BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22430_g3_i1 len=1445 path=[922:0-158 1081:159-185 2228:186-211
2254:212-573 4633:574-660 8435:661-862 4720:863-908 2452:909-945
2605:946-1031 2691:1032-1444]

Length=1445
                                                                      Score     E

ref|XP_011091944.1|  PREDICTED: remorin-like                            107   2e-27   
ref|XP_006652568.1|  PREDICTED: remorin-like                            103   1e-26   
ref|NP_001053409.1|  Os04g0533300                                       103   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002448229.1|  hypothetical protein SORBIDRAFT_06g023630          103   3e-26   Sorghum bicolor [broomcorn]
ref|NP_001159012.1|  remorin                                            103   4e-26   Zea mays [maize]
ref|NP_001147227.1|  remorin                                            103   6e-26   Zea mays [maize]
ref|XP_008661880.1|  PREDICTED: remorin isoform X1                      103   7e-26   
ref|XP_002511833.1|  Remorin, putative                                  105   1e-25   Ricinus communis
gb|EMT30253.1|  hypothetical protein F775_30825                         100   2e-25   
ref|XP_003580217.1|  PREDICTED: remorin-like                            101   2e-25   
dbj|BAJ90231.1|  predicted protein                                      100   4e-25   
ref|XP_009629650.1|  PREDICTED: remorin-like                            102   9e-25   
ref|XP_009779197.1|  PREDICTED: remorin-like                            102   1e-24   
ref|XP_008438060.1|  PREDICTED: uncharacterized protein At3g61260     96.3    1e-24   
gb|KHG12669.1|  Remorin                                                 101   1e-24   
gb|EYU32085.1|  hypothetical protein MIMGU_mgv1a014760mg                102   2e-24   
ref|XP_007051855.1|  Remorin family protein                             100   2e-24   
ref|XP_010523734.1|  PREDICTED: uncharacterized protein At3g61260     97.4    3e-24   
ref|NP_001235181.1|  uncharacterized protein LOC100305679               103   3e-24   
ref|XP_004133871.1|  PREDICTED: uncharacterized protein At3g61260...  94.7    3e-24   
ref|XP_006445087.1|  hypothetical protein CICLE_v10022286mg           99.0    5e-24   
ref|XP_006445086.1|  hypothetical protein CICLE_v10022286mg           99.0    5e-24   
gb|KDO86097.1|  hypothetical protein CISIN_1g028704mg                 98.2    6e-24   
gb|KHN29375.1|  Remorin                                               99.4    8e-24   
ref|XP_009587316.1|  PREDICTED: remorin-like                          94.0    1e-23   
gb|KDP28652.1|  hypothetical protein JCGZ_14423                         103   1e-23   
ref|XP_009116785.1|  PREDICTED: uncharacterized protein At3g61260     96.3    1e-23   
gb|KDO60012.1|  hypothetical protein CISIN_1g028549mg                 97.8    1e-23   
emb|CDY48933.1|  BnaA09g39040D                                        96.3    1e-23   
emb|CDX71754.1|  BnaC08g31200D                                        96.3    2e-23   
ref|XP_006490378.1|  PREDICTED: remorin-like                          97.8    4e-23   
ref|XP_006421909.1|  hypothetical protein CICLE_v10005899mg           97.8    5e-23   
ref|XP_006402501.1|  hypothetical protein EUTSA_v10006246mg           93.6    6e-23   
ref|XP_006291850.1|  hypothetical protein CARUB_v10018025mg           93.2    6e-23   
ref|XP_010413437.1|  PREDICTED: uncharacterized protein At3g61260...  92.8    9e-23   
ref|XP_010512460.1|  PREDICTED: uncharacterized protein At3g61260...  92.8    1e-22   
ref|XP_009794056.1|  PREDICTED: remorin-like                          92.0    1e-22   
ref|XP_009778199.1|  PREDICTED: remorin-like isoform X1               96.7    1e-22   
ref|XP_003528866.1|  PREDICTED: remorin-like                          98.6    1e-22   
ref|XP_010469049.1|  PREDICTED: uncharacterized protein At3g61260...  92.4    1e-22   
ref|XP_009778200.1|  PREDICTED: remorin-like isoform X2               96.7    1e-22   
ref|XP_004240109.1|  PREDICTED: remorin                               95.9    1e-22   
ref|XP_006345628.1|  PREDICTED: remorin-like                          97.1    1e-22   
ref|XP_011023368.1|  PREDICTED: remorin-like                          96.7    1e-22   
gb|AEK94319.1|  remorin                                               95.5    2e-22   
ref|XP_008336972.1|  PREDICTED: LOW QUALITY PROTEIN: remorin-like     94.7    2e-22   
ref|XP_010473801.1|  PREDICTED: uncharacterized protein At3g61260     92.0    2e-22   
ref|XP_006339544.1|  PREDICTED: remorin-like                          91.3    2e-22   
ref|XP_007135038.1|  hypothetical protein PHAVU_010G096300g           97.8    2e-22   
ref|NP_191685.1|  remorin family protein                              92.8    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003534573.1|  PREDICTED: remorin-like                          94.7    2e-22   
ref|XP_008377346.1|  PREDICTED: remorin-like isoform X1               92.8    2e-22   
ref|XP_009590953.1|  PREDICTED: remorin-like                          96.3    3e-22   
gb|AII99828.1|  remorin 1                                             96.3    3e-22   
ref|XP_002878373.1|  hypothetical protein ARALYDRAFT_486603           92.4    3e-22   
ref|XP_011084412.1|  PREDICTED: remorin-like                          95.5    4e-22   
ref|NP_001234238.1|  remorin 2                                        90.1    4e-22   
gb|AFK39071.1|  unknown                                               92.8    4e-22   
gb|KFK35323.1|  hypothetical protein AALP_AA5G269500                  92.0    4e-22   
ref|XP_006292649.1|  hypothetical protein CARUB_v10018892mg           92.8    4e-22   
ref|XP_009340014.1|  PREDICTED: remorin-like                          91.7    4e-22   
ref|XP_009615469.1|  PREDICTED: remorin-like                          96.3    6e-22   
ref|XP_008377354.1|  PREDICTED: remorin-like isoform X2               92.8    8e-22   
ref|XP_002320784.1|  DNA-binding family protein                       96.3    9e-22   Populus trichocarpa [western balsam poplar]
dbj|BAJ88188.1|  predicted protein                                    99.8    1e-21   
gb|KFK37371.1|  hypothetical protein AALP_AA4G248100                  89.0    1e-21   
ref|XP_008376024.1|  PREDICTED: remorin-like                          92.8    1e-21   
ref|XP_010544719.1|  PREDICTED: remorin-like isoform X1               90.5    2e-21   
ref|NP_001274989.1|  remorin                                          93.6    2e-21   
ref|XP_010544720.1|  PREDICTED: remorin-like isoform X2               90.5    2e-21   
ref|XP_002267609.1|  PREDICTED: remorin                               94.4    2e-21   Vitis vinifera
ref|XP_004510806.1|  PREDICTED: remorin-like                          92.4    2e-21   
ref|XP_009757254.1|  PREDICTED: remorin-like                          93.2    2e-21   
gb|EYU35080.1|  hypothetical protein MIMGU_mgv1a0150192mg             93.6    2e-21   
ref|XP_010934733.1|  PREDICTED: remorin                               87.4    3e-21   
ref|XP_006404199.1|  hypothetical protein EUTSA_v10011156mg           90.1    3e-21   
ref|XP_004306803.1|  PREDICTED: uncharacterized protein At3g61260...  92.8    4e-21   
gb|KEH18895.1|  carboxy-terminal region remorin                       92.8    4e-21   
gb|AFK34355.1|  unknown                                               92.8    4e-21   
ref|XP_011035931.1|  PREDICTED: remorin                               94.0    4e-21   
ref|XP_007040179.1|  Remorin family protein                           91.3    4e-21   
ref|XP_008465865.1|  PREDICTED: remorin                               90.9    4e-21   
ref|NP_974824.1|  Remorin family protein                              93.2    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197764.1|  Remorin family protein                              93.2    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493498.1|  PREDICTED: remorin-like                          92.4    8e-21   
ref|XP_010055168.1|  PREDICTED: remorin-like                          90.1    9e-21   
ref|XP_006288585.1|  hypothetical protein CARUB_v10001880mg           92.4    9e-21   
gb|KHG21181.1|  Remorin                                               88.2    9e-21   
ref|XP_010519484.1|  PREDICTED: remorin-like isoform X1               90.1    1e-20   
ref|XP_010421184.1|  PREDICTED: remorin-like                          92.4    1e-20   
ref|XP_010107439.1|  hypothetical protein L484_015780                 91.3    1e-20   
ref|XP_007152285.1|  hypothetical protein PHAVU_004G116700g           91.3    1e-20   
ref|XP_009408139.1|  PREDICTED: remorin                               89.4    1e-20   
ref|XP_006827693.1|  hypothetical protein AMTR_s00009p00257810        93.2    1e-20   
ref|XP_003521134.1|  PREDICTED: remorin-like                          96.3    1e-20   
ref|XP_002302576.1|  DNA-binding family protein                       94.7    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010426396.1|  PREDICTED: remorin-like                          89.0    2e-20   
ref|XP_010412645.1|  PREDICTED: remorin-like                          88.6    2e-20   
ref|XP_010503539.1|  PREDICTED: remorin-like                          89.0    2e-20   
ref|XP_010454663.1|  PREDICTED: remorin-like                          91.3    2e-20   
gb|KDP22286.1|  hypothetical protein JCGZ_26117                       90.5    2e-20   
gb|AAM63910.1|  remorin                                               91.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71834.1|  BnaAnng38930D                                        89.4    2e-20   
ref|XP_006394639.1|  hypothetical protein EUTSA_v10004940mg           91.3    2e-20   
ref|XP_006358926.1|  PREDICTED: remorin-like                          91.7    3e-20   
ref|XP_009150904.1|  PREDICTED: remorin-like                          90.9    3e-20   
ref|XP_004165762.1|  PREDICTED: remorin-like                          89.7    3e-20   
ref|XP_010667563.1|  PREDICTED: remorin-like                          89.7    3e-20   
emb|CDY05883.1|  BnaC08g20600D                                        89.4    3e-20   
ref|XP_003623893.1|  Remorin                                          94.4    3e-20   
ref|XP_002874146.1|  hypothetical protein ARALYDRAFT_489237           90.1    4e-20   
ref|XP_004492710.1|  PREDICTED: uncharacterized protein At3g61260...  90.5    4e-20   
ref|XP_004148376.1|  PREDICTED: remorin-like                          89.4    5e-20   
gb|KHG20032.1|  Remorin                                               90.1    5e-20   
gb|ABK95953.1|  unknown                                               94.4    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010053688.1|  PREDICTED: remorin-like                          92.0    5e-20   
gb|KDO60014.1|  hypothetical protein CISIN_1g028549mg                 97.8    6e-20   
ref|XP_010550762.1|  PREDICTED: remorin-like isoform X1               91.7    6e-20   
ref|NP_001234231.1|  remorin 1                                        89.7    6e-20   
ref|XP_007218451.1|  hypothetical protein PRUPE_ppa011776mg           87.8    6e-20   
ref|XP_009149781.1|  PREDICTED: remorin                               87.4    6e-20   
ref|XP_010550763.1|  PREDICTED: remorin-like isoform X2               91.7    7e-20   
ref|XP_011076174.1|  PREDICTED: remorin-like                          90.5    7e-20   
emb|CDP08838.1|  unnamed protein product                              80.5    1e-19   
gb|AGR88905.1|  remorin 1                                             87.4    1e-19   
ref|XP_007038675.1|  Remorin family protein                           90.1    1e-19   
ref|XP_010273101.1|  PREDICTED: remorin-like                          88.6    1e-19   
ref|XP_008232793.1|  PREDICTED: remorin                               87.4    1e-19   
ref|XP_010908426.1|  PREDICTED: remorin-like isoform X1               95.9    2e-19   
ref|XP_011048712.1|  PREDICTED: remorin isoform X1                    87.0    3e-19   
ref|XP_011048713.1|  PREDICTED: remorin isoform X2                    86.7    3e-19   
ref|XP_011048714.1|  PREDICTED: remorin isoform X3                    86.7    3e-19   
ref|XP_002322467.1|  remorin family protein                           85.9    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010519485.1|  PREDICTED: remorin-like isoform X2               84.7    3e-19   
gb|AGB07445.1|  remorin                                               90.5    3e-19   
ref|XP_003618987.1|  Remorin                                          92.0    4e-19   
ref|NP_190463.1|  Remorin-like protein                                84.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236279.1|  uncharacterized protein LOC100305501             90.1    5e-19   
ref|XP_008806887.1|  PREDICTED: remorin                               83.2    6e-19   
emb|CDX80385.1|  BnaC07g30590D                                        86.3    6e-19   
ref|XP_008353990.1|  PREDICTED: remorin-like                          94.0    6e-19   
gb|KCW78048.1|  hypothetical protein EUGRSUZ_D02272                   91.7    7e-19   
emb|CDX87157.1|  BnaC09g04720D                                        85.1    8e-19   
ref|XP_009141722.1|  PREDICTED: remorin-like isoform X1               84.7    9e-19   
ref|XP_009141736.1|  PREDICTED: remorin-like isoform X2               84.7    1e-18   
ref|XP_009382381.1|  PREDICTED: remorin-like                          89.7    1e-18   
ref|XP_010035129.1|  PREDICTED: remorin-like isoform X1               89.4    1e-18   
emb|CDY69344.1|  BnaAnng30100D                                        84.7    1e-18   
ref|XP_004240737.1|  PREDICTED: remorin                               81.3    1e-18   
ref|XP_009766651.1|  PREDICTED: remorin-like                          87.8    2e-18   
emb|CDP05208.1|  unnamed protein product                              82.0    2e-18   
ref|XP_003556104.1|  PREDICTED: remorin-like                          89.7    4e-18   
gb|EYU25090.1|  hypothetical protein MIMGU_mgv1a014261mg              84.3    4e-18   
gb|EYU25089.1|  hypothetical protein MIMGU_mgv1a014261mg              84.3    5e-18   
gb|EEC74277.1|  hypothetical protein OsI_09516                        80.1    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010035131.1|  PREDICTED: remorin-like isoform X3               89.7    5e-18   
ref|XP_008794544.1|  PREDICTED: remorin-like                          92.4    5e-18   
ref|NP_001048576.1|  Os02g0824500                                     80.1    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143402.1|  hypothetical protein PHAVU_007G069500g           87.8    7e-18   
gb|EPS61469.1|  hypothetical protein M569_13328                       83.2    9e-18   
ref|XP_002877638.1|  remorin family protein                           82.0    9e-18   
ref|XP_003638357.1|  Remorin                                          85.9    1e-17   
ref|XP_006363315.1|  PREDICTED: remorin                               81.3    1e-17   
ref|NP_001274955.1|  putative remorin a3b4                            80.5    2e-17   
gb|AFN53683.1|  hypothetical protein                                  85.1    2e-17   
ref|NP_001275297.1|  putative remorin a4-e8                           80.1    3e-17   
ref|XP_009392263.1|  PREDICTED: remorin-like                          81.6    3e-17   
ref|XP_009770981.1|  PREDICTED: remorin-like                          78.6    4e-17   
emb|CDY06318.1|  BnaA09g48850D                                        78.2    4e-17   
ref|XP_002510796.1|  Remorin, putative                                80.1    4e-17   Ricinus communis
ref|XP_010061093.1|  PREDICTED: remorin-like isoform X3               78.6    5e-17   
ref|XP_010061098.1|  PREDICTED: remorin-like isoform X4               78.6    5e-17   
gb|KCW90710.1|  hypothetical protein EUGRSUZ_A02793                   78.6    5e-17   
ref|XP_010061078.1|  PREDICTED: remorin-like isoform X1               78.6    5e-17   
ref|XP_008376569.1|  PREDICTED: remorin-like                          89.7    5e-17   
ref|XP_010061086.1|  PREDICTED: remorin-like isoform X2               78.6    6e-17   
ref|XP_010676488.1|  PREDICTED: remorin                               76.6    6e-17   
ref|XP_011022731.1|  PREDICTED: remorin-like                          84.0    6e-17   
emb|CDY37068.1|  BnaA04g26460D                                        78.2    6e-17   
ref|XP_009142370.1|  PREDICTED: remorin                               78.2    7e-17   
gb|AFK41243.1|  unknown                                               84.3    7e-17   
ref|XP_003569966.1|  PREDICTED: remorin-like isoform X1               89.0    8e-17   
ref|XP_004986023.1|  PREDICTED: remorin-like                          76.6    9e-17   
ref|XP_004953259.1|  PREDICTED: remorin-like isoform X1               88.6    9e-17   
ref|XP_010235770.1|  PREDICTED: remorin-like isoform X2               88.2    1e-16   
emb|CDY27356.1|  BnaC04g50490D                                        76.6    1e-16   
ref|XP_006295053.1|  hypothetical protein CARUB_v10024121mg           76.6    2e-16   
gb|EPS69897.1|  hypothetical protein M569_04866                       80.5    2e-16   
ref|XP_004976344.1|  PREDICTED: remorin-like                          87.8    3e-16   
ref|XP_009383123.1|  PREDICTED: remorin-like                          75.5    3e-16   
ref|XP_002270914.1|  PREDICTED: uncharacterized protein At3g61260     87.4    3e-16   Vitis vinifera
gb|AFK45936.1|  unknown                                               82.0    3e-16   
ref|XP_002304484.1|  hypothetical protein POPTR_0003s12450g           81.6    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002465999.1|  hypothetical protein SORBIDRAFT_01g049810        74.7    3e-16   Sorghum bicolor [broomcorn]
ref|XP_010518225.1|  PREDICTED: remorin                               76.6    3e-16   
ref|NP_001048722.1|  Os03g0111200                                     76.3    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008439225.1|  PREDICTED: remorin-like                          77.4    4e-16   
ref|XP_006341797.1|  PREDICTED: remorin-like                          80.1    4e-16   
ref|XP_010508104.1|  PREDICTED: remorin-like                          76.3    4e-16   
emb|CAN75437.1|  hypothetical protein VITISV_000833                   87.0    4e-16   Vitis vinifera
ref|XP_010506561.1|  PREDICTED: remorin-like                          76.3    4e-16   
ref|XP_006649253.1|  PREDICTED: remorin-like                          76.3    4e-16   
ref|XP_009409422.1|  PREDICTED: remorin-like                          86.7    5e-16   
ref|XP_002882035.1|  hypothetical protein ARALYDRAFT_483720           73.6    6e-16   
ref|XP_006590251.1|  PREDICTED: uncharacterized protein LOC100305...  79.7    6e-16   
ref|XP_009627101.1|  PREDICTED: remorin-like                          82.4    7e-16   
ref|XP_006397772.1|  hypothetical protein EUTSA_v10001646mg           75.1    7e-16   
ref|NP_001235241.1|  uncharacterized protein LOC100305683             79.3    8e-16   
gb|EMS55630.1|  hypothetical protein TRIUR3_02968                     85.5    1e-15   
gb|EPS59685.1|  hypothetical protein M569_15119                       79.3    1e-15   
ref|NP_182106.1|  Remorin family protein                              73.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558995.1|  PREDICTED: remorin-like                          77.0    2e-15   
gb|KHN35009.1|  Remorin                                               79.7    2e-15   
gb|KHN25717.1|  Remorin                                               75.9    2e-15   
ref|XP_006573768.1|  PREDICTED: remorin-like isoform X2               75.9    3e-15   
ref|XP_003516694.1|  PREDICTED: remorin-like isoform X1               75.9    3e-15   
ref|XP_010089139.1|  Pollen-specific protein SF3                      79.0    3e-15   
ref|XP_004511589.1|  PREDICTED: remorin-like isoform X2               79.0    3e-15   
ref|XP_004511588.1|  PREDICTED: remorin-like isoform X1               78.6    3e-15   
ref|XP_006648879.1|  PREDICTED: uncharacterized protein At3g61260...  84.3    3e-15   
ref|XP_009143176.1|  PREDICTED: remorin-like                          72.4    4e-15   
gb|AAA57124.1|  DNA-binding protein                                   72.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371326.1|  PREDICTED: remorin-like                          83.6    7e-15   
gb|AFK42693.1|  unknown                                               77.8    7e-15   
ref|NP_001151703.1|  LOC100285339                                     70.1    1e-14   Zea mays [maize]
tpg|DAA42886.1|  TPA: remorin                                         70.1    1e-14   
ref|XP_009349347.1|  PREDICTED: remorin-like                          82.8    1e-14   
gb|EMS52426.1|  hypothetical protein TRIUR3_02712                     71.6    1e-14   
gb|EYU38364.1|  hypothetical protein MIMGU_mgv1a022944mg              79.3    2e-14   
gb|ABK23302.1|  unknown                                               80.9    2e-14   Picea sitchensis
ref|XP_004248633.1|  PREDICTED: remorin-like                          74.7    2e-14   
ref|NP_001047554.1|  Os02g0642200                                     82.0    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452858.1|  hypothetical protein SORBIDRAFT_04g033660        78.6    3e-14   Sorghum bicolor [broomcorn]
dbj|BAJ98923.1|  predicted protein                                    67.8    3e-14   
ref|XP_010908427.1|  PREDICTED: remorin-like isoform X2               81.3    3e-14   
gb|AFW72526.1|  hypothetical protein ZEAMMB73_338346                  78.2    3e-14   
ref|XP_007218390.1|  hypothetical protein PRUPE_ppa011367mg           74.3    4e-14   
ref|XP_010905109.1|  PREDICTED: remorin-like                          80.9    4e-14   
ref|XP_006404201.1|  hypothetical protein EUTSA_v10010917mg           78.2    5e-14   
ref|XP_009400595.1|  PREDICTED: remorin-like                          80.5    6e-14   
ref|XP_004954460.1|  PREDICTED: remorin-like                          67.0    6e-14   
ref|XP_003611121.1|  Remorin                                          75.5    8e-14   
ref|XP_010105965.1|  hypothetical protein L484_017313                 80.1    1e-13   
ref|XP_007158480.1|  hypothetical protein PHAVU_002G155800g           72.4    1e-13   
ref|XP_010061111.1|  PREDICTED: remorin-like                          71.2    2e-13   
ref|XP_008234255.1|  PREDICTED: remorin-like                          71.6    3e-13   
ref|XP_008238896.1|  PREDICTED: uncharacterized protein LOC103337510  73.9    3e-13   
ref|XP_007139893.1|  hypothetical protein PHAVU_008G067400g           78.6    3e-13   
ref|XP_008238894.1|  PREDICTED: remorin                               73.2    4e-13   
ref|XP_008794187.1|  PREDICTED: remorin-like isoform X2               78.2    4e-13   
ref|XP_008794186.1|  PREDICTED: remorin-like isoform X1               78.2    5e-13   
gb|KEH21043.1|  carboxy-terminal region remorin                       72.0    8e-13   
ref|XP_006649189.1|  PREDICTED: remorin-like                          66.2    8e-13   
gb|AEX20500.1|  symbiotic remorin 1                                   72.0    8e-13   
ref|XP_004170221.1|  PREDICTED: remorin-like                          75.5    1e-12   
ref|XP_004300775.1|  PREDICTED: uncharacterized protein At3g61260...  68.6    3e-12   
gb|AGG82489.1|  remorin 2                                             70.1    3e-12   
ref|XP_008643815.1|  PREDICTED: remorin isoform X1                    75.1    4e-12   
gb|KCW90714.1|  hypothetical protein EUGRSUZ_A02795                   73.9    5e-12   
ref|NP_001237267.1|  uncharacterized protein LOC100527523             67.8    5e-12   
ref|XP_006584533.1|  PREDICTED: uncharacterized protein LOC100527...  67.8    6e-12   
gb|EMT04985.1|  hypothetical protein F775_31239                       74.7    6e-12   
ref|XP_010255442.1|  PREDICTED: remorin-like                          74.3    6e-12   
gb|KCW46423.1|  hypothetical protein EUGRSUZ_K00253                   73.6    8e-12   
gb|KHN16839.1|  Remorin                                               67.4    8e-12   
emb|CAD29780.1|  putative remorin 1 protein                           53.1    1e-11   Oryza sativa [red rice]
gb|EPS60307.1|  hypothetical protein M569_14497                       73.6    1e-11   
ref|XP_010035132.1|  PREDICTED: remorin-like isoform X4               73.6    1e-11   
gb|AFK48724.1|  unknown                                               73.6    2e-11   
gb|AFK49332.1|  unknown                                               60.5    2e-11   
ref|XP_010061121.1|  PREDICTED: remorin-like                          73.2    2e-11   
gb|KCW46422.1|  hypothetical protein EUGRSUZ_K00253                   73.2    2e-11   
ref|XP_010035130.1|  PREDICTED: remorin-like isoform X2               73.2    2e-11   
ref|XP_004140777.1|  PREDICTED: remorin-like                          73.2    2e-11   
ref|XP_002318224.2|  remorin family protein                           72.8    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011072399.1|  PREDICTED: remorin                               72.0    3e-11   
gb|EYU19543.1|  hypothetical protein MIMGU_mgv1a014270mg              72.4    3e-11   
ref|NP_001276162.1|  remorin-like                                     64.7    4e-11   
ref|XP_004496578.1|  PREDICTED: remorin-like                          72.4    4e-11   
ref|XP_010236880.1|  PREDICTED: remorin                               62.0    6e-11   
emb|CDP09770.1|  unnamed protein product                              71.6    8e-11   
ref|XP_011030103.1|  PREDICTED: remorin-like isoform X2               71.2    1e-10   
emb|CDY18898.1|  BnaC04g04520D                                        70.9    1e-10   
ref|XP_011030102.1|  PREDICTED: remorin-like isoform X1               71.2    1e-10   
gb|KHG24102.1|  Remorin                                               62.0    1e-10   
ref|XP_009390477.1|  PREDICTED: remorin-like                          69.7    2e-10   
ref|XP_001753894.1|  predicted protein                                68.6    3e-10   
gb|AAX95710.1|  Remorin, C-terminal region, putative                  64.7    3e-10   
gb|EMS64123.1|  hypothetical protein TRIUR3_18094                     60.5    3e-10   
dbj|BAJ86538.1|  predicted protein                                    60.5    3e-10   
ref|XP_002509770.1|  Remorin, putative                                64.3    4e-10   
gb|ADK98520.1|  hypothetical protein                                  61.6    4e-10   
gb|KHN23661.1|  Remorin                                               67.8    4e-10   
ref|XP_009400417.1|  PREDICTED: remorin-like                          68.6    5e-10   
ref|XP_008238876.1|  PREDICTED: remorin-like                          64.7    7e-10   
ref|NP_001151679.1|  remorin                                          68.2    8e-10   
gb|KHN31817.1|  Remorin                                               67.8    1e-09   
ref|NP_001238396.1|  uncharacterized protein LOC100500457             67.8    1e-09   
ref|XP_002271460.1|  PREDICTED: remorin                               67.4    1e-09   
ref|NP_001176230.1|  Os10g0503800                                     65.1    1e-09   
ref|NP_001238565.1|  uncharacterized protein LOC100499700             67.8    1e-09   
gb|KDP25465.1|  hypothetical protein JCGZ_20621                       66.6    2e-09   
ref|XP_010055616.1|  PREDICTED: remorin-like                          63.9    2e-09   
ref|XP_007208846.1|  hypothetical protein PRUPE_ppa025568mg           62.4    3e-09   
ref|XP_001778856.1|  predicted protein                                63.5    3e-09   
ref|XP_010672021.1|  PREDICTED: uncharacterized protein At3g61260...  66.2    3e-09   
ref|XP_010672012.1|  PREDICTED: remorin-like isoform X1               66.6    3e-09   
ref|XP_002989677.1|  hypothetical protein SELMODRAFT_27771            63.5    5e-09   
ref|XP_009350653.1|  PREDICTED: remorin-like                          58.5    6e-09   
ref|XP_009369043.1|  PREDICTED: remorin-like                          58.5    7e-09   
ref|XP_008392620.1|  PREDICTED: remorin-like                          63.2    7e-09   
ref|XP_002464410.1|  hypothetical protein SORBIDRAFT_01g017740        53.1    7e-09   
ref|XP_001761208.1|  predicted protein                                62.0    9e-09   
gb|AGC39091.1|  remorin-5 protein                                     65.1    1e-08   
ref|XP_009375800.1|  PREDICTED: remorin-like                          62.8    1e-08   
ref|XP_010545839.1|  PREDICTED: remorin                               58.5    2e-08   
ref|XP_004308093.1|  PREDICTED: remorin-like isoform 2                64.3    2e-08   
ref|XP_008346635.1|  PREDICTED: remorin-like                          58.5    2e-08   
ref|XP_004308092.1|  PREDICTED: remorin-like isoform 1                63.9    2e-08   
ref|XP_008437238.1|  PREDICTED: uncharacterized protein At3g61260...  62.0    6e-08   
ref|XP_007211079.1|  hypothetical protein PRUPE_ppa016787mg           61.6    8e-08   
ref|XP_009375798.1|  PREDICTED: remorin-like                          61.6    8e-08   
gb|EMS51879.1|  hypothetical protein TRIUR3_21382                     49.7    9e-08   
ref|XP_006396263.1|  hypothetical protein EUTSA_v10029075mg           59.3    1e-07   
ref|XP_002298047.1|  hypothetical protein POPTR_0001s09090g           61.6    1e-07   
ref|XP_011029230.1|  PREDICTED: remorin                               61.6    1e-07   
ref|XP_008437237.1|  PREDICTED: remorin isoform X2                    61.6    1e-07   
ref|XP_008437236.1|  PREDICTED: remorin isoform X1                    61.6    1e-07   
ref|XP_009398011.1|  PREDICTED: remorin-like                          61.2    2e-07   
gb|EMT11441.1|  hypothetical protein F775_30732                       49.3    2e-07   
ref|XP_008392618.1|  PREDICTED: remorin-like                          60.1    2e-07   
gb|AAC13631.1|  F6N23.13 gene product                                 56.2    3e-07   
ref|XP_004159960.1|  PREDICTED: uncharacterized protein At3g61260...  60.1    3e-07   
ref|XP_006439558.1|  hypothetical protein CICLE_v10023664mg           59.7    3e-07   
ref|XP_010456255.1|  PREDICTED: remorin-like                          58.9    4e-07   
ref|XP_010419618.1|  PREDICTED: remorin-like                          58.9    5e-07   
ref|NP_191976.2|  Remorin family protein                              56.6    5e-07   
ref|XP_004143923.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.9    7e-07   
ref|XP_006476580.1|  PREDICTED: uncharacterized protein At3g61260...  59.3    7e-07   
ref|XP_006476581.1|  PREDICTED: uncharacterized protein At3g61260...  59.3    7e-07   
ref|XP_010544382.1|  PREDICTED: remorin                               58.2    7e-07   
ref|XP_006476579.1|  PREDICTED: uncharacterized protein At3g61260...  59.3    9e-07   
ref|XP_010427301.1|  PREDICTED: remorin-like                          57.4    1e-06   
ref|XP_009111464.1|  PREDICTED: uncharacterized protein At3g61260...  56.6    1e-06   
ref|XP_009111463.1|  PREDICTED: uncharacterized protein At3g61260...  56.6    1e-06   
gb|KDO76204.1|  hypothetical protein CISIN_1g025589mg                 59.3    1e-06   
emb|CDY51146.1|  BnaA09g51810D                                        54.3    3e-06   
ref|NP_001169511.1|  hypothetical protein                             48.5    3e-06   
ref|XP_008658860.1|  PREDICTED: hypothetical protein isoform X1       48.9    3e-06   
ref|XP_002969762.1|  hypothetical protein SELMODRAFT_92364            55.5    8e-06   
ref|XP_010053297.1|  PREDICTED: uncharacterized protein At3g61260...  55.8    9e-06   
emb|CDX91900.1|  BnaC03g32020D                                        55.5    9e-06   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                  56.2    9e-06   
emb|CDX74343.1|  BnaA03g27040D                                        55.1    1e-05   
ref|XP_010053296.1|  PREDICTED: remorin-like isoform X1               55.5    1e-05   
ref|XP_002465973.1|  hypothetical protein SORBIDRAFT_01g049190        47.0    1e-05   
ref|XP_001752001.1|  predicted protein                                55.1    1e-05   
ref|XP_006470902.1|  PREDICTED: uncharacterized protein LOC102618301  47.0    3e-05   
gb|KDO57809.1|  hypothetical protein CISIN_1g039197mg                 47.0    3e-05   
gb|KFK33431.1|  hypothetical protein AALP_AA5G012500                  48.9    3e-05   
ref|XP_009134540.1|  PREDICTED: uncharacterized protein At3g61260...  53.5    3e-05   
ref|XP_009389202.1|  PREDICTED: uncharacterized protein LOC103975...  43.9    3e-05   
gb|KFK30806.1|  hypothetical protein AALP_AA6G028300                  53.9    4e-05   
ref|XP_006420670.1|  hypothetical protein CICLE_v10004714mg           46.2    4e-05   
ref|XP_006420667.1|  hypothetical protein CICLE_v10004714mg           45.8    4e-05   
ref|XP_006420668.1|  hypothetical protein CICLE_v10004714mg           45.8    5e-05   
ref|XP_006420671.1|  hypothetical protein CICLE_v10004714mg           45.8    5e-05   
ref|XP_006420669.1|  hypothetical protein CICLE_v10004714mg           45.8    5e-05   
emb|CDY07204.1|  BnaCnng02190D                                        50.8    7e-05   
ref|XP_004297777.1|  PREDICTED: uncharacterized protein LOC101302745  45.8    7e-05   
ref|XP_009389201.1|  PREDICTED: uncharacterized protein LOC103975...  43.9    9e-05   
ref|XP_007222338.1|  hypothetical protein PRUPE_ppa004761mg           45.4    1e-04   
ref|XP_008220998.1|  PREDICTED: uncharacterized protein LOC103321...  45.1    1e-04   
ref|XP_008220997.1|  PREDICTED: uncharacterized protein LOC103321...  45.1    1e-04   
ref|XP_009787376.1|  PREDICTED: uncharacterized protein LOC104235338  48.9    1e-04   
ref|XP_006357732.1|  PREDICTED: chromatin assembly factor 1 subun...  48.1    2e-04   
gb|ADE77640.1|  unknown                                               46.6    4e-04   
ref|XP_003574160.1|  PREDICTED: remorin-like                          44.3    4e-04   
gb|ABR25395.1|  remorin                                               48.5    5e-04   
ref|XP_004244959.1|  PREDICTED: uncharacterized protein LOC101243914  48.5    6e-04   
gb|ACN34199.1|  unknown                                               41.2    7e-04   
ref|XP_008676611.1|  PREDICTED: uncharacterized protein LOC100193...  41.2    7e-04   
gb|ACN28131.1|  unknown                                               41.2    7e-04   
gb|AFW66772.1|  hypothetical protein ZEAMMB73_185665                  40.8    7e-04   
ref|NP_001132518.1|  uncharacterized protein LOC100193979             40.8    7e-04   
ref|XP_004982678.1|  PREDICTED: remorin-like                          40.0    9e-04   



>ref|XP_011091944.1| PREDICTED: remorin-like [Sesamum indicum]
Length=186

 Score =   107 bits (267),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK ALVHK+AEEKR+++ ++R E++LK EEMAAK+RATGQ PK
Sbjct  119   IEEQLEKKKAEYAEKMKNKVALVHKQAEEKRAMVEARRGEEILKAEEMAAKYRATGQAPK  178

Query  1209  KAFGCFG  1229
             KAFGC G
Sbjct  179   KAFGCLG  185


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKLADV +WEN+KKA++E++LKKIE
Sbjct  93   KAQKKLADVAAWENSKKASLESQLKKIE  120


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 12/56 (21%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  743
            D+ALAK+ED+KR+SFIKAWEESEK+KVEN+            +   L DV  W +S
Sbjct  64   DVALAKLEDEKRLSFIKAWEESEKTKVENK------------AQKKLADVAAWENS  107



>ref|XP_006652568.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=202

 Score =   103 bits (258),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A+VHKEAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  135   IEEQLEKKKAEYAEKMKNKVAIVHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  194

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  195   KLIGCFG  201


 Score = 45.1 bits (105),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ +LSWENTKKANIEA+LKKIE
Sbjct  109  KASKKLSAILSWENTKKANIEAELKKIE  136



>ref|NP_001053409.1| Os04g0533300 [Oryza sativa Japonica Group]
 emb|CAE04574.1| OSJNBb0039L24.13 [Oryza sativa Japonica Group]
 dbj|BAF15323.1| Os04g0533300 [Oryza sativa Japonica Group]
 gb|EAY94960.1| hypothetical protein OsI_16768 [Oryza sativa Indica Group]
 gb|EAZ31446.1| hypothetical protein OsJ_15583 [Oryza sativa Japonica Group]
 dbj|BAG96338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89383.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   103 bits (258),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A+VHKEAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  139   IEEQLEKKKAEYAEKMKNKVAIVHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  198

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  199   KLIGCFG  205


 Score = 45.4 bits (106),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ +LSWENTKKANIEA+LKKIE
Sbjct  113  KASKKLSAILSWENTKKANIEAQLKKIE  140



>ref|XP_002448229.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
 gb|EES12557.1| hypothetical protein SORBIDRAFT_06g023630 [Sorghum bicolor]
Length=212

 Score =   103 bits (258),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++HKEAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  145   IEEQLEKKKAEYAEKMKNKVAMIHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  204

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  205   KLIGCFG  211


 Score = 43.9 bits (102),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA+LKKIE
Sbjct  119  KAAKKVSAILSWENTKKANIEAQLKKIE  146



>ref|NP_001159012.1| remorin [Zea mays]
 gb|ACF88153.1| unknown [Zea mays]
 gb|ACG36146.1| remorin [Zea mays]
 tpg|DAA36691.1| TPA: Remorin isoform 1 [Zea mays]
 tpg|DAA36692.1| TPA: Remorin isoform 2 [Zea mays]
Length=199

 Score =   103 bits (257),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++HKEAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  132   IEEQLEKKKAEYAEKMKNKVAMIHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  191

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  192   KLIGCFG  198


 Score = 43.5 bits (101),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA+LKKIE
Sbjct  106  KAAKKVSAILSWENTKKANIEAELKKIE  133



>ref|NP_001147227.1| remorin [Zea mays]
 gb|ACG26230.1| remorin [Zea mays]
 gb|AFW58967.1| remorin [Zea mays]
Length=202

 Score =   103 bits (258),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++H+EAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  135   IEEQLEKKKAEYAEKMKNKVAMIHREAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  194

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  195   KPIGCFG  201


 Score = 42.7 bits (99),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA++KKIE
Sbjct  109  KATKKVSVILSWENTKKANIEAEMKKIE  136



>ref|XP_008661880.1| PREDICTED: remorin isoform X1 [Zea mays]
Length=200

 Score =   103 bits (257),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++H+EAEEKR+++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  133   IEEQLEKKKAEYAEKMKNKVAMIHREAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPK  192

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  193   KPIGCFG  199


 Score = 42.7 bits (99),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA++KKIE
Sbjct  107  KATKKVSVILSWENTKKANIEAEMKKIE  134



>ref|XP_002511833.1| Remorin, putative [Ricinus communis]
 gb|EEF50502.1| Remorin, putative [Ricinus communis]
Length=188

 Score =   105 bits (261),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK ALVHK+AEEKR+++ +QR E+VLK EEMAAK+RATGQ PK
Sbjct  123   IEEQLEKKKAEYAEKMKNKVALVHKQAEEKRAMVEAQRGEEVLKAEEMAAKYRATGQTPK  182

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  183   KLLGCF  188


 Score = 40.8 bits (94),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA +EAKL+KIE
Sbjct  97   KAQKKLSSVTAWENSKKAALEAKLRKIE  124



>gb|EMT30253.1| hypothetical protein F775_30825 [Aegilops tauschii]
Length=214

 Score =   100 bits (250),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++HKEAEEKR+++ +++ E++LK EEMAAK+RATG  PK
Sbjct  147   IEEQLEKKKAEYAEKMKNKAAMIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGHSPK  206

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  207   KVMGCFG  213


 Score = 44.3 bits (103),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA+LKKIE
Sbjct  121  KATKKVSAILSWENTKKANIEAQLKKIE  148



>ref|XP_003580217.1| PREDICTED: remorin-like [Brachypodium distachyon]
Length=207

 Score =   101 bits (252),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++HKEAEEK++++ ++R E+VLK EEMAAK+RATG  PK
Sbjct  140   IEEQLEKKKAEYAEKMKNKAAMIHKEAEEKKAMVEAKRGEEVLKAEEMAAKYRATGNSPK  199

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  200   KTMGCFG  206


 Score = 43.1 bits (100),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA+L+KIE
Sbjct  114  KAAKKVSAILSWENTKKANIEAQLRKIE  141



>dbj|BAJ90231.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score =   100 bits (248),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A++HKEAEEKR+++ +++ E++LK EEMAAK+RATG  PK
Sbjct  144   IEEQLEKKKAEYAEKMKNKAAMIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGNSPK  203

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  204   KVMGCFG  210


 Score = 43.9 bits (102),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ +LSWENTKKANIEA+LKKIE
Sbjct  118  KATKKVSAILSWENTKKANIEAQLKKIE  145



>ref|XP_009629650.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=153

 Score =   102 bits (254),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+E+LE+KKAEYAEKM N+ AL+HKEAEEK++++ ++R EQ+LKTEEMAAK+RATGQ PK
Sbjct  87    LEERLEQKKAEYAEKMKNRAALIHKEAEEKKAMVNAKRGEQILKTEEMAAKYRATGQTPK  146

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  147   KLLGCVG  153


 Score = 40.4 bits (93),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EAKLKK+E
Sbjct  61   KAQKKLSKVAAWENSKKAHLEAKLKKLE  88



>ref|XP_009779197.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=153

 Score =   102 bits (253),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+E+LE+KKAEYAEKM N+ AL+HKEAEEK++++ ++R EQ+LKTEEMAAK+RATGQ PK
Sbjct  87    LEERLEQKKAEYAEKMKNRAALIHKEAEEKKAMVEAKRGEQILKTEEMAAKYRATGQTPK  146

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  147   KLLGCVG  153


 Score = 40.4 bits (93),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EAKLKK+E
Sbjct  61   KAQKKLSKVAAWENSKKAHLEAKLKKLE  88



>ref|XP_008438060.1| PREDICTED: uncharacterized protein At3g61260 [Cucumis melo]
Length=183

 Score = 96.3 bits (238),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK AL+HKEAEEK++ + +QR+E++LK EE AAKFRATG +PK
Sbjct  118   IEEDLEKKKAEYGEKMKNKVALIHKEAEEKKATVEAQRSEELLKAEETAAKFRATGTIPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KFLGCF  183


 Score = 46.2 bits (108),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ VL+WEN+KKAN+EAKLKKIE
Sbjct  92   KAQKKLSSVLAWENSKKANLEAKLKKIE  119



>gb|KHG12669.1| Remorin [Gossypium arboreum]
Length=190

 Score =   101 bits (252),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK AL+HKEAEEKR+++ +++ E+VLK EEMAAK+RATGQ PK
Sbjct  125   IEEQLEKKKAEYAEKMKNKVALLHKEAEEKRAMVEAKQGEEVLKAEEMAAKYRATGQTPK  184

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  185   KVLGCF  190


 Score = 40.8 bits (94),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKKL+ +++WEN+KKA++EAKLKKIE
Sbjct  99   KSQKKLSAIVAWENSKKASLEAKLKKIE  126


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 12/56 (21%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  743
            DIALA++E  KR+SFIKAWEESEK+K EN+            S   L  ++ W +S
Sbjct  70   DIALAEVEKAKRLSFIKAWEESEKTKAENK------------SQKKLSAIVAWENS  113



>gb|EYU32085.1| hypothetical protein MIMGU_mgv1a014760mg [Erythranthe guttata]
Length=179

 Score =   102 bits (255),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQ+EKKKAEYAEKM NK AL+HK+AEEKR+++ ++R E +LK EE+AAK+R TGQVPK
Sbjct  113   IEEQVEKKKAEYAEKMKNKIALIHKQAEEKRAMVEAKRGEDLLKAEELAAKYRVTGQVPK  172

Query  1209  KAFGCFG  1229
             KAFGC G
Sbjct  173   KAFGCLG  179


 Score = 39.3 bits (90),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL++V +WEN+KKA++E+ LKKIE
Sbjct  87   KAQKKLSEVSAWENSKKASLESDLKKIE  114


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  579  IALAKIEDDKRVSFIKAWEESEKSKVENR  665
            +A AK+EDDKR+SF+KAWEESEK+KVEN+
Sbjct  59   VAFAKLEDDKRLSFVKAWEESEKTKVENK  87



>ref|XP_007051855.1| Remorin family protein [Theobroma cacao]
 gb|EOX96012.1| Remorin family protein [Theobroma cacao]
Length=192

 Score =   100 bits (250),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE M NK AL+HKEAEEKR+++ ++R E+VLK EEMAAK+RATGQ PK
Sbjct  127   IEEQLEKKKAEYAENMKNKVALLHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGQTPK  186

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  187   KLLGCF  192


 Score = 40.8 bits (94),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ +++WEN+KKA +EAKL+KIE
Sbjct  101  KAQKKLSSIVAWENSKKAALEAKLRKIE  128



>ref|XP_010523734.1| PREDICTED: uncharacterized protein At3g61260 [Tarenaya hassleriana]
Length=201

 Score = 97.4 bits (241),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A +HKEAEEKR+++ ++R E++LK EEMAAK+RATG VPK
Sbjct  136   IEEQLEKKKAEYAEKMKNKVAAIHKEAEEKRAMVEAKRGEEILKAEEMAAKYRATGNVPK  195

Query  1209  KAFGCF  1226
                GCF
Sbjct  196   ATCGCF  201


 Score = 43.9 bits (102),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQKK +DVL+WEN+KKA IEA+LKKIE
Sbjct  109  NKAQKKTSDVLAWENSKKAAIEAELKKIE  137



>ref|NP_001235181.1| uncharacterized protein LOC100305679 [Glycine max]
 gb|ACU13488.1| unknown [Glycine max]
 gb|KHM99397.1| Remorin [Glycine soja]
Length=183

 Score =   103 bits (256),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLEKKKAEY EKM NK ALVHKEAEEKR++I ++R E++L+TEEMAAK+RATG  PK
Sbjct  118   LEEQLEKKKAEYGEKMKNKVALVHKEAEEKRAMIEAKRGEEILQTEEMAAKYRATGTTPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KTIGCF  183


 Score = 37.7 bits (86),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RAQK L+ + +WEN+KKA +EA+LKK+E
Sbjct  92   RAQKHLSAIAAWENSKKAALEAELKKLE  119



>ref|XP_004133871.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 ref|XP_004155821.1| PREDICTED: uncharacterized protein At3g61260-like [Cucumis sativus]
 gb|KGN56525.1| hypothetical protein Csa_3G122490 [Cucumis sativus]
Length=183

 Score = 94.7 bits (234),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK  L+HKEAEEK++ + +QR+E++LK EE AAKFRATG +PK
Sbjct  118   IEEDLEKKKAEYGEKMKNKVVLIHKEAEEKKATVEAQRSEELLKAEETAAKFRATGTIPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KFLGCF  183


 Score = 46.2 bits (108),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ VL+WEN+KKAN+EAKLKKIE
Sbjct  92   KAQKKLSSVLAWENSKKANLEAKLKKIE  119



>ref|XP_006445087.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 ref|XP_006491065.1| PREDICTED: remorin-like isoform X1 [Citrus sinensis]
 gb|ESR58327.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 gb|KDO86096.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=205

 Score = 99.0 bits (245),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE+KKAEYAEKM NK ALVHKEAEEKR+++ ++R E VLK EE+AAK+RATG  PK
Sbjct  140   IEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPK  199

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  200   KLLGCF  205


 Score = 41.2 bits (95),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EAKLKKIE
Sbjct  114  KAQKKLSAVAAWENSKKASLEAKLKKIE  141



>ref|XP_006445086.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 ref|XP_006491066.1| PREDICTED: remorin-like isoform X2 [Citrus sinensis]
 gb|ESR58326.1| hypothetical protein CICLE_v10022286mg [Citrus clementina]
 gb|KDO86095.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=183

 Score = 99.0 bits (245),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE+KKAEYAEKM NK ALVHKEAEEKR+++ ++R E VLK EE+AAK+RATG  PK
Sbjct  118   IEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KLLGCF  183


 Score = 41.2 bits (95),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQKKL+ V +WEN+KKA++EAKLKKIE
Sbjct  91   NKAQKKLSAVAAWENSKKASLEAKLKKIE  119



>gb|KDO86097.1| hypothetical protein CISIN_1g028704mg [Citrus sinensis]
Length=167

 Score = 98.2 bits (243),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE+KKAEYAEKM NK ALVHKEAEEKR+++ ++R E VLK EE+AAK+RATG  PK
Sbjct  102   IEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPK  161

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  162   KLLGCF  167


 Score = 41.6 bits (96),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EAKLKKIE
Sbjct  76   KAQKKLSAVAAWENSKKASLEAKLKKIE  103



>gb|KHN29375.1| Remorin [Glycine soja]
Length=183

 Score = 99.4 bits (246),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE+ E+M NK ALVHKEAEEKR++I + R E+VLKTEEMAAK+RATG  PK
Sbjct  118   IEEQLEKKKAEHGERMKNKVALVHKEAEEKRAMIEANRCEEVLKTEEMAAKYRATGTTPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KTIGCF  183


 Score = 40.0 bits (92),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RAQK+L+ + +WEN+KKA +EA+LKKIE
Sbjct  92   RAQKQLSAIAAWENSKKATLEAELKKIE  119



>ref|XP_009587316.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
 gb|AII99827.1| remorin 2 [Nicotiana tabacum]
Length=174

 Score = 94.0 bits (232),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLE+KKAEYAEK+ N+ A VHKEA+EKR+++ +++ E++LK +EMAAK+RATGQ PK
Sbjct  107   LEEQLEEKKAEYAEKIKNRVASVHKEADEKRAMVEARKGEELLKADEMAAKYRATGQAPK  166

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  167   KLLGCLG  173


 Score = 45.1 bits (105),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RAQKKL+ V +WENTKKAN+EAKLKK+E
Sbjct  81   RAQKKLSAVGTWENTKKANLEAKLKKLE  108


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR  665
            DIALA +E +KR S+IKAWEESEKSKVENR
Sbjct  52   DIALAHLETEKRNSYIKAWEESEKSKVENR  81



>gb|KDP28652.1| hypothetical protein JCGZ_14423 [Jatropha curcas]
Length=194

 Score =   103 bits (256),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK ALVHK+AEEKR+++ +QR E++LK EEMAAK+RATGQ P+
Sbjct  129   IEEQLEKKKAEYAEKMKNKIALVHKQAEEKRAIVEAQRGEEMLKAEEMAAKYRATGQTPR  188

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  189   KLLGCF  194


 Score = 35.8 bits (81),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK + V +WEN+KKA +EAKL+KIE
Sbjct  103  KAQKKKSAVEAWENSKKAALEAKLRKIE  130



>ref|XP_009116785.1| PREDICTED: uncharacterized protein At3g61260 [Brassica rapa]
Length=194

 Score = 96.3 bits (238),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE KKAEYAEKM NK A +HKEAEE+R++I ++R E VLK EEMAAKFRATG VPK
Sbjct  129   IEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEEMAAKFRATGIVPK  188

Query  1209  KAFGCF  1226
                GCF
Sbjct  189   ATCGCF  194


 Score = 42.7 bits (99),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KK++D+L+WEN+KKA +EA+LKKIE
Sbjct  103  KAEKKISDILAWENSKKAAVEAQLKKIE  130



>gb|KDO60012.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=207

 Score = 97.8 bits (242),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  140   IEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPK  199

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  200   KLLSCFG  206


 Score = 41.2 bits (95),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKL+ ++SWEN++KA +EA+LKKIE
Sbjct  114  RAHKKLSSIVSWENSRKAAVEAELKKIE  141



>emb|CDY48933.1| BnaA09g39040D [Brassica napus]
Length=194

 Score = 96.3 bits (238),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE KKAEYAEKM NK A +HKEAEE+R++I ++R E VLK EEMAAKFRATG VPK
Sbjct  129   IEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEEMAAKFRATGIVPK  188

Query  1209  KAFGCF  1226
                GCF
Sbjct  189   ATCGCF  194


 Score = 42.4 bits (98),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KK++D+L+WEN+KKA +EA+LKKIE
Sbjct  103  KAEKKISDILAWENSKKAAVEAQLKKIE  130



>emb|CDX71754.1| BnaC08g31200D [Brassica napus]
Length=180

 Score = 96.3 bits (238),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE KKAEYAEKM NK A +HKEAEE+R++I ++R E VLK EEMAAKFRATG VPK
Sbjct  115   IEEQLENKKAEYAEKMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEEMAAKFRATGIVPK  174

Query  1209  KAFGCF  1226
                GCF
Sbjct  175   ATCGCF  180


 Score = 42.4 bits (98),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KK++D+L+WEN+KKA +EA+LKKIE
Sbjct  89   KAEKKISDILAWENSKKAAVEAQLKKIE  116



>ref|XP_006490378.1| PREDICTED: remorin-like [Citrus sinensis]
Length=207

 Score = 97.8 bits (242),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  140   IEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPK  199

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  200   KLLSCFG  206


 Score = 39.3 bits (90),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ ++SWEN++KA +EA+LKKIE
Sbjct  114  KAHKKLSSIVSWENSRKAAVEAELKKIE  141



>ref|XP_006421909.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|ESR35149.1| hypothetical protein CICLE_v10005899mg [Citrus clementina]
 gb|KDO60013.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=206

 Score = 97.8 bits (242),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  139   IEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPK  198

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  199   KLLSCFG  205


 Score = 39.3 bits (90),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ ++SWEN++KA +EA+LKKIE
Sbjct  113  KAHKKLSSIVSWENSRKAAVEAELKKIE  140



>ref|XP_006402501.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
 gb|ESQ43954.1| hypothetical protein EUTSA_v10006246mg [Eutrema salsugineum]
Length=197

 Score = 93.6 bits (231),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  132   IEEQLEKKKAEYAEKMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  191

Query  1209  KAFGCF  1226
                GCF
Sbjct  192   ATCGCF  197


 Score = 43.1 bits (100),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  106  KAEKKISDVLAWENSKKAAVEAQLKKIE  133



>ref|XP_006291850.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
 gb|EOA24748.1| hypothetical protein CARUB_v10018025mg [Capsella rubella]
Length=208

 Score = 93.2 bits (230),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R+++ ++R E +LK EE AAK+RATG VPK
Sbjct  143   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRALVEAKRGEDILKAEETAAKYRATGTVPK  202

Query  1209  KAFGCF  1226
                GCF
Sbjct  203   ATCGCF  208


 Score = 43.5 bits (101),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  116  NKAEKKISDVLAWENSKKAAVEAQLKKIE  144



>ref|XP_010413437.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=223

 Score = 92.8 bits (229),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  158   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  217

Query  1209  KAFGCF  1226
                GCF
Sbjct  218   ATCGCF  223


 Score = 43.5 bits (101),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  131  NKAEKKISDVLAWENSKKAAVEAQLKKIE  159



>ref|XP_010512460.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=216

 Score = 92.8 bits (229),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  151   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  210

Query  1209  KAFGCF  1226
                GCF
Sbjct  211   ATCGCF  216


 Score = 43.1 bits (100),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  124  NKAEKKISDVLAWENSKKAAVEAQLKKIE  152



>ref|XP_009794056.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=176

 Score = 92.0 bits (227),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQL++KKAEYAEK+ N+ A VHKEA+EKR+++ +++ E++LK +EMAAK+RATGQ PK
Sbjct  109   LEEQLKEKKAEYAEKIKNRVAAVHKEADEKRAMVEARKGEELLKADEMAAKYRATGQAPK  168

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  169   KLLGCLG  175


 Score = 43.9 bits (102),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RAQKK + V +WENTKKAN+EAKLKK+E
Sbjct  83   RAQKKFSAVGTWENTKKANLEAKLKKLE  110


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR  665
            DIALA +E +KR S+IKAWEESEKSKVENR
Sbjct  54   DIALAHLETEKRNSYIKAWEESEKSKVENR  83



>ref|XP_009778199.1| PREDICTED: remorin-like isoform X1 [Nicotiana sylvestris]
Length=207

 Score = 96.7 bits (239),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  142   MEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  201

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  202   KLLGCF  207


 Score = 39.3 bits (90),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+EA+LKK+E
Sbjct  116  KAQKKVSAIAAWENSKKANLEAELKKME  143



>ref|XP_003528866.1| PREDICTED: remorin-like [Glycine max]
Length=198

 Score = 98.6 bits (244),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK ALVHK+AEEKR+++ ++R E++LK EE+AAK RATG  PK
Sbjct  133   IEEQLEKKKAEYGEKMKNKIALVHKQAEEKRAMVEAKRGEEILKAEEIAAKHRATGTSPK  192

Query  1209  KAFGCF  1226
             KAFGCF
Sbjct  193   KAFGCF  198


 Score = 37.4 bits (85),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQK+L+ V +WEN+KKA +EA+L+KIE
Sbjct  107  KAQKQLSAVAAWENSKKAALEAQLRKIE  134



>ref|XP_010469049.1| PREDICTED: uncharacterized protein At3g61260-like [Camelina sativa]
Length=213

 Score = 92.4 bits (228),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  148   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  207

Query  1209  KAFGCF  1226
                GCF
Sbjct  208   ATCGCF  213


 Score = 43.1 bits (100),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  121  NKAEKKISDVLAWENSKKAAVEAQLKKIE  149



>ref|XP_009778200.1| PREDICTED: remorin-like isoform X2 [Nicotiana sylvestris]
Length=204

 Score = 96.7 bits (239),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  139   MEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  198

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  199   KLLGCF  204


 Score = 39.3 bits (90),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+EA+LKK+E
Sbjct  113  KAQKKVSAIAAWENSKKANLEAELKKME  140



>ref|XP_004240109.1| PREDICTED: remorin [Solanum lycopersicum]
Length=153

 Score = 95.9 bits (237),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+ +LE+KKAEYAEK+ NK AL+HKEAEEK++++ ++R EQ+LKTE+MAAK+RATGQ PK
Sbjct  87    LEVRLEQKKAEYAEKLKNKEALIHKEAEEKKAMVEAKRGEQILKTEDMAAKYRATGQNPK  146

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  147   KLLGCVG  153


 Score = 39.7 bits (91),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIEV  951
            +AQKKL+ V +WEN KKA+++AKLKK+EV
Sbjct  61   KAQKKLSKVAAWENKKKAHLDAKLKKLEV  89



>ref|XP_006345628.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=146

 Score = 97.1 bits (240),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+ +LE+KKAEYAEKM NK ALVHKEAEEK++ + ++R EQ+L+TEEMAAK+RATGQ PK
Sbjct  80    LEVRLEQKKAEYAEKMKNKEALVHKEAEEKKATVEAKRGEQILRTEEMAAKYRATGQNPK  139

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  140   KLLGCVG  146


 Score = 38.5 bits (88),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIEV  951
            +AQKKL+ V +WEN +KA+++AKLKK+EV
Sbjct  54   KAQKKLSKVAAWENKQKAHLDAKLKKLEV  82



>ref|XP_011023368.1| PREDICTED: remorin-like [Populus euphratica]
Length=196

 Score = 96.7 bits (239),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEYAEKM NK AL+HKEAEEK++++ ++R E+VLK  E AAK+RATGQ PK
Sbjct  131   IEEKLEKQKAEYAEKMKNKIALIHKEAEEKKAIVEAKRGEEVLKAGEAAAKYRATGQTPK  190

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  191   KLFGCF  196


 Score = 38.5 bits (88),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKKL+ V +WEN+KKA +EAKL+KIE
Sbjct  105  KSQKKLSAVAAWENSKKAALEAKLRKIE  132



>gb|AEK94319.1| remorin [Pyrus x bretschneideri]
Length=198

 Score = 95.5 bits (236),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++EQLEKKKA+YAEKM NK AL+HK+A+EKR+++++Q+ E++LK +E AAK+RAT
Sbjct  128   AKLRSIEEQLEKKKAQYAEKMQNKVALLHKQADEKRAMVLAQKGEELLKADETAAKYRAT  187

Query  1194  GQVPKKAFGCF  1226
             G +PKK  GCF
Sbjct  188   GSIPKKFLGCF  198


 Score = 39.7 bits (91),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+DV +WE+++KA +EAKL+ IE
Sbjct  107  KAQKKLSDVTAWESSRKAAVEAKLRSIE  134



>ref|XP_008336972.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
 ref|XP_008362621.1| PREDICTED: LOW QUALITY PROTEIN: remorin-like [Malus domestica]
Length=240

 Score = 94.7 bits (234),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA+YAEKM NK AL+HK+A+EKR+++++Q+ E++LK +E AAK+RATG +PK
Sbjct  133   IEEQLEKKKAQYAEKMQNKVALLHKQADEKRAMVLAQKGEELLKADETAAKYRATGSIPK  192

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  193   KFLGCF  198


 Score = 40.0 bits (92),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+DV +WE+++KA +EAKL+ IE
Sbjct  107  KAQKKLSDVTAWESSRKAAVEAKLRSIE  134



>ref|XP_010473801.1| PREDICTED: uncharacterized protein At3g61260, partial [Camelina 
sativa]
Length=114

 Score = 92.0 bits (227),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  49    IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  108

Query  1209  KAFGCF  1226
                GCF
Sbjct  109   ATCGCF  114


 Score = 42.7 bits (99),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KK++DVL+WEN+KKA +EA+LKKIE
Sbjct  23   KAEKKISDVLAWENSKKAAVEAQLKKIE  50



>ref|XP_006339544.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=174

 Score = 91.3 bits (225),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLE+KKAEYAEK+ N+ A VH EAEEKR+++ ++R E++LK EEMAAK+RATGQ PK
Sbjct  108   LEEQLEQKKAEYAEKIKNRVAAVHMEAEEKRAMVEARRGEELLKAEEMAAKYRATGQAPK  167

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  168   K-IGCLG  173


 Score = 43.5 bits (101),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ V +WENTKKANIEAKLKK+E
Sbjct  82   KAEKKLSSVGTWENTKKANIEAKLKKLE  109



>ref|XP_007135038.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
 gb|AGV54511.1| remorin family protein [Phaseolus vulgaris]
 gb|ESW07032.1| hypothetical protein PHAVU_010G096300g [Phaseolus vulgaris]
Length=198

 Score = 97.8 bits (242),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK ALVHK+AEEKR+ + ++R E++L  EE AAK+RATG  PK
Sbjct  133   IEEQLEKKKAEYGEKMKNKIALVHKQAEEKRATVEAKRGEEILNAEESAAKYRATGTTPK  192

Query  1209  KAFGCF  1226
             KAFGCF
Sbjct  193   KAFGCF  198


 Score = 37.0 bits (84),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQK L+ V +WEN+KKA +EA+L+KIE
Sbjct  107  KAQKHLSAVAAWENSKKAALEAQLRKIE  134



>ref|NP_191685.1| remorin family protein [Arabidopsis thaliana]
 sp|Q9M2D8.1|Y3126_ARATH RecName: Full=Uncharacterized protein At3g61260 [Arabidopsis 
thaliana]
 gb|AAK44161.1|AF370346_1 putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB71056.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAL34151.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM65607.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE80180.1| remorin family protein [Arabidopsis thaliana]
Length=212

 Score = 92.8 bits (229),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E VLK EE AAK+RATG VPK
Sbjct  147   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEETAAKYRATGIVPK  206

Query  1209  KAFGCF  1226
                GCF
Sbjct  207   ATCGCF  212


 Score = 42.0 bits (97),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK+ADV +WEN+KKA +EA+LKKIE
Sbjct  120  NKAEKKIADVHAWENSKKAAVEAQLKKIE  148



>ref|XP_003534573.1| PREDICTED: remorin-like [Glycine max]
Length=183

 Score = 94.7 bits (234),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE+ E+M NK ALVHKEA EKR++I + R E+VLKTEE+AAK+RATG  PK
Sbjct  118   IEEQLEKKKAEHGERMKNKVALVHKEAGEKRAMIEANRCEEVLKTEEVAAKYRATGTTPK  177

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  178   KTIGCF  183


 Score = 40.0 bits (92),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RAQK+L+ + +WEN+KKA +EA+LKKIE
Sbjct  92   RAQKQLSAIAAWENSKKATLEAELKKIE  119



>ref|XP_008377346.1| PREDICTED: remorin-like isoform X1 [Malus domestica]
Length=229

 Score = 92.8 bits (229),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK AL+HK AEEKR+VI ++R E +LK EE AAK+RATG  PK
Sbjct  162   IEEQLEKKKAEYVEQMKNKIALIHKAAEEKRAVIEAKRGEDLLKAEETAAKYRATGYAPK  221

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  222   KLLGCF  227


 Score = 41.6 bits (96),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKL+ + SWENTKKA +EA+LKKIE
Sbjct  136  RAHKKLSAIGSWENTKKATVEAELKKIE  163



>ref|XP_009590953.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=205

 Score = 96.3 bits (238),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  140   MEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  199

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  200   KLLGCF  205


 Score = 38.1 bits (87),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+EA+LKK+E
Sbjct  114  KAQKKVSAIGAWENSKKANLEAELKKME  141



>gb|AII99828.1| remorin 1 [Nicotiana tabacum]
Length=205

 Score = 96.3 bits (238),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  140   MEEQLEKKKAEYIEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  199

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  200   KLLGCF  205


 Score = 38.1 bits (87),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+EA+LKK+E
Sbjct  114  KAQKKVSAIGAWENSKKANLEAELKKME  141



>ref|XP_002878373.1| hypothetical protein ARALYDRAFT_486603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54632.1| hypothetical protein ARALYDRAFT_486603 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score = 92.4 bits (228),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAE+M NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  149   IEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  208

Query  1209  KAFGCF  1226
                GCF
Sbjct  209   ATCGCF  214


 Score = 41.6 bits (96),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK+ADV +WEN+KKA +EA+LKKIE
Sbjct  122  NKAEKKIADVHAWENSKKAAVEAQLKKIE  150



>ref|XP_011084412.1| PREDICTED: remorin-like [Sesamum indicum]
Length=192

 Score = 95.5 bits (236),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK ALVHK AEEKR++I ++R E +LK EEMAAK+RATG  PK
Sbjct  127   IEEQLEKKKAEYIEKMKNKVALVHKAAEEKRAMIEAKRGEDLLKAEEMAAKYRATGTGPK  186

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  187   KLLGCF  192


 Score = 38.5 bits (88),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKA++EA+LKKIE
Sbjct  101  KAQKKISAIAAWENSKKASLEAELKKIE  128



>ref|NP_001234238.1| remorin 2 [Solanum lycopersicum]
 gb|AAD28507.2|AF123266_1 remorin 2 [Solanum lycopersicum]
Length=174

 Score = 90.1 bits (222),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLE+KKAEYAEK+ NK A VH EAEEKR+++ ++R E++LK EE+AAK+RATGQ PK
Sbjct  108   LEEQLEQKKAEYAEKIKNKVAAVHMEAEEKRAMVEARRGEELLKAEEIAAKYRATGQAPK  167

Query  1209  KAFGCFG  1229
             K  GC G
Sbjct  168   K-IGCLG  173


 Score = 43.5 bits (101),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ V +WENTKKANIEAKLKK+E
Sbjct  82   KAEKKLSSVGTWENTKKANIEAKLKKLE  109



>gb|AFK39071.1| unknown [Lotus japonicus]
Length=187

 Score = 92.8 bits (229),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEKKKAEY EKM NK ALVHKEAEE+R++I ++R E +LK EE+AAKFRATG  PK
Sbjct  121   IEERLEKKKAEYGEKMKNKIALVHKEAEERRAMIEAKRGEDLLKAEELAAKFRATGTTPK  180

Query  1209  KA-FGCF  1226
             K   GCF
Sbjct  181   KPVLGCF  187


 Score = 41.2 bits (95),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQK L+DV++WEN+KKA +EA+L+KIE
Sbjct  95   KAQKNLSDVVAWENSKKAALEAQLRKIE  122


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 12/56 (21%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILWFSS  743
            D+ALA++E +KR+S++KAWEESEKSK EN+            +  NL DV+ W +S
Sbjct  66   DVALAELEKEKRLSYVKAWEESEKSKTENK------------AQKNLSDVVAWENS  109



>gb|KFK35323.1| hypothetical protein AALP_AA5G269500 [Arabis alpina]
Length=196

 Score = 92.0 bits (227),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKK EYAEKM NK A +HKEAEE+R++I ++R E +LK EE AAK+RATG VPK
Sbjct  131   IEEQLEKKKGEYAEKMKNKVAAIHKEAEERRAMIEAKRGEDILKAEETAAKYRATGIVPK  190

Query  1209  KAFGCF  1226
                GCF
Sbjct  191   ATCGCF  196


 Score = 42.0 bits (97),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A+KK +DV +WEN+KKAN+EA+L+KIE
Sbjct  104  NKAEKKTSDVHAWENSKKANVEAQLRKIE  132



>ref|XP_006292649.1| hypothetical protein CARUB_v10018892mg [Capsella rubella]
 gb|EOA25547.1| hypothetical protein CARUB_v10018892mg [Capsella rubella]
Length=168

 Score = 92.8 bits (229),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAEKM NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  103   IEEQLIKKKAEYAEKMKNKIAQIHKEAEEKRAMAEAKRGEDVLKAEEMAAKYRATGTAPT  162

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  163   KLFGCF  168


 Score = 41.2 bits (95),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA+IEA+LKKIE
Sbjct  77   KAQKKLSSVGAWENSKKASIEAELKKIE  104



>ref|XP_009340014.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=211

 Score = 91.7 bits (226),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK AL+HK AEEKR+ I ++R E +LK EE AAK+RATG  PK
Sbjct  144   IEEQLEKKKAEYVEQMKNKIALIHKAAEEKRATIEAKRGEDLLKAEETAAKYRATGYAPK  203

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  204   KLLGCFS  210


 Score = 42.4 bits (98),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWENTKKAN+EA+LKKIE
Sbjct  118  KAHKKLSAIGSWENTKKANVEAELKKIE  145



>ref|XP_009615469.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=201

 Score = 96.3 bits (238),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    L+EQLE KKAEYAEK+ NK AL+HKEA EKR+++ ++R +++LK EEMAAK+RAT
Sbjct  131   AKPKKLEEQLEHKKAEYAEKIKNKVALIHKEANEKRAMVDARRGKEILKAEEMAAKYRAT  190

Query  1194  GQVPKKAFGCF  1226
             GQ PKK  GCF
Sbjct  191   GQTPKKFLGCF  201


 Score = 37.0 bits (84),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V  WENT+KA +EAK KK+E
Sbjct  110  KAQKKLSAVARWENTRKAKLEAKPKKLE  137



>ref|XP_008377354.1| PREDICTED: remorin-like isoform X2 [Malus domestica]
Length=211

 Score = 92.8 bits (229),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK AL+HK AEEKR+VI ++R E +LK EE AAK+RATG  PK
Sbjct  144   IEEQLEKKKAEYVEQMKNKIALIHKAAEEKRAVIEAKRGEDLLKAEETAAKYRATGYAPK  203

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  204   KLLGCF  209


 Score = 40.0 bits (92),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWENTKKA +EA+LKKIE
Sbjct  118  KAHKKLSAIGSWENTKKATVEAELKKIE  145



>ref|XP_002320784.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE99099.1| DNA-binding family protein [Populus trichocarpa]
Length=193

 Score = 96.3 bits (238),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++E+LEK+KAEYAEKM NK AL+HK+AEE+R+++ ++R E+ LK EEMAAK+RAT
Sbjct  123   ATLRKMEEKLEKQKAEYAEKMKNKVALIHKDAEEQRAMVEAKRGEEFLKAEEMAAKYRAT  182

Query  1194  GQVPKKAFGCF  1226
             GQ PKK  GCF
Sbjct  183   GQTPKKLLGCF  193


 Score = 36.6 bits (83),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKKL+ V++WEN+KKA +EA L+K+E
Sbjct  102  KSQKKLSAVVAWENSKKAALEATLRKME  129



>dbj|BAJ88188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=86

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  1026  YLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVP  1205
             + QEQLEKKKAEYAEKM NK A++HKEAEEKR+++ +++ E++LK EEMAAK+RATG  P
Sbjct  18    HFQEQLEKKKAEYAEKMKNKAAMIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGNSP  77

Query  1206  KKAFGCFG  1229
             KK  GCFG
Sbjct  78    KKVMGCFG  85



>gb|KFK37371.1| hypothetical protein AALP_AA4G248100 [Arabis alpina]
Length=200

 Score = 89.0 bits (219),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LE+KKAEY EKM NK A +HK+AEEKR+++ ++R E++LK EEMAAK RATG VPK
Sbjct  135   MEEKLERKKAEYGEKMKNKVAAIHKQAEEKRAMVEAKRGEEILKAEEMAAKHRATGIVPK  194

Query  1209  KAFGCF  1226
                GCF
Sbjct  195   ATCGCF  200


 Score = 43.5 bits (101),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++DVL+WENTKKA  EA+L+K+E
Sbjct  109  KAQKKISDVLAWENTKKAETEAQLRKME  136



>ref|XP_008376024.1| PREDICTED: remorin-like [Malus domestica]
Length=204

 Score = 92.8 bits (229),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++EQLEKKKA+YAEKM NK AL+ K+A+EKR+++++Q+ E++LK EE AAK+RAT
Sbjct  134   AKLRSIEEQLEKKKAQYAEKMKNKVALLQKQADEKRAMVLAQKGEELLKAEETAAKYRAT  193

Query  1194  GQVPKKAFGCF  1226
             G +PKK  GCF
Sbjct  194   GSIPKKFLGCF  204


 Score = 39.7 bits (91),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+DV +WE+++KA +EAKL+ IE
Sbjct  113  KAQKKLSDVTAWESSRKAAVEAKLRSIE  140



>ref|XP_010544719.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=175

 Score = 90.5 bits (223),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK A +HKEAEEKR++  ++R E+ LK EEMAAK+RATG +PK
Sbjct  110   IEEQLEKKKAEYGERMKNKVAAIHKEAEEKRAMAEAKRGEEKLKAEEMAAKYRATGNIPK  169

Query  1209  KAFGCF  1226
                GCF
Sbjct  170   ATCGCF  175


 Score = 41.6 bits (96),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ VL+WEN+KKA IEA+LKKIE
Sbjct  84   KAQKKISAVLAWENSKKAAIEAELKKIE  111



>ref|NP_001274989.1| remorin [Solanum tuberosum]
 sp|P93788.1|REMO_SOLTU RecName: Full=Remorin; AltName: Full=pp34 [Solanum tuberosum]
 gb|AAB49425.1| remorin [Solanum tuberosum]
Length=198

 Score = 93.6 bits (231),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  133   MEEQLEKKKAEYTEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  192

Query  1209  KAFGCF  1226
             K  G F
Sbjct  193   KILGIF  198


 Score = 38.5 bits (88),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+EA+LKK+E
Sbjct  107  KAQKKVSAIGAWENSKKANLEAELKKME  134



>ref|XP_010544720.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=175

 Score = 90.5 bits (223),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK A +HKEAEEKR++  ++R E+ LK EEMAAK+RATG +PK
Sbjct  110   IEEQLEKKKAEYGERMKNKVAAIHKEAEEKRAMAEAKRGEEKLKAEEMAAKYRATGNIPK  169

Query  1209  KAFGCF  1226
                GCF
Sbjct  170   ATCGCF  175


 Score = 41.6 bits (96),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ VL+WEN+KKA IEA+LKKIE
Sbjct  84   KAQKKISAVLAWENSKKAAIEAELKKIE  111



>ref|XP_002267609.1| PREDICTED: remorin [Vitis vinifera]
 emb|CAN73187.1| hypothetical protein VITISV_041529 [Vitis vinifera]
 emb|CBI22753.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 94.4 bits (233),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LE+KKAEY EKM NK A++HKEAEEKR++I ++R E +LK EEMAAK+RATG  PK
Sbjct  131   IEENLERKKAEYVEKMKNKIAIIHKEAEEKRAMIEARRGEDLLKAEEMAAKYRATGSAPK  190

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  191   KLLGCF  196


 Score = 37.4 bits (85),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+   +WEN++KA++EA+LKKIE
Sbjct  105  KAQKKLSATEAWENSQKASVEAELKKIE  132



>ref|XP_004510806.1| PREDICTED: remorin-like [Cicer arietinum]
Length=194

 Score = 92.4 bits (228),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK A+VHK+AEEKR+++ ++R+E++LK EEMAAK+ AT   PK
Sbjct  129   IEEQLEKKKAEYGEKMKNKIAMVHKQAEEKRAIVEAKRSEEILKAEEMAAKYNATRTTPK  188

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  189   KLLGCF  194


 Score = 39.3 bits (90),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQK+L+ V +WEN+KKA IEA+L+KIE
Sbjct  102  NKAQKQLSSVAAWENSKKAAIEAQLRKIE  130



>ref|XP_009757254.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=132

 Score = 93.2 bits (230),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLE KKA+YAEK+ NK AL+HKEA EKR+++ ++R +++LK EEMAAK+RATG+ PK
Sbjct  67    LEEQLEHKKADYAEKIKNKVALIHKEANEKRAMVDARRGKEILKAEEMAAKYRATGKAPK  126

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  127   KFLGCF  132


 Score = 38.5 bits (88),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V  WENT+KA  EAKLKK+E
Sbjct  41   KAQKKLSAVARWENTQKAKFEAKLKKLE  68


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  564  AVSPDIALAKIEDDKRVSFIKAWEESEKSKVENR  665
            ++  D+ALA++E +KR SF+KAWEESEKSKV+N+
Sbjct  8    SLDRDVALAQLETEKRSSFVKAWEESEKSKVDNK  41



>gb|EYU35080.1| hypothetical protein MIMGU_mgv1a0150192mg, partial [Erythranthe 
guttata]
Length=122

 Score = 93.6 bits (231),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             +QEQLE+KKAEYAEKM NK A +HK AEEKR+ + +++ E++LK  EMAAK+RATGQ+PK
Sbjct  55    IQEQLERKKAEYAEKMKNKAAQIHKHAEEKRATVEARKGEELLKASEMAAKYRATGQIPK  114

Query  1209  KAFGCF  1226
               F CF
Sbjct  115   SGFACF  120


 Score = 38.1 bits (87),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQK+ A V SWEN+KKA++EA+LKKI+
Sbjct  29   KAQKRQAKVSSWENSKKASLEAQLKKIQ  56



>ref|XP_010934733.1| PREDICTED: remorin [Elaeis guineensis]
Length=195

 Score = 87.4 bits (215),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LE KKAEY+EKM NK A++HK AEEKR+++ ++R E++LK EE AAK+RATG  PK
Sbjct  128   IEEALEMKKAEYSEKMKNKIAMIHKAAEEKRAIVEAKRGEEILKAEESAAKYRATGLYPK  187

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  188   KVCGCFS  194


 Score = 43.5 bits (101),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ ++SWENTKKA +EA+LKKIE
Sbjct  102  KAQKKMSSIVSWENTKKAAVEAELKKIE  129



>ref|XP_006404199.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
 gb|ESQ45652.1| hypothetical protein EUTSA_v10011156mg [Eutrema salsugineum]
Length=176

 Score = 90.1 bits (222),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEY E+M NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  111   IEEQLIKKKAEYTEQMKNKIAQIHKEAEEKRAMTEAKRGEDVLKAEEMAAKYRATGTAPT  170

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  171   KLFGCF  176


 Score = 40.8 bits (94),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EA+LKKIE
Sbjct  85   KAQKKLSSVGAWENSKKASVEAELKKIE  112



>ref|XP_004306803.1| PREDICTED: uncharacterized protein At3g61260-like [Fragaria vesca 
subsp. vesca]
Length=196

 Score = 92.8 bits (229),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEKKKA+YAEKM N+ AL+HK+A+EKR++I ++R +++LK EEMAAK+RATG VPK
Sbjct  131   MEEKLEKKKAQYAEKMKNQIALLHKQADEKRAMIQAERGQELLKAEEMAAKYRATGGVPK  190

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  191   KFLGCF  196


 Score = 37.7 bits (86),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+K+L+ V +WENTKKA IEAKL+ +E
Sbjct  105  KAEKRLSTVTAWENTKKAAIEAKLRSME  132



>gb|KEH18895.1| carboxy-terminal region remorin [Medicago truncatula]
Length=200

 Score = 92.8 bits (229),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A+VHK+AEEKR+++ +QR E +LK EE+AAK  ATG VPK
Sbjct  135   IEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAIVEAQRAEAILKAEEIAAKHNATGTVPK  194

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  195   KLLGCF  200


 Score = 37.4 bits (85),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQK+L+ V +WEN+KKA +EA+L+KIE
Sbjct  108  NKAQKQLSTVAAWENSKKAALEAQLRKIE  136



>gb|AFK34355.1| unknown [Medicago truncatula]
Length=200

 Score = 92.8 bits (229),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A+VHK+AEEKR+++ +QR E +LK EE+AAK  ATG VPK
Sbjct  135   IEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAIVEAQRAEAILKAEEIAAKHNATGTVPK  194

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  195   KLLGCF  200


 Score = 37.4 bits (85),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQK+L+ V +WEN+KKA +EA+L+KIE
Sbjct  108  NKAQKQLSTVAAWENSKKAALEAQLRKIE  136



>ref|XP_011035931.1| PREDICTED: remorin [Populus euphratica]
Length=193

 Score = 94.0 bits (232),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++E+LEK+KAEYAEKM NK AL+HK AEE+R+++ ++R E+ LK EEMAAK+RAT
Sbjct  123   ATLRKMEEKLEKQKAEYAEKMKNKVALIHKVAEEQRAMVEAKRGEEFLKAEEMAAKYRAT  182

Query  1194  GQVPKKAFGCF  1226
             GQ PKK  GCF
Sbjct  183   GQTPKKLLGCF  193


 Score = 36.6 bits (83),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKKL+ V++WEN+KKA +EA L+K+E
Sbjct  102  KSQKKLSAVVAWENSKKAALEATLRKME  129



>ref|XP_007040179.1| Remorin family protein [Theobroma cacao]
 gb|EOY24680.1| Remorin family protein [Theobroma cacao]
Length=274

 Score = 91.3 bits (225),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEKM N+ A +H+EAEEKR++I ++R E  LK EE AAKFRATG  PK
Sbjct  207   IEEQLEKKKAEYAEKMKNRVAEIHREAEEKRAMIEAKRGEDFLKIEETAAKFRATGYTPK  266

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  267   KFLGCF  272


 Score = 39.3 bits (90),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ + SWENTKKA +EA+LKKIE
Sbjct  181  KAHKKISAIGSWENTKKAGVEAQLKKIE  208



>ref|XP_008465865.1| PREDICTED: remorin [Cucumis melo]
Length=193

 Score = 90.9 bits (224),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKK EY EKM NK AL+HK AEEKR++I ++R E +LK EE AAK+RATG  PK
Sbjct  126   IEESLEKKKGEYIEKMKNKIALLHKSAEEKRAIIEAKRGEDLLKAEETAAKYRATGTAPK  185

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  186   KLLGCFS  192


 Score = 39.7 bits (91),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V +WEN+KKA++EA+LKKIE
Sbjct  100  KAHKKLSSVAAWENSKKASVEAELKKIE  127



>ref|NP_974824.1| Remorin family protein [Arabidopsis thaliana]
 gb|AED93208.1| Remorin family protein [Arabidopsis thaliana]
Length=201

 Score = 93.2 bits (230),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  136   MEEQLEKKKAEYVEQMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  195

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  196   KLFGCM  201


 Score = 37.0 bits (84),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  110  KAEKKLSSIGSWENNKKAAVEAELKKME  137



>ref|NP_197764.1| Remorin family protein [Arabidopsis thaliana]
 gb|AAK62451.1|AF387006_1 Unknown protein [Arabidopsis thaliana]
 dbj|BAB10048.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN15335.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93207.1| Remorin family protein [Arabidopsis thaliana]
Length=202

 Score = 93.2 bits (230),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E+M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  137   MEEQLEKKKAEYVEQMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  196

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  197   KLFGCM  202


 Score = 36.6 bits (83),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  111  KAEKKLSSIGSWENNKKAAVEAELKKME  138



>ref|XP_010493498.1| PREDICTED: remorin-like [Camelina sativa]
Length=206

 Score = 92.4 bits (228),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  141   MEEQLEKKKAEYVELMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  200

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  201   KLFGCI  206


 Score = 37.0 bits (84),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  115  KAEKKLSSIGSWENNKKAAVEAELKKME  142



>ref|XP_010055168.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW71646.1| hypothetical protein EUGRSUZ_E00174 [Eucalyptus grandis]
Length=186

 Score = 90.1 bits (222),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKA+YAE+M NK +L+HKEAEEK++++ ++R E++LK +EMAAK RATG VPK
Sbjct  121   MEEVLEKKKAQYAEQMKNKVSLIHKEAEEKKAMVEARRKEEILKAQEMAAKHRATGNVPK  180

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  181   KFLGCF  186


 Score = 39.3 bits (90),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIEVI  954
            +AQKKL+ V SWEN+KKA  EAKL+K+E +
Sbjct  95   KAQKKLSAVTSWENSKKAAAEAKLRKMEEV  124



>ref|XP_006288585.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
 gb|EOA21483.1| hypothetical protein CARUB_v10001880mg [Capsella rubella]
Length=230

 Score = 92.4 bits (228),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  165   MEEQLEKKKAEYVEVMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  224

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  225   KLFGCI  230


 Score = 37.0 bits (84),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  139  KAEKKLSSIGSWENNKKAAVEAELKKME  166



>gb|KHG21181.1| Remorin [Gossypium arboreum]
Length=191

 Score = 88.2 bits (217),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+L+K+KAEY EKM NK AL+HKEAEEK++++ ++R E VLK EE+AAK+RATG  P 
Sbjct  126   IEEKLDKQKAEYVEKMKNKAALIHKEAEEKKAIVEAKRGEDVLKAEELAAKYRATGTTPN  185

Query  1209  KAFGC  1223
             K  GC
Sbjct  186   KTVGC  190


 Score = 40.8 bits (94),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQKKL+ + +WENTKKA IEA+LK+IE
Sbjct  99   NKAQKKLSSIAAWENTKKAAIEAELKRIE  127



>ref|XP_010519484.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=188

 Score = 90.1 bits (222),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A+   ++EQLEK+KAEYAEKM NK A + +EA+EKR++I ++R E+VLK EE+AAK+ AT
Sbjct  118   ADLKKIEEQLEKQKAEYAEKMKNKIAEIQREAQEKRAMIEARRGEEVLKAEELAAKYGAT  177

Query  1194  GQVPKKAFGCF  1226
             G  PKK FGCF
Sbjct  178   GTAPKKLFGCF  188


 Score = 38.9 bits (89),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ + +WEN+KKA++EA LKKIE
Sbjct  97   KAQKKLSAIGAWENSKKASVEADLKKIE  124



>ref|XP_010421184.1| PREDICTED: remorin-like [Camelina sativa]
Length=214

 Score = 92.4 bits (228),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  149   MEEQLEKKKAEYVELMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  208

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  209   KLFGCI  214


 Score = 36.6 bits (83),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  123  KAEKKLSSIGSWENNKKAAVEAELKKME  150



>ref|XP_010107439.1| hypothetical protein L484_015780 [Morus notabilis]
 gb|EXC15977.1| hypothetical protein L484_015780 [Morus notabilis]
Length=199

 Score = 91.3 bits (225),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK AL+HKEAEE++++I ++R E++LK EE AAK+RATG  PK
Sbjct  134   IEENLEKKKAEYVEKMKNKIALIHKEAEERKAMIEAKRGEELLKAEESAAKYRATGTAPK  193

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  194   KLLGCF  199


 Score = 37.7 bits (86),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA K ++ V +WEN+KKA++EA+LKKIE
Sbjct  108  RAHKNISSVGAWENSKKASVEAQLKKIE  135



>ref|XP_007152285.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
 gb|ESW24279.1| hypothetical protein PHAVU_004G116700g [Phaseolus vulgaris]
Length=205

 Score = 91.3 bits (225),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEYAEK+ NK A +HKEAEEKR++I +++ E +L  EE AAK+RATG  PK
Sbjct  140   IEEQLEKKKAEYAEKIKNKIATIHKEAEEKRAIIEAKKGEDLLNAEETAAKYRATGTAPK  199

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  200   KLLGCF  205


 Score = 37.7 bits (86),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  113  NKAHKKLSAISAWENSKKASVEAELKKIE  141



>ref|XP_009408139.1| PREDICTED: remorin [Musa acuminata subsp. malaccensis]
Length=171

 Score = 89.4 bits (220),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E++E +KAEYAEKM NK A++HK AEEK++++ ++R E++LK EE AAK+RATGQ PK
Sbjct  104   IEEKIENQKAEYAEKMKNKIAMIHKAAEEKKALVEAKRGEELLKAEETAAKYRATGQAPK  163

Query  1209  KAFGCFG  1229
             K F CF 
Sbjct  164   KGFSCFS  170


 Score = 39.7 bits (91),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKKL+ + SWEN+KKA +EA+LKKIE
Sbjct  78   KSQKKLSAITSWENSKKATLEAELKKIE  105



>ref|XP_006827693.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
 gb|ERM95109.1| hypothetical protein AMTR_s00009p00257810 [Amborella trichopoda]
Length=187

 Score = 93.2 bits (230),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LE++KAEYAEKM NK AL+HKEAEEKR++  ++R E++LK EE AAK+RATG  PK
Sbjct  120   IEEKLERQKAEYAEKMKNKIALIHKEAEEKRAMTEAKRGEELLKAEETAAKYRATGLAPK  179

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  180   KLIGCFG  186


 Score = 35.4 bits (80),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  874  KKLADVLSWENTKKANIEAKLKKIE  948
            KKL+ + SWEN+KKA +EA+L+KIE
Sbjct  97   KKLSSIGSWENSKKAAVEAELRKIE  121



>ref|XP_003521134.1| PREDICTED: remorin-like [Glycine max]
Length=200

 Score = 96.3 bits (238),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQ+EKKKAEY EKM NK  LVHK+AEEKR+++ ++R E++LK EE+AAK RATG  PK
Sbjct  135   IEEQMEKKKAEYGEKMKNKIVLVHKQAEEKRAMVEAKRGEEILKAEEIAAKHRATGTTPK  194

Query  1209  KAFGCF  1226
             KAFGCF
Sbjct  195   KAFGCF  200


 Score = 32.3 bits (72),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+K L+ V +WEN+K A +EA+L+KIE
Sbjct  109  KAEKHLSAVAAWENSKIAALEAQLRKIE  136



>ref|XP_002302576.1| DNA-binding family protein [Populus trichocarpa]
 gb|ABK92585.1| unknown [Populus trichocarpa]
 gb|EEE81849.1| DNA-binding family protein [Populus trichocarpa]
Length=196

 Score = 94.7 bits (234),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEYAEKM NK AL+HKEAEEK++++ ++R E+VLK  E AAK+RATGQ PK
Sbjct  131   MEEKLEKQKAEYAEKMKNKIALIHKEAEEKKAIVEAKRGEEVLKAGETAAKYRATGQTPK  190

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  191   KLLGCF  196


 Score = 33.9 bits (76),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QK  + V +WEN+KKA +EAKL+K+E
Sbjct  105  KSQKNFSAVAAWENSKKAALEAKLRKME  132



>ref|XP_010426396.1| PREDICTED: remorin-like [Camelina sativa]
Length=176

 Score = 89.0 bits (219),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAEKM NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  111   IEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMAEAKRGEDVLKAEEMAAKYRATGTAPT  170

Query  1209  KAFGCF  1226
             K FG F
Sbjct  171   KLFGLF  176


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EA+LKKIE
Sbjct  85   KAQKKLSYVGAWENSKKASVEAELKKIE  112



>ref|XP_010412645.1| PREDICTED: remorin-like [Camelina sativa]
Length=186

 Score = 88.6 bits (218),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAEKM NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  121   IEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMAEAKRGEDVLKAEEMAAKYRATGTAPT  180

Query  1209  KAFGCF  1226
             K FG F
Sbjct  181   KLFGLF  186


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EA+LKKIE
Sbjct  95   KAQKKLSYVGAWENSKKASVEAELKKIE  122



>ref|XP_010503539.1| PREDICTED: remorin-like [Camelina sativa]
Length=175

 Score = 89.0 bits (219),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAEKM NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  110   IEEQLLKKKAEYAEKMKNKIARIHKEAEEKRAMAEAKRGEDVLKAEEMAAKYRATGTAPT  169

Query  1209  KAFGCF  1226
             K FG F
Sbjct  170   KLFGLF  175


 Score = 39.3 bits (90),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA++EA+LKKIE
Sbjct  84   KAQKKLSYVGAWENSKKASVEAELKKIE  111



>ref|XP_010454663.1| PREDICTED: remorin-like [Camelina sativa]
Length=216

 Score = 91.3 bits (225),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HKEAEE+R++I ++R E++LK EE+AAK+RATG  PK
Sbjct  151   MEEQLEKKKAEYVEVMKNKIAQIHKEAEERRAMIEAKRGEEILKAEELAAKYRATGTAPK  210

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  211   KLFGCI  216


 Score = 37.0 bits (84),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  125  KAEKKLSSIGSWENNKKAAVEAELKKME  152



>gb|KDP22286.1| hypothetical protein JCGZ_26117 [Jatropha curcas]
Length=203

 Score = 90.5 bits (223),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEYAEKM NK AL+HK AEEKR++I ++R E +LK EE AAK RATG  PK
Sbjct  138   IEEKLEKQKAEYAEKMKNKIALIHKAAEEKRAIIEAKRGEDLLKAEETAAKCRATGTAPK  197

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  198   KLLGCF  203


 Score = 37.7 bits (86),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ ++SWEN+KKA +EA+LK+IE
Sbjct  112  KAHKKLSAIVSWENSKKALVEAELKQIE  139



>gb|AAM63910.1| remorin [Arabidopsis thaliana]
Length=202

 Score = 91.3 bits (225),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY E+M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  137   MEEHLEKKKAEYVEQMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  196

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  197   KLFGCM  202


 Score = 36.6 bits (83),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  111  KAEKKLSSIGSWENNKKAAVEAELKKME  138



>emb|CDY71834.1| BnaAnng38930D [Brassica napus]
Length=176

 Score = 89.4 bits (220),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAE+M NK   +HKEAEEKR++  + R E++LK EEMAAK+RATG  P 
Sbjct  111   IEEQLIKKKAEYAEQMKNKIVQIHKEAEEKRAMTEANRGEEILKAEEMAAKYRATGTAPT  170

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  171   KLFGCF  176


 Score = 38.9 bits (89),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA+ EA+LKKIE
Sbjct  85   KAQKKLSSVGAWENSKKASAEAELKKIE  112



>ref|XP_006394639.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
 gb|ESQ31925.1| hypothetical protein EUTSA_v10004940mg [Eutrema salsugineum]
Length=202

 Score = 91.3 bits (225),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RATG  PK
Sbjct  137   MEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRATGTTPK  196

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  197   KLFGCM  202


 Score = 37.0 bits (84),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  111  KAEKKLSSIGSWENNKKAAVEAELKKME  138



>ref|XP_006358926.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=190

 Score = 91.7 bits (226),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             +QE+LEKKKAEYAEKM NK A +H+EAE+KR++I ++  E +LK EE+AAKFRATG +PK
Sbjct  123   IQEELEKKKAEYAEKMKNKMAEIHREAEDKRAMIKAKEGEDILKVEEIAAKFRATGNMPK  182

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  183   KFLRCFG  189


 Score = 36.2 bits (82),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V SWENTKKA IEA+L++I+
Sbjct  97   KALKKLSAVGSWENTKKATIEAELRQIQ  124



>ref|XP_009150904.1| PREDICTED: remorin-like [Brassica rapa]
 emb|CDX88048.1| BnaA06g26390D [Brassica napus]
Length=205

 Score = 90.9 bits (224),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RATG  PK
Sbjct  140   MEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRATGTAPK  199

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  200   KLFGCM  205


 Score = 36.6 bits (83),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  114  KAEKKLSSIGSWENNKKAAVEAELKKME  141



>ref|XP_004165762.1| PREDICTED: remorin-like [Cucumis sativus]
 gb|KGN60481.1| hypothetical protein Csa_3G915100 [Cucumis sativus]
Length=189

 Score = 89.7 bits (221),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A+   ++E LEKKKA+Y E+M NK AL+HK AEEKR++I ++R E +LK EE AAK+RAT
Sbjct  117   ADLKKIEESLEKKKAKYIEQMKNKIALLHKSAEEKRAIIEAKRGEDLLKAEETAAKYRAT  176

Query  1194  GQVPKKAFGCFG  1229
             G  PKK  GCF 
Sbjct  177   GTAPKKLLGCFS  188


 Score = 38.1 bits (87),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V +WEN++KA++EA LKKIE
Sbjct  96   KAHKKLSSVAAWENSQKASVEADLKKIE  123



>ref|XP_010667563.1| PREDICTED: remorin-like [Beta vulgaris subsp. vulgaris]
Length=210

 Score = 89.7 bits (221),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEYAEKM NK A+ HKEAEEK++ + ++R E +LK EEMAAK+RATG+ PK
Sbjct  145   IEESLEKKKAEYAEKMKNKVAMTHKEAEEKKATVEAKRAEDILKAEEMAAKYRATGKPPK  204

Query  1209  KAFGCF  1226
             K  G F
Sbjct  205   KLLGLF  210


 Score = 37.7 bits (86),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK+A + +WEN+KKA++EA+LKKIE
Sbjct  119  KAHKKIAAIEAWENSKKASLEAELKKIE  146



>emb|CDY05883.1| BnaC08g20600D [Brassica napus]
Length=120

 Score = 89.4 bits (220),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             +++QL KKKAEYAE+M NK A +HKEAEEKR++  ++R E++LK EEMAAK+RATG  P 
Sbjct  55    IEQQLIKKKAEYAEQMKNKIAQIHKEAEEKRAMTEAKRGEEILKAEEMAAKYRATGTAPT  114

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  115   KLFGCF  120


 Score = 38.1 bits (87),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA  EA+LKKIE
Sbjct  29   KAQKKLSSVGAWENSKKAYAEAELKKIE  56



>ref|XP_003623893.1| Remorin [Medicago truncatula]
 gb|AES80111.1| carboxy-terminal region remorin [Medicago truncatula]
Length=133

 Score = 94.4 bits (233),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE+KKA Y E M NK ALVHKEAEEKR++I ++R E+VLK +EMAAK+RATG  PK
Sbjct  68    IEEQLERKKARYGEIMRNKIALVHKEAEEKRAMIEAKRGEEVLKVQEMAAKYRATGTTPK  127

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  128   KTIGCF  133


 Score = 33.1 bits (74),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A K ++ + +WE++KKA +EA+LKKIE
Sbjct  42   KAHKHISSIAAWEDSKKAALEAELKKIE  69



>ref|XP_002874146.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50405.1| hypothetical protein ARALYDRAFT_489237 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score = 90.1 bits (222),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY E M NK A +HKEAEEKR++I ++R E++LK EE+AAK+RATG  PK
Sbjct  145   MEEHLEKKKAEYVELMKNKIAQIHKEAEEKRAMIEAKRGEEILKAEELAAKYRATGTAPK  204

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  205   KLFGCI  210


 Score = 37.0 bits (84),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  119  KAEKKLSSIGSWENNKKAAVEAELKKME  146



>ref|XP_004492710.1| PREDICTED: uncharacterized protein At3g61260-like [Cicer arietinum]
Length=185

 Score = 90.5 bits (223),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LE+KKA+Y E+M NK A++HKEAEEKR+VI ++R E VLK EEMAAK+RATG  PK
Sbjct  119   IEEHLERKKAQYGEEMKNKIAIIHKEAEEKRAVIEAKRGEMVLKVEEMAAKYRATGTTPK  178

Query  1209  K-AFGCF  1226
             K   GCF
Sbjct  179   KTTIGCF  185


 Score = 36.6 bits (83),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  850  LKRFGRAQKKLADVLSWENTKKANIEAKLKKIE  948
            +K   +AQK  + + +WEN+KKA +EA+LKKIE
Sbjct  88   VKADNKAQKHFSSIAAWENSKKAALEAELKKIE  120



>ref|XP_004148376.1| PREDICTED: remorin-like [Cucumis sativus]
Length=157

 Score = 89.4 bits (220),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A+   ++E LEKKKA+Y E+M NK AL+HK AEEKR++I ++R E +LK EE AAK+RAT
Sbjct  85    ADLKKIEESLEKKKAKYIEQMKNKIALLHKSAEEKRAIIEAKRGEDLLKAEETAAKYRAT  144

Query  1194  GQVPKKAFGCFG  1229
             G  PKK  GCF 
Sbjct  145   GTAPKKLLGCFS  156


 Score = 37.7 bits (86),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V +WEN++KA++EA LKKIE
Sbjct  64   KAHKKLSSVAAWENSQKASVEADLKKIE  91



>gb|KHG20032.1| Remorin [Gossypium arboreum]
Length=187

 Score = 90.1 bits (222),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK AL+HKEAEEK++++ ++R E +LK EE+AAK+RATG  P 
Sbjct  122   IEEKLEKQKAEYVEKMKNKIALIHKEAEEKKAMVEAKRGEDLLKAEEIAAKYRATGTTPN  181

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  182   KVLGCF  187


 Score = 37.0 bits (84),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A KKL+ + +WEN+KKA +EA+LKKIE
Sbjct  95   NKAHKKLSSIEAWENSKKAALEAELKKIE  123



>gb|ABK95953.1| unknown [Populus trichocarpa]
Length=66

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEYAEKM NK AL+HK+AEE+R+++ ++R E+ LK EEMAAK+RATGQ PK
Sbjct  1     MEEKLEKQKAEYAEKMKNKVALIHKDAEEQRAMVEAKRGEEFLKAEEMAAKYRATGQTPK  60

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  61    KLLGCF  66



>ref|XP_010053688.1| PREDICTED: remorin-like [Eucalyptus grandis]
Length=162

 Score = 92.0 bits (227),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A+    +E LEKKKAE+ EKM NK AL+HK+AEEKR+VI ++R E++LK EE+AAK+RAT
Sbjct  92    ADLRKTEEGLEKKKAEHGEKMKNKVALIHKQAEEKRAVIQAKRGEEILKAEEVAAKYRAT  151

Query  1194  GQVPKKAFGCF  1226
             G +PKK  GCF
Sbjct  152   GYMPKKFLGCF  162


 Score = 34.7 bits (78),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ V SWEN+KKA  EA L+K E
Sbjct  71   KAQKKMSIVTSWENSKKATKEADLRKTE  98



>gb|KDO60014.1| hypothetical protein CISIN_1g028549mg [Citrus sinensis]
Length=192

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  125   IEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPK  184

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  185   KLLSCFG  191



>ref|XP_010550762.1| PREDICTED: remorin-like isoform X1 [Tarenaya hassleriana]
Length=198

 Score = 91.7 bits (226),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM N+ A +H+EAEE+R++I ++R E+VLK EE+AAK+RATG  PK
Sbjct  133   IEEQLEKKKAEYREKMKNRIAEIHREAEERRAMIEARRGEEVLKAEEIAAKYRATGTAPK  192

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  193   KLLGCF  198


 Score = 34.7 bits (78),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A + L+ + +WEN+KKA++EA+LKKIE
Sbjct  107  KAHRNLSAIGAWENSKKASVEAELKKIE  134



>ref|NP_001234231.1| remorin 1 [Solanum lycopersicum]
 gb|AAD28506.1|AF123265_1 remorin 1 [Solanum lycopersicum]
Length=197

 Score = 89.7 bits (221),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA Y EKM NK AL+HKEAEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  132   MEEQLEKKKAIYTEKMKNKIALLHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGTAPK  191

Query  1209  KAFGCF  1226
             K  G F
Sbjct  192   KILGIF  197


 Score = 36.6 bits (83),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN+KKAN+E++LKK+E
Sbjct  106  KAQKKVSAIGAWENSKKANLESELKKME  133



>ref|XP_007218451.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
 gb|EMJ19650.1| hypothetical protein PRUPE_ppa011776mg [Prunus persica]
Length=197

 Score = 87.8 bits (216),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEKKK +YAEKM N+ AL+HK+A+EKR++ ++ R E+ LK +E AAK+RATG +PK
Sbjct  132   MEEKLEKKKTQYAEKMKNQVALLHKQADEKRALTIANRGEEFLKADETAAKYRATGSIPK  191

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  192   KFLGCF  197


 Score = 38.5 bits (88),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+D+ +WEN++KA  EAKL+++E
Sbjct  106  KAQKKLSDITAWENSRKAAAEAKLRRME  133



>ref|XP_009149781.1| PREDICTED: remorin [Brassica rapa]
Length=175

 Score = 87.4 bits (215),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKAEYAE+M NK   +HKEAEEKR++  ++R E++LK EEMAA +RATG  P 
Sbjct  110   IEEQLIKKKAEYAEQMKNKIVQIHKEAEEKRAMTEAKRGEEILKAEEMAANYRATGTAPT  169

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  170   KLFGCF  175


 Score = 38.9 bits (89),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA+ EA+LKKIE
Sbjct  84   KAQKKLSSVGAWENSKKASAEAELKKIE  111



>ref|XP_010550763.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=197

 Score = 91.7 bits (226),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EKM N+ A +H+EAEE+R++I ++R E+VLK EE+AAK+RATG  PK
Sbjct  132   IEEQLEKKKAEYREKMKNRIAEIHREAEERRAMIEARRGEEVLKAEEIAAKYRATGTAPK  191

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  192   KLLGCF  197


 Score = 34.7 bits (78),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A + L+ + +WEN+KKA++EA+LKKIE
Sbjct  106  KAHRNLSAIGAWENSKKASVEAELKKIE  133



>ref|XP_011076174.1| PREDICTED: remorin-like [Sesamum indicum]
Length=195

 Score = 90.5 bits (223),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA+Y E M N+ AL+HK AEEKR++I ++R E +LK EE+AAK+RATG  PK
Sbjct  130   IEEQLEKKKAKYIETMKNRVALIHKAAEEKRAIIEAKRGEDLLKAEEIAAKYRATGTAPK  189

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  190   KLLGCF  195


 Score = 36.2 bits (82),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQ K++ + +WEN+KKA++EA+LKKIE
Sbjct  104  KAQMKVSAIAAWENSKKASLEAELKKIE  131



>emb|CDP08838.1| unnamed protein product [Coffea canephora]
Length=181

 Score = 80.5 bits (197),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA+Y E + NK A +HK+AEEK++++ ++R E++L+ +EM+AK+RAT Q PK
Sbjct  115   IEEQLEKKKADYGETIKNKIAEIHKQAEEKKAMVEARRREEILQADEMSAKYRATNQAPK  174

Query  1209  KAFGCFG  1229
             +  GCFG
Sbjct  175   Q-VGCFG  180


 Score = 45.4 bits (106),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL++V SWENTKKA IEAKLKKIE
Sbjct  89   KAQKKLSEVSSWENTKKAAIEAKLKKIE  116


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  564  AVSPDIALAKIEDDKRVSFIKAWEESEKSKVENR  665
            +V  D+ALA++E++KR+SFIKAWEESEK+K EN+
Sbjct  56   SVDKDVALAEVENEKRLSFIKAWEESEKTKAENK  89



>gb|AGR88905.1| remorin 1 [Datisca glomerata]
Length=202

 Score = 87.4 bits (215),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK  NK A +HK AEEKR+ I ++R E +LK EE AAK+RATG  PK
Sbjct  135   IEEQLEKKKAEYVEKQKNKIAQIHKSAEEKRAEIEAKRGEDLLKAEETAAKYRATGSAPK  194

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  195   KLLGCFS  201


 Score = 38.5 bits (88),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ +++WEN++KA++EA+LKKIE
Sbjct  109  KAHKKLSAIVAWENSRKASVEAELKKIE  136



>ref|XP_007038675.1| Remorin family protein [Theobroma cacao]
 gb|EOY23176.1| Remorin family protein [Theobroma cacao]
Length=408

 Score = 90.1 bits (222),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK AL+HKEAEEK++++ ++R E +LK EE AAKFRA G  PK
Sbjct  343   IEEKLEKQKAEYVEKMKNKVALIHKEAEEKKAIVEAKRGEDLLKAEETAAKFRAKGTTPK  402

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  403   KVLGCF  408


 Score = 35.8 bits (81),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A KKL+ + +WEN++KA +EA+LKKIE
Sbjct  316  NKAYKKLSSIAAWENSRKAALEAELKKIE  344



>ref|XP_010273101.1| PREDICTED: remorin-like [Nelumbo nucifera]
Length=194

 Score = 88.6 bits (218),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQ EKKKA YAEKM NK A VHKEAEEKR+++ ++R E +LK EEMAAK+RA G  PK
Sbjct  129   VEEQYEKKKAGYAEKMKNKIAQVHKEAEEKRAMVEAKRGEDLLKAEEMAAKYRAKGIAPK  188

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  189   KLLGCF  194


 Score = 37.0 bits (84),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWEN+KKA++EA+L+K+E
Sbjct  103  KADKKLSAIGSWENSKKASVEAQLRKVE  130



>ref|XP_008232793.1| PREDICTED: remorin [Prunus mume]
Length=198

 Score = 87.4 bits (215),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEKKK +YAEKM N+ AL+HK+A+EKR++ ++ R E+ LK +E AAK+RATG +PK
Sbjct  133   MEEKLEKKKTQYAEKMKNQVALLHKQADEKRALAIANRGEEFLKADETAAKYRATGTIPK  192

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  193   KFLGCF  198


 Score = 37.7 bits (86),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+D+ +WEN++KA  EAKL+ +E
Sbjct  107  KAQKKLSDITAWENSRKAAAEAKLRSME  134



>ref|XP_010908426.1| PREDICTED: remorin-like isoform X1 [Elaeis guineensis]
Length=205

 Score = 95.9 bits (237),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             QE+LEKKKAEYAEKM NK A++HK AEEKR+++ ++  E +LK EEMAAK+R+TG  PKK
Sbjct  139   QEELEKKKAEYAEKMKNKVAMIHKTAEEKRAIVEAKCGEDILKAEEMAAKYRSTGLAPKK  198

Query  1212  AFGCFG  1229
              FGCFG
Sbjct  199   LFGCFG  204


 Score = 29.3 bits (64),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +A K+++ + +WEN+KKA  EA+LK
Sbjct  100  KAAKQMSSITAWENSKKAATEAELK  124



>ref|XP_011048712.1| PREDICTED: remorin isoform X1 [Populus euphratica]
Length=198

 Score = 87.0 bits (214),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE  EKM NK A++HKEAEEK+++I ++R E +LK EEMAAK+RATG  PK
Sbjct  133   IEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAIIEAKRGEDLLKAEEMAAKYRATGSSPK  192

Query  1209  KAFGCF  1226
             K  G F
Sbjct  193   KLLGFF  198


 Score = 37.4 bits (85),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A +KL+ + SWEN+KKA++EA+L KIE
Sbjct  106  NKAHRKLSSITSWENSKKASVEAELMKIE  134



>ref|XP_011048713.1| PREDICTED: remorin isoform X2 [Populus euphratica]
Length=197

 Score = 86.7 bits (213),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE  EKM NK A++HKEAEEK+++I ++R E +LK EEMAAK+RATG  PK
Sbjct  132   IEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAIIEAKRGEDLLKAEEMAAKYRATGSSPK  191

Query  1209  KAFGCF  1226
             K  G F
Sbjct  192   KLLGFF  197


 Score = 37.7 bits (86),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A +KL+ + SWEN+KKA++EA+L KIE
Sbjct  105  NKAHRKLSSITSWENSKKASVEAELMKIE  133



>ref|XP_011048714.1| PREDICTED: remorin isoform X3 [Populus euphratica]
Length=193

 Score = 86.7 bits (213),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE  EKM NK A++HKEAEEK+++I ++R E +LK EEMAAK+RATG  PK
Sbjct  128   IEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAIIEAKRGEDLLKAEEMAAKYRATGSSPK  187

Query  1209  KAFGCF  1226
             K  G F
Sbjct  188   KLLGFF  193


 Score = 37.4 bits (85),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A +KL+ + SWEN+KKA++EA+L KIE
Sbjct  101  NKAHRKLSSITSWENSKKASVEAELMKIE  129



>ref|XP_002322467.1| remorin family protein [Populus trichocarpa]
 gb|EEF06594.1| remorin family protein [Populus trichocarpa]
Length=201

 Score = 85.9 bits (211),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE  EKM NK A++HKEAEEK++++ ++R E +LK EEMA K+RATG  PK
Sbjct  136   IEEQLEKKKAECMEKMKNKIAMIHKEAEEKKAIVEAKRGEDLLKAEEMAGKYRATGSSPK  195

Query  1209  KAFGCF  1226
             K  G F
Sbjct  196   KLLGIF  201


 Score = 38.1 bits (87),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWEN+KKA++EA+L KIE
Sbjct  110  KAHKKLSSIASWENSKKASVEAELMKIE  137



>ref|XP_010519485.1| PREDICTED: remorin-like isoform X2 [Tarenaya hassleriana]
Length=186

 Score = 84.7 bits (208),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  1038  QLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAF  1217
             +LEK+KAEYAEKM NK A + +EA+EKR++I ++R E+VLK EE+AAK+ ATG  PKK F
Sbjct  124   ELEKQKAEYAEKMKNKIAEIQREAQEKRAMIEARRGEEVLKAEELAAKYGATGTAPKKLF  183

Query  1218  GCF  1226
             GCF
Sbjct  184   GCF  186


 Score = 39.3 bits (90),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIEV  951
            +AQKKL+ + +WEN+KKA++EA LKKIE+
Sbjct  97   KAQKKLSAIGAWENSKKASVEADLKKIEL  125



>gb|AGB07445.1| remorin [Morus indica]
Length=199

 Score = 90.5 bits (223),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +E LEKKKAEY EKM NK AL+HKEAEE++++I ++R E++LK EE AAK+RATG  PK
Sbjct  134   FEENLEKKKAEYVEKMKNKIALIHKEAEERKAIIEAKRGEELLKAEESAAKYRATGTGPK  193

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  194   KLLGCF  199


 Score = 33.5 bits (75),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A K ++ + +WEN+KKA++EA+LKK E
Sbjct  108  KAHKNVSSIGAWENSKKASVEAQLKKFE  135



>ref|XP_003618987.1| Remorin, partial [Medicago truncatula]
Length=87

 Score = 92.0 bits (227),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A+VHK+AEEKR+++ +QR E +LK EE+AAK  ATG VPK
Sbjct  22    IEEQLEKKKAEYGEKIKNKVAMVHKQAEEKRAIVEAQRAEAILKAEEIAAKHNATGTVPK  81

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  82    KLLGCF  87


 Score = 32.0 bits (71),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  880  LADVLSWENTKKANIEAKLKKIE  948
            L+ V +WEN+KKA +EA+L+KIE
Sbjct  1    LSTVAAWENSKKAALEAQLRKIE  23



>ref|NP_190463.1| Remorin-like protein [Arabidopsis thaliana]
 emb|CAB62016.1| remorin-like protein [Arabidopsis thaliana]
 gb|AEE78475.1| Remorin-like protein [Arabidopsis thaliana]
Length=175

 Score = 84.0 bits (206),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL KKKA Y E+M NK A +HKEAEEKR++  ++R E VLK EEMAAK+RATG  P 
Sbjct  110   IEEQLNKKKAHYTEQMKNKIAQIHKEAEEKRAMTEAKRGEDVLKAEEMAAKYRATGTAPT  169

Query  1209  KAFGCF  1226
             K FG F
Sbjct  170   KLFGFF  175


 Score = 39.7 bits (91),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ V +WEN+KKA++EA+LKKIE
Sbjct  84   KAQKKISSVGAWENSKKASVEAELKKIE  111



>ref|NP_001236279.1| uncharacterized protein LOC100305501 [Glycine max]
 gb|ACU13201.1| unknown [Glycine max]
 gb|KHN21737.1| Remorin [Glycine soja]
Length=194

 Score = 90.1 bits (222),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A +H+EAEEKR+ I +Q+ E+ LK EE AAK+RATG  P 
Sbjct  129   IEEQLEKKKAEYGEKLKNKIATIHREAEEKRAFIEAQKGEEFLKAEETAAKYRATGTAPT  188

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  189   KLFGCF  194


 Score = 33.1 bits (74),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++ KKL+ + +WEN+KKA  EA+L+KIE
Sbjct  103  KSHKKLSAISAWENSKKAAAEAELRKIE  130



>ref|XP_008806887.1| PREDICTED: remorin [Phoenix dactylifera]
Length=277

 Score = 83.2 bits (204),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LE KKAEYAEKM NK A++HK A EKR+++ ++R E++LK EE AAK+ A G  PK
Sbjct  210   IEEALEMKKAEYAEKMKNKIAMIHKAAAEKRAIVEAKRGEEILKAEETAAKYHAKGLYPK  269

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  270   KVLGCF  275


 Score = 40.0 bits (92),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++QKK++ + SWENTKKA +EA+L+KIE
Sbjct  184  KSQKKMSSIASWENTKKAAVEAELRKIE  211



>emb|CDX80385.1| BnaC07g30590D [Brassica napus]
Length=388

 Score = 86.3 bits (212),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAE  E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RATG  PK
Sbjct  140   MEEQLEKKKAENVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRATGTAPK  199

Query  1209  KAFGCF  1226
             K FGC 
Sbjct  200   KLFGCI  205


 Score = 37.0 bits (84),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKK+E
Sbjct  114  KAEKKLSSIGSWENNKKAAVEAELKKME  141



>ref|XP_008353990.1| PREDICTED: remorin-like [Malus domestica]
Length=154

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +3

Query  1035  EQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKA  1214
             EQLEKKKA+YAEKM NK AL+HK+A+EKR+++++Q+ E++LK +E AAK+RATG +PKK 
Sbjct  91    EQLEKKKAQYAEKMQNKVALLHKQADEKRAMVLAQKGEELLKADETAAKYRATGSIPKKF  150

Query  1215  FGCF  1226
              GCF
Sbjct  151   LGCF  154



>gb|KCW78048.1| hypothetical protein EUGRSUZ_D02272 [Eucalyptus grandis]
Length=87

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A+    +E LEKKKAE+ EKM NK AL+HK+AEEKR+VI ++R E++LK EE+AAK+RAT
Sbjct  17    ADLRKTEEGLEKKKAEHGEKMKNKVALIHKQAEEKRAVIQAKRGEEILKAEEVAAKYRAT  76

Query  1194  GQVPKKAFGCF  1226
             G +PKK  GCF
Sbjct  77    GYMPKKFLGCF  87



>emb|CDX87157.1| BnaC09g04720D [Brassica napus]
Length=194

 Score = 85.1 bits (209),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RA+G  PK
Sbjct  129   IEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRASGTAPK  188

Query  1209  KAFG  1220
             K FG
Sbjct  189   KLFG  192


 Score = 37.7 bits (86),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKKIE
Sbjct  103  KAEKKLSSIESWENNKKAAVEAELKKIE  130



>ref|XP_009141722.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
 ref|XP_009141730.1| PREDICTED: remorin-like isoform X1 [Brassica rapa]
Length=197

 Score = 84.7 bits (208),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RA+G  PK
Sbjct  132   IEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRASGTAPK  191

Query  1209  KAFG  1220
             K FG
Sbjct  192   KLFG  195


 Score = 37.7 bits (86),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKKIE
Sbjct  106  KAEKKLSSIESWENNKKAAVEAELKKIE  133



>ref|XP_009141736.1| PREDICTED: remorin-like isoform X2 [Brassica rapa]
Length=196

 Score = 84.7 bits (208),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RA+G  PK
Sbjct  131   IEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRASGTAPK  190

Query  1209  KAFG  1220
             K FG
Sbjct  191   KLFG  194


 Score = 37.7 bits (86),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKKIE
Sbjct  105  KAEKKLSSIESWENNKKAAVEAELKKIE  132



>ref|XP_009382381.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=196

 Score = 89.7 bits (221),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E LEKKKAEY EKM NK A++HK AEEK++++ ++R E+ LK EEMAAK+R TG  PKK
Sbjct  130   EEALEKKKAEYVEKMKNKIAMLHKAAEEKKAMVEAKRGEEFLKAEEMAAKYRVTGFTPKK  189

Query  1212  AFGCFG  1229
              FGCFG
Sbjct  190   LFGCFG  195


 Score = 32.7 bits (73),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +A KK+A + +WEN+KKA +EA+LK
Sbjct  103  KAAKKMASITAWENSKKAALEAELK  127



>ref|XP_010035129.1| PREDICTED: remorin-like isoform X1 [Eucalyptus grandis]
Length=222

 Score = 89.4 bits (220),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  1023  NYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQV  1202
             N+ QE++EKKKAEYAE M NK A VHK AEEKR+++ +++ E +LK EEMAAK+RA+G V
Sbjct  153   NFEQEKMEKKKAEYAETMKNKIASVHKLAEEKRAIVEAKKGEDLLKAEEMAAKYRASGLV  212

Query  1203  PKKAFGCFG  1229
             PKK   CFG
Sbjct  213   PKKLLLCFG  221


 Score = 32.7 bits (73),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  853  KRFGRAQKKLADVLSWENTKKANIEAKLKKIE  948
            +   RAQKK + + +WEN+KKA+I + LK  E
Sbjct  124  RSLNRAQKKFSTIGAWENSKKASIGSDLKNFE  155



>emb|CDY69344.1| BnaAnng30100D, partial [Brassica napus]
Length=130

 Score = 84.7 bits (208),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY E M NK A +HK+AEEKR++I ++R E+VLK EE+AAK+RA+G  PK
Sbjct  65    IEEQLEKKKAEYVELMKNKIAQIHKQAEEKRAMIEARRGEEVLKAEELAAKYRASGTAPK  124

Query  1209  KAFG  1220
             K FG
Sbjct  125   KLFG  128


 Score = 37.4 bits (85),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A+KKL+ + SWEN KKA +EA+LKKIE
Sbjct  39   KAEKKLSSIESWENNKKAAVEAELKKIE  66



>ref|XP_004240737.1| PREDICTED: remorin [Solanum lycopersicum]
Length=185

 Score = 81.3 bits (199),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +EQL KKKAEY EK+ NK ALVHK AEEKR++  ++R E +L  EEMAAK RATG  PKK
Sbjct  120   EEQLLKKKAEYIEKLKNKIALVHKSAEEKRAITEAKRGEDLLTAEEMAAKCRATGSSPKK  179

Query  1212  A-FGCF  1226
                GCF
Sbjct  180   PLLGCF  185


 Score = 40.4 bits (93),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK+A++L+WEN+KKA++EA+LK+ E
Sbjct  93   KAQKKIAEILAWENSKKASLEAELKRTE  120



>ref|XP_009766651.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=198

 Score = 87.8 bits (216),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LE+KKAEYAEKM NK A++H+EAEEKR++I + R +  LK EE AAKFR TG +PK
Sbjct  132   IEEELERKKAEYAEKMKNKMAVIHREAEEKRALIEANRGQDFLKVEETAAKFRETG-IPK  190

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  191   KFLGCFG  197


 Score = 33.9 bits (76),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V +WENTKKA IE +LK+IE
Sbjct  106  KAFKKLSAVGAWENTKKATIEFELKQIE  133



>emb|CDP05208.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 82.0 bits (201),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A +HK AEE+++ I  +R E +LK EE AAK+RATG  PK
Sbjct  138   IEEKLEKQKAEYVEKMKNKIAALHKSAEEQKAAIEYKRGEDLLKAEEAAAKYRATGTAPK  197

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  198   KLLGCF  203


 Score = 39.7 bits (91),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + SWEN+KKA+IEA+L+KIE
Sbjct  112  KAQKKISAIGSWENSKKASIEAELRKIE  139



>ref|XP_003556104.1| PREDICTED: remorin-like [Glycine max]
 gb|KHN26658.1| Remorin [Glycine soja]
Length=197

 Score = 89.7 bits (221),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A +H+EAEEKR+ I +Q+ E  LK EE AAK+RATG  P 
Sbjct  132   IEEQLEKKKAEYGEKLKNKIATIHREAEEKRAFIEAQKGEDFLKAEETAAKYRATGTAPT  191

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  192   KLFGCF  197


 Score = 30.4 bits (67),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            ++ KKL+ + +WEN+ KA  EA+L+KIE
Sbjct  106  KSHKKLSVISAWENSMKAAAEAELRKIE  133



>gb|EYU25090.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=194

 Score = 84.3 bits (207),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE KKA+Y EK+ NK A VHK AEEKR+ + +QR E++LK EE+AAK+RATG  PK
Sbjct  129   IEEQLEIKKAQYIEKLKNKVAYVHKAAEEKRANVEAQRGEELLKAEEVAAKYRATGTGPK  188

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  189   KLLGCF  194


 Score = 36.2 bits (82),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN++KA +EA+LKKIE
Sbjct  103  KAQKKVSAIGAWENSRKATLEAELKKIE  130



>gb|EYU25089.1| hypothetical protein MIMGU_mgv1a014261mg [Erythranthe guttata]
Length=195

 Score = 84.3 bits (207),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLE KKA+Y EK+ NK A VHK AEEKR+ + +QR E++LK EE+AAK+RATG  PK
Sbjct  130   IEEQLEIKKAQYIEKLKNKVAYVHKAAEEKRANVEAQRGEELLKAEEVAAKYRATGTGPK  189

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  190   KLLGCF  195


 Score = 36.2 bits (82),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ + +WEN++KA +EA+LKKIE
Sbjct  104  KAQKKVSAIGAWENSRKATLEAELKKIE  131



>gb|EEC74277.1| hypothetical protein OsI_09516 [Oryza sativa Indica Group]
Length=179

 Score = 80.1 bits (196),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E+LE+KKAEYAEKM N+ A +HK AEEKR+ + + R+E+++K EEMAAK R+ G  P K
Sbjct  113   EEKLERKKAEYAEKMRNQVAAIHKAAEEKRATVEATRHEEIIKYEEMAAKHRSKGTTPTK  172

Query  1212  AFGCFG  1229
                CFG
Sbjct  173   FLSCFG  178


 Score = 40.0 bits (92),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ +LSWENT+KA IEAKL+  E
Sbjct  86   KAQKKMSSILSWENTRKAAIEAKLRTQE  113



>ref|XP_010035131.1| PREDICTED: remorin-like isoform X3 [Eucalyptus grandis]
Length=202

 Score = 89.7 bits (221),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  1023  NYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQV  1202
             N+ QE++EKKKAEYAE M NK A VHK AEEKR+++ +++ E +LK EEMAAK+RA+G V
Sbjct  133   NFEQEKMEKKKAEYAETMKNKIASVHKLAEEKRAIVEAKKGEDLLKAEEMAAKYRASGLV  192

Query  1203  PKKAFGCFG  1229
             PKK   CFG
Sbjct  193   PKKLLLCFG  201


 Score = 30.4 bits (67),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK + + +WEN+KKA+I + LK  E
Sbjct  108  KAQKKFSTIGAWENSKKASIGSDLKNFE  135



>ref|XP_008794544.1| PREDICTED: remorin-like [Phoenix dactylifera]
Length=192

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E LEKKKAEYAEKM NK A++HK AEEK++ + ++R E++LK EEMAAK+RATG  PKK
Sbjct  126   EEALEKKKAEYAEKMKNKVAMLHKVAEEKKAFVEAKRGEEILKAEEMAAKYRATGLAPKK  185

Query  1212  AFGCFG  1229
               GCFG
Sbjct  186   LLGCFG  191



>ref|NP_001048576.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAD22865.1| putative DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF10490.1| Os02g0824500 [Oryza sativa Japonica Group]
 dbj|BAG99202.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58077.1| hypothetical protein OsJ_08942 [Oryza sativa Japonica Group]
Length=179

 Score = 80.1 bits (196),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E+LE+KKAEYAEKM N+ A +HK AEEKR+ + + R+E+++K EEMAAK R+ G  P K
Sbjct  113   EEKLERKKAEYAEKMRNQVAAIHKAAEEKRATVEATRHEEIIKYEEMAAKHRSKGTTPTK  172

Query  1212  AFGCFG  1229
                CFG
Sbjct  173   FLSCFG  178


 Score = 40.0 bits (92),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK++ +LSWENT+KA IEAKL+  E
Sbjct  86   KAQKKMSSILSWENTRKAAIEAKLRTQE  113



>ref|XP_007143402.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
 gb|ESW15396.1| hypothetical protein PHAVU_007G069500g [Phaseolus vulgaris]
Length=198

 Score = 87.8 bits (216),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKAEY EK+ NK A +H+EAEEKR+ I +++ E  LK EE +A++RATG  PK
Sbjct  133   IEEQLEKKKAEYGEKLKNKIATIHREAEEKRAFIEAKKGEDFLKAEETSARYRATGTAPK  192

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  193   KLFGCF  198


 Score = 31.6 bits (70),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A K ++ + +WEN+KKA  EA+L+KIE
Sbjct  106  NKAHKNISAISAWENSKKAATEAELRKIE  134



>gb|EPS61469.1| hypothetical protein M569_13328, partial [Genlisea aurea]
Length=131

 Score = 83.2 bits (204),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLEKK+AE+ EK++N+ A +HK AEEKR+VI + R +++LK EE AAK+RATG  PK
Sbjct  66    LEEQLEKKRAEFLEKLNNQIAQIHKSAEEKRAVIEANRGQEILKAEETAAKYRATGTAPK  125

Query  1209  KAFGCF  1226
             K  G F
Sbjct  126   KLLGLF  131


 Score = 36.2 bits (82),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQ+KLA +  WEN+KKA++EA+LKK+E
Sbjct  40   KAQRKLAAIGVWENSKKASLEAELKKLE  67



>ref|XP_002877638.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53897.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 82.0 bits (201),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++EQL KKKA Y E+M NK A +HK+AEEKR++  ++R E VLK EEMAAK+RAT
Sbjct  105   AELKMIEEQLLKKKARYTEQMKNKIAQIHKKAEEKRAMTEAKRGEDVLKAEEMAAKYRAT  164

Query  1194  GQVPKKAFGCF  1226
             G  P K FG F
Sbjct  165   GTAPTKLFGLF  175


 Score = 37.0 bits (84),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WEN+KKA +EA+LK IE
Sbjct  84   KAQKKLSSVGAWENSKKACVEAELKMIE  111



>ref|XP_003638357.1| Remorin [Medicago truncatula]
 gb|AFK36180.1| unknown [Medicago truncatula]
 gb|KEH43717.1| carboxy-terminal region remorin [Medicago truncatula]
Length=209

 Score = 85.9 bits (211),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLEKKK EYAEK+ NK A +HK AEEK+++I +++ E +LK EE+AAK+RATG  PK
Sbjct  144   LEEQLEKKKGEYAEKLKNKIAALHKAAEEKKAMIEAKKGEDLLKAEEIAAKYRATGTAPK  203

Query  1209  KAFGCF  1226
             K FG F
Sbjct  204   KLFGLF  209


 Score = 33.1 bits (74),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQ++L+ + +WEN+KKA  EA+L+K+E
Sbjct  118  KAQRRLSTITAWENSKKAAKEAELRKLE  145



>ref|XP_006363315.1| PREDICTED: remorin [Solanum tuberosum]
Length=185

 Score = 81.3 bits (199),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +EQL KKKAEY EK+ NK ALVHK AEEKR++  ++R E +L  EEMAAK RATG  PKK
Sbjct  120   EEQLLKKKAEYIEKLKNKIALVHKSAEEKRAITEAKRGEDLLTAEEMAAKCRATGSSPKK  179

Query  1212  A-FGCF  1226
                GCF
Sbjct  180   PLLGCF  185


 Score = 37.4 bits (85),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK +++L+WEN+KKA++EA+LK+ E
Sbjct  93   KAQKKRSEILAWENSKKASLEAELKRTE  120



>ref|NP_001274955.1| putative remorin a3b4 [Solanum tuberosum]
 gb|ACB28484.1| putative remorin a3b4 [Solanum tuberosum]
Length=199

 Score = 80.5 bits (197),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +EQL KKKAEY EK+ NK AL+HKEAEEKR++  ++R E +L  EEMA K RATG  PKK
Sbjct  134   EEQLLKKKAEYIEKLKNKIALLHKEAEEKRAITEAKRGEDLLTAEEMAPKCRATGSSPKK  193

Query  1212  A-FGCF  1226
                GCF
Sbjct  194   PLLGCF  199


 Score = 37.4 bits (85),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK +++L+WEN+KKA++EA+LK+ E
Sbjct  107  KAQKKRSEILAWENSKKASLEAELKRTE  134



>gb|AFN53683.1| hypothetical protein [Linum usitatissimum]
Length=422

 Score = 85.1 bits (209),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 2/67 (3%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E+LEK+KAEYAEKM NK A +HK AEEKR+ I ++R E +LK EEMAAK+RATG  PK 
Sbjct  356   EEKLEKQKAEYAEKMKNKIAEIHKLAEEKRATIEAKRGEDMLKAEEMAAKYRATGTTPKN  415

Query  1212  --AFGCF  1226
                FGCF
Sbjct  416   PLGFGCF  422


 Score = 33.1 bits (74),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK++ + SWEN+KKA +EA+L++ E
Sbjct  329  KAHKKVSAIESWENSKKAAVEAQLRQYE  356



>ref|NP_001275297.1| putative remorin a4-e8 [Solanum tuberosum]
 gb|ABU49728.1| putative remorin a4-e8 [Solanum tuberosum]
Length=196

 Score = 80.1 bits (196),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +EQL KKKAEY EK+ NK ALVHK AEEKR++  ++R E +L  EEMA K RATG  PKK
Sbjct  131   EEQLLKKKAEYIEKLKNKIALVHKSAEEKRAITEAKRGEDLLTAEEMAPKCRATGSSPKK  190

Query  1212  A-FGCF  1226
                GCF
Sbjct  191   PLLGCF  196


 Score = 37.4 bits (85),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK +++L+WEN+KKA++EA+LK+ E
Sbjct  104  KAQKKRSEILAWENSKKASLEAELKRTE  131



>ref|XP_009392263.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=164

 Score = 81.6 bits (200),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVP-  1205
             +++ LE KKAE  EK+ NK A+VHK AEEKR+++ ++R E++LK EE AAK+RATG+ P 
Sbjct  96    IEQNLENKKAETKEKIKNKIAMVHKAAEEKRAMVEAKRGEELLKVEEAAAKYRATGKPPK  155

Query  1206  KKAFGCFG  1229
             KK FGCFG
Sbjct  156   KKGFGCFG  163


 Score = 35.4 bits (80),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKK + + SWEN+KKA+++++L+KIE
Sbjct  70   KAQKKKSSITSWENSKKASLQSQLQKIE  97



>ref|XP_009770981.1| PREDICTED: remorin-like [Nicotiana sylvestris]
Length=178

 Score = 78.6 bits (192),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  1014  ANANYLQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRAT  1193
             A    ++EQL KKKAEY EKM NK AL+HK AEEKR++I ++R E +L  EE AAK RAT
Sbjct  107   AELKRIEEQLLKKKAEYIEKMKNKIALLHKSAEEKRAIIEAKRGEDLLMAEETAAKHRAT  166

Query  1194  GQVPKKA-FGCF  1226
                PKK   GCF
Sbjct  167   ETSPKKPLLGCF  178


 Score = 38.9 bits (89),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +AQ+K +++L+WEN+KKA++EA+LK+IE
Sbjct  85   NKAQRKQSEILAWENSKKASLEAELKRIE  113



>emb|CDY06318.1| BnaA09g48850D [Brassica napus]
Length=195

 Score = 78.2 bits (191),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  141   YGEKMKNKVAAIHKEAEEKRAMVEAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 38.9 bits (89),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN++KA IEA+L+
Sbjct  104  KAQKKVSDVLAWENSQKAAIEARLR  128



>ref|XP_002510796.1| Remorin, putative [Ricinus communis]
 gb|EEF51398.1| Remorin, putative [Ricinus communis]
Length=182

 Score = 80.1 bits (196),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK AL+HKEAEEKR++I ++R E +LK EE AAK+RATG  PKK  GCF
Sbjct  128   YVEKMKNKIALIHKEAEEKRAMIEAKRGEDLLKAEETAAKYRATGTAPKKLLGCF  182


 Score = 37.0 bits (84),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKI  945
            +A KKL+ ++SWEN+KKA++EA+LK++
Sbjct  91   KAHKKLSAIVSWENSKKASVEAELKQM  117



>ref|XP_010061093.1| PREDICTED: remorin-like isoform X3 [Eucalyptus grandis]
 gb|KCW90708.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=265

 Score = 78.6 bits (192),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A  HK AEEKR++I ++R E +LK EE+AAK+RA G  PK
Sbjct  200   IEEKLEKQKAEYVEKMKNKIAAFHKAAEEKRALIEAKRGEDILKAEELAAKYRAKGTTPK  259

Query  1209  KAFGCF  1226
             K    F
Sbjct  260   KLLSIF  265


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  174  KAHKKLSAIGAWENSKKASVEAELKKIE  201



>ref|XP_010061098.1| PREDICTED: remorin-like isoform X4 [Eucalyptus grandis]
 gb|KCW90711.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=264

 Score = 78.6 bits (192),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A  HK AEEKR++I ++R E +LK EE+AAK+RA G  PK
Sbjct  199   IEEKLEKQKAEYVEKMKNKIAAFHKAAEEKRALIEAKRGEDILKAEELAAKYRAKGTTPK  258

Query  1209  KAFGCF  1226
             K    F
Sbjct  259   KLLSIF  264


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  173  KAHKKLSAIGAWENSKKASVEAELKKIE  200



>gb|KCW90710.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=265

 Score = 78.6 bits (192),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A  HK AEEKR++I ++R E +LK EE+AAK+RA G  PK
Sbjct  200   IEEKLEKQKAEYVEKMKNKIAAFHKAAEEKRALIEAKRGEDILKAEELAAKYRAKGTTPK  259

Query  1209  KAFGCF  1226
             K    F
Sbjct  260   KLLSIF  265


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  174  KAHKKLSAIGAWENSKKASVEAELKKIE  201



>ref|XP_010061078.1| PREDICTED: remorin-like isoform X1 [Eucalyptus grandis]
Length=275

 Score = 78.6 bits (192),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A  HK AEEKR++I ++R E +LK EE+AAK+RA G  PK
Sbjct  210   IEEKLEKQKAEYVEKMKNKIAAFHKAAEEKRALIEAKRGEDILKAEELAAKYRAKGTTPK  269

Query  1209  KAFGCF  1226
             K    F
Sbjct  270   KLLSIF  275


 Score = 38.1 bits (87),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  184  KAHKKLSAIGAWENSKKASVEAELKKIE  211



>ref|XP_008376569.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376570.1| PREDICTED: remorin-like [Malus domestica]
 ref|XP_008376572.1| PREDICTED: remorin-like [Malus domestica]
Length=211

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY E+M NK AL+HK AEEKR+V+ ++R E +LK EE AAK+RATG+ PK
Sbjct  146   IEEKLEKQKAEYMEQMKNKIALIHKAAEEKRAVVEAKRGEDLLKAEEAAAKYRATGKTPK  205

Query  1209  KAFGCF  1226
             K  GCF
Sbjct  206   KLLGCF  211



>ref|XP_010061086.1| PREDICTED: remorin-like isoform X2 [Eucalyptus grandis]
 gb|KCW90709.1| hypothetical protein EUGRSUZ_A02793 [Eucalyptus grandis]
Length=274

 Score = 78.6 bits (192),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY EKM NK A  HK AEEKR++I ++R E +LK EE+AAK+RA G  PK
Sbjct  209   IEEKLEKQKAEYVEKMKNKIAAFHKAAEEKRALIEAKRGEDILKAEELAAKYRAKGTTPK  268

Query  1209  KAFGCF  1226
             K    F
Sbjct  269   KLLSIF  274


 Score = 38.1 bits (87),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN+KKA++EA+LKKIE
Sbjct  183  KAHKKLSAIGAWENSKKASVEAELKKIE  210



>ref|XP_010676488.1| PREDICTED: remorin [Beta vulgaris subsp. vulgaris]
Length=196

 Score = 76.6 bits (187),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             YAEKM NK A VHK A+EKR++I  Q+ E+VLK EE AAK+RATG VPKK  GCF
Sbjct  142   YAEKMKNKVAEVHKLAQEKRAMIECQKGEEVLKAEECAAKYRATGHVPKKFLGCF  196


 Score = 40.0 bits (92),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +A KKL+DV SWEN+KKANIEA+L+
Sbjct  105  KACKKLSDVTSWENSKKANIEAQLR  129



>ref|XP_011022731.1| PREDICTED: remorin-like [Populus euphratica]
Length=189

 Score = 84.0 bits (206),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +E+LE+KKAEYAEKM NK A +HK AEEK+++I ++++E+ LK EE AAKFRATG  PK
Sbjct  122   FEEKLERKKAEYAEKMKNKAAELHKAAEEKKAMIEAKKSEECLKVEETAAKFRATGYAPK  181

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  182   KFLGCFS  188


 Score = 32.7 bits (73),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWE TKK ++EAK+ K E
Sbjct  96   KAHKKLSAIGSWETTKKVSVEAKIMKFE  123



>emb|CDY37068.1| BnaA04g26460D [Brassica napus]
Length=195

 Score = 78.2 bits (191),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  141   YGEKMKNKVAAIHKEAEEKRAMVEAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 38.1 bits (87),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN++KA +EA+L+
Sbjct  104  KAQKKVSDVLAWENSQKAAVEAQLR  128



>ref|XP_009142370.1| PREDICTED: remorin [Brassica rapa]
Length=195

 Score = 78.2 bits (191),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  141   YGEKMKNKVAAIHKEAEEKRAMVEAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 38.1 bits (87),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN++KA +EA+L+
Sbjct  104  KAQKKVSDVLAWENSQKAAVEAQLR  128



>gb|AFK41243.1| unknown [Lotus japonicus]
Length=215

 Score = 84.3 bits (207),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKA Y EK+ NK A+VH+EAEEKR+ I +++ E +LKTEE+AAK+RATG  PK
Sbjct  150   IEENLEKKKAVYVEKLKNKIAMVHREAEEKRAFIEAKKGEDLLKTEELAAKYRATGTAPK  209

Query  1209  KAFGCF  1226
             K F  F
Sbjct  210   KPFSFF  215


 Score = 32.0 bits (71),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             +A KKL+D+ +WEN+K A  E +L+KIE
Sbjct  123  NKAHKKLSDISAWENSKIAAKEVELRKIE  151



>ref|XP_003569966.1| PREDICTED: remorin-like isoform X1 [Brachypodium distachyon]
Length=193

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK A+VHKEAEEKR+++V++R E VLK EEMAA++RATG  PKK  GCFG
Sbjct  137   YAEKMKNKKAIVHKEAEEKRAMVVARRGEDVLKAEEMAARYRATGLAPKKVLGCFG  192



>ref|XP_004986023.1| PREDICTED: remorin-like [Setaria italica]
Length=187

 Score = 76.6 bits (187),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA Y EK+ NK A++HK AEEKR++  ++R E+++  EE+AAK+RA G+ P 
Sbjct  120   IEEQLEKKKAAYEEKLKNKLAMLHKTAEEKRALTEAKRGEEIIMAEELAAKYRAKGEAPT  179

Query  1209  KAFGCF  1226
             K FG  
Sbjct  180   KLFGLL  185


 Score = 39.3 bits (90),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKLA + SWEN KKA +EA+LKKIE
Sbjct  94   RAAKKLAYITSWENAKKAEMEAELKKIE  121



>ref|XP_004953259.1| PREDICTED: remorin-like isoform X1 [Setaria italica]
Length=183

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             AEYAEKM NK A++H+ AEEKR+++++QR E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  125   AEYAEKMKNKKAIIHRRAEEKRAMVMAQRGEEVLKAEEMAAKYRATGLAPKKFLGCFG  182



>ref|XP_010235770.1| PREDICTED: remorin-like isoform X2 [Brachypodium distachyon]
Length=177

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK A+VHKEAEEKR+++V++R E VLK EEMAA++RATG  PKK  GCFG
Sbjct  121   YAEKMKNKKAIVHKEAEEKRAMVVARRGEDVLKAEEMAARYRATGLAPKKVLGCFG  176



>emb|CDY27356.1| BnaC04g50490D [Brassica napus]
Length=195

 Score = 76.6 bits (187),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HK+AEEKR+++ ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  141   YGEKMKNKVAAIHKQAEEKRAMVEAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 38.5 bits (88),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN++KA IEA+L+
Sbjct  104  KAQKKVSDVLAWENSQKAAIEARLR  128



>ref|XP_006295053.1| hypothetical protein CARUB_v10024121mg [Capsella rubella]
 gb|EOA27951.1| hypothetical protein CARUB_v10024121mg [Capsella rubella]
Length=191

 Score = 76.6 bits (187),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  137   YGEKMKNKVAAIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 38.5 bits (88),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK++DV +WEN+KKA +EA+L+
Sbjct  100  RAQKKISDVHAWENSKKAAVEAQLR  124



>gb|EPS69897.1| hypothetical protein M569_04866 [Genlisea aurea]
Length=170

 Score = 80.5 bits (197),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L+EQLEKKK+ Y EK+ NK AL+HK AEEKR+VI + +  ++LK EE AAK+RATG  PK
Sbjct  105   LEEQLEKKKSGYLEKVKNKIALIHKAAEEKRAVIEAVQGGELLKAEETAAKYRATGSAPK  164

Query  1209  KAFGCF  1226
             K   CF
Sbjct  165   KILRCF  170


 Score = 33.9 bits (76),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ +  WE++K+A++EA+LKK+E
Sbjct  79   KAQKKLSAIGVWEDSKRASLEAELKKLE  106



>ref|XP_004976344.1| PREDICTED: remorin-like [Setaria italica]
Length=212

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK A++HKEAEEKR+++ ++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  156   YAEKMKNKVAIIHKEAEEKRAMVEAKRGEEVLKAEEMAAKYRATGHAPKKLIGCFG  211



>ref|XP_009383123.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=180

 Score = 75.5 bits (184),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E+LEKKKA+  EK  NK A++HKEAEE+R+++ S+  E++L+ EE  AK+ +TG  PKK
Sbjct  111   EERLEKKKADSEEKAKNKIAMIHKEAEERRAMVESKHGEELLRAEEAVAKYHSTGHTPKK  170

Query  1212  AFGCF  1226
               GCF
Sbjct  171   GAGCF  175


 Score = 38.5 bits (88),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQ+K++ +LSWENTK A IEA++KK E
Sbjct  84   KAQRKMSSILSWENTKMATIEAEIKKNE  111



>ref|XP_002270914.1| PREDICTED: uncharacterized protein At3g61260 [Vitis vinifera]
 emb|CBI40326.3| unnamed protein product [Vitis vinifera]
Length=196

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK AL+HK+AEEK+++I ++R E+ LK EEMAAKFRATGQ PKK  GCFG
Sbjct  140   YAEKMKNKVALIHKQAEEKKAMIEARRGEEFLKAEEMAAKFRATGQTPKKVLGCFG  195



>gb|AFK45936.1| unknown [Lotus japonicus]
Length=215

 Score = 82.0 bits (201),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKA Y EK+ NK A+VH+EAEEKR+ I +++ E +LK EE+AAK+RATG  PK
Sbjct  150   IEENLEKKKAVYVEKLKNKIAMVHREAEEKRAFIEAKKGEDLLKAEELAAKYRATGTAPK  209

Query  1209  KAFGCF  1226
             K F  F
Sbjct  210   KPFSFF  215


 Score = 32.0 bits (71),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+D+ +WEN+K A  E +L+KIE
Sbjct  124  KAHKKLSDISAWENSKIAAKEVELRKIE  151



>ref|XP_002304484.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
 gb|EEE79463.1| hypothetical protein POPTR_0003s12450g [Populus trichocarpa]
Length=189

 Score = 81.6 bits (200),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +E+LE+KKAEY EKM NK A +HK AEEK+++I ++++E+ LK EE AAKFRATG  PK
Sbjct  122   FEEKLERKKAEYEEKMKNKAAELHKAAEEKKAMIEAKKSEECLKVEETAAKFRATGYTPK  181

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  182   KFLGCFS  188


 Score = 32.3 bits (72),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + SWE TKK ++EAK+ K E
Sbjct  96   KAHKKLSAIGSWETTKKVSVEAKIMKFE  123



>ref|XP_002465999.1| hypothetical protein SORBIDRAFT_01g049810 [Sorghum bicolor]
 gb|EER92997.1| hypothetical protein SORBIDRAFT_01g049810 [Sorghum bicolor]
Length=181

 Score = 74.7 bits (182),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA Y EK+ NK A++HK AEE+R+   ++R E+++  EEMAAK+RA G+ P 
Sbjct  114   IEEQLEKKKAAYEEKLKNKLAMLHKTAEERRAQTEAKRGEEIILAEEMAAKYRAKGEAPT  173

Query  1209  KAFGCF  1226
             K FG  
Sbjct  174   KLFGLL  179


 Score = 39.3 bits (90),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKLA + SWEN KKA +EA+LKKIE
Sbjct  88   RAAKKLAFITSWENAKKAEMEAELKKIE  115



>ref|XP_010518225.1| PREDICTED: remorin [Camelina sativa]
Length=191

 Score = 76.6 bits (187),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  137   YGEKMKNKVAAIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 37.4 bits (85),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK +DV +WEN+KKA +EA+L+
Sbjct  100  RAQKKTSDVHAWENSKKAAVEAQLR  124



>ref|NP_001048722.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|ABF93596.1| Remorin, C-terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10636.1| Os03g0111200 [Oryza sativa Japonica Group]
 gb|EAY88244.1| hypothetical protein OsI_09695 [Oryza sativa Indica Group]
 gb|EAZ25323.1| hypothetical protein OsJ_09134 [Oryza sativa Japonica Group]
 dbj|BAG87426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 76.3 bits (186),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++++LEKKKA Y EK+ NK AL+HK AEEKR++  ++R E+++  EEMAAK+RA G+ P 
Sbjct  108   IEQELEKKKAAYEEKLKNKLALLHKTAEEKRALTTAKRGEELIMAEEMAAKYRAKGEAPT  167

Query  1209  KAFGCF  1226
             K FG  
Sbjct  168   KLFGLL  173


 Score = 37.4 bits (85),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKL+ + SWEN KKA +EA+LK+IE
Sbjct  82   RAAKKLSYITSWENAKKAEMEAELKRIE  109



>ref|XP_008439225.1| PREDICTED: remorin-like [Cucumis melo]
Length=202

 Score = 77.4 bits (189),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK AL+HK AEEK++VI ++R E+ LK EE+AAK RATG  PKK FGCF
Sbjct  146   YIEKMKNKIALIHKTAEEKKAVIEAKRGEEKLKAEEIAAKHRATGTAPKKIFGCF  200


 Score = 36.6 bits (83),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKI  945
            RA KKL+ + SWEN+KKA +EA+LK+I
Sbjct  109  RAHKKLSAIGSWENSKKAAVEAELKQI  135



>ref|XP_006341797.1| PREDICTED: remorin-like [Solanum tuberosum]
Length=191

 Score = 80.1 bits (196),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             L++QLE KKAEYAEK+ N+ AL+ +EA+EKR+V+ +++ E+ LK EE AA++RATGQ PK
Sbjct  123   LEDQLEHKKAEYAEKIKNEVALIRQEADEKRAVVEARQGEEFLKAEETAARYRATGQTPK  182

Query  1209  K-AFGCFG  1229
             K   GC G
Sbjct  183   KQLLGCCG  190


 Score = 33.5 bits (75),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WE T  A +EAKLK++E
Sbjct  97   KAQKKLSAVATWEKTHTAKLEAKLKQLE  124



>ref|XP_010508104.1| PREDICTED: remorin-like [Camelina sativa]
Length=191

 Score = 76.3 bits (186),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  137   YGEKMKNKVAAIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 37.4 bits (85),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK +DV +WEN+KKA +EA+L+
Sbjct  100  RAQKKTSDVHAWENSKKAAVEAQLR  124



>emb|CAN75437.1| hypothetical protein VITISV_000833 [Vitis vinifera]
Length=196

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK AL+HK+AEEK+++I ++R E+ LK EEMAAKFRATGQ PKK  GCFG
Sbjct  140   YAEKMKNKVALIHKQAEEKKAMIEARRGEEFLKAEEMAAKFRATGQTPKKVLGCFG  195



>ref|XP_010506561.1| PREDICTED: remorin-like [Camelina sativa]
Length=191

 Score = 76.3 bits (186),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HKEAEEKR+++ +++ E++LK EEMAAK+RATG VPK   GCF
Sbjct  137   YGEKMKNKVAAIHKEAEEKRAMVEAKKGEELLKAEEMAAKYRATGVVPKATCGCF  191


 Score = 37.4 bits (85),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK +DV +WEN+KKA +EA+L+
Sbjct  100  RAQKKTSDVHAWENSKKAAVEAQLR  124



>ref|XP_006649253.1| PREDICTED: remorin-like [Oryza brachyantha]
Length=174

 Score = 76.3 bits (186),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQLEKKKA Y EK+ NK AL+HK AEEKR++  ++R E+++  EE+AAK+RA G+ P 
Sbjct  107   IEEQLEKKKAAYEEKLKNKLALLHKTAEEKRAMTEAKRGEELIMAEELAAKYRAKGEAPT  166

Query  1209  KAFGCF  1226
             K FG  
Sbjct  167   KLFGLL  172


 Score = 37.4 bits (85),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKL+ + SWEN KKA +EA+LK+IE
Sbjct  81   RAAKKLSYITSWENAKKAEMEAELKRIE  108



>ref|XP_009409422.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=192

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             AEYAEKM NK AL+HKEAEEKR++I ++R E++LK +E+AAK+RATG  PKK  GCFG
Sbjct  134   AEYAEKMKNKVALLHKEAEEKRAMIEARRGEELLKADEVAAKYRATGLAPKKLLGCFG  191



>ref|XP_002882035.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58294.1| hypothetical protein ARALYDRAFT_483720 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 73.6 bits (179),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             A+Y EKM NK A +HK AEEKR+++ +++ E++LK EEM AK+RATG VPK   GCF
Sbjct  134   AQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF  190


 Score = 39.7 bits (91),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK++DV +WENTKKA +EA+L+
Sbjct  99   RAQKKISDVHAWENTKKAAVEAQLR  123



>ref|XP_006590251.1| PREDICTED: uncharacterized protein LOC100305683 isoform X1 [Glycine 
max]
Length=215

 Score = 79.7 bits (195),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E +EKKKAEY EKM NK A +H+ AEEK++++ +Q+ E+ +  EE A+KFR+ G VP+
Sbjct  148   IEESMEKKKAEYVEKMKNKIAEIHRLAEEKKAIVEAQKREEFIDLEETASKFRSRGDVPR  207

Query  1209  KAFGCFG  1229
             K F CFG
Sbjct  208   KFFACFG  214


 Score = 33.1 bits (74),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA KK + V  WE++KKA++EA+LKKIE
Sbjct  121  NRAYKKHSAVGLWEDSKKASVEAQLKKIE  149



>ref|XP_009627101.1| PREDICTED: remorin-like [Nicotiana tomentosiformis]
Length=198

 Score = 82.4 bits (202),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+ E+KKAEY EKM NK A++H+EAEEKR++I + R +  LK EE AAKF  TG +PK
Sbjct  132   IEEEFERKKAEYEEKMKNKMAVIHREAEEKRALIEANRGQDFLKVEETAAKFHVTG-IPK  190

Query  1209  KAFGCFG  1229
             K  GCFG
Sbjct  191   KFLGCFG  197


 Score = 30.4 bits (67),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ V +WE++KKA IE +LK+IE
Sbjct  106  KAFKKLSAVGAWESSKKATIEFELKQIE  133



>ref|XP_006397772.1| hypothetical protein EUTSA_v10001646mg [Eutrema salsugineum]
 gb|ESQ39225.1| hypothetical protein EUTSA_v10001646mg [Eutrema salsugineum]
Length=195

 Score = 75.1 bits (183),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HK AEEKR+++ ++R E++LK EEMAAK+RATG VPK   GCF
Sbjct  141   YGEKMKNKVAAIHKLAEEKRAMVEAKRGEELLKAEEMAAKYRATGIVPKATCGCF  195


 Score = 37.7 bits (86),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN+KKA  EA+L+
Sbjct  104  KAQKKISDVLAWENSKKAATEAQLR  128



>ref|NP_001235241.1| uncharacterized protein LOC100305683 [Glycine max]
 gb|ACU13494.1| unknown [Glycine max]
Length=190

 Score = 79.3 bits (194),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E +EKKKAEY EKM NK A +H+ AEEK++++ +Q+ E+ +  EE A+KFR+ G VP+
Sbjct  123   IEESMEKKKAEYVEKMKNKIAEIHRLAEEKKAIVEAQKREEFIDLEEAASKFRSRGDVPR  182

Query  1209  KAFGCFG  1229
             K F CFG
Sbjct  183   KFFACFG  189


 Score = 33.1 bits (74),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KK + V  WE++KKA++EA+LKKIE
Sbjct  97   RAYKKHSAVGLWEDSKKASVEAQLKKIE  124



>gb|EMS55630.1| hypothetical protein TRIUR3_02968 [Triticum urartu]
Length=193

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM N+ A+ H+EAEEKR+++V++R E+VLK EEMAAK+RATG  PKK  GCFG
Sbjct  137   YAEKMKNRKAIAHREAEEKRAMVVARRGEEVLKAEEMAAKYRATGLAPKKLLGCFG  192



>gb|EPS59685.1| hypothetical protein M569_15119, partial [Genlisea aurea]
Length=137

 Score = 79.3 bits (194),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
               E+LEKKKA YAEK+ NK A++HK+AEE+R+ ++++R E+ LK +E AAKFRA GQ+P 
Sbjct  72    FDEELEKKKAGYAEKVKNKLAIIHKQAEEQRAEVLAKRGEEQLKADEAAAKFRAAGQIPP  131

Query  1209  KAFGCF  1226
                GC 
Sbjct  132   TGCGCL  137


 Score = 33.1 bits (74),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +A+KKL++V SWEN+K+A +E KLK
Sbjct  46   KAEKKLSEVNSWENSKRAALEGKLK  70


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR  665
            DIALAK++DDKR+SFIKAWE+SEK+K +N+
Sbjct  17   DIALAKVDDDKRLSFIKAWEDSEKTKAQNK  46



>ref|NP_182106.1| Remorin family protein [Arabidopsis thaliana]
 sp|O80837.1|REMO_ARATH RecName: Full=Remorin; AltName: Full=DNA-binding protein [Arabidopsis 
thaliana]
 gb|AAC28542.1| remorin [Arabidopsis thaliana]
 gb|AAK76670.1| putative remorin protein [Arabidopsis thaliana]
 gb|AAL85060.1| putative remorin protein [Arabidopsis thaliana]
 gb|AEC10605.1| Remorin family protein [Arabidopsis thaliana]
Length=190

 Score = 73.6 bits (179),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             A+Y EKM NK A +HK AEEKR+++ +++ E++LK EEM AK+RATG VPK   GCF
Sbjct  134   AQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF  190


 Score = 38.1 bits (87),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK++DV +WEN+KKA +EA+L+
Sbjct  99   RAQKKISDVHAWENSKKAAVEAQLR  123



>ref|XP_003558995.1| PREDICTED: remorin-like [Brachypodium distachyon]
Length=179

 Score = 77.0 bits (188),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKA Y EK+ NK A++HK AEEKR++  ++R E+++ TEEMAAK+RA G+ P 
Sbjct  112   IEENLEKKKASYQEKLKNKLAMLHKSAEEKRAMAEAKRGEEIVMTEEMAAKYRAKGEAPT  171

Query  1209  KAFGCF  1226
             K FG  
Sbjct  172   KLFGLM  177


 Score = 34.7 bits (78),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA K L+ + SWE+ KKA +EA+LKKIE
Sbjct  86   RAAKNLSFITSWEHAKKAEMEAELKKIE  113



>gb|KHN35009.1| Remorin [Glycine soja]
Length=191

 Score = 79.7 bits (195),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E +EKKKAEY EKM NK A +H+ AEEK++++ +Q+ E+ +  EE A+KFR+ G VP+
Sbjct  124   IEESMEKKKAEYVEKMKNKIAEIHRLAEEKKAIVEAQKREEFIDLEETASKFRSRGDVPR  183

Query  1209  KAFGCFG  1229
             K F CFG
Sbjct  184   KFFACFG  190


 Score = 31.6 bits (70),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK + V  WE++KKA++EA+LKKIE
Sbjct  98   QAYKKHSAVGLWEDSKKASVEAQLKKIE  125



>gb|KHN25717.1| Remorin [Glycine soja]
Length=146

 Score = 75.9 bits (185),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK A +H  AEEKR+V+ +Q+ E+ +  EE A+KFR+ G  P+
Sbjct  79    IEENLEKKKAEYVEKMKNKVAKIHLLAEEKRAVVEAQKREEFIDLEETASKFRSRGDTPR  138

Query  1209  KAFGCFG  1229
             + F CF 
Sbjct  139   RFFACFS  145


 Score = 35.4 bits (80),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +1

Query  859  FG-RAQKKLADVLSWENTKKANIEAKLKKIE  948
            FG +A K+L+ V  WE++KKA++EA+LKKIE
Sbjct  50   FGSKAYKRLSAVGFWEDSKKASVEAQLKKIE  80



>ref|XP_006573768.1| PREDICTED: remorin-like isoform X2 [Glycine max]
Length=188

 Score = 75.9 bits (185),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK A +H  AEEKR+V+ +Q+ E+ +  EE A+KFR+ G  P+
Sbjct  121   IEENLEKKKAEYVEKMKNKVAKIHLLAEEKRAVVEAQKREEFIDLEETASKFRSRGDTPR  180

Query  1209  KAFGCFG  1229
             + F CF 
Sbjct  181   RFFACFS  187


 Score = 35.0 bits (79),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA K+L+ V  WE++KKA++EA+LKKIE
Sbjct  94   NRAYKRLSAVGFWEDSKKASVEAQLKKIE  122



>ref|XP_003516694.1| PREDICTED: remorin-like isoform X1 [Glycine max]
Length=191

 Score = 75.9 bits (185),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LEKKKAEY EKM NK A +H  AEEKR+V+ +Q+ E+ +  EE A+KFR+ G  P+
Sbjct  124   IEENLEKKKAEYVEKMKNKVAKIHLLAEEKRAVVEAQKREEFIDLEETASKFRSRGDTPR  183

Query  1209  KAFGCFG  1229
             + F CF 
Sbjct  184   RFFACFS  190


 Score = 35.0 bits (79),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA K+L+ V  WE++KKA++EA+LKKIE
Sbjct  97   NRAYKRLSAVGFWEDSKKASVEAQLKKIE  125



>ref|XP_010089139.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB37386.1| Pollen-specific protein SF3 [Morus notabilis]
Length=421

 Score = 79.0 bits (193),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEKK+AEY EKM NK A VHK AEEKR+ + + + E+ LK EE AAKFRA+G  PK
Sbjct  147   IEEKLEKKRAEYTEKMKNKVAEVHKLAEEKRAFVEANKREECLKVEETAAKFRASGFKPK  206

Query  1209  KAFGCFG  1229
             K   CFG
Sbjct  207   KLLRCFG  213


 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KK + V +WEN+K+A +EA+L+ IE
Sbjct  121  KAYKKFSAVGAWENSKRAAVEAELRAIE  148



>ref|XP_004511589.1| PREDICTED: remorin-like isoform X2 [Cicer arietinum]
Length=202

 Score = 79.0 bits (193),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +++LE+KK EY EKM N+ A +H+ AEEKR+++ +Q+ E++L+ EE A+KFR+ G VP+
Sbjct  135   FEDKLERKKVEYVEKMKNEIAEIHQYAEEKRAIVEAQKGEEILELEETASKFRSRGVVPR  194

Query  1209  KAFGCFG  1229
             K FGCF 
Sbjct  195   KFFGCFS  201


 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA KK + V+ WE ++KA+IEA+LKK E
Sbjct  108  NRAYKKQSAVVLWEESRKASIEAQLKKFE  136



>ref|XP_004511588.1| PREDICTED: remorin-like isoform X1 [Cicer arietinum]
Length=204

 Score = 78.6 bits (192),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +++LE+KK EY EKM N+ A +H+ AEEKR+++ +Q+ E++L+ EE A+KFR+ G VP+
Sbjct  137   FEDKLERKKVEYVEKMKNEIAEIHQYAEEKRAIVEAQKGEEILELEETASKFRSRGVVPR  196

Query  1209  KAFGCF  1226
             K FGCF
Sbjct  197   KFFGCF  202


 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KK + V+ WE ++KA+IEA+LKK E
Sbjct  111  RAYKKQSAVVLWEESRKASIEAQLKKFE  138



>ref|XP_006648879.1| PREDICTED: uncharacterized protein At3g61260-like [Oryza brachyantha]
Length=204

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             AEY EK  NK A+VH+EAEEKR++++++R E+V+K EEMAAK+RATG  PKK  GCFG
Sbjct  146   AEYGEKAKNKEAIVHREAEEKRAMVMARRGEEVIKAEEMAAKYRATGVTPKKNLGCFG  203


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 12/52 (23%)
 Frame = +3

Query  579  IALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILW  734
            +ALAK+E DKR S IKAWE++EK+K ENR            ++  LLD+I W
Sbjct  83   VALAKVETDKRESLIKAWEDNEKAKAENR------------ASKKLLDIISW  122



>ref|XP_009143176.1| PREDICTED: remorin-like [Brassica rapa]
 emb|CDX74768.1| BnaA05g05140D [Brassica napus]
Length=192

 Score = 72.4 bits (176),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             Y EKM NK A +HK+AEEKR+++ +++ E++LK EE AAK+RATG VPK   GCF
Sbjct  138   YGEKMKNKVAAIHKQAEEKRAMVEAKKGEELLKAEETAAKYRATGVVPKATCGCF  192


 Score = 37.7 bits (86),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++DVL+WEN+KKA  EA+L+
Sbjct  101  KAQKKISDVLAWENSKKAATEAQLR  125



>gb|AAA57124.1| DNA-binding protein [Arabidopsis thaliana]
Length=190

 Score = 72.0 bits (175),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             A+Y EKM NK A +HK AEEKR+++ +++ E++L+ EEM AK+RATG VPK   GCF
Sbjct  134   AQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLEAEEMGAKYRATGVVPKATCGCF  190


 Score = 38.5 bits (88),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RAQKK++DV +WEN+KKA +EA+L+
Sbjct  99   RAQKKISDVHAWENSKKAAVEAQLR  123



>ref|XP_009371326.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LEK+KAEY E+M NK AL+HK AEEKR+V+ ++  E +LK EE AAK+RA G+ PK
Sbjct  146   IEEKLEKQKAEYVEQMKNKIALIHKAAEEKRAVVEAKCGEDLLKAEETAAKYRAKGKTPK  205

Query  1209  KAFGCFG  1229
             K  GCF 
Sbjct  206   KLLGCFS  212



>gb|AFK42693.1| unknown [Lotus japonicus]
Length=194

 Score = 77.8 bits (190),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E LE+KKAEYAEKM NK A +H+ AEEKR+ + + + E+ L+ EE AAKFR+ G  PK
Sbjct  127   IEENLERKKAEYAEKMKNKIAEIHQAAEEKRATVEANKKEEFLEVEETAAKFRSRGVAPK  186

Query  1209  KAFGCFG  1229
             K F CF 
Sbjct  187   KLFACFS  193


 Score = 31.6 bits (70),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA KK + V  WE ++KA+IEA+LKKIE
Sbjct  100  NRAYKKQSAVGLWEESRKASIEAELKKIE  128



>ref|NP_001151703.1| LOC100285339 [Zea mays]
 gb|ACG44049.1| remorin [Zea mays]
Length=182

 Score = 70.1 bits (170),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL+KKKA Y EK+ NK A++H+ AEE+R+   ++R E+ +  EEMAAK+RA G+ P 
Sbjct  115   IEEQLQKKKAAYEEKLKNKLAMLHRTAEERRAQTEARRGEETILAEEMAAKYRAKGEGPT  174

Query  1209  KAFGCF  1226
             K FG  
Sbjct  175   KLFGLL  180


 Score = 38.9 bits (89),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKLA + SWEN KKA +EA+L+KIE
Sbjct  89   RAAKKLAFITSWENAKKAEMEAELRKIE  116



>tpg|DAA42886.1| TPA: remorin [Zea mays]
Length=183

 Score = 70.1 bits (170),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++EQL+KKKA Y EK+ NK A++H+ AEE+R+   ++R E+ +  EEMAAK+RA G+ P 
Sbjct  116   IEEQLQKKKAAYEEKLKNKLAMLHRTAEERRAQTEARRGEETILAEEMAAKYRAKGEGPT  175

Query  1209  KAFGCF  1226
             K FG  
Sbjct  176   KLFGLL  181


 Score = 38.9 bits (89),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KKLA + SWEN KKA +EA+L+KIE
Sbjct  90   RAAKKLAFITSWENAKKAEMEAELRKIE  117



>ref|XP_009349347.1| PREDICTED: remorin-like [Pyrus x bretschneideri]
Length=213

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +E+LEK+KAEY E+M NK AL+HK AEEKR+V+ ++R E +LK EE AAK RATG+ PK
Sbjct  146   FEEKLEKQKAEYVEQMKNKIALIHKAAEEKRAVVEAKRGEDLLKAEETAAKCRATGKTPK  205

Query  1209  KAFGCFG  1229
             K  G F 
Sbjct  206   KLLGWFS  212



>gb|EMS52426.1| hypothetical protein TRIUR3_02712 [Triticum urartu]
Length=178

 Score = 71.6 bits (174),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCFG  1229
             YAEKM N+ A++HKEAEE+R+++ ++R E+++K +EMAAK R+ G  PKK F GCFG
Sbjct  122   YAEKMRNRVAMIHKEAEEQRALVEARRQEEMIKCQEMAAKHRSQGTTPKKKFLGCFG  178


 Score = 37.0 bits (84),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            RA+++++ ++SWENTKKA ++AKL+
Sbjct  85   RAEQRMSSIMSWENTKKAAVQAKLR  109



>gb|EYU38364.1| hypothetical protein MIMGU_mgv1a022944mg, partial [Erythranthe 
guttata]
Length=70

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             QE+ EKKKAEY EKM NK ++VH+ AEE ++ I + R  + L  EE+A+KFRATG++PKK
Sbjct  3     QEKFEKKKAEYGEKMKNKMSIVHRAAEENKASIEADRAGEFLTVEEVASKFRATGRIPKK  62

Query  1212  AFGCF  1226
              F CF
Sbjct  63    LFACF  67



>gb|ABK23302.1| unknown [Picea sitchensis]
Length=197

 Score = 80.9 bits (198),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  1032  QEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKK  1211
             +E+LEK+KA Y EKM N+ A++HK+AEEK+++  ++R E +LK EE +AK+ ATGQVPKK
Sbjct  131   EEKLEKQKAAYVEKMKNEIAIIHKQAEEKKAMAEAKRGEDMLKAEESSAKYNATGQVPKK  190

Query  1212  AFGCFG  1229
              F CFG
Sbjct  191   FFLCFG  196


 Score = 27.3 bits (59),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  874  KKLADVLSWENTKKANIEAKLKKIE  948
            K ++ + +WENTKK++ E ++K+ E
Sbjct  107  KSVSTITAWENTKKSSAETRMKRAE  131



>ref|XP_004248633.1| PREDICTED: remorin-like [Solanum lycopersicum]
Length=189

 Score = 74.7 bits (182),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVP-  1205
             L++QLE KK EYAEK+ N+ AL+ KE +EKR+ + ++R E++LK EE AA +RATGQ P 
Sbjct  121   LEDQLEHKKVEYAEKIKNEVALIRKEGDEKRAEVEARRGEELLKAEERAATYRATGQTPK  180

Query  1206  KKAFGC  1223
             KK  GC
Sbjct  181   KKLLGC  186


 Score = 33.5 bits (75),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +AQKKL+ V +WE T  A +EAKLK++E
Sbjct  95   KAQKKLSAVATWEKTHTAKLEAKLKQLE  122



>ref|NP_001047554.1| Os02g0642200 [Oryza sativa Japonica Group]
 dbj|BAD25231.1| putative remorin 1 [Oryza sativa Japonica Group]
 dbj|BAF09468.1| Os02g0642200 [Oryza sativa Japonica Group]
 gb|EAY86855.1| hypothetical protein OsI_08239 [Oryza sativa Indica Group]
 gb|EAZ23964.1| hypothetical protein OsJ_07690 [Oryza sativa Japonica Group]
 dbj|BAG97133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEK  NK A+VHKEAEEKR++++++R E+V+K EE+AAK+RATG  PKK  GCFG
Sbjct  147   YAEKAKNKEAIVHKEAEEKRAMVMARRGEEVIKAEEIAAKYRATGVTPKKHIGCFG  202


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 12/53 (23%)
 Frame = +3

Query  576  DIALAKIEDDKRVSFIKAWEESEKSKVENR*AIVFNFFFILASNMNLLDVILW  734
            DIALAK+E DKR S IKAWEE+EK+K ENR            ++  LLD+I W
Sbjct  81   DIALAKVETDKRESLIKAWEENEKAKAENR------------ASKKLLDIISW  121



>ref|XP_002452858.1| hypothetical protein SORBIDRAFT_04g033660 [Sorghum bicolor]
 gb|EES05834.1| hypothetical protein SORBIDRAFT_04g033660 [Sorghum bicolor]
Length=209

 Score = 78.6 bits (192),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  1050  KKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             KKAEY EKM NK A++H++AEEKR+++++Q  E+VLK EE+AAK+RA G  PKK  GCFG
Sbjct  149   KKAEYGEKMKNKKAVIHRQAEEKRAMVIAQCGEEVLKAEEVAAKYRAKGVAPKKFLGCFG  208


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  874  KKLADVLSWENTKKANIEA  930
            KK + +LSWENTKKA IEA
Sbjct  119  KKQSVILSWENTKKAVIEA  137



>dbj|BAJ98923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score = 67.8 bits (164),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCFG  1229
             YAEKM N+ A++HKEAEE+R+ + + R E+++K +EMAAK R+ G  PKK F  CFG
Sbjct  141   YAEKMRNRVAMIHKEAEEQRAAVEAMRQEEMIKCQEMAAKHRSKGTTPKKKFLTCFG  197


 Score = 39.7 bits (91),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLK  939
             RA+ K++ +LSWENTKKA +EAKL+
Sbjct  103  NRAEHKMSSILSWENTKKATVEAKLR  128



>ref|XP_010908427.1| PREDICTED: remorin-like isoform X2 [Elaeis guineensis]
Length=193

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK A++HK AEEKR+++ ++  E +LK EEMAAK+R+TG  PKK FGCFG
Sbjct  137   YAEKMKNKVAMIHKTAEEKRAIVEAKCGEDILKAEEMAAKYRSTGLAPKKLFGCFG  192



>gb|AFW72526.1| hypothetical protein ZEAMMB73_338346 [Zea mays]
Length=60

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             AEYAEKM NK A++HK+AEEKR+++++Q  E++LKTEEMAAK+RAT   PKK   CF
Sbjct  2     AEYAEKMKNKKAIIHKKAEEKRAMVMAQHGEEILKTEEMAAKYRATRVAPKKFLRCF  58



>ref|XP_007218390.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
 gb|EMJ19589.1| hypothetical protein PRUPE_ppa011367mg [Prunus persica]
Length=214

 Score = 74.3 bits (181),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  1050  KKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             KKAEY E+M NK AL+HK AEEKR+ I ++R E +LK EE AAK+RATG  PKK  GCF 
Sbjct  154   KKAEYVEQMKNKIALIHKAAEEKRAAIEAKRGEDLLKAEETAAKYRATGNAPKKLLGCFS  213


 Score = 32.7 bits (73),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEA  930
            +A KKL+ V SWENTKKA +EA
Sbjct  121  KAHKKLSAVGSWENTKKATVEA  142



>ref|XP_010905109.1| PREDICTED: remorin-like [Elaeis guineensis]
Length=192

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  1053  KAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             KAEYAE+M NK A+VHK AEEKR+ I ++R E++LK EEMAAK+RATG  PKK  GCFG
Sbjct  133   KAEYAEQMKNKMAMVHKAAEEKRAFIEAKRGEEILKAEEMAAKYRATGLAPKKLLGCFG  191



>ref|XP_006404201.1| hypothetical protein EUTSA_v10010917mg, partial [Eutrema salsugineum]
 gb|ESQ45654.1| hypothetical protein EUTSA_v10010917mg, partial [Eutrema salsugineum]
Length=91

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             AEYAE+M NK A +HKEAE KR+   ++R E VLK EEMAAK+RATG  P K FGCF
Sbjct  35    AEYAEQMKNKIAQIHKEAEGKRATTEAKRGEDVLKAEEMAAKYRATGTAPTKLFGCF  91



>ref|XP_009400595.1| PREDICTED: remorin-like [Musa acuminata subsp. malaccensis]
Length=186

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             AEYAEK+ NK AL+H+ AEEKR+++ ++R E++LK EE+AAK+RATG  PKK  GCFG
Sbjct  128   AEYAEKIKNKIALLHRFAEEKRAMVEARRGEELLKVEEVAAKYRATGLAPKKLLGCFG  185



>ref|XP_004954460.1| PREDICTED: remorin-like [Setaria italica]
Length=158

 Score = 67.0 bits (162),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAF-GCF  1226
             YAEKM N+ A +HKEAEEKR+ + + R+E +LK E+MAAK R+ G  P K F GCF
Sbjct  103   YAEKMRNQIAAIHKEAEEKRAAVEAMRHEAILKYEDMAAKHRSKGTTPAKKFLGCF  158


 Score = 39.3 bits (90),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLK  939
            +AQKK++ ++SWENTKKA +EAKL+
Sbjct  66   KAQKKMSSIMSWENTKKAAVEAKLR  90



>ref|XP_003611121.1| Remorin [Medicago truncatula]
 gb|AES94079.1| carboxy-terminal region remorin [Medicago truncatula]
Length=209

 Score = 75.5 bits (184),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
              +E LE+KK EY  KM N+ A +H+ AEEKR+++ +Q+ E+ L+ EE AAKFR+ G  PK
Sbjct  142   FEENLERKKVEYVSKMKNELAEIHQYAEEKRAIVEAQKREECLELEETAAKFRSRGVAPK  201

Query  1209  KAFGCFG  1229
             K FGCF 
Sbjct  202   KLFGCFS  208


 Score = 30.8 bits (68),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            RA KK + V  WE +KK++IEA+LKK E
Sbjct  116  RAYKKQSSVGLWEESKKSSIEAQLKKFE  143



>ref|XP_010105965.1| hypothetical protein L484_017313 [Morus notabilis]
 gb|EXC06847.1| hypothetical protein L484_017313 [Morus notabilis]
Length=233

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             YAEKM NK AL+HKEAEEKR+ + + R E++LK EE+AAK+RATG  PKK  GCF
Sbjct  179   YAEKMKNKVALIHKEAEEKRAAVEAIRREELLKAEELAAKYRATGNTPKKFLGCF  233



>ref|XP_007158480.1| hypothetical protein PHAVU_002G155800g [Phaseolus vulgaris]
 gb|ESW30474.1| hypothetical protein PHAVU_002G155800g [Phaseolus vulgaris]
Length=187

 Score = 72.4 bits (176),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E +E+KKAEY EKM NK A +H+ AEEKR+ + +Q+ E+ L  EE A KFR+ G  P+
Sbjct  120   IEENMERKKAEYVEKMKNKVAEIHRLAEEKRANVKAQKREEFLGVEETAEKFRSRGVTPR  179

Query  1209  KAFGCFG  1229
             K F CF 
Sbjct  180   KFFACFS  186


 Score = 32.7 bits (73),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  862  GRAQKKLADVLSWENTKKANIEAKLKKIE  948
             RA KK + V  WE+++KA++EA+LKKIE
Sbjct  93   NRAYKKHSAVELWEDSRKASVEAELKKIE  121



>ref|XP_010061111.1| PREDICTED: remorin-like [Eucalyptus grandis]
 gb|KCW90713.1| hypothetical protein EUGRSUZ_A02794 [Eucalyptus grandis]
Length=202

 Score = 71.2 bits (173),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+LE++KAEY EKM NK AL HK AEEKR++I ++R E +LKTEE+AA+ RA G  P 
Sbjct  135   IEEKLEREKAEYVEKMKNKIALYHKAAEEKRALIEAKREENILKTEEIAAENRAKGTTPN  194

Query  1209  KAFGCF  1226
             K     
Sbjct  195   KLLSFL  200


 Score = 33.1 bits (74),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A KKL+ + +WEN K A++EA+LKKIE
Sbjct  109  KAHKKLSAIEAWENRKIASVEAELKKIE  136



>ref|XP_008234255.1| PREDICTED: remorin-like [Prunus mume]
Length=212

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  1050  KKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             KKAEY E+M NK AL+HK AEEKR+ I ++R E +LK EE AAK+RATG  PKK   CF 
Sbjct  152   KKAEYVEQMKNKIALIHKAAEEKRAAIEAKRGEDLLKAEETAAKYRATGNAPKKLLACFS  211


 Score = 32.3 bits (72),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEA  930
            +A KKL+ V SWENTKKA +EA
Sbjct  119  KAHKKLSAVGSWENTKKATVEA  140



>ref|XP_008238896.1| PREDICTED: uncharacterized protein LOC103337510 [Prunus mume]
Length=371

 Score = 73.9 bits (180),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+ E+KKAEYAEKM NK A +HK  +E+R+ I +++ EQ L+ EE AAKFR+ G  PK
Sbjct  114   IEEKFERKKAEYAEKMKNKVAEIHKAGDERRAFIEAKQREQCLRVEETAAKFRSHGITPK  173

Query  1209  K-AFGCF  1226
             K   GCF
Sbjct  174   KLLLGCF  180


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A ++++ V  WE+ KK ++EA+LKKIE
Sbjct  88   KAYRRMSTVELWEDNKKTSVEAELKKIE  115



>ref|XP_007139893.1| hypothetical protein PHAVU_008G067400g [Phaseolus vulgaris]
 gb|ESW11887.1| hypothetical protein PHAVU_008G067400g [Phaseolus vulgaris]
Length=209

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  1056  AEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCF  1226
             AE +EKM NK AL+HK+AEEKR+ I ++R E+VLK EE+ A++RATG  PKK  GCF
Sbjct  153   AEQSEKMKNKMALIHKQAEEKRATIEAKRGEEVLKAEEIGARYRATGTTPKKTIGCF  209



>ref|XP_008238894.1| PREDICTED: remorin [Prunus mume]
Length=223

 Score = 73.2 bits (178),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  1029  LQEQLEKKKAEYAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPK  1208
             ++E+ E+KKAEYAEKM NK A +HK  + +R+ I +++ EQ L+ EE AAKFR+TG  PK
Sbjct  149   IEEKFERKKAEYAEKMKNKVAEIHKAGDGRRAFIEAKQREQCLRVEETAAKFRSTGITPK  208

Query  1209  K-AFGCF  1226
             K   GCF
Sbjct  209   KLLLGCF  215


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  865  RAQKKLADVLSWENTKKANIEAKLKKIE  948
            +A ++++ V  WE++KK ++EA+LKKIE
Sbjct  123  KAYRRMSTVELWEDSKKTSVEAELKKIE  150



>ref|XP_008794187.1| PREDICTED: remorin-like isoform X2 [Phoenix dactylifera]
Length=193

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  1062  YAEKMSNKTALVHKEAEEKRSVIVSQRNEQVLKTEEMAAKFRATGQVPKKAFGCFG  1229
             YAEKM NK A++HK AEEKR+ + ++R E +LK EE AAK+R+ G  PKK FGCFG
Sbjct  137   YAEKMKNKVAMIHKAAEEKRAYVEAKRGEDILKAEETAAKYRSKGLAPKKIFGCFG  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3899525361552