTTPKKAFGCF  200


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  589  PLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P+K   + GSLDRDIALA+IE +KR+S +KAWEESEKSK EN+
Sbjct  67   PVKKNATGGSLDRDIALAEIEKEKRLSNVKAWEESEKSKAENK  109



>ref|XP_006358926.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=190

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V SWENTKKA IEA+L++I+E+LEKKKAEYAEKM NK A +H+EAE+KR++I
Sbjct  97    KALKKLSAVGSWENTKKATIEAELRQIQEELEKKKAEYAEKMKNKMAEIHREAEDKRAMI  156

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++  E +LK EE+AAKFRATG +PKK   CFG
Sbjct  157   KAKEGEDILKVEEIAAKFRATGNMPKKFLRCFG  189


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  565  VPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V  K  D  ++T+ + GS D D ALAK+E +KR++ IKAWE++EK+K EN+
Sbjct  48   VQEKGIDSGIQTS-TGGSKDTDTALAKVESEKRLALIKAWEDNEKTKTENK  97



>gb|KHG20032.1| Remorin [Gossypium arboreum]
Length=187

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ + +WEN+KKA +EA+LKKIEE+LEK+KAEY EKM NK AL+HKEAEEK+++
Sbjct  95    NKAHKKLSSIEAWENSKKAALEAELKKIEEKLEKQKAEYVEKMKNKIALIHKEAEEKKAM  154

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EE+AAK+RATG  P K  GCF
Sbjct  155   VEAKRGEDLLKAEEIAAKYRATGTTPNKVLGCF  187


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 19/76 (25%)
 Frame = +1

Query  538  KDVSPEKAVVPHKNPDP----------------PLKTAGSKGSLDRDIALAKIEDDKRVS  669
            KDV+ EK+V+P   P P                P +   ++ ++DRD  LA++  +KR+S
Sbjct  24   KDVAEEKSVIP---PPPSEEKPAESAALQKAAEPTEEKSTESTVDRDTVLARVATEKRIS  80

Query  670  FIKAWEESEKSKVENR  717
             IKAWEE+E+SK EN+
Sbjct  81   LIKAWEETERSKAENK  96



>ref|XP_010107439.1| hypothetical protein L484_015780 [Morus notabilis]
 gb|EXC15977.1| hypothetical protein L484_015780 [Morus notabilis]
Length=199

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              RA K ++ V +WEN+KKA++EA+LKKIEE LEKKKAEY EKM NK AL+HKEAEE++++
Sbjct  107   NRAHKNISSVGAWENSKKASVEAQLKKIEENLEKKKAEYVEKMKNKIALIHKEAEERKAM  166

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E++LK EE AAK+RATG  PKK  GCF
Sbjct  167   IEAKRGEELLKAEESAAKYRATGTAPKKLLGCF  199


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 17/77 (22%)
 Frame = +1

Query  538  KDVSPEKAVVPH-----------------KNPDPPLKTAGSKGSLDRDIALAKIEDDKRV  666
            KDV+ EK+V+PH                 K P+P ++   S+GS++RD  LA++  +KR+
Sbjct  32   KDVTEEKSVIPHPPPEDKPDESKALAVVDKEPEPAVEKRSSEGSINRDAVLARVATEKRL  91

Query  667  SFIKAWEESEKSKVENR  717
            S I+AWEESEKSK ENR
Sbjct  92   SLIRAWEESEKSKAENR  108



>gb|EMS52426.1| hypothetical protein TRIUR3_02712 [Triticum urartu]
Length=178

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA+++++ ++SWENTKKA ++AKL+  EE+LEKKKAEYAEKM N+ A++HKEAEE+R+++
Sbjct  85    RAEQRMSSIMSWENTKKAAVQAKLRTREEKLEKKKAEYAEKMRNRVAMIHKEAEEQRALV  144

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCFG  1195
              ++R E+++K +EMAAK R+ G  PKK F GCFG
Sbjct  145   EARRQEEMIKCQEMAAKHRSQGTTPKKKFLGCFG  178



>ref|XP_010905109.1| PREDICTED: remorin-like [Elaeis guineensis]
Length=192

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             ++ + +WEN+KKA +EA+LK  EE+LEKKKAEYAE+M NK A+VHK AEEKR+ I ++R 
Sbjct  104   MSSITAWENSKKAAMEAELKAKEEELEKKKAEYAEQMKNKMAMVHKAAEEKRAFIEAKRG  163

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  164   EEILKAEEMAAKYRATGLAPKKLLGCFG  191



>ref|XP_006394639.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
 gb|ESQ31925.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
Length=202

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HK+AEEKR++I
Sbjct  111   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMI  170

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+RATG  PKK FGC 
Sbjct  171   EARRGEEVLKAEELAAKYRATGTTPKKLFGCM  202


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  77   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  111



>ref|XP_010454663.1| PREDICTED: remorin-like [Camelina sativa]
Length=216

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HKEAEE+R++I
Sbjct  125   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVEVMKNKIAQIHKEAEERRAMI  184

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE+AAK+RATG  PKK FGC 
Sbjct  185   EAKRGEEILKAEELAAKYRATGTAPKKLFGCI  216


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  91   GSVNRDAVLARVETEKRLSLIKAWEEAEKCKVENK  125



>ref|XP_009150904.1| PREDICTED: remorin-like [Brassica rapa]
 emb|CDX88048.1| BnaA06g26390D [Brassica napus]
Length=205

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAEY E M NK A +HK+AEEKR++I
Sbjct  114   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+RATG  PKK FGC 
Sbjct  174   EARRGEEVLKAEELAAKYRATGTAPKKLFGCM  205


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  80   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  114



>ref|XP_004240737.1| PREDICTED: remorin [Solanum lycopersicum]
Length=185

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK+A++L+WEN+KKA++EA+LK+ EEQL KKKAEY EK+ NK ALVHK AEEKR++ 
Sbjct  93    KAQKKIAEILAWENSKKASLEAELKRTEEQLLKKKAEYIEKLKNKIALVHKSAEEKRAIT  152

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
              ++R E +L  EEMAAK RATG  PKK   GCF
Sbjct  153   EAKRGEDLLTAEEMAAKCRATGSSPKKPLLGCF  185


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  610  KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KGS+DRD  LA++  +KR+S IKAWEESEK+K EN+
Sbjct  58   KGSIDRDATLARLTTEKRLSLIKAWEESEKAKAENK  93



>gb|AAA57124.1| DNA-binding protein [Arabidopsis thaliana]
Length=190

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RAQKK++DV +WEN+KKA +EA+L+KIEE+LEKKKA+Y EKM NK A +HK AEEKR+++
Sbjct  99    RAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMV  158

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E++L+ EEM AK+RATG VPK   GCF
Sbjct  159   EAKKGEELLEAEEMGAKYRATGVVPKATCGCF  190


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S GS DRD+ LA +E +K+ SFIKAWEESEKSK ENR
Sbjct  62   ASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENR  99



>ref|XP_006404201.1| hypothetical protein EUTSA_v10010917mg, partial [Eutrema salsugineum]
 gb|ESQ45654.1| hypothetical protein EUTSA_v10010917mg, partial [Eutrema salsugineum]
Length=91

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  923   QKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVS  1102
             QKK + V +WE++KKA++EA+LKKIEE+L KKKAEYAE+M NK A +HKEAE KR+   +
Sbjct  2     QKKFSSVGAWEHSKKASVEAELKKIEEKLIKKKAEYAEQMKNKIAQIHKEAEGKRATTEA  61

Query  1103  QRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             +R E VLK EEMAAK+RATG  P K FGCF
Sbjct  62    KRGEDVLKAEEMAAKYRATGTAPTKLFGCF  91



>ref|XP_010255442.1| PREDICTED: remorin-like [Nelumbo nucifera]
Length=186

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN+KKA++EAKLKK EE+ EK+KAEYAEKM N  A +HKEAEEK++++
Sbjct  95    KAEKKLSTIGSWENSKKASVEAKLKKKEEEYEKRKAEYAEKMKNMIAQIHKEAEEKKAMV  154

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RA G  PKK FGCF
Sbjct  155   EAKRGEDLLKAEELAAKYRAKGTAPKKLFGCF  186



>ref|XP_010667563.1| PREDICTED: remorin-like [Beta vulgaris subsp. vulgaris]
Length=210

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KK+A + +WEN+KKA++EA+LKKIEE LEKKKAEYAEKM NK A+ HKEAEEK++ 
Sbjct  118   NKAHKKIAAIEAWENSKKASLEAELKKIEESLEKKKAEYAEKMKNKVAMTHKEAEEKKAT  177

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EEMAAK+RATG+ PKK  G F
Sbjct  178   VEAKRAEDILKAEEMAAKYRATGKPPKKLLGLF  210


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            + P++    +GS+ RD  LA+++ +KR+S IKAWEESEK K EN+
Sbjct  75   EKPIEEKPLEGSVGRDAQLARVQTEKRISLIKAWEESEKCKAENK  119



>ref|XP_007040179.1| Remorin family protein [Theobroma cacao]
 gb|EOY24680.1| Remorin family protein [Theobroma cacao]
Length=274

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ + SWENTKKA +EA+LKKIEEQLEKKKAEYAEKM N+ A +H+EAEEKR++I
Sbjct  181   KAHKKISAIGSWENTKKAGVEAQLKKIEEQLEKKKAEYAEKMKNRVAEIHREAEEKRAMI  240

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E  LK EE AAKFRATG  PKK  GCF
Sbjct  241   EAKRGEDFLKIEETAAKFRATGYTPKKFLGCF  272



>gb|EYU19543.1| hypothetical protein MIMGU_mgv1a014270mg [Erythranthe guttata]
Length=195

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK++ V +WEN+KKANIEA+LKKIEE+LEKKKAEY EKM NK A+VHK AEEKR++
Sbjct  103   NKAQKKVSAVAAWENSKKANIEAELKKIEEKLEKKKAEYVEKMKNKVAMVHKAAEEKRAM  162

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EE+AAK+RATG  PKK  G F
Sbjct  163   VEARRGEDLLKAEEIAAKYRATGTAPKKLLGFF  195



>gb|EMT04985.1| hypothetical protein F775_31239 [Aegilops tauschii]
Length=191

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             L+ +LSWENTKKA I+A+LK+ EE+LEKKKA+YAEKM NK A+ H+EAEEKR+++V++R 
Sbjct  103   LSSILSWENTKKATIDAQLKRKEEELEKKKAKYAEKMKNKKAIAHREAEEKRAMVVARRG  162

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  163   EEVLKAEEMAAKYRATGLAPKKLLGCFG  190



>ref|XP_008234255.1| PREDICTED: remorin-like [Prunus mume]
Length=212

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V SWENTKKA +EA+LKKIEE+LEKKKAEY E+M NK AL+HK AEEKR+ I
Sbjct  119   KAHKKLSAVGSWENTKKATVEAELKKIEEKLEKKKAEYVEQMKNKIALIHKAAEEKRAAI  178

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+RATG  PKK   CF 
Sbjct  179   EAKRGEDLLKAEETAAKYRATGNAPKKLLACFS  211


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 16/86 (19%)
 Frame = +1

Query  508  VAAPQNMGPTKDVS-------PE-KAVVPH--------KNPDPPLKTAGSKGSLDRDIAL  639
            V AP++  PTKD S       PE KA   H        K  +P  +    +GS++RD  L
Sbjct  34   VEAPKDPQPTKDKSETPPLPAPEHKAEADHSKVLAIVEKPCEPAAEEKSKEGSVNRDAVL  93

Query  640  AKIEDDKRVSFIKAWEESEKSKVENR  717
            A++  +KR+S I+AWEESEKSK EN+
Sbjct  94   ARVATEKRLSLIRAWEESEKSKAENK  119



>ref|XP_007152285.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
 gb|ESW24279.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
Length=205

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ + +WEN+KKA++EA+LKKIEEQLEKKKAEYAEK+ NK A +HKEAEEKR++
Sbjct  113   NKAHKKLSAISAWENSKKASVEAELKKIEEQLEKKKAEYAEKIKNKIATIHKEAEEKRAI  172

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E +L  EE AAK+RATG  PKK  GCF
Sbjct  173   IEAKKGEDLLNAEETAAKYRATGTAPKKLLGCF  205


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 16/76 (21%)
 Frame = +1

Query  538  KDVSPEKAVVP----HKNPDPP------------LKTAGSKGSLDRDIALAKIEDDKRVS  669
            KDV+ EK+V+P     + PD               +   ++GS++RD  LA++  +KR+S
Sbjct  39   KDVAEEKSVIPVPSSDEKPDESKALVLVEKTQEVAEVKPTEGSVNRDAVLARVATEKRLS  98

Query  670  FIKAWEESEKSKVENR  717
             IKAWEESEKSK EN+
Sbjct  99   LIKAWEESEKSKAENK  114



>ref|NP_190463.1| Remorin-like protein [Arabidopsis thaliana]
 emb|CAB62016.1| remorin-like protein [Arabidopsis thaliana]
 gb|AEE78475.1| Remorin-like protein [Arabidopsis thaliana]
Length=175

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ V +WEN+KKA++EA+LKKIEEQL KKKA Y E+M NK A +HKEAEEKR++ 
Sbjct  84    KAQKKISSVGAWENSKKASVEAELKKIEEQLNKKKAHYTEQMKNKIAQIHKEAEEKRAMT  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FG F
Sbjct  144   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGFF  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E DKR+S IKAWEE+EKSKVEN+
Sbjct  50   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENK  84



>ref|XP_011076174.1| PREDICTED: remorin-like [Sesamum indicum]
Length=195

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQ K++ + +WEN+KKA++EA+LKKIEEQLEKKKA+Y E M N+ AL+HK AEEKR++I
Sbjct  104   KAQMKVSAIAAWENSKKASLEAELKKIEEQLEKKKAKYIETMKNRVALIHKAAEEKRAII  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RATG  PKK  GCF
Sbjct  164   EAKRGEDLLKAEEIAAKYRATGTAPKKLLGCF  195


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 24/80 (30%)
 Frame = +1

Query  538  KDVSPEKAVVPHKNPDPPLKTAGSK--------------------GSLDRDIALAKIEDD  657
            KDV+ EKAV+P     PP +    +                    GS++RD  LA++  +
Sbjct  29   KDVAEEKAVIPL----PPTEEKAEECKALAVVEKEPEAAEEKKPEGSINRDAVLARVATE  84

Query  658  KRVSFIKAWEESEKSKVENR  717
            KR+S IKAWEESEKSK EN+
Sbjct  85   KRLSLIKAWEESEKSKAENK  104



>ref|XP_003618987.1| Remorin, partial [Medicago truncatula]
Length=87

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             L+ V +WEN+KKA +EA+L+KIEEQLEKKKAEY EK+ NK A+VHK+AEEKR+++ +QR 
Sbjct  1     LSTVAAWENSKKAALEAQLRKIEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAIVEAQRA  60

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             E +LK EE+AAK  ATG VPKK  GCF
Sbjct  61    EAILKAEEIAAKHNATGTVPKKLLGCF  87



>ref|XP_002452858.1| hypothetical protein SORBIDRAFT_04g033660 [Sorghum bicolor]
 gb|EES05834.1| hypothetical protein SORBIDRAFT_04g033660 [Sorghum bicolor]
Length=209

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  926   KKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQ  1105
             KK + +LSWENTKKA IEA+LKK EEQLEKKKAEY EKM NK A++H++AEEKR+++++Q
Sbjct  119   KKQSVILSWENTKKAVIEAQLKKKEEQLEKKKAEYGEKMKNKKAVIHRQAEEKRAMVIAQ  178

Query  1106  RNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
               E+VLK EE+AAK+RA G  PKK  GCFG
Sbjct  179   CGEEVLKAEEVAAKYRAKGVAPKKFLGCFG  208



>gb|EEC74277.1| hypothetical protein OsI_09516 [Oryza sativa Indica Group]
Length=179

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ +LSWENT+KA IEAKL+  EE+LE+KKAEYAEKM N+ A +HK AEEKR+ +
Sbjct  86    KAQKKMSSILSWENTRKAAIEAKLRTQEEKLERKKAEYAEKMRNQVAAIHKAAEEKRATV  145

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              + R+E+++K EEMAAK R+ G  P K   CFG
Sbjct  146   EATRHEEIIKYEEMAAKHRSKGTTPTKFLSCFG  178


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGS-KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            AV     P  P   A +  GS+DRD  LA +E ++++S IKAWEESEKSK EN+
Sbjct  33   AVAKMNGPSAPAHKAATPTGSVDRDAILANVELERKLSMIKAWEESEKSKAENK  86



>ref|NP_001048576.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAD22865.1| putative DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF10490.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAG99202.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58077.1| hypothetical protein OsJ_08942 [Oryza sativa Japonica Group]
Length=179

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ +LSWENT+KA IEAKL+  EE+LE+KKAEYAEKM N+ A +HK AEEKR+ +
Sbjct  86    KAQKKMSSILSWENTRKAAIEAKLRTQEEKLERKKAEYAEKMRNQVAAIHKAAEEKRATV  145

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              + R+E+++K EEMAAK R+ G  P K   CFG
Sbjct  146   EATRHEEIIKYEEMAAKHRSKGTTPTKFLSCFG  178


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +1

Query  559  AVVPHKNPDPPL-KTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            AV     P  P  K A   GS+DRD  LA +E ++++S IKAWEESEKSK EN+
Sbjct  33   AVTKTNGPSAPAGKAATPTGSVDRDAILANVELERKLSMIKAWEESEKSKAENK  86



>ref|XP_010035130.1| PREDICTED: remorin-like isoform X2 [Eucalyptus grandis]
Length=221

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +2

Query  905   KRFGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEK  1084
             +   RAQKK + + +WEN+KKA+I + LK  EE++EKKKAEYAE M NK A VHK AEEK
Sbjct  124   RSLNRAQKKFSTIGAWENSKKASIGSDLKNFEEKMEKKKAEYAETMKNKIASVHKLAEEK  183

Query  1085  RSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             R+++ +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  184   RAIVEAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  220



>dbj|BAJ98923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              RA+ K++ +LSWENTKKA +EAKL+  EE+LEKKKAEYAEKM N+ A++HKEAEE+R+ 
Sbjct  103   NRAEHKMSSILSWENTKKATVEAKLRTREEKLEKKKAEYAEKMRNRVAMIHKEAEEQRAA  162

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCFG  1195
             + + R E+++K +EMAAK R+ G  PKK F  CFG
Sbjct  163   VEAMRQEEMIKCQEMAAKHRSKGTTPKKKFLTCFG  197



>gb|KCW46422.1| hypothetical protein EUGRSUZ_K00253 [Eucalyptus grandis]
Length=220

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +2

Query  905   KRFGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEK  1084
             +   RAQKK + + +WEN+KKA+I + LK  EE++EKKKAEYAE M NK A VHK AEEK
Sbjct  123   RSLNRAQKKFSTIGAWENSKKASIGSDLKNFEEKMEKKKAEYAETMKNKIASVHKLAEEK  182

Query  1085  RSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             R+++ +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  183   RAIVEAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  219



>ref|XP_004140777.1| PREDICTED: remorin-like [Cucumis sativus]
 gb|KGN57372.1| hypothetical protein Csa_3G182080 [Cucumis sativus]
Length=203

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWEN+KKA +EA+LK+IEE+ EKKK E+ EKM NK A +HK+AEEK++VI
Sbjct  112   RAHKKLSAIGSWENSKKAAVEAELKQIEEKFEKKKGEHIEKMKNKIASIHKKAEEKKAVI  171

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+ LK EE+AAK RATG  PKK FGCF
Sbjct  172   EAKRGEEKLKAEEIAAKHRATGTAPKKIFGCF  203


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++  +KR+S IKAWEESEKSK ENR
Sbjct  78   GSINRDAVLARVATEKRLSLIKAWEESEKSKAENR  112



>ref|XP_002318224.2| remorin family protein [Populus trichocarpa]
 gb|EEE96444.2| remorin family protein [Populus trichocarpa]
Length=204

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KK++ + SWEN+KKA++EA+LKKIEE+LEKKKAEY EKM NK A++HKEAEEK+++
Sbjct  110   NKAHKKISSIASWENSKKASVEAELKKIEEKLEKKKAEYVEKMKNKIAVIHKEAEEKKAI  169

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EE+AAK+RATG  PKK F  F
Sbjct  170   VEAKRGEDLLKAEEIAAKYRATGTTPKKLFKMF  202


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            ++GS++RD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  75   TEGSVNRDAVLARVVTEKRISLIKAWEESEKSKAENK  111



>gb|KCW46423.1| hypothetical protein EUGRSUZ_K00253 [Eucalyptus grandis]
Length=149

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK + + +WEN+KKA+I + LK  EE++EKKKAEYAE M NK A VHK AEEKR+++
Sbjct  56    KAQKKFSTIGAWENSKKASIGSDLKNFEEKMEKKKAEYAETMKNKIASVHKLAEEKRAIV  115

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  116   EAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  148


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS +RD+ LA++E DK++S I+AWEE+EKSK EN+
Sbjct  22   GSGNRDVELARVETDKKLSLIRAWEENEKSKAENK  56



>ref|XP_008643815.1| PREDICTED: remorin isoform X1 [Zea mays]
 gb|AFW72527.1| remorin [Zea mays]
Length=186

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  926   KKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQ  1105
             KK + +LSWENTKKA IEA+LKK +E+LEKK AEYAEKM NK A++HK+AEEKR+++++Q
Sbjct  96    KKQSIILSWENTKKAIIEAELKKKKEELEKKMAEYAEKMKNKKAIIHKKAEEKRAMVMAQ  155

Query  1106  RNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
               E++LKTEEMAAK+RAT   PKK   CF
Sbjct  156   HGEEILKTEEMAAKYRATRVAPKKFLRCF  184



>ref|XP_009392263.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=164

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK + + SWEN+KKA+++++L+KIE+ LE KKAE  EK+ NK A+VHK AEEKR++
Sbjct  69    NKAQKKKSSITSWENSKKASLQSQLQKIEQNLENKKAETKEKIKNKIAMVHKAAEEKRAM  128

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVP-KKAFGCFG  1195
             + ++R E++LK EE AAK+RATG+ P KK FGCFG
Sbjct  129   VEAKRGEELLKVEEAAAKYRATGKPPKKKGFGCFG  163



>gb|AGB07445.1| remorin [Morus indica]
Length=199

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K ++ + +WEN+KKA++EA+LKK EE LEKKKAEY EKM NK AL+HKEAEE++++I
Sbjct  108   KAHKNVSSIGAWENSKKASVEAQLKKFEENLEKKKAEYVEKMKNKIALIHKEAEERKAII  167

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE AAK+RATG  PKK  GCF
Sbjct  168   EAKRGEELLKAEESAAKYRATGTGPKKLLGCF  199


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 17/79 (22%)
 Frame = +1

Query  532  PTKDVSPEKAVVPH-----------------KNPDPPLKTAGSKGSLDRDIALAKIEDDK  660
            P KDV+ EK+V+PH                   P+P  + + S+GS++RD  LA++  +K
Sbjct  30   PPKDVTEEKSVIPHPPPEDKPDESKALAVVDMEPEPAAEKSSSEGSINRDAVLARVATEK  89

Query  661  RVSFIKAWEESEKSKVENR  717
            R+S I+AWEESEKSK EN+
Sbjct  90   RLSLIRAWEESEKSKAENK  108



>ref|XP_004954460.1| PREDICTED: remorin-like [Setaria italica]
Length=158

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ ++SWENTKKA +EAKL+  EE+LEKKKAEYAEKM N+ A +HKEAEEKR+ +
Sbjct  66    KAQKKMSSIMSWENTKKAAVEAKLRTREEKLEKKKAEYAEKMRNQIAAIHKEAEEKRAAV  125

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCF  1192
              + R+E +LK E+MAAK R+ G  P K F GCF
Sbjct  126   EAMRHEAILKYEDMAAKHRSKGTTPAKKFLGCF  158



>ref|XP_009400595.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=186

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  926   KKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQ  1105
             KKL+ ++ WE T+KA +EA+LK+ EE+LEKKKAEYAEK+ NK AL+H+ AEEKR+++ ++
Sbjct  96    KKLSSIMVWEITRKAAVEAELKRKEEELEKKKAEYAEKIKNKIALLHRFAEEKRAMVEAR  155

Query  1106  RNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             R E++LK EE+AAK+RATG  PKK  GCFG
Sbjct  156   RGEELLKVEEVAAKYRATGLAPKKLLGCFG  185



>ref|XP_011030102.1| PREDICTED: remorin-like isoform X1 [Populus euphratica]
Length=205

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWEN+KKA++EA+LKKIEE+LEKKKAEY EKM NK A++HKEAEEK++++
Sbjct  112   KAHKKLSSIASWENSKKASVEAELKKIEEKLEKKKAEYVEKMKNKIAVIHKEAEEKKAIV  171

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RA+G  PKK F  F
Sbjct  172   EAKRGEDLLKAEEIAAKYRASGTTPKKLFKMF  203


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            ++GS++RD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  76   TEGSVNRDAVLARVVTEKRISLIKAWEESEKSKAENK  112



>ref|XP_010550763.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=197

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A + L+ + +WEN+KKA++EA+LKKIEEQLEKKKAEY EKM N+ A +H+EAEE+R++I
Sbjct  106   KAHRNLSAIGAWENSKKASVEAELKKIEEQLEKKKAEYREKMKNRIAEIHREAEERRAMI  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+RATG  PKK  GCF
Sbjct  166   EARRGEEVLKAEEIAAKYRATGTAPKKLLGCF  197


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            K +VP K  D   K     GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  57   KTIVPVKKHDEEKKG----GSVERDAVLARVETEKRMSLIKAWEEAEKCKVENK  106



>ref|XP_011030103.1| PREDICTED: remorin-like isoform X2 [Populus euphratica]
Length=204

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWEN+KKA++EA+LKKIEE+LEKKKAEY EKM NK A++HKEAEEK++++
Sbjct  111   KAHKKLSSIASWENSKKASVEAELKKIEEKLEKKKAEYVEKMKNKIAVIHKEAEEKKAIV  170

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EE+AAK+RA+G  PKK F  F
Sbjct  171   EAKRGEDLLKAEEIAAKYRASGTTPKKLFKMF  202


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            ++GS++RD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  75   TEGSVNRDAVLARVVTEKRISLIKAWEESEKSKAENK  111



>ref|XP_011048714.1| PREDICTED: remorin isoform X3 [Populus euphratica]
Length=193

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A +KL+ + SWEN+KKA++EA+L KIEEQLEKKKAE  EKM NK A++HKEAEEK+++
Sbjct  101   NKAHRKLSSITSWENSKKASVEAELMKIEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAI  160

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EEMAAK+RATG  PKK  G F
Sbjct  161   IEAKRGEDLLKAEEMAAKYRATGSSPKKLLGFF  193



>ref|XP_004496578.1| PREDICTED: remorin-like [Cicer arietinum]
Length=219

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A +KL+ +L+WEN+KKA  EA+L+K+EE+LEKKK EYAEKM NK A +HK+AEEKR++
Sbjct  127   NKAHRKLSTILAWENSKKAATEAELRKLEEKLEKKKGEYAEKMKNKIAALHKQAEEKRAM  186

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E +LK EE+AAK RATG  PKK FG F
Sbjct  187   IEAKKGEDLLKAEEIAAKHRATGTAPKKLFGLF  219



>ref|XP_008806887.1| PREDICTED: remorin [Phoenix dactylifera]
Length=277

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++QKK++ + SWENTKKA +EA+L+KIEE LE KKAEYAEKM NK A++HK A EKR+++
Sbjct  184   KSQKKMSSIASWENTKKAAVEAELRKIEEALEMKKAEYAEKMKNKIAMIHKAAAEKRAIV  243

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E++LK EE AAK+ A G  PKK  GCF
Sbjct  244   EAKRGEEILKAEETAAKYHAKGLYPKKVLGCF  275


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +1

Query  586  PPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            PP K+A   GS DRD  LA++  +KR+S IKAWEESEK+K EN+
Sbjct  143  PPEKSAA--GSADRDAVLARVATEKRISLIKAWEESEKTKAENK  184



>ref|XP_011048712.1| PREDICTED: remorin isoform X1 [Populus euphratica]
Length=198

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A +KL+ + SWEN+KKA++EA+L KIEEQLEKKKAE  EKM NK A++HKEAEEK+++
Sbjct  106   NKAHRKLSSITSWENSKKASVEAELMKIEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAI  165

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EEMAAK+RATG  PKK  G F
Sbjct  166   IEAKRGEDLLKAEEMAAKYRATGSSPKKLLGFF  198



>ref|XP_010550762.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=198

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A + L+ + +WEN+KKA++EA+LKKIEEQLEKKKAEY EKM N+ A +H+EAEE+R++I
Sbjct  107   KAHRNLSAIGAWENSKKASVEAELKKIEEQLEKKKAEYREKMKNRIAEIHREAEERRAMI  166

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+RATG  PKK  GCF
Sbjct  167   EARRGEEVLKAEEIAAKYRATGTAPKKLLGCF  198


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            K +VP K+     K  GS   ++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  57   KTIVPVKSKHDEEKKGGS---VERDAVLARVETEKRMSLIKAWEEAEKCKVENK  107



>ref|XP_006363315.1| PREDICTED: remorin [Solanum tuberosum]
Length=185

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK +++L+WEN+KKA++EA+LK+ EEQL KKKAEY EK+ NK ALVHK AEEKR++ 
Sbjct  93    KAQKKRSEILAWENSKKASLEAELKRTEEQLLKKKAEYIEKLKNKIALVHKSAEEKRAIT  152

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
              ++R E +L  EEMAAK RATG  PKK   GCF
Sbjct  153   EAKRGEDLLTAEEMAAKCRATGSSPKKPLLGCF  185


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 11/59 (19%)
 Frame = +1

Query  544  VSPE-KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            V PE KA+VP             KGS+DRD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  45   VEPETKALVP----------VEKKGSIDRDATLARLTTEKRLSLIKAWEESEKSKAENK  93



>ref|XP_011048713.1| PREDICTED: remorin isoform X2 [Populus euphratica]
Length=197

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A +KL+ + SWEN+KKA++EA+L KIEEQLEKKKAE  EKM NK A++HKEAEEK+++
Sbjct  105   NKAHRKLSSITSWENSKKASVEAELMKIEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAI  164

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EEMAAK+RATG  PKK  G F
Sbjct  165   IEAKRGEDLLKAEEMAAKYRATGSSPKKLLGFF  197



>ref|XP_010519485.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=186

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ + +WEN+KKA++EA LKKIE + +K +  YAEKM NK A + +EA+EKR++I
Sbjct  97    KAQKKLSAIGAWENSKKASVEADLKKIELEKQKAE--YAEKMKNKIAEIQREAQEKRAMI  154

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+ ATG  PKK FGCF
Sbjct  155   EARRGEEVLKAEELAAKYGATGTAPKKLFGCF  186


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  616  SLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            S+DRD  LA++E +KR+S IKAWEE+EKSKV+N+
Sbjct  64   SVDRDAVLARVETEKRMSLIKAWEEAEKSKVDNK  97



>ref|XP_002877638.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53897.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ V +WEN+KKA +EA+LK IEEQL KKKA Y E+M NK A +HK+AEEKR++ 
Sbjct  84    KAQKKLSSVGAWENSKKACVEAELKMIEEQLLKKKARYTEQMKNKIAQIHKKAEEKRAMT  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E VLK EEMAAK+RATG  P K FG F
Sbjct  144   EAKRGEDVLKAEEMAAKYRATGTAPTKLFGLF  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+ RD  L ++E DKR+S IKAWEE+EKSKVEN+
Sbjct  50   GSVHRDAVLVRLEQDKRISLIKAWEEAEKSKVENK  84



>ref|XP_009766651.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=198

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ V +WENTKKA IE +LK+IEE+LE+KKAEYAEKM NK A++H+EAEEKR++
Sbjct  105   NKAFKKLSAVGAWENTKKATIEFELKQIEEELERKKAEYAEKMKNKMAVIHREAEEKRAL  164

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             I + R +  LK EE AAKFR TG +PKK  GCFG
Sbjct  165   IEANRGQDFLKVEETAAKFRETG-IPKKFLGCFG  197



>gb|AFK41243.1| unknown [Lotus japonicus]
Length=215

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+D+ +WEN+K A  E +L+KIEE LEKKKA Y EK+ NK A+VH+EAEEKR+ 
Sbjct  123   NKAHKKLSDISAWENSKIAAKEVELRKIEENLEKKKAVYVEKLKNKIAMVHREAEEKRAF  182

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E +LKTEE+AAK+RATG  PKK F  F
Sbjct  183   IEAKKGEDLLKTEELAAKYRATGTAPKKPFSFF  215



>ref|XP_008794187.1| PREDICTED: remorin-like isoform X2 [Phoenix dactylifera]
Length=193

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K+++ + +WEN+K A +EA+LK  EE+LEK KAEYAEKM NK A++HK AEEKR+ +
Sbjct  100   KAVKQMSSITAWENSKMAAMEAELKAKEEELEKMKAEYAEKMKNKVAMIHKAAEEKRAYV  159

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+R+ G  PKK FGCFG
Sbjct  160   EAKRGEDILKAEETAAKYRSKGLAPKKIFGCFG  192


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 48/85 (56%), Gaps = 19/85 (22%)
 Frame = +1

Query  514  APQNMGPTKDVSPEKAVVP----HKNPD-------------PPLKTAGSKGSLDRDIALA  642
            AP    PTKDVS EKAV+P     K  D             P  K+ G  GS +R   LA
Sbjct  18   APPPTEPTKDVSEEKAVIPPPSEEKADDSKALAVVEMVADTPTEKSTG--GSTERVAILA  75

Query  643  KIEDDKRVSFIKAWEESEKSKVENR  717
            ++E +KR+S IKAWEE+EK KVEN+
Sbjct  76   RLETEKRISLIKAWEENEKVKVENK  100



>ref|XP_008794544.1| PREDICTED: remorin-like [Phoenix dactylifera]
Length=192

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  932   LADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQRN  1111
             ++ + +WEN+ KA +EA+LK  EE LEKKKAEYAEKM NK A++HK AEEK++ + ++R 
Sbjct  104   MSSITAWENSTKAAMEAELKAKEEALEKKKAEYAEKMKNKVAMLHKVAEEKKAFVEAKRG  163

Query  1112  EQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  164   EEILKAEEMAAKYRATGLAPKKLLGCFG  191



>ref|XP_002322467.1| remorin family protein [Populus trichocarpa]
 gb|EEF06594.1| remorin family protein [Populus trichocarpa]
Length=201

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWEN+KKA++EA+L KIEEQLEKKKAE  EKM NK A++HKEAEEK++++
Sbjct  110   KAHKKLSSIASWENSKKASVEAELMKIEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAIV  169

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E +LK EEMA K+RATG  PKK  G F
Sbjct  170   EAKRGEDLLKAEEMAGKYRATGSSPKKLLGIF  201


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 14/74 (19%)
 Frame = +1

Query  538  KDVSPEKAVVP---------HKNPDPPLKTAGS-----KGSLDRDIALAKIEDDKRVSFI  675
            KDV+ EK V+P                ++T+ S     +GS++RD  LA++  +KR+S +
Sbjct  37   KDVAEEKTVIPPSVAEEKVEESEAVAVIETSESAEEKKEGSVNRDAVLARVATEKRISLV  96

Query  676  KAWEESEKSKVENR  717
            KAWEESEKSK EN+
Sbjct  97   KAWEESEKSKAENK  110



>ref|XP_009371326.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ + SWENT+KA +EA+LKKIEE+LEK+KAEY E+M NK AL+HK AEEKR+V+
Sbjct  120   KAQKKLSAIGSWENTRKAIVEAELKKIEEKLEKQKAEYVEQMKNKIALIHKAAEEKRAVV  179

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++  E +LK EE AAK+RA G+ PKK  GCF 
Sbjct  180   EAKCGEDLLKAEETAAKYRAKGKTPKKLLGCFS  212


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  559  AVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            A+V  K  +P  +   ++GS++RD  LAK+  +KR+S I+AWEESEKSK EN+
Sbjct  68   AIVVDKPSEPIAEEKSTEGSVNRDAVLAKVATEKRLSLIRAWEESEKSKAENK  120



>ref|XP_007038675.1| Remorin family protein [Theobroma cacao]
 gb|EOY23176.1| Remorin family protein [Theobroma cacao]
Length=408

 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ + +WEN++KA +EA+LKKIEE+LEK+KAEY EKM NK AL+HKEAEEK+++
Sbjct  316   NKAYKKLSSIAAWENSRKAALEAELKKIEEKLEKQKAEYVEKMKNKVALIHKEAEEKKAI  375

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             + ++R E +LK EE AAKFRA G  PKK  GCF
Sbjct  376   VEAKRGEDLLKAEETAAKFRAKGTTPKKVLGCF  408


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             ++GS++RD  LA++E  KRVS IKAWEESEKSK EN+
Sbjct  280  STEGSVNRDAVLARVETQKRVSLIKAWEESEKSKAENK  317



>ref|XP_008794186.1| PREDICTED: remorin-like isoform X1 [Phoenix dactylifera]
Length=208

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K+++ + +WEN+K A +EA+LK  EE+LEK KAEYAEKM NK A++HK AEEKR+ +
Sbjct  115   KAVKQMSSITAWENSKMAAMEAELKAKEEELEKMKAEYAEKMKNKVAMIHKAAEEKRAYV  174

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK+R+ G  PKK FGCFG
Sbjct  175   EAKRGEDILKAEETAAKYRSKGLAPKKIFGCFG  207


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 48/100 (48%), Gaps = 34/100 (34%)
 Frame = +1

Query  514  APQNMGPTKDVSPEKAVVP----------------HKNP----------------DPPLK  597
            AP    PTKDVS EKAV+P                 KN                  P  K
Sbjct  18   APPPTEPTKDVSEEKAVIPPPSEEKADDSKALAVVEKNSLRRSLRSILLLEVVADTPTEK  77

Query  598  TAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            + G  GS +R   LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  78   STG--GSTERVAILARLETEKRISLIKAWEENEKVKVENK  115



>ref|XP_010035132.1| PREDICTED: remorin-like isoform X4 [Eucalyptus grandis]
 gb|KCW46421.1| hypothetical protein EUGRSUZ_K00253 [Eucalyptus grandis]
Length=201

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK + + +WEN+KKA+I + LK  EE++EKKKAEYAE M NK A VHK AEEKR+++
Sbjct  108   KAQKKFSTIGAWENSKKASIGSDLKNFEEKMEKKKAEYAETMKNKIASVHKLAEEKRAIV  167

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  168   EAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  200



>ref|NP_001274955.1| putative remorin a3b4 [Solanum tuberosum]
 gb|ACB28484.1| putative remorin a3b4 [Solanum tuberosum]
Length=199

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK +++L+WEN+KKA++EA+LK+ EEQL KKKAEY EK+ NK AL+HKEAEEKR++
Sbjct  106   NKAQKKRSEILAWENSKKASLEAELKRTEEQLLKKKAEYIEKLKNKIALLHKEAEEKRAI  165

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
               ++R E +L  EEMA K RATG  PKK   GCF
Sbjct  166   TEAKRGEDLLTAEEMAPKCRATGSSPKKPLLGCF  199


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS+DRD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  73   GSIDRDATLARLTTEKRLSLIKAWEESEKSKAENK  107



>ref|NP_001236279.1| uncharacterized protein LOC100305501 [Glycine max]
 gb|ACU13201.1| unknown [Glycine max]
 gb|KHN21737.1| Remorin [Glycine soja]
Length=194

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++ KKL+ + +WEN+KKA  EA+L+KIEEQLEKKKAEY EK+ NK A +H+EAEEKR+ I
Sbjct  103   KSHKKLSAISAWENSKKAAAEAELRKIEEQLEKKKAEYGEKLKNKIATIHREAEEKRAFI  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +Q+ E+ LK EE AAK+RATG  P K FGCF
Sbjct  163   EAQKGEEFLKAEETAAKYRATGTAPTKLFGCF  194


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 15/77 (19%)
 Frame = +1

Query  532  PTKDVSPEKAVVPHKNPDPPLKTAGS---------------KGSLDRDIALAKIEDDKRV  666
            P +DV+ EK+V+P  +P P  ++                  +GS++RD  LA++  +KR+
Sbjct  27   PKEDVAEEKSVIPQPSPSPADESKALVIVEKTSEVAEEKPIEGSVNRDAVLARVATEKRL  86

Query  667  SFIKAWEESEKSKVENR  717
            S IKAWEESEKSK +N+
Sbjct  87   SLIKAWEESEKSKADNK  103



>gb|EYU25090.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=194

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN++KA +EA+LKKIEEQLE KKA+Y EK+ NK A VHK AEEKR+ +
Sbjct  103   KAQKKVSAIGAWENSRKATLEAELKKIEEQLEIKKAQYIEKLKNKVAYVHKAAEEKRANV  162

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR E++LK EE+AAK+RATG  PKK  GCF
Sbjct  163   EAQRGEELLKAEEVAAKYRATGTGPKKLLGCF  194



>emb|CDP08838.1| unnamed protein product [Coffea canephora]
Length=181

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKKL++V SWENTKKA IEAKLKKIEEQLEKKKA+Y E + NK A +HK+AEEK+++
Sbjct  88    NKAQKKLSEVSSWENTKKAAIEAKLKKIEEQLEKKKADYGETIKNKIAEIHKQAEEKKAM  147

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + ++R E++L+ +EM+AK+RAT Q PK+  GCFG
Sbjct  148   VEARRREEILQADEMSAKYRATNQAPKQ-VGCFG  180


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  532  PTKDVSPEKAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVE  711
            P  DV  EKA+V  +    P     SKGS+D+D+ALA++E++KR+SFIKAWEESEK+K E
Sbjct  28   PPNDVVEEKAIVKAEKASDPSVQKSSKGSVDKDVALAEVENEKRLSFIKAWEESEKTKAE  87

Query  712  NR  717
            N+
Sbjct  88   NK  89



>gb|EYU25089.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=195

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + +WEN++KA +EA+LKKIEEQLE KKA+Y EK+ NK A VHK AEEKR+ +
Sbjct  104   KAQKKVSAIGAWENSRKATLEAELKKIEEQLEIKKAQYIEKLKNKVAYVHKAAEEKRANV  163

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +QR E++LK EE+AAK+RATG  PKK  GCF
Sbjct  164   EAQRGEELLKAEEVAAKYRATGTGPKKLLGCF  195



>gb|ABK95953.1| unknown [Populus trichocarpa]
Length=66

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  1028  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             YAEKM NK AL+HK+AEE+R+++ ++R E+ LK EEMAAK+RATGQ PKK  GCF
Sbjct  12    YAEKMKNKVALIHKDAEEQRAMVEAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF  66



>emb|CDY69344.1| BnaAnng30100D, partial [Brassica napus]
Length=130

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKKIEEQLEKKKAEY E M NK A +HK+AEEKR++I
Sbjct  39    KAEKKLSSIESWENNKKAAVEAELKKIEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMI  98

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFG  1186
              ++R E+VLK EE+AAK+RA+G  PKK FG
Sbjct  99    EARRGEEVLKAEELAAKYRASGTAPKKLFG  128


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  5    GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENK  39



>gb|AGR88905.1| remorin 1 [Datisca glomerata]
Length=202

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ +++WEN++KA++EA+LKKIEEQLEKKKAEY EK  NK A +HK AEEKR+ 
Sbjct  108   NKAHKKLSAIVAWENSRKASVEAELKKIEEQLEKKKAEYVEKQKNKIAQIHKSAEEKRAE  167

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             I ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  168   IEAKRGEDLLKAEETAAKYRATGSAPKKLLGCFS  201


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  604  GSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
             S+GS++RD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  72   SSEGSVNRDAVLARVATEKRMSLIKAWEESEKSKAENK  109



>emb|CDP05208.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ + SWEN+KKA+IEA+L+KIEE+LEK+KAEY EKM NK A +HK AEE+++ I
Sbjct  112   KAQKKISAIGSWENSKKASIEAELRKIEEKLEKQKAEYVEKMKNKIAALHKSAEEQKAAI  171

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
               +R E +LK EE AAK+RATG  PKK  GCF
Sbjct  172   EYKRGEDLLKAEEAAAKYRATGTAPKKLLGCF  203


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KA+   + P  P +   ++GS++RD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  59   KALAIVEKPAEPAEEKPAEGSINRDAVLARVATEKRLSLIKAWEESEKSKAENK  112



>ref|NP_001275297.1| putative remorin a4-e8 [Solanum tuberosum]
 gb|ABU49728.1| putative remorin a4-e8 [Solanum tuberosum]
Length=196

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK +++L+WEN+KKA++EA+LK+ EEQL KKKAEY EK+ NK ALVHK AEEKR++
Sbjct  103   NKAQKKRSEILAWENSKKASLEAELKRTEEQLLKKKAEYIEKLKNKIALVHKSAEEKRAI  162

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
               ++R E +L  EEMA K RATG  PKK   GCF
Sbjct  163   TEAKRGEDLLTAEEMAPKCRATGSSPKKPLLGCF  196


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  610  KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KGS+DRD  LA++  +KR+S IKAWEESEKSK EN+
Sbjct  69   KGSIDRDATLARLTTEKRLSLIKAWEESEKSKAENK  104



>ref|XP_009349347.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ + SWENT+KA +EA+LKK EE+LEK+KAEY E+M NK AL+HK AEEKR+V+
Sbjct  120   KAQKKLSAIGSWENTRKAIVEAELKKFEEKLEKQKAEYVEQMKNKIALIHKAAEEKRAVV  179

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++R E +LK EE AAK RATG+ PKK  G F 
Sbjct  180   EAKRGEDLLKAEETAAKCRATGKTPKKLLGWFS  212



>dbj|BAJ88188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=86

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  1028  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             YAEKM NK A++HKEAEEKR+++ +++ E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  30    YAEKMKNKAAMIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGNSPKKVMGCFG  85



>gb|EPS60307.1| hypothetical protein M569_14497 [Genlisea aurea]
Length=194

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQKK + V +WEN+KKA +EA+LKKIEE+ EKKKAEY EK+ NK ALVHK AEEKR+V
Sbjct  102   NKAQKKKSAVGAWENSKKAKLEAELKKIEEEFEKKKAEYVEKIRNKVALVHKAAEEKRAV  161

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R+E  LK EE+AAK+RATG  PKK  G F
Sbjct  162   IEARRSEDHLKAEEIAAKYRATGTAPKKLLGIF  194


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 42/84 (50%), Gaps = 22/84 (26%)
 Frame = +1

Query  532  PTKDVSPEKAVVPHKNPDP----------PLKTAGSK------------GSLDRDIALAK  645
            P KDV+ EK +V    P P           L  A  K             S DRDI LA+
Sbjct  20   PPKDVAEEKTIVAAPTPTPTEEKLKDEFKALAVADEKPAEPVAEESKPDESTDRDIVLAR  79

Query  646  IEDDKRVSFIKAWEESEKSKVENR  717
            +  +KR+S IKAWEESEKSK EN+
Sbjct  80   VATEKRLSLIKAWEESEKSKAENK  103



>gb|EPS59685.1| hypothetical protein M569_15119, partial [Genlisea aurea]
Length=137

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL++V SWEN+K+A +E KLK  +E+LEKKKA YAEK+ NK A++HK+AEE+R+ +
Sbjct  46    KAEKKLSEVNSWENSKRAALEGKLKTFDEELEKKKAGYAEKVKNKLAIIHKQAEEQRAEV  105

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             +++R E+ LK +E AAKFRA GQ+P    GC 
Sbjct  106   LAKRGEEQLKADEAAAKFRAAGQIPPTGCGCL  137


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  607  SKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            SKGSLDRDIALAK++DDKR+SFIKAWE+SEK+K +N+
Sbjct  10   SKGSLDRDIALAKVDDDKRLSFIKAWEDSEKTKAQNK  46



>gb|AFK45936.1| unknown [Lotus japonicus]
Length=215

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+D+ +WEN+K A  E +L+KIEE LEKKKA Y EK+ NK A+VH+EAEEKR+ 
Sbjct  123   NKAHKKLSDISAWENSKIAAKEVELRKIEENLEKKKAVYVEKLKNKIAMVHREAEEKRAF  182

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E +LK EE+AAK+RATG  PKK F  F
Sbjct  183   IEAKKGEDLLKAEELAAKYRATGTAPKKPFSFF  215



>ref|XP_010035129.1| PREDICTED: remorin-like isoform X1 [Eucalyptus grandis]
Length=222

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +2

Query  911   FGRAQKKLADVLSWENTKKANieaklkk-ieeqlekkkaeYAEKMSNKTALVHKEAEEKR  1087
               RAQKK + + +WEN+KKA+I + LK   +E++EKKKAEYAE M NK A VHK AEEKR
Sbjct  126   LNRAQKKFSTIGAWENSKKASIGSDLKNFEQEKMEKKKAEYAETMKNKIASVHKLAEEKR  185

Query  1088  SVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             +++ +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  186   AIVEAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  221



>ref|XP_010908426.1| PREDICTED: remorin-like isoform X1 [Elaeis guineensis]
Length=205

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 12/105 (11%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeql------------ekkkaeYAEKMSNKTAL  1060
             +A K+++ + +WEN+KKA  EA+LK  E               EKKKAEYAEKM NK A+
Sbjct  100   KAAKQMSSITAWENSKKAATEAELKAKESLQPNTFLMCEQEELEKKKAEYAEKMKNKVAM  159

Query  1061  VHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             +HK AEEKR+++ ++  E +LK EEMAAK+R+TG  PKK FGCFG
Sbjct  160   IHKTAEEKRAIVEAKCGEDILKAEEMAAKYRSTGLAPKKLFGCFG  204


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 19/78 (24%)
 Frame = +1

Query  535  TKDVSPEKAVVP----------------HKNPDPPL-KTAGSKGSLDRDIALAKIEDDKR  663
            TKDV+ EKAV+P                 K  D P  K+ G  GS +R   L ++E +KR
Sbjct  25   TKDVAEEKAVIPPPSEEKADDSKALDVVEKVADTPTEKSRG--GSTERVAQLTRLETEKR  82

Query  664  VSFIKAWEESEKSKVENR  717
            +S I+AWEE+EK KVEN+
Sbjct  83   MSLIRAWEENEKVKVENK  100



>ref|XP_009141736.1| PREDICTED: remorin-like isoform X2 [Brassica rapa]
Length=196

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KKL+ + SWEN KKA +EA+LKKIEEQLEKKKAEY E M NK A +HK+AEEKR++
Sbjct  104   NKAEKKLSSIESWENNKKAAVEAELKKIEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAM  163

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFG  1186
             I ++R E+VLK EE+AAK+RA+G  PKK FG
Sbjct  164   IEARRGEEVLKAEELAAKYRASGTAPKKLFG  194


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  71   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENK  105



>gb|AGG82489.1| remorin 2 [Datisca glomerata]
Length=187

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWEN KKA++EA+L+KIEE+LEKKKAEY E+M NK   VHK AEEKR+V+
Sbjct  94    KAFKKLSAIDSWENRKKASVEAQLRKIEEKLEKKKAEYGEQMKNKMVEVHKAAEEKRAVV  153

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R EQ LK EE AAK+RA G  PKK FGCF
Sbjct  154   EASRGEQFLKVEETAAKYRAAGFAPKKLFGCF  185


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 16/74 (22%)
 Frame = +1

Query  538  KDVSPEKAV-------------VPHKNPDPPL-KTAGSKGSLDRDIALAKIEDDKRVSFI  675
            KDV+ EK+V             VP K  D    K+AG  GS+DRD  LA++E +KR++ I
Sbjct  23   KDVAEEKSVTVIPLSDHKSSLSVPEKISDAASEKSAG--GSIDRDAVLARVETEKRLALI  80

Query  676  KAWEESEKSKVENR  717
            KAWEESEK++ EN+
Sbjct  81   KAWEESEKTRAENK  94



>ref|XP_009141722.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
 ref|XP_009141730.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
Length=197

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KKL+ + SWEN KKA +EA+LKKIEEQLEKKKAEY E M NK A +HK+AEEKR++
Sbjct  105   NKAEKKLSSIESWENNKKAAVEAELKKIEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAM  164

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFG  1186
             I ++R E+VLK EE+AAK+RA+G  PKK FG
Sbjct  165   IEARRGEEVLKAEELAAKYRASGTAPKKLFG  195


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  72   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENK  106



>emb|CDX87157.1| BnaC09g04720D [Brassica napus]
Length=194

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A+KKL+ + SWEN KKA +EA+LKKIEEQLEKKKAEY E M NK A +HK+AEEKR++
Sbjct  102   NKAEKKLSSIESWENNKKAAVEAELKKIEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAM  161

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFG  1186
             I ++R E+VLK EE+AAK+RA+G  PKK FG
Sbjct  162   IEARRGEEVLKAEELAAKYRASGTAPKKLFG  192


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  69   GSINRDAVLARVETEKRMSLIKAWEEAEKCKVENK  103



>ref|XP_011022731.1| PREDICTED: remorin-like [Populus euphratica]
Length=189

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWE TKK ++EAK+ K EE+LE+KKAEYAEKM NK A +HK AEEK+++I
Sbjct  96    KAHKKLSAIGSWETTKKVSVEAKIMKFEEKLERKKAEYAEKMKNKAAELHKAAEEKKAMI  155

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              ++++E+ LK EE AAKFRATG  PKK  GCF 
Sbjct  156   EAKKSEECLKVEETAAKFRATGYAPKKFLGCFS  188



>ref|XP_003638357.1| Remorin [Medicago truncatula]
 gb|AFK36180.1| unknown [Medicago truncatula]
 gb|KEH43717.1| carboxy-terminal region remorin [Medicago truncatula]
Length=209

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQ++L+ + +WEN+KKA  EA+L+K+EEQLEKKK EYAEK+ NK A +HK AEEK+++I
Sbjct  118   KAQRRLSTITAWENSKKAAKEAELRKLEEQLEKKKGEYAEKLKNKIAALHKAAEEKKAMI  177

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E +LK EE+AAK+RATG  PKK FG F
Sbjct  178   EAKKGEDLLKAEEIAAKYRATGTAPKKLFGLF  209


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 42/84 (50%), Gaps = 21/84 (25%)
 Frame = +1

Query  529  GPTKDVSPEKAVVPH---------------------KNPDPPLKTAGSKGSLDRDIALAK  645
             P KDV+ EK+V+P                      K  +   +     GS+DRD  L +
Sbjct  35   APKKDVAEEKSVIPQDNNPPPPPPVVDDSKALVIVQKTDEAAEEKPKEGGSIDRDAVLTR  94

Query  646  IEDDKRVSFIKAWEESEKSKVENR  717
            +  +KR+S IKAWEESEKSK EN+
Sbjct  95   VATEKRLSLIKAWEESEKSKAENK  118



>ref|XP_011072399.1| PREDICTED: remorin [Sesamum indicum]
Length=165

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A K+L+ V +WEN K+A++EA+LK+IEE++EKKKAEYA KM NKTA++H+  EEKR+++
Sbjct  72    KAYKRLSGVDAWENAKRASLEAQLKQIEEKIEKKKAEYAAKMKNKTAMIHRAGEEKRAMV  131

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R + +L  EE AAK+RATG VPKK F CF
Sbjct  132   EADRGKDLLMVEEAAAKYRATGNVPKKLFACF  163



>emb|CDP09770.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ + +WENTKKA++E +LK IEE+ EKKKA+ AE+M NK A +H+++EEKR++
Sbjct  118   NKAYKKLSSIGAWENTKKASVEVELKLIEEEFEKKKAKAAERMKNKMAEIHRKSEEKRAM  177

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + ++R E +LK EE AAKFR+TG VPKK F CFG
Sbjct  178   VEAKRGEDILKVEETAAKFRSTGNVPKKLFACFG  211



>gb|EPS61469.1| hypothetical protein M569_13328, partial [Genlisea aurea]
Length=131

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQ+KLA +  WEN+KKA++EA+LKK+EEQLEKK+AE+ EK++N+ A +HK AEEKR+VI
Sbjct  40    KAQRKLAAIGVWENSKKASLEAELKKLEEQLEKKRAEFLEKLNNQIAQIHKSAEEKRAVI  99

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + R +++LK EE AAK+RATG  PKK  G F
Sbjct  100   EANRGQEILKAEETAAKYRATGTAPKKLLGLF  131



>ref|XP_006649189.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=199

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKK++ +L+WEN++KA +EAKL+  EE+LEKKKAEYAEKM N+ A VHK AEEKR+ +
Sbjct  106   KAQKKMSSILAWENSRKAAVEAKLRTREEKLEKKKAEYAEKMRNQVAAVHKAAEEKRAAV  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              + R E+++K EEMAAK R+ G  P K   CFG
Sbjct  166   EATRREEMIKYEEMAAKHRSKGTTPTKFLSCFG  198


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  586  PPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            P  K A   GS DRD  LAK+E ++++S IKAWEESEKSK EN+
Sbjct  63   PADKAAMPTGSADRDAILAKVELERKLSMIKAWEESEKSKAENK  106



>ref|XP_003556104.1| PREDICTED: remorin-like [Glycine max]
 gb|KHN26658.1| Remorin [Glycine soja]
Length=197

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             ++ KKL+ + +WEN+ KA  EA+L+KIEEQLEKKKAEY EK+ NK A +H+EAEEKR+ I
Sbjct  106   KSHKKLSVISAWENSMKAAAEAELRKIEEQLEKKKAEYGEKLKNKIATIHREAEEKRAFI  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +Q+ E  LK EE AAK+RATG  P K FGCF
Sbjct  166   EAQKGEDFLKAEETAAKYRATGTAPTKLFGCF  197



>ref|XP_007139893.1| hypothetical protein PHAVU_008G067400g [Phaseolus vulgaris]
 gb|ESW11887.1| hypothetical protein PHAVU_008G067400g [Phaseolus vulgaris]
Length=209

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA+K L+ V +WE+ K A +EA+LKKIEE+LEKKKAE +EKM NK AL+HK+AEEKR+ I
Sbjct  118   RAEKHLSAVAAWESRKMAILEAELKKIEEELEKKKAEQSEKMKNKMALIHKQAEEKRATI  177

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+ A++RATG  PKK  GCF
Sbjct  178   EAKRGEEVLKAEEIGARYRATGTTPKKTIGCF  209


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +1

Query  562  VVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            VVP K P  P      +GSLDRDIA A++E +K++S++KAWEESEK+K +NR
Sbjct  68   VVPEK-PVVPANQQSWRGSLDRDIARAEVEKEKKLSYVKAWEESEKAKADNR  118



>ref|XP_010035131.1| PREDICTED: remorin-like isoform X3 [Eucalyptus grandis]
Length=202

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkk-ieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
             +AQKK + + +WEN+KKA+I + LK   +E++EKKKAEYAE M NK A VHK AEEKR++
Sbjct  108   KAQKKFSTIGAWENSKKASIGSDLKNFEQEKMEKKKAEYAETMKNKIASVHKLAEEKRAI  167

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             + +++ E +LK EEMAAK+RA+G VPKK   CFG
Sbjct  168   VEAKKGEDLLKAEEMAAKYRASGLVPKKLLLCFG  201


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS +RD+ LA++E DK++S I+AWEE+EKSK EN+
Sbjct  74   GSGNRDVELARVETDKKLSLIRAWEENEKSKAENK  108



>emb|CDX80385.1| BnaC07g30590D [Brassica napus]
Length=388

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A+KKL+ + SWEN KKA +EA+LKK+EEQLEKKKAE  E M NK A +HK+AEEKR++I
Sbjct  114   KAEKKLSSIGSWENNKKAAVEAELKKMEEQLEKKKAENVELMKNKIAQIHKQAEEKRAMI  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+VLK EE+AAK+RATG  PKK FGC 
Sbjct  174   EARRGEEVLKAEELAAKYRATGTAPKKLFGCI  205


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  613  GSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            GS++RD  LA++E +KR+S IKAWEE+EK KVEN+
Sbjct  80   GSVNRDAVLARVETEKRMSLIKAWEEAEKCKVENK  114



>gb|ABK23302.1| unknown [Picea sitchensis]
Length=197

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  926   KKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVIVSQ  1105
             K ++ + +WENTKK++ E ++K+ EE+LEK+KA Y EKM N+ A++HK+AEEK+++  ++
Sbjct  107   KSVSTITAWENTKKSSAETRMKRAEEKLEKQKAAYVEKMKNEIAIIHKQAEEKKAMAEAK  166

Query  1106  RNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             R E +LK EE +AK+ ATGQVPKK F CFG
Sbjct  167   RGEDMLKAEESSAKYNATGQVPKKFFLCFG  196


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            +P L  +   GSLDRD  L K+  +KR++ +KAWEE+EK+K EN+
Sbjct  60   EPVLSKSSEGGSLDRDAFLVKVNTEKRLALVKAWEENEKAKAENK  104



>ref|XP_009770981.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=178

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +AQ+K +++L+WEN+KKA++EA+LK+IEEQL KKKAEY EKM NK AL+HK AEEKR++
Sbjct  85    NKAQRKQSEILAWENSKKASLEAELKRIEEQLLKKKAEYIEKMKNKIALLHKSAEEKRAI  144

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKA-FGCF  1192
             I ++R E +L  EE AAK RAT   PKK   GCF
Sbjct  145   IEAKRGEDLLMAEETAAKHRATETSPKKPLLGCF  178


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 20/80 (25%)
 Frame = +1

Query  538  KDVSPEKAVVP------HKNPDPP---------LKTAG-----SKGSLDRDIALAKIEDD  657
            KDV+ +KA+VP       +  D P         L+T        +GS+DRD  LA+   +
Sbjct  7    KDVAEDKAIVPLALPPSQEEKDKPDDDSKAVAILETKALVPVEKRGSIDRDATLARFTTE  66

Query  658  KRVSFIKAWEESEKSKVENR  717
            KR+S IKAWEESEKSK EN+
Sbjct  67   KRLSLIKAWEESEKSKAENK  86



>ref|NP_001048722.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|ABF93596.1| Remorin, C-terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10636.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|EAY88244.1| hypothetical protein OsI_09695 [Oryza sativa Indica Group]
 gb|EAZ25323.1| hypothetical protein OsJ_09134 [Oryza sativa Japonica Group]
 dbj|BAG87426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWEN KKA +EA+LK+IE++LEKKKA Y EK+ NK AL+HK AEEKR++ 
Sbjct  82    RAAKKLSYITSWENAKKAEMEAELKRIEQELEKKKAAYEEKLKNKLALLHKTAEEKRALT  141

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+++  EEMAAK+RA G+ P K FG  
Sbjct  142   TAKRGEELIMAEEMAAKYRAKGEAPTKLFGLL  173


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 15/82 (18%)
 Frame = +1

Query  535  TKDVSPEKAVVPHKNPDPP------------LKTA-GSKGSLDRDIALAKIEDDKRVSFI  675
            TKD++ EKAVVP   P PP            +K A  + GS +RD  LAKI  +KR+  I
Sbjct  11   TKDIAEEKAVVPL--PTPPATEHDDSKAIVLVKEAEATGGSAERDAYLAKIVSEKRLVLI  68

Query  676  KAWEESEKSKVENR*AIVFNFF  741
             AWEESEK++ ENR A   ++ 
Sbjct  69   NAWEESEKARAENRAAKKLSYI  90



>gb|KDO60014.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=192

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 8/99 (8%)
 Frame = +2

Query  923   QKKLADVLSWE--------NTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAE  1078
             +K+++ + +WE        N +KA +EA+LKKIEEQLEKKKAEY EKM NK AL+HKEAE
Sbjct  93    EKRISLIRAWEESEKSQAENNRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHKEAE  152

Query  1079  EKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
             EKR++I ++R E +LK EE+AAK+RATG  PKK   CFG
Sbjct  153   EKRAMIEAKRGEDLLKAEELAAKYRATGSAPKKLLSCFG  191


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  583  DPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVEN  714
            +PP     ++GS++RD  LA++E +KR+S I+AWEESEKS+ EN
Sbjct  69   EPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAEN  112



>ref|XP_009383123.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=180

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQ+K++ +LSWENTK A IEA++KK EE+LEKKKA+  EK  NK A++HKEAEE+R+++
Sbjct  84    KAQRKMSSILSWENTKMATIEAEIKKNEERLEKKKADSEEKAKNKIAMIHKEAEERRAMV  143

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              S+  E++L+ EE  AK+ +TG  PKK  GCF
Sbjct  144   ESKHGEELLRAEEAVAKYHSTGHTPKKGAGCF  175



>ref|XP_002304484.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
 gb|EEE79463.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
Length=189

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ + SWE TKK ++EAK+ K EE+LE+KKAEY EKM NK A +HK AEEK+++I
Sbjct  96    KAHKKLSAIGSWETTKKVSVEAKIMKFEEKLERKKAEYEEKMKNKAAELHKAAEEKKAMI  155

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++++E+ LK EE AAKFRATG  PKK  GCF
Sbjct  156   EAKKSEECLKVEETAAKFRATGYTPKKFLGCF  187



>ref|XP_007143402.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
 gb|ESW15396.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
Length=198

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A K ++ + +WEN+KKA  EA+L+KIEEQLEKKKAEY EK+ NK A +H+EAEEKR+ 
Sbjct  106   NKAHKNISAISAWENSKKAATEAELRKIEEQLEKKKAEYGEKLKNKIATIHREAEEKRAF  165

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E  LK EE +A++RATG  PKK FGCF
Sbjct  166   IEAKKGEDFLKAEETSARYRATGTAPKKLFGCF  198



>ref|XP_008353990.1| PREDICTED: remorin-like [Malus domestica]
Length=154

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  1028  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             YAEKM NK AL+HK+A+EKR+++++Q+ E++LK +E AAK+RATG +PKK  GCF
Sbjct  100   YAEKMQNKVALLHKQADEKRAMVLAQKGEELLKADETAAKYRATGSIPKKFLGCF  154



>ref|XP_009390477.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=190

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  902   LKRFGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEE  1081
             +K   +A KK++ + +WE +KKA++EA+LKK EE+LEKKKAEYAE++ NK AL+HK+AEE
Sbjct  94    VKAENKAIKKISSISAWEKSKKADVEAELKKKEEELEKKKAEYAEQVKNKLALIHKQAEE  153

Query  1082  KRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             KR++  ++R E+ LK EE AAK+RATG  PKK FG F
Sbjct  154   KRAIAEAKRGEEALKAEEKAAKYRATGLAPKKIFGFF  190



>ref|XP_009400417.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=179

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +2

Query  902   LKRFGRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEE  1081
             +K   +A KK++ + +WEN+KKA +EA+LKK EE+LEKKKAE+AEK+ NK AL+HKEAEE
Sbjct  83    VKAENKALKKMSSISAWENSKKAEVEAELKKKEEELEKKKAEHAEKVKNKIALIHKEAEE  142

Query  1082  KRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             KR++  ++  E+ LK EE AAK+RATG  PK+ FG F
Sbjct  143   KRAIAEAKHGEEALKAEEKAAKYRATGLTPKRIFGFF  179



>gb|AFN53683.1| hypothetical protein [Linum usitatissimum]
Length=422

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KK++ + SWEN+KKA +EA+L++ EE+LEK+KAEYAEKM NK A +HK AEEKR+ I
Sbjct  329   KAHKKVSAIESWENSKKAAVEAQLRQYEEKLEKQKAEYAEKMKNKIAEIHKLAEEKRATI  388

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKK--AFGCF  1192
              ++R E +LK EEMAAK+RATG  PK    FGCF
Sbjct  389   EAKRGEDMLKAEEMAAKYRATGTTPKNPLGFGCF  422


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGS--KGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            KA+VP +    P+       +GS++RD+ LA++E +KR+SFIKAWEESEKSK EN+
Sbjct  274  KAIVPLQKEAEPVSEEAKPVEGSVNRDLELARVETEKRLSFIKAWEESEKSKAENK  329



>ref|NP_001151679.1| remorin [Zea mays]
 gb|ACG43842.1| remorin [Zea mays]
Length=180

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +  KK + +LSWENTKKA IEA+LKK +E+LEKK AEYAEKM NK A++HK+AEEKR+++
Sbjct  93    KTAKKQSIILSWENTKKAIIEAELKKKKEELEKKMAEYAEKMKNKKAIIHKKAEEKRAMV  152

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPK  1174
             ++Q  E++LKTEEMAAK+RAT   PK
Sbjct  153   MAQHGEEILKTEEMAAKYRATRVAPK  178



>ref|XP_004986023.1| PREDICTED: remorin-like [Setaria italica]
Length=187

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKLA + SWEN KKA +EA+LKKIEEQLEKKKA Y EK+ NK A++HK AEEKR++ 
Sbjct  94    RAAKKLAYITSWENAKKAEMEAELKKIEEQLEKKKAAYEEKLKNKLAMLHKTAEEKRALT  153

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+++  EE+AAK+RA G+ P K FG  
Sbjct  154   EAKRGEEIIMAEELAAKYRAKGEAPTKLFGLL  185


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +1

Query  556  KAVVPHKNPDPPLKTAGSKGSLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFN  735
            KA+V  K  D   K A + GS +RD  LAKI  +KR++ I AWEESEK++ ENR A    
Sbjct  43   KAIVVVK--DAAEKPAATGGSTERDAYLAKIVSEKRLTLITAWEESEKARAENRAAKKLA  100

Query  736  FF  741
            + 
Sbjct  101  YI  102



>gb|EPS69897.1| hypothetical protein M569_04866 [Genlisea aurea]
Length=170

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +AQKKL+ +  WE++K+A++EA+LKK+EEQLEKKK+ Y EK+ NK AL+HK AEEKR+VI
Sbjct  79    KAQKKLSAIGVWEDSKRASLEAELKKLEEQLEKKKSGYLEKVKNKIALIHKAAEEKRAVI  138

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              + +  ++LK EE AAK+RATG  PKK   CF
Sbjct  139   EAVQGGELLKAEETAAKYRATGSAPKKILRCF  170


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  616  SLDRDIALAKIEDDKRVSFIKAWEESEKSKVENR  717
            S++RD ALA++  +KR+SFI+AWEESEK+K EN+
Sbjct  46   SVNRDAALARVTTEKRLSFIRAWEESEKAKAENK  79



>gb|KHN31817.1| Remorin [Glycine soja]
Length=206

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ V +WEN+KKA +EA LKKIEE+LEKKKAE AEK+ NK A +HKEAEE+R++
Sbjct  114   NKAHKKLSSVSAWENSKKAAVEADLKKIEEELEKKKAEAAEKIKNKIATIHKEAEERRAI  173

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I +++ E +LK EE AAK+RATG  PKK  GCF
Sbjct  174   IEAKKGEDLLKAEEQAAKYRATGTAPKKLLGCF  206


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 16/76 (21%)
 Frame = +1

Query  538  KDVSPEKAVVPH-KNPDPPLKTAG---------------SKGSLDRDIALAKIEDDKRVS  669
            KDV+ EK+V+P   + D P ++                 ++GS++RD  LA++  +KR+S
Sbjct  40   KDVTEEKSVIPVPSSDDKPDESKALVLVEKTQEVAEVKPTEGSINRDAVLARVATEKRLS  99

Query  670  FIKAWEESEKSKVENR  717
             IKAWEESEKSK EN+
Sbjct  100  LIKAWEESEKSKAENK  115



>ref|NP_001238396.1| uncharacterized protein LOC100500457 [Glycine max]
 gb|ACU15544.1| unknown [Glycine max]
Length=206

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V +WEN+KKA +EA LKKIEE+LEKKKAE AEK+ NK A +HKEAEE+R++I
Sbjct  115   KAHKKLSSVSAWENSKKAAVEADLKKIEEELEKKKAEAAEKIKNKIATIHKEAEERRAII  174

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E +LK EE AAK+RATG  PKK  GCF
Sbjct  175   EAKKGEDLLKAEEQAAKYRATGTAPKKLLGCF  206


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 16/76 (21%)
 Frame = +1

Query  538  KDVSPEKAVVPH-KNPDPPLKTAG---------------SKGSLDRDIALAKIEDDKRVS  669
            KDV+ EK+V+P   + D P ++                 ++GS++RD  LA++  +KR+S
Sbjct  40   KDVTEEKSVIPVPSSDDKPDESKALVLVEKTQEVAEVKPTEGSINRDAVLARVATEKRLS  99

Query  670  FIKAWEESEKSKVENR  717
             IKAWEESEKSK EN+
Sbjct  100  LIKAWEESEKSKAENK  115



>ref|XP_004308093.1| PREDICTED: remorin-like isoform 2 [Fragaria vesca subsp. vesca]
Length=197

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  914   GRAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSV  1093
              +A KKL+ V SWENTKKA++EA+LK IEE+LEKKKAE  E+M NK AL+HK AEEKR++
Sbjct  105   NKAHKKLSVVGSWENTKKASVEAELKIIEEKLEKKKAEAVEQMKNKIALIHKAAEEKRAL  164

Query  1094  IVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
             I ++R E +LK EE AAK+RATG+ PKK    F
Sbjct  165   IEAKRAEDLLKAEENAAKYRATGKAPKKLLSFF  197



>ref|XP_009627101.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=198

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V +WE++KKA IE +LK+IEE+ E+KKAEY EKM NK A++H+EAEEKR++I
Sbjct  106   KAFKKLSAVGAWESSKKATIEFELKQIEEEFERKKAEYEEKMKNKMAVIHREAEEKRALI  165

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1195
              + R +  LK EE AAKF  TG +PKK  GCFG
Sbjct  166   EANRGQDFLKVEETAAKFHVTG-IPKKFLGCFG  197



>ref|XP_006649253.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=174

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             RA KKL+ + SWEN KKA +EA+LK+IEEQLEKKKA Y EK+ NK AL+HK AEEKR++ 
Sbjct  81    RAAKKLSYITSWENAKKAEMEAELKRIEEQLEKKKAAYEEKLKNKLALLHKTAEEKRAMT  140

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              ++R E+++  EE+AAK+RA G+ P K FG  
Sbjct  141   EAKRGEELIMAEELAAKYRAKGEAPTKLFGLL  172


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 14/81 (17%)
 Frame = +1

Query  535  TKDVSPEKAVVPHKNPDPPLKTAGSK------------GSLDRDIALAKIEDDKRVSFIK  678
            TKD++ EKAVVP   P PP +   SK            GS +RD  LAKI  +KR+  I 
Sbjct  11   TKDIAEEKAVVPL--PAPPSQHDDSKAIVLVKDAEATGGSAERDAYLAKIVSEKRLVLIN  68

Query  679  AWEESEKSKVENR*AIVFNFF  741
            AWEESEK++ ENR A   ++ 
Sbjct  69   AWEESEKARAENRAAKKLSYI  89



>ref|NP_001238565.1| uncharacterized protein LOC100499700 [Glycine max]
 gb|ACU13297.1| unknown [Glycine max]
 gb|KHN42543.1| Remorin [Glycine soja]
Length=205

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  917   RAQKKLADVLSWENTKKANieaklkkieeqlekkkaeYAEKMSNKTALVHKEAEEKRSVI  1096
             +A KKL+ V +WEN+KKA +EA LKKIEE+LEKKKAE AEK+ NK A +HKEAEE+R++I
Sbjct  114   KAHKKLSSVSAWENSKKAAVEADLKKIEEELEKKKAEAAEKIKNKIAAIHKEAEERRAII  173

Query  1097  VSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1192
              +++ E +LK EE AAK+RATG  PKK  GCF
Sbjct  174   EAKKGEDLLKAEEQAAKYRATGTAPKKLLGCF  205


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 16/76 (21%)
 Frame = +1

Query  538  KDVSPEKAVVPH-KNPDPPLKTAG---------------SKGSLDRDIALAKIEDDKRVS  669
            KDV+ EK+V+P   + D P ++                 ++GS++RD  LA++  +KR+S
Sbjct  39   KDVAEEKSVIPVPSSDDKPDESKALVLVEKTQEVAEVKPTEGSVNRDAVLARVATEKRLS  98

Query  670  FIKAWEESEKSKVENR  717
             IKAWEESEKSK EN+
Sbjct  99   LIKAWEESEKSKAENK  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378