BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22425_g1_i2 len=964 path=[14:0-194 209:195-262 277:263-329
344:330-392 407:393-395 410:396-425 2770:426-963]

Length=964
                                                                      Score     E

ref|XP_011091671.1|  PREDICTED: uncharacterized protein LOC105172030    177   3e-50   
gb|EYU43762.1|  hypothetical protein MIMGU_mgv1a025785mg                160   7e-44   
gb|EYU32599.1|  hypothetical protein MIMGU_mgv1a012547mg                160   4e-43   
ref|XP_010662476.1|  PREDICTED: uncharacterized protein LOC100258685    143   3e-37   
emb|CAN77603.1|  hypothetical protein VITISV_006917                     144   3e-36   Vitis vinifera
ref|XP_002315167.2|  calcium-binding EF hand family protein             140   6e-36   Populus trichocarpa [western balsam poplar]
emb|CBI23727.3|  unnamed protein product                                139   7e-36   
ref|XP_010650189.1|  PREDICTED: uncharacterized protein LOC100252791    139   1e-35   
ref|XP_010650190.1|  PREDICTED: uncharacterized protein LOC100254539    139   2e-35   
emb|CAN69590.1|  hypothetical protein VITISV_042945                     137   4e-35   Vitis vinifera
ref|XP_002282250.3|  PREDICTED: uncharacterized protein LOC100244274    141   1e-34   Vitis vinifera
emb|CAN65651.1|  hypothetical protein VITISV_020551                     141   2e-34   Vitis vinifera
emb|CBI23728.3|  unnamed protein product                                137   3e-33   
gb|EYU32601.1|  hypothetical protein MIMGU_mgv1a025510mg                122   2e-30   
ref|XP_007214781.1|  hypothetical protein PRUPE_ppa023576mg             124   4e-30   
ref|XP_011035987.1|  PREDICTED: uncharacterized protein LOC105133614    124   5e-30   
ref|XP_006420376.1|  hypothetical protein CICLE_v10006564mg             123   7e-30   
gb|KDO52252.1|  hypothetical protein CISIN_1g026938mg                   124   1e-29   
ref|XP_006489250.1|  PREDICTED: uncharacterized protein LOC102613415    120   8e-29   
ref|XP_006489576.1|  PREDICTED: uncharacterized protein LOC102608184    123   2e-28   
ref|XP_006419789.1|  hypothetical protein CICLE_v10005927mg             115   4e-27   
gb|KDO74849.1|  hypothetical protein CISIN_1g037528mg                   114   4e-27   
ref|XP_007035299.1|  Calcium-binding EF-hand family protein, puta...    115   6e-27   
ref|XP_008224098.1|  PREDICTED: uncharacterized protein LOC103323855    116   7e-27   
ref|XP_006489277.1|  PREDICTED: uncharacterized protein LOC102622719    115   9e-27   
ref|XP_007226431.1|  hypothetical protein PRUPE_ppa023963mg             114   2e-26   
ref|XP_010274595.1|  PREDICTED: plastin-2-like isoform X1               114   3e-26   
ref|XP_006419790.1|  hypothetical protein CICLE_v10007030mg             113   3e-26   
ref|XP_004306582.1|  PREDICTED: uncharacterized protein LOC101309960    113   3e-26   
ref|XP_007224696.1|  hypothetical protein PRUPE_ppa025456mg             113   5e-26   
ref|XP_002528341.1|  calcium ion binding protein, putative              111   9e-26   Ricinus communis
gb|KDP33333.1|  hypothetical protein JCGZ_12882                         115   1e-25   
ref|XP_004306583.1|  PREDICTED: uncharacterized protein LOC101310252    111   2e-25   
gb|KDP33328.1|  hypothetical protein JCGZ_12877                         110   2e-25   
ref|XP_008224031.1|  PREDICTED: uncharacterized protein LOC103323795    111   3e-25   
ref|XP_006419794.1|  hypothetical protein CICLE_v10007025mg             108   5e-25   
ref|XP_007223977.1|  hypothetical protein PRUPE_ppa014649mg             109   1e-24   
gb|KDO74847.1|  hypothetical protein CISIN_1g0274422mg                  107   1e-24   
ref|XP_002863242.1|  hypothetical protein ARALYDRAFT_358968             108   2e-24   
ref|NP_193080.1|  EF-hand, calcium binding motif-containing protein     107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069095.1|  PREDICTED: uncharacterized protein LOC104456073    108   2e-24   
ref|XP_010277593.1|  PREDICTED: uncharacterized protein LOC104611989    107   4e-24   
ref|XP_010999446.1|  PREDICTED: uncharacterized protein LOC105107269    107   6e-24   
ref|XP_010550855.1|  PREDICTED: uncharacterized protein LOC104821630    107   8e-24   
ref|XP_010110693.1|  hypothetical protein L484_009721                   106   1e-23   
ref|XP_006371124.1|  hypothetical protein POPTR_0019s04360g             105   1e-23   
ref|XP_009350825.1|  PREDICTED: uncharacterized protein LOC103942366    106   2e-23   
ref|XP_006284534.1|  hypothetical protein CARUB_v10005736mg             105   4e-23   
ref|XP_006284535.1|  hypothetical protein CARUB_v10005736mg             105   4e-23   
ref|XP_006480237.1|  PREDICTED: uncharacterized protein LOC102612370    104   7e-23   
ref|XP_010274594.1|  PREDICTED: uncharacterized protein LOC104609873    103   2e-22   
ref|XP_010105214.1|  hypothetical protein L484_011271                   102   3e-22   
ref|WP_033634418.1|  hypothetical protein                             98.6    7e-22   
gb|KFK36230.1|  hypothetical protein AALP_AA4G095100                    101   8e-22   
ref|XP_006371134.1|  hypothetical protein POPTR_0019s04450g             100   1e-21   
ref|XP_006371129.1|  hypothetical protein POPTR_0019s04400g           99.8    3e-21   
ref|XP_004297939.1|  PREDICTED: uncharacterized protein LOC101315429    100   3e-21   
ref|XP_011012322.1|  PREDICTED: uncharacterized protein LOC105116...  99.4    3e-21   
ref|XP_011012321.1|  PREDICTED: uncharacterized protein LOC105116...  99.4    4e-21   
ref|XP_011011795.1|  PREDICTED: uncharacterized protein LOC105116...  99.0    6e-21   
ref|XP_011011797.1|  PREDICTED: uncharacterized protein LOC105116...  99.0    6e-21   
ref|XP_007226919.1|  hypothetical protein PRUPE_ppa015959mg           97.8    6e-21   
gb|EYU32592.1|  hypothetical protein MIMGU_mgv1a013813mg              98.6    8e-21   
gb|ABK94726.1|  unknown                                               97.4    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010256260.1|  PREDICTED: uncharacterized protein LOC104596704  97.4    2e-20   
ref|XP_009113947.1|  PREDICTED: uncharacterized protein LOC103839...  96.3    2e-20   
ref|XP_004296541.1|  PREDICTED: uncharacterized protein LOC101310401  97.4    2e-20   
ref|XP_006371128.1|  hypothetical protein POPTR_0019s04390g           97.1    3e-20   
ref|XP_009113944.1|  PREDICTED: uncharacterized protein LOC103839...  96.7    3e-20   
ref|XP_009113943.1|  PREDICTED: uncharacterized protein LOC103839...  96.7    3e-20   
ref|XP_008353259.1|  PREDICTED: proline-rich receptor-like protei...  98.2    3e-20   
ref|XP_006388264.1|  hypothetical protein POPTR_0257s00210g           96.7    4e-20   
ref|XP_011011798.1|  PREDICTED: uncharacterized protein LOC105116...  96.3    4e-20   
ref|XP_011011799.1|  PREDICTED: uncharacterized protein LOC105116...  96.3    4e-20   
ref|XP_006371132.1|  hypothetical protein POPTR_0019s04430g           95.1    5e-20   
ref|XP_010428594.1|  PREDICTED: uncharacterized protein LOC104713...  95.5    7e-20   
ref|XP_010471684.1|  PREDICTED: uncharacterized protein LOC104751...  95.5    8e-20   
ref|XP_010471683.1|  PREDICTED: uncharacterized protein LOC104751...  95.5    8e-20   
emb|CDY36976.1|  BnaC09g17920D                                        94.4    9e-20   
ref|XP_010428593.1|  PREDICTED: uncharacterized protein LOC104713...  95.1    1e-19   
ref|XP_010256259.1|  PREDICTED: uncharacterized protein LOC104596703  95.1    1e-19   
ref|XP_010471689.1|  PREDICTED: uncharacterized protein LOC104751...  94.7    1e-19   
gb|EYU32593.1|  hypothetical protein MIMGU_mgv1a021501mg              93.2    1e-19   
ref|XP_010471688.1|  PREDICTED: uncharacterized protein LOC104751...  94.7    1e-19   
ref|XP_009113946.1|  PREDICTED: uncharacterized protein LOC103839...  94.7    1e-19   
ref|XP_007226352.1|  hypothetical protein PRUPE_ppa022625mg           93.6    1e-19   
ref|XP_009113945.1|  PREDICTED: uncharacterized protein LOC103839...  94.7    1e-19   
ref|XP_006388948.1|  hypothetical protein POPTR_0068s00200g           93.6    3e-19   
gb|EYU38467.1|  hypothetical protein MIMGU_mgv1a018857mg              92.8    3e-19   
ref|XP_006371126.1|  hypothetical protein POPTR_0019s04380g           92.0    5e-19   
ref|XP_006371125.1|  hypothetical protein POPTR_0019s04370g           91.7    8e-19   
ref|XP_006371123.1|  hypothetical protein POPTR_0019s04350g           92.0    1e-18   
ref|XP_011091670.1|  PREDICTED: uncharacterized protein LOC105172028  91.7    2e-18   
ref|XP_004296539.1|  PREDICTED: uncharacterized protein LOC101309628  91.7    2e-18   
gb|EYU38469.1|  hypothetical protein MIMGU_mgv1a0149542mg             89.0    6e-18   
ref|XP_008224099.1|  PREDICTED: uncharacterized protein LOC103323856  87.8    8e-18   
gb|EYU38473.1|  hypothetical protein MIMGU_mgv1a021207mg              88.6    8e-18   
ref|XP_006371135.1|  hypothetical protein POPTR_0019s04460g           89.4    9e-18   
ref|XP_011012576.1|  PREDICTED: uncharacterized protein LOC105116792  88.6    2e-17   
ref|XP_010243843.1|  PREDICTED: uncharacterized protein LOC104587...  91.7    7e-17   
ref|XP_010243841.1|  PREDICTED: uncharacterized protein LOC104587...  91.3    8e-17   
ref|XP_010243840.1|  PREDICTED: uncharacterized protein LOC104587...  91.3    9e-17   
ref|XP_010243842.1|  PREDICTED: uncharacterized protein LOC104587...  91.3    9e-17   
ref|XP_010243839.1|  PREDICTED: uncharacterized protein LOC104587...  91.3    9e-17   
ref|XP_010110690.1|  hypothetical protein L484_009718                 84.0    2e-16   
gb|AIU48193.1|  MSH1                                                  90.5    2e-16   
gb|KCW46930.1|  hypothetical protein EUGRSUZ_K00744                   84.3    2e-16   
gb|EYU38474.1|  hypothetical protein MIMGU_mgv11b018110mg             84.3    2e-16   
ref|XP_004297941.1|  PREDICTED: DNA mismatch repair protein MSH1,...  90.1    3e-16   
ref|XP_009341628.1|  PREDICTED: uncharacterized protein LOC103933660  85.1    3e-16   
ref|XP_010274596.1|  PREDICTED: uncharacterized protein LOC104609...  82.8    1e-15   
gb|EYU32602.1|  hypothetical protein MIMGU_mgv1a022976mg              80.5    2e-15   
gb|KCW54062.1|  hypothetical protein EUGRSUZ_I00042                   79.7    4e-15   
gb|EYU38471.1|  hypothetical protein MIMGU_mgv1a021889mg              80.5    7e-15   
ref|XP_004296537.1|  PREDICTED: uncharacterized protein LOC101308274  80.5    1e-14   
gb|KDP33330.1|  hypothetical protein JCGZ_12879                       78.2    7e-14   
gb|EYU17886.1|  hypothetical protein MIMGU_mgv1a0207622mg             76.6    8e-14   
gb|EYU43763.1|  hypothetical protein MIMGU_mgv1a018413mg              77.0    1e-13   
ref|XP_002522873.1|  calcium ion binding protein, putative            75.9    4e-13   Ricinus communis
ref|XP_011011800.1|  PREDICTED: uncharacterized protein LOC105116...  75.5    4e-13   
gb|KCW52370.1|  hypothetical protein EUGRSUZ_J01776                   71.6    3e-12   
gb|KDP33329.1|  hypothetical protein JCGZ_12878                       73.9    9e-12   
ref|XP_007206780.1|  hypothetical protein PRUPE_ppa025480mg           70.1    1e-11   
ref|XP_002527293.1|  calcium ion binding protein, putative            72.4    2e-11   Ricinus communis
ref|XP_010062355.1|  PREDICTED: uncharacterized protein LOC104449789  70.9    3e-11   
gb|KDP33332.1|  hypothetical protein JCGZ_12881                       69.3    5e-11   
gb|KDO52253.1|  hypothetical protein CISIN_1g044607mg                 68.9    5e-11   
ref|XP_010064849.1|  PREDICTED: uncharacterized protein LOC104452008  68.2    5e-10   
ref|XP_010474353.1|  PREDICTED: 16 kDa calcium-binding protein-like   64.7    1e-09   
ref|XP_006420377.1|  hypothetical protein CICLE_v10006956mg           63.5    3e-09   
ref|XP_002528342.1|  calcium ion binding protein, putative            63.5    6e-09   Ricinus communis
ref|XP_011091669.1|  PREDICTED: uncharacterized protein LOC105172027  62.4    2e-08   
gb|EYU38323.1|  hypothetical protein MIMGU_mgv1a025498mg              61.6    2e-08   
gb|KCW60200.1|  hypothetical protein EUGRSUZ_H02911                   61.6    3e-08   
ref|XP_006388949.1|  hypothetical protein POPTR_0068s00210g           57.8    4e-07   
ref|XP_002532441.1|  calcium ion binding protein, putative            58.5    4e-07   Ricinus communis
gb|EYU38472.1|  hypothetical protein MIMGU_mgv1a025022mg              58.2    4e-07   
ref|XP_010023832.1|  PREDICTED: uncharacterized protein LOC104414418  59.7    7e-07   
ref|XP_010023827.1|  PREDICTED: uncharacterized protein LOC104414...  58.2    2e-06   
ref|XP_010023825.1|  PREDICTED: uncharacterized protein LOC104414...  58.5    2e-06   
ref|XP_010023830.1|  PREDICTED: uncharacterized protein LOC104414...  57.8    3e-06   
gb|KCW60188.1|  hypothetical protein EUGRSUZ_H02908                   57.8    3e-06   
ref|XP_010023824.1|  PREDICTED: uncharacterized protein LOC104414...  58.2    3e-06   
ref|XP_010023828.1|  PREDICTED: uncharacterized protein LOC104414...  57.8    3e-06   
ref|XP_010023829.1|  PREDICTED: uncharacterized protein LOC104414...  57.8    3e-06   
gb|KCW60195.1|  hypothetical protein EUGRSUZ_H02908                   58.2    3e-06   
gb|KCW60196.1|  hypothetical protein EUGRSUZ_H02908                   58.2    3e-06   
gb|KCW60189.1|  hypothetical protein EUGRSUZ_H02908                   58.2    3e-06   
ref|XP_010023821.1|  PREDICTED: uncharacterized protein LOC104414...  58.2    3e-06   
ref|XP_010023822.1|  PREDICTED: uncharacterized protein LOC104414...  57.8    3e-06   
gb|KCW60191.1|  hypothetical protein EUGRSUZ_H02908                   57.8    3e-06   
gb|KCW60193.1|  hypothetical protein EUGRSUZ_H02908                   58.2    3e-06   
gb|KCW60197.1|  hypothetical protein EUGRSUZ_H02908                   58.2    3e-06   
ref|XP_010023826.1|  PREDICTED: uncharacterized protein LOC104414...  57.8    3e-06   
gb|KCW44553.1|  hypothetical protein EUGRSUZ_L01937                   52.8    2e-05   
gb|KCW44552.1|  hypothetical protein EUGRSUZ_L01936                   53.5    2e-05   
gb|KDQ10519.1|  hypothetical protein BOTBODRAFT_36215                 52.8    3e-05   
ref|XP_010277740.1|  PREDICTED: uncharacterized protein LOC104612...  52.0    6e-05   
ref|XP_010277739.1|  PREDICTED: uncharacterized protein LOC104612...  52.0    7e-05   
ref|XP_010277738.1|  PREDICTED: uncharacterized protein LOC104612...  52.0    8e-05   
ref|XP_010033731.1|  PREDICTED: neuronal calcium sensor 2-like        52.0    8e-05   
ref|XP_004297935.1|  PREDICTED: uncharacterized protein LOC101313407  52.8    8e-05   
gb|KCW60198.1|  hypothetical protein EUGRSUZ_H02910                   52.0    9e-05   
ref|XP_010041117.1|  PREDICTED: neuronal calcium sensor 2-like        51.6    9e-05   
ref|XP_010023831.1|  PREDICTED: uncharacterized protein LOC104414417  51.6    1e-04   
ref|XP_002968513.1|  hypothetical protein SELMODRAFT_440368           50.4    2e-04   
ref|XP_002975971.1|  hypothetical protein SELMODRAFT_443090           50.4    2e-04   
ref|XP_007510592.1|  predicted protein                                52.8    2e-04   
gb|EFQ35051.1|  hypothetical protein GLRG_10195                       53.1    2e-04   
gb|KCW84064.1|  hypothetical protein EUGRSUZ_B00947                   50.1    2e-04   
ref|XP_010026782.1|  PREDICTED: uncharacterized protein LOC104417165  50.1    3e-04   
gb|KDN68651.1|  hypothetical protein CSUB01_03110                     51.6    6e-04   
pdb|2AMI|A  Chain A, Solution Structure Of The Calcium-loaded N-t...  47.8    0.001   



>ref|XP_011091671.1| PREDICTED: uncharacterized protein LOC105172030 [Sesamum indicum]
Length=218

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL ++A+A+YRAGSPE++  A E F ++D +GDGRVD +EFLTFM ++GY  M +  F
Sbjct  1    MEELREIARAHYRAGSPEVQALAYEFFKTMDTNGDGRVDLSEFLTFMRQEGYSQMRSPYF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            FNELD DGN  LDF EVMTL YI KSGRPFCDGCG FIP  FF+C++C      +++LC 
Sbjct  61   FNELDHDGNGALDFSEVMTLYYIIKSGRPFCDGCGNFIPGIFFSCVECFKNPQRSFNLCR  120

Query  437  SCYENGKSGHNH----QFMDNYALLAVKK  511
             CY + K  HNH    QF+DNY LL  K+
Sbjct  121  DCYRSTKCNHNHDGRVQFLDNYTLLEAKR  149



>gb|EYU43762.1| hypothetical protein MIMGU_mgv1a025785mg [Erythranthe guttata]
Length=193

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 100/152 (66%), Gaps = 12/152 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQ--GYQCMSTK  265
            MDEL + AKA+YRAGSPE++  A + F S+D DGDGRVD +EFL FM  Q   Y  M  +
Sbjct  1    MDELRETAKAHYRAGSPEVQQLAYDFFKSMDTDGDGRVDLSEFLAFMRAQEGRYSNMRNR  60

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN------YD  427
             FF+ELD D N TLDF EVM+L YI KS RPFCD CG+FIP  FF+C++C N      +D
Sbjct  61   YFFDELDQDANGTLDFSEVMSLYYIIKSRRPFCDFCGQFIPGIFFSCVECFNDSSGAPFD  120

Query  428  LCISCYENGKSGHNH----QFMDNYALLAVKK  511
            LC  CY+     H H    QF+DNY LL  K+
Sbjct  121  LCPVCYKAKSCKHEHDGRFQFLDNYTLLETKR  152



>gb|EYU32599.1| hypothetical protein MIMGU_mgv1a012547mg [Erythranthe guttata]
Length=247

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 99/150 (66%), Gaps = 9/150 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ L  +A A+YRA  P  K  A E F +LD+DGDGRV  NEFL+ M EQG+  ++   F
Sbjct  1    MERLRAIADAHYRASPPAAKALAYEFFKTLDSDGDGRVSINEFLSLMKEQGHVRLANPYF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN-----YDLCI  436
            F ELD++GN +LDFWEV+TL YI KSGRP C+ CG  +  TFF+C++C +     Y LCI
Sbjct  61   FRELDSNGNGSLDFWEVLTLYYIVKSGRPVCECCGILVTGTFFSCVECFDSPAGAYSLCI  120

Query  437  SCYENGKSGHNH----QFMDNYALLAVKKR  514
             CY + KS HNH    QF+D + LL  KKR
Sbjct  121  LCYRSNKSDHNHGGRQQFLDAFTLLETKKR  150



>ref|XP_010662476.1| PREDICTED: uncharacterized protein LOC100258685 [Vitis vinifera]
Length=206

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY AG+ E +  A+  F +LD DGDG V   EF+ F+  +GY+ +    F
Sbjct  1    MEEIREAALAYYEAGTQEQRQLARAFFQTLDVDGDGIVSVQEFVDFLRGRGYRLLDNPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            F  LD DGN  LDF+EV+TL YI KSGRPFCDGCG F+   FFTCL C       ++LC 
Sbjct  61   FQALDRDGNGCLDFYEVLTLYYIIKSGRPFCDGCGVFLKGLFFTCLDCYESSHTTFNLCS  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +CY   +  H H   +DNY LL  K+
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLTHKR  146



>emb|CAN77603.1| hypothetical protein VITISV_006917 [Vitis vinifera]
Length=343

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 88/146 (60%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY AG+ E +  A   F +LD DGDG V   EF+ F+   GY+ +    F
Sbjct  1    MEEIREAALAYYEAGTQEQRQLAWAFFQALDVDGDGTVSVQEFVNFLRGSGYRLLDNPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            F  LD DGN  LDF+EV+TL YI KSGRPFCDGCG F+   FFTCL C       +DLC 
Sbjct  61   FQALDRDGNGCLDFYEVLTLYYIIKSGRPFCDGCGVFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +CY   +  H H   +DNY LL  K+
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLTHKR  146



>ref|XP_002315167.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEF01338.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=230

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELHK+AKAYY   + E K+    LF  +D DGDG++  +EFL F+  +G   M++  F
Sbjct  1    MDELHKIAKAYYETANSENKDLGHRLFKRMDVDGDGQISLHEFLAFLKNEGRGEMASPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            F EL+ +G   LD  E MTL YI +SGR FC+GCG F+   F +C++C      +++LC 
Sbjct  61   FKELNKNGTGRLDLMEAMTLCYIIESGRKFCNGCGEFMKGIFLSCMECFDHEDRSFNLCC  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +C+E G+  H+H +F+DNY LL  K+
Sbjct  121  ACFEQGRYVHSHKKFLDNYVLLETKR  146



>emb|CBI23727.3| unnamed protein product [Vitis vinifera]
Length=199

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY AG+ E K  A   F +LD DGDG V   EF+ F+  +GY+      F
Sbjct  1    MEEIREAALAYYEAGTQEQKQLAWAFFQTLDVDGDGTVSVQEFVNFLRGRGYRLFDNPNF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            +  LD DGN  LDF EV+T  YI KSGRPFCDGCG F+   FFTCL C       +DLC 
Sbjct  61   YRALDRDGNGCLDFHEVLTFFYIIKSGRPFCDGCGIFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +CY   +  H H   +DNY LL  K+
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLTHKR  146



>ref|XP_010650189.1| PREDICTED: uncharacterized protein LOC100252791 [Vitis vinifera]
Length=211

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 95/147 (65%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY  GS E K  A++ FNSLD DG+G VD +EF+  ++E+G+  ++   F
Sbjct  1    MEEISEAALAYYENGSEEQKQLARDFFNSLDEDGNGTVDVHEFIKILSEEGHGLVNNSGF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS-GRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            F ELD DGN +LDF E +TL YI KS  RPFC GCG F+ + FF+C +C       +DLC
Sbjct  61   FQELDRDGNESLDFNEFLTLFYIIKSRSRPFCAGCGIFLKSLFFSCAKCHESSDETFDLC  120

Query  434  ISCYENGKSGHNH-QFMDNYALLAVKK  511
             +CY   +  H H  F+DNY LLA K+
Sbjct  121  SACYRGKRFSHQHAAFLDNYTLLAHKR  147



>ref|XP_010650190.1| PREDICTED: uncharacterized protein LOC100254539 [Vitis vinifera]
Length=238

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY AG+ E K  A   F +LD DGDG V   EF+ F+  +GY+      F
Sbjct  1    MEEIREAALAYYEAGTQEQKQLAWAFFQTLDVDGDGTVSVQEFVNFLRGRGYRLFDNPNF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            +  LD DGN  LDF EV+T  YI KSGRPFCDGCG F+   FFTCL C       +DLC 
Sbjct  61   YRALDRDGNGCLDFHEVLTFFYIIKSGRPFCDGCGIFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +CY   +  H H   +DNY LL  K+
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLTHKR  146



>emb|CAN69590.1| hypothetical protein VITISV_042945 [Vitis vinifera]
Length=208

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 94/147 (64%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY  GS E K  A++ FNSLD DG+G VD +EF+  + E+G+  ++   F
Sbjct  1    MEEISEAALAYYENGSEEQKQLARDFFNSLDEDGNGTVDVHEFIKILGEEGHGLVNNSGF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS-GRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            F ELD DGN +LDF E +TL YI KS  RPFC GCG F+ + FF+C +C       +DLC
Sbjct  61   FQELDRDGNESLDFNEFLTLFYIIKSRSRPFCAGCGIFLKSLFFSCAKCHESSDETFDLC  120

Query  434  ISCYENGKSGHNH-QFMDNYALLAVKK  511
             +CY   +  H H  F+DNY LLA K+
Sbjct  121  SACYRGKRFSHQHAAFLDNYTLLAHKR  147



>ref|XP_002282250.3| PREDICTED: uncharacterized protein LOC100244274 [Vitis vinifera]
Length=471

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +M+++ ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L F  ++GY  MS + 
Sbjct  11   RMEKMREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQE  70

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PN-YDLC  433
            +F +LD D   +L F +VMTL YI KSGRPFC GCG F+   FFTC++C    P+ + +C
Sbjct  71   WFRKLDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVC  130

Query  434  ISCYENGKSGHNH-QFMDNYALLAVKKR  514
            + CYE+    H H +F+DN+ALL  K+R
Sbjct  131  LQCYESNNIEHEHKEFLDNFALLEAKRR  158


 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 21/156 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLTFMTEQGY------  247
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM  + Y      
Sbjct  187  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  246

Query  248  ----QCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC  415
                + M+T  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   FFTC+ C
Sbjct  247  NLDLEFMNTPEFFRKLDKD-KKGLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  305

Query  416  -----PNYDLCISCYENGK---SGHNHQFMDNYALL  499
                   + LC+ CY   K   S  +H F+DNYALL
Sbjct  306  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALL  341



>emb|CAN65651.1| hypothetical protein VITISV_020551 [Vitis vinifera]
Length=460

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 99/147 (67%), Gaps = 6/147 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++ ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L F  ++GY  MS + +
Sbjct  1    MEKMREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQEW  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PN-YDLCI  436
            F +LD D   +L F +VMTL YI KSGRPFC GCG F+   FFTC++C    P+ + +C+
Sbjct  61   FRKLDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVCL  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKKR  514
             CYE+    H H +F+DN+ALL  K+R
Sbjct  121  QCYESNNIEHEHKEFLDNFALLEAKRR  147


 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 21/156 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLTFMTEQGY------  247
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM  + Y      
Sbjct  176  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  235

Query  248  ----QCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC  415
                + M+T  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   FFTC+ C
Sbjct  236  NLDLEFMNTPEFFRKLDKD-KKGLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  294

Query  416  -----PNYDLCISCYENGK---SGHNHQFMDNYALL  499
                   + LC+ CY   K   S  +H F+DNYALL
Sbjct  295  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALL  330



>emb|CBI23728.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 6/144 (4%)
 Frame = +2

Query  101  LHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNE  280
            + ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L F  ++GY  MS + +F +
Sbjct  1    MREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQEWFRK  60

Query  281  LDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PN-YDLCISCY  445
            LD D   +L F +VMTL YI KSGRPFC GCG F+   FFTC++C    P+ + +C+ CY
Sbjct  61   LDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVCLQCY  120

Query  446  ENGKSGHNH-QFMDNYALLAVKKR  514
            E+    H H +F+DN+ALL  K+R
Sbjct  121  ESNNIEHEHKEFLDNFALLEAKRR  144


 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 21/156 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLTFMTEQGY------  247
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM  + Y      
Sbjct  173  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  232

Query  248  ----QCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC  415
                + M+T  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   FFTC+ C
Sbjct  233  NLDLEFMNTPEFFRKLDKD-KKGLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  291

Query  416  -----PNYDLCISCYENGK---SGHNHQFMDNYALL  499
                   + LC+ CY   K   S  +H F+DNYALL
Sbjct  292  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALL  327



>gb|EYU32601.1| hypothetical protein MIMGU_mgv1a025510mg [Erythranthe guttata]
Length=122

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ L  +A A+YRA  P     A E F +LD+DGDGRV  NEFL+ M EQG+  ++   F
Sbjct  1    MERLRAIADAHYRASPPA----AYEFFKTLDSDGDGRVSINEFLSLMKEQGHVSLANPYF  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC  415
            F ELD++ N +LDFWEV+TL YI KSGRP CD CG  +   FF+C++C
Sbjct  57   FRELDSNSNGSLDFWEVLTLYYIVKSGRPVCDCCGILVHGIFFSCVEC  104



>ref|XP_007214781.1| hypothetical protein PRUPE_ppa023576mg [Prunus persica]
 gb|EMJ15980.1| hypothetical protein PRUPE_ppa023576mg [Prunus persica]
Length=189

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ELH+ A AYY  GS  L+  A   F S+D +GDGRV K+EF+TF+ + GY  ++   F
Sbjct  1    MEELHQAALAYYNNGSQNLQLLAANFFRSMDRNGDGRVSKSEFITFLRQNGYGWINPS-F  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            FN LD + +  LDF EV+T  YI K+   +CDGCG  +   +FTC++C       YDLC 
Sbjct  60   FNNLDRNRDGGLDFEEVLTFYYIIKTRNLWCDGCGVCLKGLYFTCVECFDRAANTYDLCS  119

Query  437  SCYENGKSGHNHQ-FMDNYALLAVKK  511
             CY + +  HNH  F+DN+ LL  K+
Sbjct  120  RCYSSRRFRHNHTCFLDNHMLLRSKR  145



>ref|XP_011035987.1| PREDICTED: uncharacterized protein LOC105133614 [Populus euphratica]
Length=220

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDEL+K+AKAYY   + + K     +F  +D D DG++  +EFL F+  +G + +++  F
Sbjct  1    MDELYKIAKAYYETANIDNKGLGHRVFKRMDMDDDGQISLHEFLAFLKNEGRREIASPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPNYD-----LCI  436
              EL+ +G   LD  E MTL YI +SGR FCDGCG F+   F +C++C +++     LC 
Sbjct  61   SKELNKNGTGRLDLMEAMTLCYIIESGRKFCDGCGEFMKGIFLSCMECFDHEDTTLNLCC  120

Query  437  SCYENGKSGHNH-QFMDNYALLAVKK  511
            +C E G+  H+H +F+DNY  L  K+
Sbjct  121  ACCEQGRYVHSHKKFLDNYVFLETKR  146



>ref|XP_006420376.1| hypothetical protein CICLE_v10006564mg [Citrus clementina]
 gb|ESR33616.1| hypothetical protein CICLE_v10006564mg [Citrus clementina]
Length=191

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 11/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M++L+++A AYY +G+ E +    + F S+D DG+GRV   EF  FM+ + Y + M T+ 
Sbjct  1    MEDLNEVALAYYESGTDEERRLFDQFFESMDEDGNGRVSYREFSEFMSLEAYDRNMCTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN-----YDLC  433
            FFN+LD DG+  LDF EV+TL YI KSGRP C  C  FI   +FTC +C       Y++C
Sbjct  61   FFNDLDVDGSRGLDFNEVLTLYYIIKSGRPICRQCKIFITNEYFTCTRCFKTRSFPYNIC  120

Query  434  ISCY--ENGKSGHNH---QFMDNYALLAVKKR  514
            + C+  E G   H H   QF+DN+ALL   ++
Sbjct  121  LECFRGEEGHFNHTHSLEQFVDNFALLECLRK  152



>gb|KDO52252.1| hypothetical protein CISIN_1g026938mg [Citrus sinensis]
Length=230

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 126/230 (55%), Gaps = 18/230 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M++L+++A AYY +G+ E +    + F S+D DG+GRV   EF  FM+ + Y + M T+ 
Sbjct  1    MEDLNEVALAYYESGTDEERRLFDQFFESMDEDGNGRVSYREFSEFMSLEAYDRNMCTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN-----YDLC  433
            FFN+LD DG+  LDF EV+TL YI KSGRP C  C  FI   +FTC +C       Y++C
Sbjct  61   FFNDLDVDGSRGLDFNEVLTLYYIIKSGRPICRQCKIFITNEYFTCTRCFKTRSFPYNIC  120

Query  434  ISCY--ENGKSGHNH---QFMDNYALLA-VKKRAemneeee-teDVNIVSHHSVSTYddd  592
            + C+  E G   H H   QF+DN+ALL  ++K A     E+   + +     S       
Sbjct  121  LECFRGEEGHFNHTHSLEQFVDNFALLECLRKEALEENREDGYYEPSPSRSRSQRIVPYS  180

Query  593  dddESYTAMHAIVA--ANVPakkfrkrklalkalQIALH---VGNNCSIM  727
                  ++ HAIV    N+PA++  +   A + L+  LH   V  +CSIM
Sbjct  181  RYPSENSSHHAIVPYNPNIPAERRNRWGTAFRILETGLHFASVVTSCSIM  230



>ref|XP_006489250.1| PREDICTED: uncharacterized protein LOC102613415 [Citrus sinensis]
Length=211

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+GRV   EF  FM+++ + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNGRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   +F C++C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFACMKCFETGSAAYSIC  120

Query  434  ISCYENGKS-GHNH---QFMDNYALL  499
            + C+ +G S  HNH    F+DN++LL
Sbjct  121  LECFRDGASLNHNHVRFNFVDNFSLL  146



>ref|XP_006489576.1| PREDICTED: uncharacterized protein LOC102608184 [Citrus sinensis]
Length=375

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 91/146 (62%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+GRV   EF  FM+++ + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNGRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC--PN---YDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   +FTC+ C  P    Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFTCMSCFEPQTAAYSIC  120

Query  434  ISCY-ENGKSGHNH---QFMDNYALL  499
            + C+ + G+  HNH    F+DN++LL
Sbjct  121  LECFCDKGRHDHNHGRSHFVDNFSLL  146



>ref|XP_006419789.1| hypothetical protein CICLE_v10005927mg [Citrus clementina]
 gb|ESR33029.1| hypothetical protein CICLE_v10005927mg [Citrus clementina]
Length=200

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (61%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ + ++   + F S+D DG+GRV   E+  FM+++ + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDQERSLFNQFFQSMDKDGNGRVSYREYSDFMSQKAHDENMRTRY  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   +F C++C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFNEVLTLYYILKSGRPICGQCKIFITNEYFACMKCFETGSAAYSIC  120

Query  434  ISCYE-NGKSGHNH---QFMDNYALL  499
            + C+   G   HNH    F+DN++LL
Sbjct  121  LECFRAKGSLNHNHVRFNFVDNFSLL  146



>gb|KDO74849.1| hypothetical protein CISIN_1g037528mg, partial [Citrus sinensis]
Length=158

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 87/146 (60%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+ Q + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSLQAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FFN+LD DG+  LDF EV+TL YI KS RP C  C  FI   +F C++C       Y +C
Sbjct  61   FFNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCRIFITNEYFACMRCFETGSAAYSIC  120

Query  434  ISCY-ENGKSGHNH---QFMDNYALL  499
            + C+ + G   HNH    F+DN++LL
Sbjct  121  LECFGDKGSLNHNHVRSYFVDNFSLL  146



>ref|XP_007035299.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY06225.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=220

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 9/149 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MD+L ++A AYY      ++ EAQ+ FN +D +GDG ++  EFL FM ++      +   
Sbjct  1    MDKLRQIANAYYELAPKNIQKEAQKFFNEIDFNGDGHIELEEFLEFMKQKPCDAYRSSNL  60

Query  272  FNEL--DTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PNYDLC  433
            F EL    D N  L F +VMTL YI +SGRPFC+GC  FI   +F C++C      Y LC
Sbjct  61   FKELCAGNDAN-KLGFMDVMTLYYIVQSGRPFCNGCDEFIKDIYFCCVECFHSSTKYCLC  119

Query  434  ISCYENGK-SGHNH-QFMDNYALLAVKKR  514
            + CY+  K   H H QF+DN++LL   +R
Sbjct  120  LQCYKAKKYRSHPHRQFLDNFSLLEANRR  148



>ref|XP_008224098.1| PREDICTED: uncharacterized protein LOC103323855 [Prunus mume]
Length=236

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 93/152 (61%), Gaps = 13/152 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQC--MSTK  265
            M+EL + A AYY+    +++    E F  +D+D D RV  +EFLT+M E    C  +S  
Sbjct  1    MEELRQTAFAYYQDAPEQIRRWVDEFFLEMDHDEDDRVSLHEFLTYM-EMHEDCTHLSNH  59

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC--------P  418
            RFF+EL  +G+  LDF +V+TL YI  SG+PFC+G C +F+   +FTC++C         
Sbjct  60   RFFDELKKEGSEELDFLDVVTLFYIVYSGKPFCNGDCKKFVKGVYFTCVKCFDHASDAAN  119

Query  419  NYDLCISCYENGKSGHNH-QFMDNYALLAVKK  511
             +++C +CY +GK  H H +F+DN+ LL  K+
Sbjct  120  TFNVCTACYVDGKYVHGHKKFLDNFLLLQTKR  151



>ref|XP_006489277.1| PREDICTED: uncharacterized protein LOC102622719 [Citrus sinensis]
Length=237

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 88/146 (60%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+++ + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FFN+LD DG+  LDF EV+TL YI KS RP C  C  FI   +F C++C       Y +C
Sbjct  61   FFNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCRIFITNEYFACMRCFETGSAAYSIC  120

Query  434  ISCY-ENGKSGHNHQ---FMDNYALL  499
            + C+ + G   HNH    F+DN++LL
Sbjct  121  LECFGDKGSLNHNHVRSYFVDNFSLL  146



>ref|XP_007226431.1| hypothetical protein PRUPE_ppa023963mg [Prunus persica]
 gb|EMJ27630.1| hypothetical protein PRUPE_ppa023963mg [Prunus persica]
Length=236

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 93/152 (61%), Gaps = 13/152 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQC--MSTK  265
            M+EL + A AYY+    +++    E F  +D+D D +V  +EFLT+M E    C  +S  
Sbjct  1    MEELRQTAFAYYKDAPEQIRRWVDEFFLEMDHDEDDQVSLHEFLTYM-EMHEDCTHLSNP  59

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC--------P  418
            RFF+EL  +G+  LDF +V+TL YI  SG+PFC+G C +F+   +FTC++C         
Sbjct  60   RFFDELKKEGSEELDFLDVVTLFYIVYSGKPFCNGDCKKFVKGVYFTCVKCFDHASDAAN  119

Query  419  NYDLCISCYENGKSGHNH-QFMDNYALLAVKK  511
             +++C +CY +GK  H H +F+DN+ LL  K+
Sbjct  120  TFNVCTACYVDGKYVHGHKKFLDNFLLLQTKR  151



>ref|XP_010274595.1| PREDICTED: plastin-2-like isoform X1 [Nelumbo nucifera]
Length=219

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 86/149 (58%), Gaps = 13/149 (9%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTF-MTEQGYQCMST  262
             +++++ K+A AYY+  S E K  A++LF  +D DGDG+V  NEF  F M  +G      
Sbjct  1    MELEQIRKVALAYYQGSSDETKQHAEKLFKKMDADGDGKVSFNEFSDFFMKSKGLTV--P  58

Query  263  KRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PN  421
            K  F ELD DGN  +D  E + L YI ++ R  CDGCG  I   +FTC+QC        N
Sbjct  59   KLCFEELDKDGNGFMDLEESIVLFYIIQTRRISCDGCGSLIKGMYFTCVQCFFNTKTAVN  118

Query  422  YDLCISCYENGKSG---HNHQFMDNYALL  499
            Y+LC  C+ +GKS     ++  +DNYALL
Sbjct  119  YNLCCDCHRSGKSAAGCEHNTLVDNYALL  147



>ref|XP_006419790.1| hypothetical protein CICLE_v10007030mg, partial [Citrus clementina]
 gb|ESR33030.1| hypothetical protein CICLE_v10007030mg, partial [Citrus clementina]
Length=204

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 10/145 (7%)
 Frame = +2

Query  95   DELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKRF  271
            + L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+++ + + M T+ F
Sbjct  22   EALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSQKAHDENMRTRDF  81

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            FN+LD DG+  LDF EV+TL YI KS RP C  C  FI   +F C++C       Y +C+
Sbjct  82   FNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCKIFITNEYFACMRCFETGSAAYSICL  141

Query  437  SCY-ENGKSGHNH---QFMDNYALL  499
             C+ + G   HNH    F+DN++LL
Sbjct  142  ECFGDKGSLNHNHVRSYFVDNFSLL  166



>ref|XP_004306582.1| PREDICTED: uncharacterized protein LOC101309960 [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 16/155 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDEL + A AYY  GSPE++  A   F S+D + DG+VD NEF  F+ + G Q +S   F
Sbjct  1    MDELRQAASAYYNNGSPEIEQLAWCFFQSMDTNCDGQVDWNEFSAFLYQSGNQWISPS-F  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            FN+LD + +  LDF EV+T  YI K+   +C  CG  +   +FTC++C        YDLC
Sbjct  60   FNDLDRNHDGALDFMEVLTFYYIIKTRSFWCSVCGICLTGLYFTCVECFDNVNSNTYDLC  119

Query  434  ISCYE--------NGKSGHNHQ-FMDNYALLAVKK  511
              CYE        N +S H+H  FMDN+ LL  K+
Sbjct  120  PGCYESKPERQRYNRQSDHHHAYFMDNHMLLRSKR  154



>ref|XP_007224696.1| hypothetical protein PRUPE_ppa025456mg [Prunus persica]
 gb|EMJ25895.1| hypothetical protein PRUPE_ppa025456mg [Prunus persica]
Length=201

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 85/151 (56%), Gaps = 11/151 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ELH  A AYY  GSPEL+  A   F S+D + DGR+  +EF  F+ + GY   ++   
Sbjct  1    MEELHAAALAYYSNGSPELQRLAWSFFQSMDTNNDGRISSSEFYEFLQQSGYGWIVNDPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PN  421
            FF +LD +G+  LDF+EV+T  YI K+    C GC  ++   +FTC+ C           
Sbjct  61   FFTKLDRNGDGGLDFYEVLTFYYIVKTRNILCQGCRVYLCGLYFTCVACFDVGAGHHQGT  120

Query  422  YDLCISCYENGKSGHNHQ-FMDNYALLAVKK  511
            YDLC +CY      H+H  F+DN+ LL  K+
Sbjct  121  YDLCAACYGVKNFYHHHTYFLDNHVLLRSKR  151



>ref|XP_002528341.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF34013.1| calcium ion binding protein, putative [Ricinus communis]
Length=183

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTE-QGYQCMSTKR  268
            M+E+ + AKAYY   S   K   +E F ++D DGDG++   E+   + E +G++ +S+  
Sbjct  1    MEEISETAKAYYANLSDRQKRLGKEFFQAMDTDGDGKITLEEYAQCIKEKKGFKTISSPD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQCPN-----YDL  430
            FF +LD DGN TLDF E + + YI  + R  FCD C  F+   +FTC+QC N     YDL
Sbjct  61   FFKKLDKDGNGTLDFDEFIIVHYICSTERVYFCDECKVFLAGVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKR  514
            C SCY +    H+    F+DNY LL  K++
Sbjct  121  CSSCYRDKNINHHKDALFLDNYTLLQAKRQ  150



>gb|KDP33333.1| hypothetical protein JCGZ_12882 [Jatropha curcas]
Length=417

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFM-TEQGYQCMSTKR  268
            M+E+ + AKAYY   S + K  A++ FN +D DGDG++  +E+  ++ T++G++ +++  
Sbjct  1    MEEISETAKAYYANLSEKQKRLAKDFFNEMDKDGDGKITFDEYEQYIKTKKGFKTIASSD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQCPN-----YDL  430
            FF +LD DGN +LDF E +T+ YI  S R F CD C  F+   +FTC+QC N     YDL
Sbjct  61   FFRKLDKDGNGSLDFDEFVTVHYICASERVFYCDECRVFLDRVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYENGKSGHNHQ---FMDNYALLAVKK  511
            C+SCY +    ++H+   F+DNY +L  K+
Sbjct  121  CVSCYRDKNIINHHKDAVFLDNYTMLQAKR  150


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 75/144 (52%), Gaps = 11/144 (8%)
 Frame = +2

Query  119  AYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGN  298
            +YYR+  P    +A++ F+++D  G G+V   E+  +  ++G   ++    F  LDT+G+
Sbjct  185  SYYRSLPPAEMQKAKDGFSAMDKTGSGKVSLKEYSEYFKQRGLVELTYPDLFKALDTNGD  244

Query  299  HTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATFFTCLQCPN------YDLCISCYENGK  457
              LDF E +T+ Y+  + +  +C  CG F+  ++ +C QC N      Y++C  CY    
Sbjct  245  GRLDFDEYITVYYLCMNNKLIYCGECGVFLSGSYMSCRQCFNNGSGDPYNICYDCYSRNN  304

Query  458  SGHNHQ--FMDNYAL--LAVKKRA  517
              H+    F+DN  L   AVK  A
Sbjct  305  IDHHKDATFVDNIQLHCFAVKGSA  328



>ref|XP_004306583.1| PREDICTED: uncharacterized protein LOC101310252 [Fragaria vesca 
subsp. vesca]
Length=213

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 86/147 (59%), Gaps = 8/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL++ A AYY  GS  L+  A + F SLD +GDG V  +EF++F+ + GY        
Sbjct  1    MEELNQAAIAYYNNGSQNLQTLALDFFQSLDTNGDGGVSWSEFISFLQQSGYDI--DPDM  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            FN LD DG+  LDF EV+TL YI K+    C GCG  +   +FTC++C       +DLC 
Sbjct  59   FNVLDEDGDGYLDFREVLTLYYIIKTRFFSCVGCGERLLGLYFTCVECFDRANDTFDLCS  118

Query  437  SCYENGKSGHNHQ-FMDNYALLAVKKR  514
            +CY   +  H H  F+DN+ LL  K+R
Sbjct  119  NCYAEKQFRHRHTLFLDNHMLLIAKRR  145



>gb|KDP33328.1| hypothetical protein JCGZ_12877 [Jatropha curcas]
Length=172

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 93/150 (62%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMT-EQGYQCMSTKR  268
            M+E+ + AKAYY   S + K  A++ FN +D DGDG++  +E+   +  ++G+  +++  
Sbjct  1    MEEISETAKAYYANLSEKQKRLAKDFFNEMDKDGDGKITFDEYEQRIKPKKGFNPIASSD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQCPN-----YDL  430
            FF +LD DGN TLDF E +TL YI  + R F CD C  F+   +FTC+QC N     YDL
Sbjct  61   FFRKLDKDGNGTLDFDEFVTLHYICATRRVFYCDECRVFLDRVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYENGKSGHNHQ---FMDNYALLAVKK  511
            C+SCY +    ++H+   F+DNY +L  K+
Sbjct  121  CVSCYRDKNIINHHKDAVFLDNYTMLHAKR  150



>ref|XP_008224031.1| PREDICTED: uncharacterized protein LOC103323795 [Prunus mume]
Length=226

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFM-TEQGYQCMSTKR  268
            M+EL ++A AYY      +K   QE  + +D DG+ +V   EFL +M   +  + + T  
Sbjct  1    MEELRQIALAYYEDVPEHMKTWVQEFLSEIDKDGNEKVSLQEFLAYMGMHEDSKHLCTPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC-----PNYDL  430
            FF+EL  +G   L+F +++ L YI  +GRPFC+G C  FI   +FTC+QC       +DL
Sbjct  61   FFDELKQEGREELEFMDLLALFYIVSTGRPFCNGHCKNFIKGGYFTCVQCFYHSPKTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C  CY +GK  H H+ F+DN+ +L  K+
Sbjct  121  CPVCYLDGKYVHGHKNFLDNFLVLKTKR  148



>ref|XP_006419794.1| hypothetical protein CICLE_v10007025mg [Citrus clementina]
 gb|ESR33034.1| hypothetical protein CICLE_v10007025mg [Citrus clementina]
Length=146

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMSTKR  268
            M+ L K+A AYY +G+ E +      F S+D DG+GRV   E+  FM+ + +   M T+ 
Sbjct  1    MEALSKVALAYYNSGTDEERRLFNLFFLSMDQDGNGRVSYREYSDFMSLEAHDDNMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   +FTC+ C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFTCMSCFEPQTAAYSIC  120

Query  434  ISCY-ENGKSGHNH---QFMDNY  490
            + C+ + G+  HNH    F+DN+
Sbjct  121  LECFCDKGRHDHNHGRSHFVDNF  143



>ref|XP_007223977.1| hypothetical protein PRUPE_ppa014649mg [Prunus persica]
 gb|EMJ25176.1| hypothetical protein PRUPE_ppa014649mg [Prunus persica]
Length=215

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 86/148 (58%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFM-TEQGYQCMSTKR  268
            M+EL ++A AYY+     +K   QE  + +D DG+ +V   EFL +M   +  + + T  
Sbjct  1    MEELRQIAFAYYKDVPEHVKMWVQEFLSEIDRDGNEKVSLQEFLAYMGMHEDSKHLCTPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC-----PNYDL  430
            FF+EL  +G   L+F +++ L YI  +GRPFC G C  FI   +FTC+QC       +DL
Sbjct  61   FFDELKQEGREELEFIDLLALFYIVSTGRPFCSGHCKNFIKGGYFTCVQCFYHSPKTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C  CY +GK  H H+ F+D++ +L  K+
Sbjct  121  CAVCYLDGKYVHRHKNFLDDFLVLKTKR  148



>gb|KDO74847.1| hypothetical protein CISIN_1g0274422mg, partial [Citrus sinensis]
Length=158

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 10/146 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGY-QCMSTKR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+ Q + + M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFADFMSLQAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            FF++L+ + +  LD  EV+TL YI KSGRP C  C  F+   +FTC++C       Y +C
Sbjct  61   FFDKLNINRSGGLDSMEVLTLYYILKSGRPICGQCKTFVTNEYFTCMKCFERQTAAYSIC  120

Query  434  ISCYEN-GKSGHNHQ---FMDNYALL  499
            + C+ + G   HNH    F+DN++LL
Sbjct  121  LKCFRDKGGLDHNHARSYFVDNFSLL  146



>ref|XP_002863242.1| hypothetical protein ARALYDRAFT_358968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39501.1| hypothetical protein ARALYDRAFT_358968 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELH+ A AYY  GS E +N + + F ++D +GDGRV   E+  F+ +           
Sbjct  1    MDELHEAAIAYYNNGSMEQQNLSWQFFRAMDVNGDGRVSLQEYTEFLRQTAGLAWVHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            F ELD +G+  LDFWEV+TL Y+ ++    C  C R +   +FTC+ C        +DLC
Sbjct  61   FRELDRNGDGQLDFWEVLTLYYVARTRTISCRTCLRILNGLYFTCVTCFESPCGNTFDLC  120

Query  434  ISCYENGKSGHNHQ-FMDNYALLAVKK  511
            + CY      H H+ F+D+Y LL  ++
Sbjct  121  VKCYMRRTYCHPHRLFLDSYVLLRSRR  147



>ref|NP_193080.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 emb|CAB40779.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83279.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=154

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELH+ A AYY  GS E +N + + F ++D +GDGRV   E+  F+ +           
Sbjct  1    MDELHEAAIAYYNNGSMEQQNLSWQFFRAMDVNGDGRVSLQEYTDFLRQTAGLAWIHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            F ELD +G+  LDFWEV+TL Y+ ++    C  C R +   +FTC+ C        +DLC
Sbjct  61   FRELDRNGDGQLDFWEVLTLYYVARTRTINCRTCLRILNGLYFTCVTCFESSCGNTFDLC  120

Query  434  ISCYENGKSGHNHQ-FMDNYALLAVKK  511
            + CY      H H+ F+D+Y LL  ++
Sbjct  121  VKCYMRRTYCHPHRLFLDSYVLLRSRR  147



>ref|XP_010069095.1| PREDICTED: uncharacterized protein LOC104456073 [Eucalyptus grandis]
Length=205

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 80/149 (54%), Gaps = 8/149 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M++L + AK Y+ A +  +K  AQ+    +D+D DG V  +EFL+F   +GY  MS    
Sbjct  1    MEDLQRTAKVYFDAAAENVKQLAQDFVTEMDHDHDGVVCLSEFLSFTKVKGYVRMSNPYL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F +L+  G   L F E +T  YI  S RP CDGCG      FFTC++C         ++L
Sbjct  61   FKQLNVSGTGKLSFDEAITFFYIATSARPLCDGCGCLALGMFFTCVKCFKDAGEAETFNL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKKR  514
            C  C+ +G   H H  F+DN+ +L   +R
Sbjct  121  CSDCFSHGNYTHPHNDFLDNFVMLEAMRR  149



>ref|XP_010277593.1| PREDICTED: uncharacterized protein LOC104611989 [Nelumbo nucifera]
Length=215

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (57%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ ++A +YY A S E K      F  LD+D +G +  NEF  ++  +G  C++   F
Sbjct  1    MEEIREVALSYYHACSAETKQMILNFFRELDSDQNGYITINEFTDYLMRKGCSCLNPN-F  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATFFTCLQC-------PNYD  427
            F ELD D N  LDF EV+T  YI +  R  FCDGCG F+ +++FTC+ C         YD
Sbjct  60   FLELDKDRNGLLDFEEVITFYYIVEFMRLVFCDGCGCFLKSSYFTCVDCYYSNEDNNTYD  119

Query  428  LCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
            LC  CY  G     H+ F+DN+ALL +  +
Sbjct  120  LCPRCYRTGNYARGHELFLDNHALLQLTGK  149



>ref|XP_010999446.1| PREDICTED: uncharacterized protein LOC105107269 [Populus euphratica]
Length=185

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 83/150 (55%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A+AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     +S    
Sbjct  1    MEEIRRAAEAYYENLSDEKKRNARFSFNEMDKNGDGKINLDEYVEYLKKDNNTVLSHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR  FC  C  F+   +F+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFKETIVLYYIMQSGRALFCQSCNTFLADVYFSCSQCFFNDDSDSTYE  120

Query  428  LCISCYENGKSGHN--HQFMDNYALLAVKK  511
            +C  CY   K  HN  H F DNY LL+  +
Sbjct  121  ICCDCYGGKKFRHNDGHIFCDNYTLLSQSR  150



>ref|XP_010550855.1| PREDICTED: uncharacterized protein LOC104821630 [Tarenaya hassleriana]
Length=204

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 83/150 (55%), Gaps = 11/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ELH+ A AYY  G+ E +  A + F ++D D DGRV  +E+  F+   G       + 
Sbjct  1    MEELHEAAIAYYNNGTDEQRALAWQFFQAMDTDHDGRVSFHEYSDFLRRTG--GFLRPQS  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC--------PNYD  427
            F +LD D N +LDFWEV+TL YI ++    C  C R +    FTCL C          +D
Sbjct  59   FQDLDRDRNGSLDFWEVLTLYYIARTRTLTCRTCHRSLEGLHFTCLACFDSPSHESATFD  118

Query  428  LCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
            LC+SCY      H+H+ F+D+Y LL  ++R
Sbjct  119  LCVSCYRARTYDHHHRLFLDSYVLLRSRRR  148



>ref|XP_010110693.1| hypothetical protein L484_009721 [Morus notabilis]
 gb|EXC27697.1| hypothetical protein L484_009721 [Morus notabilis]
Length=195

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 6/144 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY    P+ +N+A E F S+D DGDGR+   EF  F+   GY     + +
Sbjct  1    MEELRRAAVAYYNNSCPDFQNKAWEFFKSMDTDGDGRIRFAEFNQFLHWSGYG-FVDRNW  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PNYDLCIS  439
            F  LD + +  LDFWEV+TL Y+ K+   +C  C   +   +FTC++C     +YDLC  
Sbjct  60   FVHLDANRDGCLDFWEVLTLYYVLKTRGVWCAQCHTQLHGLYFTCVECFDAACSYDLCSD  119

Query  440  CYENGKSGHNHQ-FMDNYALLAVK  508
            CY +    H H  F+D++ LL  K
Sbjct  120  CYSHRNFSHYHSLFLDSFVLLRSK  143



>ref|XP_006371124.1| hypothetical protein POPTR_0019s04360g [Populus trichocarpa]
 gb|ERP48921.1| hypothetical protein POPTR_0019s04360g [Populus trichocarpa]
Length=193

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 82/150 (55%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A+AYY+  S E K  A+  FN +D DGDGR++ +E++ ++ +     ++    
Sbjct  1    MEEIRRAAEAYYKNLSEEKKRNARFYFNEMDIDGDGRINLDEYVEYLKKDNNTVLTHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E +   YI +SGR  FC  C  F+   +F+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVWYYIMQSGRALFCQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYENGKSGHNHQ--FMDNYALLAVKK  511
            LC  CY   +  H+    F DNY LL+  +
Sbjct  121  LCCDCYGGKRFTHHDDAVFWDNYTLLSQSR  150



>ref|XP_009350825.1| PREDICTED: uncharacterized protein LOC103942366 [Pyrus x bretschneideri]
Length=244

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 87/148 (59%), Gaps = 12/148 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQG-YQCMSTKR  268
            M++L + A AYY+  S +++  A E F  +D D + RV   EF  +M   G Y+ +    
Sbjct  1    MEDLRQTAFAYYKYASTDVQRLADESFYEMDLDKNDRVSLQEFTEYMERHGDYKHLCNSP  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC---------P  418
            FF+EL  +G   LDF +VMTLLYI  SG+PFC+G C +FI   +F C++C          
Sbjct  61   FFDELKKEGREELDFMDVMTLLYINYSGKPFCNGQCKKFIKGVYFACVKCFDDCATDATN  120

Query  419  NYDLCISCYENGKSGHNH-QFMDNYALL  499
             +++C +CY +GK  H H +F+DN+ LL
Sbjct  121  TFNVCPACYADGKYFHGHDKFLDNFLLL  148



>ref|XP_006284534.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
 gb|EOA17432.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
Length=207

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 79/147 (54%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELH+ A AYY  GS E ++ A   F ++DNDGDGRV   E++ F+             
Sbjct  1    MDELHEAAIAYYNNGSREQQDLAWHFFRAMDNDGDGRVSFQEYIDFLHRTAGLAWVCPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +    FTC+ C        +DLC
Sbjct  61   FRELDRNRDGQLDFWEVLTLYYVARTRTISCRTCLQSLSGLHFTCVTCFDTPGGETFDLC  120

Query  434  ISCYENGKSGHNH-QFMDNYALLAVKK  511
            + CY      H+H  F+D+Y LL  K+
Sbjct  121  VKCYMRRNYTHSHCLFLDSYVLLRSKR  147



>ref|XP_006284535.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
 gb|EOA17433.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
Length=208

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 79/147 (54%), Gaps = 7/147 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELH+ A AYY  GS E ++ A   F ++DNDGDGRV   E++ F+             
Sbjct  1    MDELHEAAIAYYNNGSREQQDLAWHFFRAMDNDGDGRVSFQEYIDFLHRTAGLAWVCPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +    FTC+ C        +DLC
Sbjct  61   FRELDRNRDGQLDFWEVLTLYYVARTRTISCRTCLQSLSGLHFTCVTCFDTPGGETFDLC  120

Query  434  ISCYENGKSGHNH-QFMDNYALLAVKK  511
            + CY      H+H  F+D+Y LL  K+
Sbjct  121  VKCYMRRNYTHSHCLFLDSYVLLRSKR  147



>ref|XP_006480237.1| PREDICTED: uncharacterized protein LOC102612370 [Citrus sinensis]
 ref|XP_006480238.1| PREDICTED: uncharacterized protein LOC102612675 [Citrus sinensis]
 ref|XP_006480239.1| PREDICTED: uncharacterized protein LOC102612979 [Citrus sinensis]
Length=201

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 107/201 (53%), Gaps = 18/201 (9%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGY-QCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGR  355
            +D DG+GRV   EF  FM+ + Y + M T+ FFN+LD DG+  LDF EV+TL YI KSGR
Sbjct  1    MDEDGNGRVSYREFSEFMSLEAYDRNMCTRDFFNDLDVDGSRGLDFNEVLTLYYIIKSGR  60

Query  356  PFCDGCGRFIPATFFTCLQCPN-----YDLCISCY--ENGKSGHNH---QFMDNYALL-A  502
            P C  C  FI   +FTC +C       Y++C+ C+  E G   H H   QF+DN+ALL  
Sbjct  61   PICRQCKIFITNEYFTCTRCFKTRSFPYNICLECFRGEEGHFNHTHSLEQFVDNFALLEC  120

Query  503  VKKRAemneeeeteDVNIVSH-HSVSTYddddddESYTAMHAIVA--ANVPakkfrkrkl  673
            ++K A   + E+       S   S             ++ HAIV    N+PA++  +   
Sbjct  121  LRKEALEEDREDEYYEPSPSRSRSQRIVHYSRYPSENSSHHAIVPYNPNIPAERRNRWGT  180

Query  674  alkalQIALH---VGNNCSIM  727
            A + L+  LH   V  +CSIM
Sbjct  181  AFRILETGLHFASVVTSCSIM  201



>ref|XP_010274594.1| PREDICTED: uncharacterized protein LOC104609873 [Nelumbo nucifera]
Length=230

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMS--TK  265
            M+E+ + A  YYR   PE+K +A E F S+D DGDG+V   EF  ++   G       ++
Sbjct  1    MEEIRQAALCYYRDSEPEIKMKAAEQFMSMDGDGDGKVSITEFTEYLKSAGCNVDKNLSR  60

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYD  427
              F ELD D N  LDF E +   YI       C GCG FI   +FTC+QC        Y+
Sbjct  61   NLFEELDRDKNGVLDFEEAIVFFYISTKRMIICGGCGSFIRDVYFTCIQCFRNKSQDAYN  120

Query  428  LCISCYEN--GKSGHNHQFMDNYALLAVKKRA  517
            LC  CY +  G+S  +  F+DN+  L   +++
Sbjct  121  LCCDCYASGQGRSDEHKVFLDNFTALKFIRQS  152



>ref|XP_010105214.1| hypothetical protein L484_011271 [Morus notabilis]
 gb|EXC04079.1| hypothetical protein L484_011271 [Morus notabilis]
Length=184

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 7/146 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL   A+AYY   S +L+N A   F S+D + DG V   EF  F+   GY  ++    
Sbjct  1    MEELRLAARAYYNNSSSDLQNLAINFFRSMDANRDGWVSFQEFTRFLRHNGYNWVNPN-M  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            F++LDT+ +  L FWEV+T  YI K+   +C  CG  +    FTC+ C       +DLC 
Sbjct  60   FSQLDTNNDGGLGFWEVLTFYYIIKTRAVWCRACGAQLHGLHFTCVACFDGGQNTFDLCA  119

Query  437  SCYENGKSGHNHQ-FMDNYALLAVKK  511
             CY   +  H+H+ F+DNY LL  K+
Sbjct  120  RCYGGRQFRHHHRVFLDNYILLRSKR  145



>ref|WP_033634418.1| hypothetical protein, partial [Serratia marcescens]
Length=101

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELHK+A+AYY   + E K++ +  FNS+D+D + R+   E+L +M   G+  M+ + F
Sbjct  1    MDELHKIARAYYTTANEESKSQGRRFFNSIDHDSNRRITIQEYLPYMKRNGHTKMANRPF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPAT  394
            F  L+      L+F EVMTL YI KSGR FCDGC   +  T
Sbjct  61   FEYLNESRTGQLEFMEVMTLFYIIKSGRKFCDGCDGLLKGT  101



>gb|KFK36230.1| hypothetical protein AALP_AA4G095100 [Arabis alpina]
Length=202

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 78/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDELH+ A AYY  G+ E ++ A + F ++D DG+GRV   E+  F+             
Sbjct  1    MDELHEAAIAYYNNGTMEQQSFAWQFFQAMDIDGNGRVSLQEYTDFLCRSAGLAWVHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C R +   +FTC+ C         +DL
Sbjct  61   FIELDRNRDGQLDFWEVLTLYYVARTRTISCRTCHRALNGLYFTCITCFDSPYGGDTFDL  120

Query  431  CISCYENGKSGHNH-QFMDNYALLAVKK  511
            C+ CY      H H  F+D+Y LL  K+
Sbjct  121  CVKCYNGRSYSHPHCLFLDSYVLLRSKR  148



>ref|XP_006371134.1| hypothetical protein POPTR_0019s04450g [Populus trichocarpa]
 gb|ERP48931.1| hypothetical protein POPTR_0019s04450g [Populus trichocarpa]
Length=186

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDGR++ +E+L ++ +     ++    
Sbjct  1    MEEVRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGRINLHEYLEYLKKDNNTVLTHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRALICQSCNTFLADVYFSCSQCFFKDDSDSTYE  120

Query  428  LCISCYENGKSGHNHQ--FMDNYALLAVKK  511
            +C  CY   +  H+    F DNY LL+  +
Sbjct  121  ICCDCYGGKRFTHHADAIFCDNYTLLSQSR  150



>ref|XP_006371129.1| hypothetical protein POPTR_0019s04400g [Populus trichocarpa]
 gb|ERP48926.1| hypothetical protein POPTR_0019s04400g [Populus trichocarpa]
Length=206

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 80/153 (52%), Gaps = 13/153 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E++ ++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVAYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC--------PNY  424
            F ELD DGN TLDF E + L YI +SGR   C  C  F+   +FTC QC          +
Sbjct  59   FTELDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYENGKSGHN--HQFMDNYALLAVKKRA  517
            D+C  CY   K  HN  H F DNY LL   + A
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSA  151



>ref|XP_004297939.1| PREDICTED: uncharacterized protein LOC101315429 [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 83/155 (54%), Gaps = 15/155 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMSTKR  268
            M+ELH  A AYY  G+ EL++ A   F S+D +GDG +   EF  F+ + GY   ++   
Sbjct  1    MEELHAAALAYYENGTQELRDLAWSFFRSIDTNGDGHISCLEFNDFLQQSGYNWIINDPN  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG--CGRFIPATFFTCLQC--------P  418
            FF  LD +G+  LDF EV+T  YI K+    C G  CG  +   +FTC+ C        P
Sbjct  61   FFKLLDRNGDGGLDFGEVITFYYIIKTRYIRCQGYHCGVHLCGLYFTCVACFDGVHEHRP  120

Query  419  NYDLCISCYENGKSGHNHQ----FMDNYALLAVKK  511
             +DLC +CY      H +Q    F+DN+ LL  K+
Sbjct  121  TFDLCPACYSKRNYYHPYQNHTYFLDNHVLLRSKR  155



>ref|XP_011012322.1| PREDICTED: uncharacterized protein LOC105116598 isoform X2 [Populus 
euphratica]
Length=192

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     +     
Sbjct  1    MEEIRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGQINLHEYVDYLKKHNNTVLILPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRNLICQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYENGKSGHNHQ--FMDNYALLAVKK  511
            LC  CY   +  H+    F DNY LL+  +
Sbjct  121  LCCDCYGGKRFTHHDDAIFWDNYTLLSQSR  150



>ref|XP_011012321.1| PREDICTED: uncharacterized protein LOC105116598 isoform X1 [Populus 
euphratica]
Length=193

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     +     
Sbjct  1    MEEIRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGQINLHEYVDYLKKHNNTVLILPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRNLICQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYENGKSGHNHQ--FMDNYALLAVKK  511
            LC  CY   +  H+    F DNY LL+  +
Sbjct  121  LCCDCYGGKRFTHHDDAIFWDNYTLLSQSR  150



>ref|XP_011011795.1| PREDICTED: uncharacterized protein LOC105116247 isoform X1 [Populus 
euphratica]
 ref|XP_011011796.1| PREDICTED: uncharacterized protein LOC105116247 isoform X1 [Populus 
euphratica]
Length=201

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 82/151 (54%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY+      K +A+E FN++D + DG++   E++ ++ E+     + +  
Sbjct  1    MEEIRRAAGAYYKHLPENNKEQARETFNAMDKNRDGKISVREYMDYLNEKKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C +C        Y++
Sbjct  61   FSALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C  CY + K  H+    F DNY LL   + A
Sbjct  121  CCECYGDNKFTHHDGAIFCDNYTLLCQSRSA  151



>ref|XP_011011797.1| PREDICTED: uncharacterized protein LOC105116247 isoform X2 [Populus 
euphratica]
Length=201

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 82/151 (54%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY+      K +A+E FN++D + DG++   E++ ++ E+     + +  
Sbjct  1    MEEIRRAAGAYYKHLPENNKEQARETFNAMDKNRDGKISVREYMDYLNEKKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C +C        Y++
Sbjct  61   FSALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C  CY + K  H+    F DNY LL   + A
Sbjct  121  CCECYGDNKFTHHDGAIFCDNYTLLCQSRSA  151



>ref|XP_007226919.1| hypothetical protein PRUPE_ppa015959mg, partial [Prunus persica]
 gb|EMJ28118.1| hypothetical protein PRUPE_ppa015959mg, partial [Prunus persica]
Length=168

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 80/157 (51%), Gaps = 17/157 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCM--STK  265
            M+ELH  A AYY  G+   +  A + F S+D DGDGR+   EF  F+ + GY  +  +  
Sbjct  1    MEELHAAAYAYYDRGNEHTRRVAYDFFRSMDTDGDGRISYAEFNDFVQQSGYYWILHNDP  60

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------  415
              F +LD + +  LD  EV+T  YI K+    C GC   +   +FTC++C          
Sbjct  61   NLFAKLDRNRDGGLDLQEVLTFYYIIKTRYITCQGCRAHLCGLYFTCVECFDGGAANYHH  120

Query  416  ----PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKK  511
                P YDLC +CY N    + H  F+DN+ LL  K+
Sbjct  121  HHQYPTYDLCAACYGNANYINQHSYFLDNHVLLRSKR  157



>gb|EYU32592.1| hypothetical protein MIMGU_mgv1a013813mg [Erythranthe guttata]
Length=209

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 12/140 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ ++AKAYY   + E K  A   F SLD +GDG++   E+   +        S  R 
Sbjct  1    MNEIREVAKAYYSRATAEEKKLATMYFRSLDLNGDGKISLAEYKKMVNPW----FSNNRL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----PN-YDLCI  436
            F ELD +GN TLDF E + L Y+ +   P CD C   +  ++F+CL C    PN YDLC 
Sbjct  57   FTELDRNGNGTLDFDEFLALFYMQRVPIPKCDACNNMLFGSYFSCLLCEKDFPNSYDLCC  116

Query  437  SCYENGKSGHNH---QFMDN  487
             CY  GK  H+H    FMDN
Sbjct  117  RCYGGGKYKHHHPRASFMDN  136



>gb|ABK94726.1| unknown [Populus trichocarpa]
Length=206

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 13/153 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E++ ++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVAYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC--------PNY  424
            F  LD DGN TLDF E + L YI +SGR   C  C  F+   +FTC QC          +
Sbjct  59   FTALDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYENGKSGHN--HQFMDNYALLAVKKRA  517
            D+C  CY   K  HN  H F DNY LL   + A
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSA  151



>ref|XP_010256260.1| PREDICTED: uncharacterized protein LOC104596704 [Nelumbo nucifera]
Length=213

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 10/144 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++ K+A AYY+  S E K   ++LF  +D DG+ +V  +EF  +   +  +    K  
Sbjct  1    MEQIRKVALAYYKESSDETKEHVKKLFKKIDADGNRKVSLDEFNEYCRRKSKKL--PKHC  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLC  433
            FNELD +G+  LDF E++   YI ++    C GCG  +   +FTC  C       N++LC
Sbjct  59   FNELDKNGDGFLDFEEIIVFFYIIQTRTISCSGCGSLVMGMYFTCAICFYTETSVNHNLC  118

Query  434  ISCYENGKSG--HNHQFMDNYALL  499
             SC+++GKS    +   +DNYALL
Sbjct  119  CSCHQSGKSAGCEHSNLVDNYALL  142



>ref|XP_009113947.1| PREDICTED: uncharacterized protein LOC103839202 isoform X5 [Brassica 
rapa]
Length=174

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 84/167 (50%), Gaps = 8/167 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+             
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C         +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKKRAemneeeeteDVNIVSHH  568
            C++CY      H H+ F+D++ LL  K+      +E   D N+   H
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKRSHPPMLQEPPGDQNMPEQH  167



>ref|XP_004296541.1| PREDICTED: uncharacterized protein LOC101310401 [Fragaria vesca 
subsp. vesca]
Length=218

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 87/155 (56%), Gaps = 16/155 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMSTKR  268
            M+ELH  A AYY  G+ +L++ A   F S+D + DG++  +EF  F+ + GY   ++   
Sbjct  3    MEELHAAALAYYDNGTQQLRDLAGSFFRSMDTNDDGKISCSEFNEFLQQSGYNWIINDPN  62

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG--CGRFIPATFFTCLQC--------P  418
            FF  LD +G+  LDF EV+T  YI K+    C G  CG  +   +FTC+ C         
Sbjct  63   FFKRLDRNGDGGLDFGEVLTFYYIIKTRYIRCQGYHCGVHLCGLYFTCVACFDGAHEHRS  122

Query  419  NYDLCISCYENGKSGHNHQ----FMDNYALLAVKK  511
             +DLC +CY N ++ ++HQ    F+DN+ LL  K+
Sbjct  123  TFDLCATCYRN-RNYYHHQHHTYFLDNHVLLRSKR  156



>ref|XP_006371128.1| hypothetical protein POPTR_0019s04390g [Populus trichocarpa]
 ref|XP_006371130.1| hypothetical protein POPTR_0019s04410g [Populus trichocarpa]
 gb|ERP48925.1| hypothetical protein POPTR_0019s04390g [Populus trichocarpa]
 gb|ERP48927.1| hypothetical protein POPTR_0019s04410g [Populus trichocarpa]
Length=206

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 13/153 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E++ ++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVEYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC--------PNY  424
            F  LD DGN TLDF E + L YI +SGR   C  C  F+   +FTC QC          +
Sbjct  59   FTALDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYENGKSGHN--HQFMDNYALLAVKKRA  517
            D+C  CY   K  HN  H F DNY LL   + A
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSA  151



>ref|XP_009113944.1| PREDICTED: uncharacterized protein LOC103839202 isoform X2 [Brassica 
rapa]
Length=196

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 84/167 (50%), Gaps = 8/167 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+             
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C         +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKKRAemneeeeteDVNIVSHH  568
            C++CY      H H+ F+D++ LL  K+      +E   D N+   H
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKRSHPPMLQEPPGDQNMPEQH  167



>ref|XP_009113943.1| PREDICTED: uncharacterized protein LOC103839202 isoform X1 [Brassica 
rapa]
Length=198

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 84/167 (50%), Gaps = 8/167 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+             
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C         +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKKRAemneeeeteDVNIVSHH  568
            C++CY      H H+ F+D++ LL  K+      +E   D N+   H
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKRSHPPMLQEPPGDQNMPEQH  167



>ref|XP_008353259.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 [Malus 
domestica]
Length=284

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 6/123 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ELH+ A AYY  G   L+  A   F S+D +GDG V+  EF+TF+ + GY  +  + F
Sbjct  1    MEELHRAALAYYNNGDRNLQLLASNFFQSMDQNGDGIVNLAEFVTFLQQNGYGWIG-RNF  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
            F +LD +    LDF EV+T  YI K+   +C  CG ++   +FTC++C      NYDLC 
Sbjct  60   FYDLDRNLVGGLDFHEVLTFYYIIKTRNLWCRRCGVWLTGLYFTCVECFDGAPDNYDLCS  119

Query  437  SCY  445
             CY
Sbjct  120  GCY  122



>ref|XP_006388264.1| hypothetical protein POPTR_0257s00210g [Populus trichocarpa]
 gb|ABK96078.1| unknown [Populus trichocarpa]
 gb|ERP47178.1| hypothetical protein POPTR_0257s00210g [Populus trichocarpa]
Length=206

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 82/151 (54%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY+      K  A++ F ++D +GDG+++++E++ ++ +     ++    
Sbjct  1    MEEIRRAAGAYYQHLPENNKELAKKTFAAMDKNGDGKINRDEYVEYLKKDNNTVLTLPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C +C       +Y++
Sbjct  61   FTALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSSYEI  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C  CY   K  H+    F DNY LL   + A
Sbjct  121  CCECYGGKKFTHHDGAIFCDNYTLLCRSRSA  151



>ref|XP_011011798.1| PREDICTED: uncharacterized protein LOC105116248 isoform X1 [Populus 
euphratica]
Length=199

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 80/151 (53%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY+      K +A++ FN++D +GDG++   E++ ++ E      + +  
Sbjct  1    MEEIRRAAGAYYKHLPENKKEQARKTFNAMDKNGDGKISVREYVDYLNENKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F+ LD D N +LDF E   L YI +SGR   C  C  F+   +F+C +C        Y++
Sbjct  61   FSALDKDSNGSLDFDEATVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C  CY + K  H+    F DNY LL   + A
Sbjct  121  CCECYGDKKFTHHDGAIFCDNYTLLCQSRSA  151



>ref|XP_011011799.1| PREDICTED: uncharacterized protein LOC105116248 isoform X2 [Populus 
euphratica]
Length=199

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 80/151 (53%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY+      K +A++ FN++D +GDG++   E++ ++ E      + +  
Sbjct  1    MEEIRRAAGAYYKHLPENKKEQARKTFNAMDKNGDGKISVREYVDYLNENKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F+ LD D N +LDF E   L YI +SGR   C  C  F+   +F+C +C        Y++
Sbjct  61   FSALDKDSNGSLDFDEATVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C  CY + K  H+    F DNY LL   + A
Sbjct  121  CCECYGDKKFTHHDGAIFCDNYTLLCQSRSA  151



>ref|XP_006371132.1| hypothetical protein POPTR_0019s04430g [Populus trichocarpa]
 gb|ERP48929.1| hypothetical protein POPTR_0019s04430g [Populus trichocarpa]
Length=163

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 80/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ + ++A AYY     E K  A+ +F+ +D + DG++D +E++ ++ +      +    
Sbjct  1    MERIRRVAVAYYENLPEEKKRYARFIFDEMDENRDGQIDLDEYVEYLKKHNNTIFTDPSM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DG+ +LDF E +TL YI +SGR  FCD C  F+   +F+C QC         YD
Sbjct  61   FRALDKDGDGSLDFEESITLYYILQSGRALFCDCCHTFLADVYFSCFQCFCLHESASTYD  120

Query  428  LCISCYENGKSGHNHQ--FMDNYALLAVKK  511
            LC  CY   K  H+    F DN  LL+  +
Sbjct  121  LCCDCYGGKKFNHHDDAIFWDNCTLLSKSR  150



>ref|XP_010428594.1| PREDICTED: uncharacterized protein LOC104713218 isoform X2 [Camelina 
sativa]
Length=199

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFAEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>ref|XP_010471684.1| PREDICTED: uncharacterized protein LOC104751441 isoform X2 [Camelina 
sativa]
 ref|XP_010471687.1| PREDICTED: uncharacterized protein LOC104751443 isoform X2 [Camelina 
sativa]
Length=208

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>ref|XP_010471683.1| PREDICTED: uncharacterized protein LOC104751441 isoform X1 [Camelina 
sativa]
 ref|XP_010471686.1| PREDICTED: uncharacterized protein LOC104751443 isoform X1 [Camelina 
sativa]
Length=209

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>emb|CDY36976.1| BnaC09g17920D [Brassica napus]
Length=155

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 80/148 (54%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M EL++ A AYY  GS + +N A + F S+D DG+GRV   E+  F+          +  
Sbjct  1    MQELNEAAIAYYNNGSTDQQNLAWQFFLSMDGDGNGRVSFQEYTDFLCRTTGLAWVRREM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPA---TFFTCLQ----CPNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +     TF TC +    C  +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTFVTCFESQCVCDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C++CY      H H+ F+D++ LL  K+
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKR  148



>ref|XP_010428593.1| PREDICTED: uncharacterized protein LOC104713218 isoform X1 [Camelina 
sativa]
Length=200

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFAEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>ref|XP_010256259.1| PREDICTED: uncharacterized protein LOC104596703 [Nelumbo nucifera]
Length=205

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +2

Query  113  AKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMST--KRFFNELD  286
            A  YYR   PE+K  AQ+ FNS+D + DG++   EF  ++  + Y   +    + F ELD
Sbjct  18   ALCYYRDSPPEIKQMAQDQFNSMDRNEDGKISITEFKEYLVGEKYGNNNNNYSKLFEELD  77

Query  287  TDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNYDLCISCYE  448
             D N  LDF E +   YI  +    C GCG  I   +FTC++C        Y+LC  CY 
Sbjct  78   RDNNGFLDFDEAIVFFYISTARLVICGGCGILIKEIYFTCMECFCDRSLDEYNLCCDCYA  137

Query  449  NGKSGH-NH-QFMDNYALLAV  505
            + K  H NH +F+DN+A L +
Sbjct  138  SKKGRHENHKKFVDNFAALQL  158



>ref|XP_010471689.1| PREDICTED: uncharacterized protein LOC104751444 isoform X2 [Camelina 
sativa]
Length=192

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>gb|EYU32593.1| hypothetical protein MIMGU_mgv1a021501mg, partial [Erythranthe 
guttata]
Length=136

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 12/140 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ ++A+AYY   + + KN A + F SLD++ DG +   EF   +       +ST + 
Sbjct  1    MNEIREVAEAYYARATVDEKNSALDFFRSLDDNNDGTISHAEFRKLVDPS----LSTDKL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCP-----NYDLCI  436
            F ELD + + TLDF EV+ L YI K G   CD C   +  ++F+CL C      ++DLC 
Sbjct  57   FKELDKNNDGTLDFNEVLALYYIQKCGARLCDVCRDILLTSYFSCLLCEKHLPYSFDLCC  116

Query  437  SCYENGKSGHNH---QFMDN  487
             CY  G   H H   +F+DN
Sbjct  117  GCYGGGAFEHRHPPSKFIDN  136



>ref|XP_010471688.1| PREDICTED: uncharacterized protein LOC104751444 isoform X1 [Camelina 
sativa]
Length=193

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   +FTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C+ CY+     H H+ F+D+  LL  K+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRAKR  148



>ref|XP_009113946.1| PREDICTED: uncharacterized protein LOC103839202 isoform X4 [Brassica 
rapa]
Length=194

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 78/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+             
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C         +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C++CY      H H+ F+D++ LL  K+
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKR  148



>ref|XP_007226352.1| hypothetical protein PRUPE_ppa022625mg, partial [Prunus persica]
 gb|EMJ27551.1| hypothetical protein PRUPE_ppa022625mg, partial [Prunus persica]
Length=144

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 17/138 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQC--MSTK  265
            M+EL +   AYY+     +K    E F  +D DG+ RV   EFL +M E    C  +ST 
Sbjct  1    MEELRQTVLAYYKDAPQHIKRSVDECFIEMDVDGNDRVSWQEFLAYM-EMHEDCKHLSTC  59

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC---------  415
             FFNEL  +    LDF +V+ L+YI  SG+PFC+G  G FI  T+FTC++C         
Sbjct  60   SFFNELKKEEKEGLDFMDVVILVYIIYSGKPFCNGHSGSFIKGTYFTCVKCFDGHEHGQC  119

Query  416  --PN--YDLCISCYENGK  457
              PN  +++C  CY +GK
Sbjct  120  SVPNKTFNVCTVCYVDGK  137



>ref|XP_009113945.1| PREDICTED: uncharacterized protein LOC103839202 isoform X3 [Brassica 
rapa]
Length=196

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 78/148 (53%), Gaps = 8/148 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+             
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C         +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFDL  120

Query  431  CISCYENGKSGHNHQ-FMDNYALLAVKK  511
            C++CY      H H+ F+D++ LL  K+
Sbjct  121  CVNCYMRRNYNHPHRVFLDSFVLLRSKR  148



>ref|XP_006388948.1| hypothetical protein POPTR_0068s00200g [Populus trichocarpa]
 gb|ERP47862.1| hypothetical protein POPTR_0068s00200g [Populus trichocarpa]
Length=195

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 72/147 (49%), Gaps = 10/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ + + A AYY     E K  A++ F ++D +GDG++   E+L ++        +    
Sbjct  3    MEGIRQAAVAYYEHLPEEKKKSAEDTFKAMDKNGDGKISLREYLGYLASSNNAVFTHPNI  62

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F+ LD D N  LDF E   L YI  SGR   C  CG F+   +F+C QC         YD
Sbjct  63   FSALDKDNNGNLDFEETKVLYYILFSGRALLCKCCGTFLADVYFSCFQCFCLDESASTYD  122

Query  428  LCISCYENGKSGH--NHQFMDNYALLA  502
            LC  C+   K  H   H F DNY LL+
Sbjct  123  LCCDCFGGKKFRHLDGHIFWDNYTLLS  149



>gb|EYU38467.1| hypothetical protein MIMGU_mgv1a018857mg, partial [Erythranthe 
guttata]
Length=165

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 15/145 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDEL  + KAY+   + + K  A+E F SLD D DGRV   E+ T ++       +    
Sbjct  1    MDELRAVGKAYFARATDQEKELAKEFFRSLDGDSDGRVSLAEYKTLVSRP----YANDTL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF--CDGCGRFIPATFFTCLQC----PN-YDL  430
            F  LD +G+ +LDF EV+ L +I   G P   C  C R +P  +F+C+ C    P+ YDL
Sbjct  57   FTGLDRNGDESLDFDEVLALHFIMTKG-PLRTCHACARSMPGAYFSCIPCEKNHPDTYDL  115

Query  431  CISCYENGKSGHNH---QFMDNYAL  496
            C SCY  G+  H H    F+D++++
Sbjct  116  CCSCYGAGQYDHQHPAADFLDSHSM  140



>ref|XP_006371126.1| hypothetical protein POPTR_0019s04380g, partial [Populus trichocarpa]
 gb|ERP48923.1| hypothetical protein POPTR_0019s04380g, partial [Populus trichocarpa]
Length=147

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 11/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ + + A  YY     E K  A+ +F+ +D + DG++D +E++ ++ +      +    
Sbjct  1    MEGIRRAAVTYYENLPEEKKRYARFIFDEMDENRDGQIDLDEYVEYLKKDNNTVFTDPSM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DG+ +LDF E +TL YI +SGR  FC  C  F+   +F+C QC         YD
Sbjct  61   FRALDKDGDGSLDFEETITLYYIMESGRALFCKTCNTFLAEVYFSCFQCFCLDESASTYD  120

Query  428  LCISCYENGKSGHNHQ---FMDNYALL  499
            LC  CY   K   +H    F DNY LL
Sbjct  121  LCCDCYGGKKFTDHHDDAIFCDNYTLL  147



>ref|XP_006371125.1| hypothetical protein POPTR_0019s04370g, partial [Populus trichocarpa]
 gb|ERP48922.1| hypothetical protein POPTR_0019s04370g, partial [Populus trichocarpa]
Length=158

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 81/152 (53%), Gaps = 11/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYY     + K  A++ F ++D   DG++  +E++ ++ ++     + +  
Sbjct  1    MEEIRRAAVAYYENQPAKNKKLARKAFKAMDKSRDGKISLSEYVDYLKKKKASDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C QC        Y++
Sbjct  61   FSLLDKDGNGSLDFEEAIVLYYIMQSGRALICKSCNTFLAGAYFSCSQCFFNDSVSTYEI  120

Query  431  CISCYENGKSGHNHQ---FMDNYALLAVKKRA  517
            C  CY  GK+  +H    F DNY LL   + A
Sbjct  121  CCECY-GGKNFKHHDCAIFCDNYTLLRQSRSA  151



>ref|XP_006371123.1| hypothetical protein POPTR_0019s04350g [Populus trichocarpa]
 gb|ERP48920.1| hypothetical protein POPTR_0019s04350g [Populus trichocarpa]
Length=199

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 78/146 (53%), Gaps = 11/146 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M++  + A AYY     + K  A++ FN++D +GDG++   E++ ++ +      + +  
Sbjct  1    MEQTRRAAVAYYEHLPAKTKKLARKTFNAMDKNGDGQISLREYVDYLKKNKATDFTHQSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATFFTCLQC------PNYDL  430
            F  LD DGN +LDF E + L YI +SGR   C  C   +   +F+C QC        Y++
Sbjct  61   FTALDKDGNGSLDFEEAIVLYYIMQSGRAISCQSCKTLLAGAYFSCSQCFFNVSDSTYEI  120

Query  431  CISCYENGKSGHNHQ---FMDNYALL  499
            C +CY  GK+  +H    F DNY LL
Sbjct  121  CCACY-GGKNYTHHGDAIFCDNYTLL  145



>ref|XP_011091670.1| PREDICTED: uncharacterized protein LOC105172028 [Sesamum indicum]
Length=194

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 13/147 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ + ++A AYY   S E K  A+E F +LD +GDGRV     L      G   +S +  
Sbjct  1    MEGMREIATAYYERASDEEKESAEEFFRNLDVNGDGRVS---LLELKRSVG-SWLSNENV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATFFTCLQC-----PNYDLC  433
            F +LD +G+ TLDF+EV+ + Y+  K     C GC   +   +F+CL C       +DLC
Sbjct  57   FKQLDENGDGTLDFYEVLAVYYMVNKVNLLVCSGCWGLLVGPYFSCLLCLGKSPDTFDLC  116

Query  434  ISCYENGKSGHNHQ---FMDNYALLAV  505
             +CY  G   H H     +D+++LLAV
Sbjct  117  CTCYRRGTVAHEHSSKYLLDHHSLLAV  143



>ref|XP_004296539.1| PREDICTED: uncharacterized protein LOC101309628 [Fragaria vesca 
subsp. vesca]
Length=224

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 81/154 (53%), Gaps = 15/154 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQ-GYQCMSTKR  268
            M+E+ + A AYY     +L+  A   F  +D++G+G +   EF   M        +  KR
Sbjct  1    MEEIREAALAYYHNLPEDLQKLASAKFKEIDSNGNGTISLREFKNSMRSSFDNDSVIMKR  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGR--PFC--DGC---GRFIPATFFTCLQC----  415
             F ELD +G+  LDF E +TL Y+ +SGR   +C  DGC     F+   +FTC+ C    
Sbjct  61   SFKELDKNGDGKLDFNEYITLYYLLESGRLLIYCAGDGCEDDAPFLKGHYFTCVDCFHHN  120

Query  416  --PNYDLCISCYENGKSGHNH-QFMDNYALLAVK  508
                +DLC SCY NGK  H H  F+DN+ LL  K
Sbjct  121  ENETFDLCTSCYRNGKFAHEHTNFLDNHVLLRSK  154



>gb|EYU38469.1| hypothetical protein MIMGU_mgv1a0149542mg, partial [Erythranthe 
guttata]
Length=159

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 82/144 (57%), Gaps = 13/144 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ ++AKA Y   + E K  A++ F SLD D DG+V+  E+ + +  + Y   + +  
Sbjct  1    MNEIRRVAKAQYLRATEEEKGAAKKFFQSLDGDCDGKVNLAEYKS-LVRRAY---THESL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC-----PNYDLC  433
            FN LD +G+ +LDF EV+ L Y+ K G   CDG C  ++   +F+C  C       YDLC
Sbjct  57   FNCLDENGDGSLDFEEVLVLHYMQKCGMRICDGSCRGWLLGPYFSCTICEKNYPKTYDLC  116

Query  434  ISCYENGKSGHNH---QFMDNYAL  496
             +CY  GK  H+H    F+D+ ++
Sbjct  117  CTCYSGGKFKHDHSTTSFLDDRSM  140



>ref|XP_008224099.1| PREDICTED: uncharacterized protein LOC103323856 [Prunus mume]
Length=128

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFM-TEQGYQCMSTKR  268
            M+EL +   AY +     +K    E F  +D DG+ RV++ EFL +M   +  + MST  
Sbjct  1    MEELWQTVLAYCKDAPQHIKWSVDECFVEMDVDGNDRVNRQEFLAYMEIHEDCKHMSTCS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATFFTCLQC  415
            FFNE   +    LDF +++ L+YI  SG+PFC+G CG FI  T+FTC++C
Sbjct  61   FFNEFKKEEKEGLDFMDMVILVYIIYSGKPFCNGHCGSFIKGTYFTCVKC  110



>gb|EYU38473.1| hypothetical protein MIMGU_mgv1a021207mg, partial [Erythranthe 
guttata]
Length=161

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 84/151 (56%), Gaps = 15/151 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MD+LH +AKAYY   + E K +A+  F SLD +  G++   E+ + +        ++   
Sbjct  1    MDQLHLVAKAYYARATDEEKEKAENYFRSLDVNCTGKISLAEYKSLVNPY----YASDAV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF--CDGCGRFIPATFFTCLQC----PN-YDL  430
            F  LD +G+ +LDF EV+ L +I K  RP   CD C   +   +F+CL C    PN YD+
Sbjct  57   FKWLDKNGDGSLDFEEVLALYFIHKI-RPLRRCDACRGSLQGPYFSCLMCEKNHPNTYDI  115

Query  431  CISCYENGKSGHNH---QFMDNYALLAVKKR  514
            C  CY NGK  H+H    F+D+Y++  ++ +
Sbjct  116  CCGCYGNGKFEHHHPTTSFLDSYSMRRLQTQ  146



>ref|XP_006371135.1| hypothetical protein POPTR_0019s04460g [Populus trichocarpa]
 gb|ERP48932.1| hypothetical protein POPTR_0019s04460g [Populus trichocarpa]
Length=182

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 76/151 (50%), Gaps = 9/151 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+ + + A+AYY       +  A + FN +D + DG++   E++ ++ ++       +  
Sbjct  9    MEGIRRAARAYYDHLPDGERKNATKDFNDMDKNRDGKISLLEYVDYLKKKKATSFVQQSI  68

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC------PNYDL  430
            F  LD D N TLDF E + L Y+ KSGR   C GC +F+   +F+C QC        Y++
Sbjct  69   FRALDKDDNGTLDFEEAIVLFYLMKSGRAIICKGCEKFLAGAYFSCSQCFFNVSVSTYEI  128

Query  431  CISCYENGKSGHNHQ--FMDNYALLAVKKRA  517
            C +CY      H+    F DNY LL   + A
Sbjct  129  CCACYRGNNFTHHGDAIFCDNYTLLRQSRSA  159



>ref|XP_011012576.1| PREDICTED: uncharacterized protein LOC105116792 [Populus euphratica]
Length=200

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 12/147 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M++  + A AYY     + K  A++ FN++D +GDG++   E++ ++ +      + +  
Sbjct  1    MEQTRRAAVAYYEHLPAKTKKLARKTFNAMDKNGDGQISLREYVDYLKKNKATDFTHQSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATFFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   +F+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFEEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSQCFFNNDSGSTYE  120

Query  428  LCISCYENGKSGHNHQ---FMDNYALL  499
            +  +CY  GK+  +H    F DNY LL
Sbjct  121  IFCACY-GGKNFTHHGDAIFCDNYTLL  146



>ref|XP_010243843.1| PREDICTED: uncharacterized protein LOC104587812 isoform X5 [Nelumbo 
nucifera]
Length=911

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF  F +  G    + + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
            F  ELD DG+  LD+ +   +LY     R  C  C RFI   ++TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDA-KVLYYMDLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVK  508
             + LC++CY+ G+  H H F+DNYALL  +
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALLRTR  837


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 12/141 (9%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y+  S E K    + F  LD++ DG++   E   F++E+GY     K    ELD DG+  
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGYTGQKFKS-LAELDKDGDGY  390

Query  305  LDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNYDLCISCYENGK  457
            LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +GK
Sbjct  391  LDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHSGK  449

Query  458  SGHNHQ-FMDNYALLAVKKRA  517
              H H  F DNY +L  + +A
Sbjct  450  FVHEHSTFWDNYEMLWNRMQA  470


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (48%), Gaps = 16/149 (11%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF  F +  G   ++ + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   +++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAV  505
             Y+LC SCY  G+  H H F+DNY  L +
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQM  624


 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 75/155 (48%), Gaps = 19/155 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     +E   Q    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSESRSQ--RKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGR---FIPATFFTCLQC---------  415
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C         
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  416  -PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
              +Y+LC++CY++ +  H+H  F+DNY  L ++KR
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKR  150


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 21/151 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F            ++ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   F++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYENGKSGHNH-QFMDNYALLAVKKRA  517
            LC++CY   K  H H  F DNY LL  +  A
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLLEKRNLA  308



>ref|XP_010243841.1| PREDICTED: uncharacterized protein LOC104587812 isoform X3 [Nelumbo 
nucifera]
Length=990

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF  F +  G    + + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   ++TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVK  508
             + LC++CY+ G+  H H F+DNYALL  +
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALLRTR  837


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 12/141 (9%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y+  S E K    + F  LD++ DG++   E   F++E+GY     K    ELD DG+  
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGYTGQKFKS-LAELDKDGDGY  390

Query  305  LDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNYDLCISCYENGK  457
            LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +GK
Sbjct  391  LDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHSGK  449

Query  458  SGHNHQ-FMDNYALLAVKKRA  517
              H H  F DNY +L  + +A
Sbjct  450  FVHEHSTFWDNYEMLWNRMQA  470


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (48%), Gaps = 16/149 (11%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF  F +  G   ++ + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   +++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAV  505
             Y+LC SCY  G+  H H F+DNY  L +
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQM  624


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 75/155 (48%), Gaps = 19/155 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     +E   Q    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSESRSQ--RKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATFFTCLQC---------  415
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C         
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  416  -PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
              +Y+LC++CY++ +  H+H  F+DNY  L ++KR
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKR  150


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 21/151 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F            ++ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   F++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYENGKSGHNH-QFMDNYALLAVKKRA  517
            LC++CY   K  H H  F DNY LL  +  A
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLLEKRNLA  308



>ref|XP_010243840.1| PREDICTED: uncharacterized protein LOC104587812 isoform X2 [Nelumbo 
nucifera]
Length=994

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF  F +  G    + + 
Sbjct  689  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  748

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   ++TC++C           
Sbjct  749  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  806

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVK  508
             + LC++CY+ G+  H H F+DNYALL  +
Sbjct  807  THSLCLACYDTGRVNHPHVFLDNYALLRTR  836


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 12/141 (9%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y+  S E K    + F  LD++ DG++   E   F++E+GY     K    ELD DG+  
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGYTGQKFKS-LAELDKDGDGY  390

Query  305  LDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNYDLCISCYENGK  457
            LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +GK
Sbjct  391  LDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHSGK  449

Query  458  SGHNHQ-FMDNYALLAVKKRA  517
              H H  F DNY +L  + +A
Sbjct  450  FVHEHSTFWDNYEMLWNRMQA  470


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (48%), Gaps = 16/149 (11%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF  F +  G   ++ + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   +++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAV  505
             Y+LC SCY  G+  H H F+DNY  L +
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQM  624


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 75/155 (48%), Gaps = 19/155 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     +E   Q    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSESRSQ--RKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGR---FIPATFFTCLQC---------  415
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C         
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  416  -PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
              +Y+LC++CY++ +  H+H  F+DNY  L ++KR
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKR  150


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 21/151 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F            ++ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   F++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYENGKSGHNH-QFMDNYALLAVKKRA  517
            LC++CY   K  H H  F DNY LL  +  A
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLLEKRNLA  308



>ref|XP_010243842.1| PREDICTED: uncharacterized protein LOC104587812 isoform X4 [Nelumbo 
nucifera]
Length=990

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF  F +  G    + + 
Sbjct  685  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  744

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   ++TC++C           
Sbjct  745  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  802

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVK  508
             + LC++CY+ G+  H H F+DNYALL  +
Sbjct  803  THSLCLACYDTGRVNHPHVFLDNYALLRTR  832


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 12/141 (9%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y+  S E K    + F  LD++ DG++   E   F++E+GY     K    ELD DG+  
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGYTGQKFKS-LAELDKDGDGY  390

Query  305  LDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNYDLCISCYENGK  457
            LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +GK
Sbjct  391  LDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHSGK  449

Query  458  SGHNHQ-FMDNYALLAVKKRA  517
              H H  F DNY +L  + +A
Sbjct  450  FVHEHSTFWDNYEMLWNRMQA  470


 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 94/198 (47%), Gaps = 19/198 (10%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF  F +  G   ++ + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   +++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVKKRAemneeeeteDV---NIVSHHSVSTYdd  589
             Y+LC SCY  G+  H H F+DNY  L +   A  NE +E  +V   +I +  S  T + 
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMILSAPTNENKEENEVFTEDIATVESTQTDNS  655

Query  590  ddddESYTAMHAIVAANV  643
             ++ ++    +AIV + +
Sbjct  656  QEEKDADQEENAIVPSTI  673


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 75/155 (48%), Gaps = 19/155 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     +E   Q    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSESRSQ--RKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATFFTCLQC---------  415
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C         
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  416  -PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
              +Y+LC++CY++ +  H+H  F+DNY  L ++KR
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKR  150


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 21/151 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F            ++ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   F++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYENGKSGHNH-QFMDNYALLAVKKRA  517
            LC++CY   K  H H  F DNY LL  +  A
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLLEKRNLA  308



>ref|XP_010243839.1| PREDICTED: uncharacterized protein LOC104587812 isoform X1 [Nelumbo 
nucifera]
Length=995

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 12/150 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF  F +  G    + + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   ++TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAVK  508
             + LC++CY+ G+  H H F+DNYALL  +
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALLRTR  837


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (49%), Gaps = 12/141 (9%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y+  S E K    + F  LD++ DG++   E   F++E+GY     K    ELD DG+  
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGYTGQKFKS-LAELDKDGDGY  390

Query  305  LDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNYDLCISCYENGK  457
            LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +GK
Sbjct  391  LDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHSGK  449

Query  458  SGHNHQ-FMDNYALLAVKKRA  517
              H H  F DNY +L  + +A
Sbjct  450  FVHEHSTFWDNYEMLWNRMQA  470


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (48%), Gaps = 16/149 (11%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF  F +  G   ++ + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   +++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYENGKSGHNHQFMDNYALLAV  505
             Y+LC SCY  G+  H H F+DNY  L +
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQM  624


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 75/155 (48%), Gaps = 19/155 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     +E   Q    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSESRSQ--RKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATFFTCLQC---------  415
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C         
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  416  -PNYDLCISCYENGKSGHNHQ-FMDNYALLAVKKR  514
              +Y+LC++CY++ +  H+H  F+DNY  L ++KR
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKR  150


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (46%), Gaps = 21/151 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F            ++ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   F++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYENGKSGHNH-QFMDNYALLAVKKRA  517
            LC++CY   K  H H  F DNY LL  +  A
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLLEKRNLA  308



>ref|XP_010110690.1| hypothetical protein L484_009718 [Morus notabilis]
 gb|EXC27694.1| hypothetical protein L484_009718 [Morus notabilis]
Length=116

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL   A+AYY   S +L+N A   F S+D +GDG +   EF  F+ + GY  ++    
Sbjct  1    MEELRLAARAYYNNSSSDLQNLAINFFRSMDTNGDGWISFQEFTRFLMDNGYNWVNPN-M  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC  415
            F++LDT+ +  LDFWEV+T  YI K+    C+ C   +    FTC+ C
Sbjct  60   FSQLDTNLDGGLDFWEVLTFYYIIKTRGVLCNACYAPLHGLHFTCVAC  107



>gb|AIU48193.1| MSH1, partial [Fragaria vesca]
Length=1398

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMST  262
             ++++LH  A AYY  GSPEL+  A   F S+D +GD R+  +EF  F+ + G++  ++ 
Sbjct  1    MEIEQLHPAALAYYEHGSPELQRLAWSFFQSMDTNGDQRISYSEFSDFLEQTGHKWILND  60

Query  263  KRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNY  424
              FF +LD + +  LDF EV+T  YI K+    C GC  ++   +FTC+ C        Y
Sbjct  61   PNFFKKLDRNRDGGLDFEEVLTFYYIIKTRCVICRGCSVYLCGLYFTCVACFDGADHKTY  120

Query  425  DLCISCYENGKS  460
            DLC +     +S
Sbjct  121  DLCAAMTPQPQS  132



>gb|KCW46930.1| hypothetical protein EUGRSUZ_K00744 [Eucalyptus grandis]
Length=147

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (50%), Gaps = 17/131 (13%)
 Frame = +2

Query  104  HKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNEL  283
            H L+ AY  A +  +K  AQ+    +D+D +G V  +EFL+F   +GY          EL
Sbjct  5    HILSMAYLDAATENVKQLAQDFVTEMDHDRNGVVCLSEFLSFTKVKGY----------EL  54

Query  284  DTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDLCISC  442
            +  G   L F E +T+ YI  S RP CDGC    P  FFTC++C         ++LC  C
Sbjct  55   NACGTGKLSFDEAITVFYIATSARPLCDGCRCLTPGMFFTCVKCFKDTGEAETFNLCSDC  114

Query  443  YENGKSGHNHQ  475
            + +G   H H 
Sbjct  115  FSHGNHTHPHH  125



>gb|EYU38474.1| hypothetical protein MIMGU_mgv11b018110mg [Erythranthe guttata]
Length=148

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 10/133 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M ++HK+AKAYY   + E + +A+  F SLD + DG++   E+ T ++ +     +    
Sbjct  1    MADIHKIAKAYYARATEEEREKAKNYFRSLDANCDGKISFAEYKTMVSRR----CANDTM  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATFFTCLQC----PN-YDLC  433
            FN +D +G+ +LD  EV+ L +I  K     C+ CG  I   +F+ L C    PN Y+LC
Sbjct  57   FNAIDKNGDGSLDIEEVLALYFILMKCPLRSCNACGSSISGAYFSYLPCEKNDPNTYELC  116

Query  434  ISCYENGKSGHNH  472
             SCY  GK  H+H
Sbjct  117  CSCYGGGKFEHHH  129



>ref|XP_004297941.1| PREDICTED: DNA mismatch repair protein MSH1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=1279

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (57%), Gaps = 7/123 (6%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMST  262
             ++++LH  A AYY  GSPEL+  A   F S+D +GD R+  +EF  F+ + G++  ++ 
Sbjct  1    MEIEQLHPAALAYYEHGSPELQRLAWSFFQSMDTNGDQRISYSEFSDFLEQTGHKWILND  60

Query  263  KRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC------PNY  424
              FF +LD + +  LDF EV+T  YI K+    C GC  ++   +FTC+ C        Y
Sbjct  61   PNFFKKLDRNRDGGLDFEEVLTFYYIIKTRCVICRGCSVYLCGLYFTCVACFDGADHKTY  120

Query  425  DLC  433
            DLC
Sbjct  121  DLC  123



>ref|XP_009341628.1| PREDICTED: uncharacterized protein LOC103933660 [Pyrus x bretschneideri]
 ref|XP_009341629.1| PREDICTED: uncharacterized protein LOC103933660 [Pyrus x bretschneideri]
Length=214

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 14/124 (11%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGYQC--MSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSG  352
            +D DG+ RV   EF  +M E+   C  +    FF EL  +G+  LDF +VMTL YI  SG
Sbjct  1    MDVDGNDRVSFQEFTEYM-ERYEDCKHLCNSLFFEELKKEGHEELDFVDVMTLFYIVYSG  59

Query  353  RPFCDG-CGRFIPATFFTCLQC---------PNYDLCISCYENGKSGHNHQ-FMDNYALL  499
            +PFC+G C +FI   +FTC++C           +++C SCY + K  H+H   +D++ LL
Sbjct  60   KPFCNGQCKKFIKGVYFTCVKCFDDYATYATNTFNVCPSCYADSKYVHDHDTLLDSFLLL  119

Query  500  AVKK  511
              K+
Sbjct  120  QSKR  123



>ref|XP_010274596.1| PREDICTED: uncharacterized protein LOC104609874 isoform X2 [Nelumbo 
nucifera]
Length=187

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLT-FMTEQGYQCMST  262
             +++++ K+A AYY+  S E K  A++LF  +D DGDG+V  NEF   FM  +G      
Sbjct  1    MELEQIRKVALAYYQGSSDETKQHAEKLFKKMDADGDGKVSFNEFSDFFMKSKGLTV--P  58

Query  263  KRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPA  391
            K  F ELD DGN  +D  E + L YI ++ R  CDGCG  I A
Sbjct  59   KLCFEELDKDGNGFMDLEESIVLFYIIQTRRISCDGCGSLIKA  101



>gb|EYU32602.1| hypothetical protein MIMGU_mgv1a022976mg, partial [Erythranthe 
guttata]
Length=94

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = +2

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---PN--YDLCISC  442
            ELD++GN +LDFWEV+TL YI KSGRP    CG  +  TFF+C++C   P   Y LCI C
Sbjct  1    ELDSNGNGSLDFWEVLTLYYIVKSGRPL---CGILVTGTFFSCVECFDSPTGAYSLCIYC  57

Query  443  YENGKSGHNH  472
            Y + KS HNH
Sbjct  58   YRSNKSDHNH  67



>gb|KCW54062.1| hypothetical protein EUGRSUZ_I00042 [Eucalyptus grandis]
Length=103

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M++L   AK Y+ A +  +K  AQ+    +D+D DG V  +EFL+F   +GY  MS    
Sbjct  1    MEDLQ--AKVYFDAAAENVKRLAQDFVTEMDHDCDGVVCLSEFLSFTKIKGYGRMSNPYL  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFT  403
            F EL+  G   L F E +T  YI  S RP CDGCG      FFT
Sbjct  59   FKELNASGTGKLSFDEAITFFYIAMSARPLCDGCGCLALGMFFT  102



>gb|EYU38471.1| hypothetical protein MIMGU_mgv1a021889mg, partial [Erythranthe 
guttata]
Length=162

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 83/151 (55%), Gaps = 14/151 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++H +AKAYY   + E K +A+  F SLD + DG++   E+ + +        +++  
Sbjct  1    MEQVHLVAKAYYARATDEEKEKAKNYFRSLDVNRDGKISLAEYRSPVNPY----YASEAV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFK-SGRPFCDGCGRFIPATFFTCLQC----PNY--DL  430
            F  LD +G+ +LDF E + L +I    G  +CD CG  +   +F+CLQC    PN   DL
Sbjct  57   FKCLDKNGDGSLDFEEFLALNFIHNICGLRWCDACGGSLHGHYFSCLQCEKDYPNKSCDL  116

Query  431  CISCYENGKSGHNH---QFMDNYALLAVKKR  514
            C  CY  GK  H+H    F+D+ +L  ++ +
Sbjct  117  CYGCYGAGKFKHHHPTASFLDSCSLRRLQTQ  147



>ref|XP_004296537.1| PREDICTED: uncharacterized protein LOC101308274 [Fragaria vesca 
subsp. vesca]
Length=210

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 14/131 (11%)
 Frame = +2

Query  158  AQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTLLY  337
            A+  F+ +D+D +GR+   E+   +   G         FN +D +G+  LD+WE +TL Y
Sbjct  2    AKTTFDKMDSDRNGRISLEEYRKHLANPGESTQMKSSSFNVVDKNGDGKLDYWEFITLYY  61

Query  338  IFKSGRPFC----DGC--GRFIPATFFTCLQC------PN-YDLCISCYENGKSGHNH-Q  475
            + KSGR  C     GC  G F+   +FTC+ C      P  + LC SCY N +  H H  
Sbjct  62   LDKSGRLNCWCNGHGCKNGTFLSGLYFTCVTCFSSSTEPELFYLCWSCYRNRRYTHKHDN  121

Query  476  FMDNYALLAVK  508
            F+DNY  L +K
Sbjct  122  FLDNYTFLQMK  132



>gb|KDP33330.1| hypothetical protein JCGZ_12879 [Jatropha curcas]
Length=195

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 11/153 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++   A AYYR   P  K   +  F++LD  G G+V   ++  +  ++G   ++    
Sbjct  1    MEKIRLDASAYYRNLPPAEKQRVKIGFSALDKTGSGKVSLKQYSEYFKQRGLVELTYPYL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATFFTCLQCPN------YDL  430
            F  LDT+G+  LDF E +T+ Y+  + +  FC+ CG F+  ++ +CLQC +      Y++
Sbjct  61   FKALDTNGDGRLDFNEYITVYYLCMNNKMIFCEECGVFLSGSYMSCLQCFDNDSGDPYNI  120

Query  431  CISCYENGKSGH--NHQFMDNYAL--LAVKKRA  517
            C  CY      H  +  F+D+  L  LAVK  A
Sbjct  121  CYDCYNRNNIDHHKDATFVDDIKLQCLAVKGSA  153



>gb|EYU17886.1| hypothetical protein MIMGU_mgv1a0207622mg, partial [Erythranthe 
guttata]
Length=125

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 13/126 (10%)
 Frame = +2

Query  149  KNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMT  328
            + E QE+F SLD D DG+V+  E+ + +        + +  FN LD + + +LDF EV+ 
Sbjct  1    RKERQEIFQSLDGDCDGKVNLAEYKSLVLRA----YTHESLFNCLDENSDGSLDFEEVLV  56

Query  329  LLYIFKSGRPFCDG-CGRFIPATFFTCLQC-----PNYDLCISCYENGKSGHNH---QFM  481
            L Y+ K G   CDG C  ++   +F+C  C       YDLC +CY  GK  H+H    F+
Sbjct  57   LHYMQKCGMRICDGSCHGWLLGPYFSCTICEKNYPKTYDLCCTCYSGGKFKHDHPTTSFL  116

Query  482  DNYALL  499
            D+ ++L
Sbjct  117  DDRSIL  122



>gb|EYU43763.1| hypothetical protein MIMGU_mgv1a018413mg [Erythranthe guttata]
Length=176

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 9/125 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MD + ++A++YY   S + K   QE F  LD D DG+V + E     T     C+S    
Sbjct  1    MDGMREIARSYYSRASEDDKKSIQEFFEKLDVDRDGKVSRPELKRSATVSA--CLSADNV  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATFFTCLQCP------NYDL  430
            F +LD +G+  LDF E   L Y+  K   P C GC   +   +F+C +C        YDL
Sbjct  59   FQKLDVNGDGVLDFDEAKCLYYMVNKVKIPRCCGCYDLLVGPYFSCSRCAGKSPLQRYDL  118

Query  431  CISCY  445
            C +CY
Sbjct  119  CCACY  123



>ref|XP_002522873.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF39571.1| calcium ion binding protein, putative [Ricinus communis]
Length=172

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 12/150 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MDE+ K A AY+  G+ E K         LD+  DG +   +F  F+ E+G++ +S    
Sbjct  1    MDEILKAALAYFEFGNHEFKKGTLHFLEMLDHCTDGTI--GQFEEFLRERGHEPLSPG-I  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
              EL    +  L F + + LLY+ K+ RP CD C  F+   +FTC  C       +++C+
Sbjct  58   LKELGKKLDDHLGFNDFLVLLYVVKTRRPCCDLCQAFLKGLYFTCAVCFDEEEKTFNMCL  117

Query  437  SCYENGKS---GHNHQFMDNYALLAVKKRA  517
             C    K+   GH   F+DN+ALL  K +A
Sbjct  118  DCTSKQKTCPQGHA-LFIDNFALLHSKSKA  146



>ref|XP_011011800.1| PREDICTED: uncharacterized protein LOC105116248 isoform X3 [Populus 
euphratica]
Length=170

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            +D +GDG++   E++ ++ E      + +  F+ LD D N +LDF E   L YI +SGR 
Sbjct  1    MDKNGDGKISVREYVDYLNENKATDFTHQSIFSALDKDSNGSLDFDEATVLYYIMQSGRA  60

Query  359  -FCDGCGRFIPATFFTCLQC------PNYDLCISCYENGKSGHNHQ--FMDNYALLAVKK  511
              C  C  F+   +F+C +C        Y++C  CY + K  H+    F DNY LL   +
Sbjct  61   IICQSCKTFLAGAYFSCSECFFNDSVSTYEICCECYGDKKFTHHDGAIFCDNYTLLCQSR  120

Query  512  RA  517
             A
Sbjct  121  SA  122



>gb|KCW52370.1| hypothetical protein EUGRSUZ_J01776 [Eucalyptus grandis]
Length=103

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 55/104 (53%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M++L   AKAY+ A +  +K  AQ+    +D+D D  +  +EFL+F   +G   +S    
Sbjct  1    MEDLQ--AKAYFDAAAENVKRLAQDFVTEMDHDHDSVMCLSEFLSFTKIKGDGRISNPYL  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFT  403
            F EL+  G   L F E +T  YI  S RP CDGCG      FFT
Sbjct  59   FKELNASGTGKLSFDEAITFFYIAMSARPLCDGCGCLALGMFFT  102



>gb|KDP33329.1| hypothetical protein JCGZ_12878 [Jatropha curcas]
Length=277

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 75/143 (52%), Gaps = 8/143 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++   A AYYR  +   K  A   FN +D  G+G++    +  +  ++G   ++   F
Sbjct  1    MEKIRLDASAYYRNLATADKQMAINGFNLMDKTGNGKISLRRYSEYFKQRGLVELTYPEF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATFFTCLQCPN-----YDLC  433
            F  LD++G+  LDF E +T+ Y+  + +  FC+ C  F+  ++ +CLQC N     Y++C
Sbjct  61   FKALDSNGDDRLDFDEFITVYYLCMNNKLIFCEECMVFLSGSYMSCLQCFNSGSEPYNVC  120

Query  434  ISCYENGKSGHNHQ--FMDNYAL  496
             +CY      H+    F+DN  L
Sbjct  121  CACYRKNNIDHHKDATFVDNQKL  143



>ref|XP_007206780.1| hypothetical protein PRUPE_ppa025480mg [Prunus persica]
 gb|EMJ07979.1| hypothetical protein PRUPE_ppa025480mg [Prunus persica]
Length=84

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQ-CMSTKR  268
            M+ELH  A AYY  GSPE +  A   F S+D + DGR+   EF  F+ + GY   ++   
Sbjct  1    MEELHAAALAYYSNGSPERQRLAWSFFQSMDTNNDGRISSAEFYEFLQQSGYSWIVNDPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYI  340
            FF +LD + +  LDF+EV+T + I
Sbjct  61   FFTKLDRNRDGGLDFYEVLTYIVI  84



>ref|XP_002527293.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF35137.1| calcium ion binding protein, putative [Ricinus communis]
Length=225

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 73/149 (49%), Gaps = 10/149 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ K A AY+  GS E K         LD   +G +   +F  F+ E+G++ +S    
Sbjct  1    MEEILKAALAYFELGSHEFKTGTLRFLQMLDQCTNGTI--GQFDEFLRERGHEPLSPS-I  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-----PNYDLCI  436
               L    +  + F + + L+YI K+ RP CD C  F+   +FTC  C       ++LC+
Sbjct  58   LTALGKKPDDHIGFNDFLILMYIIKTRRPCCDLCQAFLKGLYFTCAVCFETEEKTFNLCL  117

Query  437  SCYENGKSG-HNHQFM-DNYALLAVKKRA  517
             C    K+  H H  + DN+A+L  K +A
Sbjct  118  CCISKQKNCLHGHGLLVDNFAMLHSKSKA  146



>ref|XP_010062355.1| PREDICTED: uncharacterized protein LOC104449789 [Eucalyptus grandis]
 gb|KCW69483.1| hypothetical protein EUGRSUZ_F02936 [Eucalyptus grandis]
Length=184

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 72/144 (50%), Gaps = 11/144 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++   A  ++   S +LKN AQ  F++L     G V K  F   +  +  +C+S+   
Sbjct  1    MEDIRLAASIFFEQNS-QLKNIAQTEFSNLTRTKQGLVTKRAFDEHLRLRQPECLSSN-L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC-------PNYDL  430
              ELD + +  L F + +   Y+F++ RP C  C   +   F+TCL+C         YDL
Sbjct  59   AAELDANNDGYLTFEDFLVYRYLFQT-RPVCRHCKAIVKLVFYTCLECFAGKLKERTYDL  117

Query  431  CISCYENGKSGHNH-QFMDNYALL  499
            C  CY   K  H H QF +NYA++
Sbjct  118  CPMCYLGNKFSHPHKQFTNNYAVV  141



>gb|KDP33332.1| hypothetical protein JCGZ_12881 [Jatropha curcas]
Length=124

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+E+ + A AYYR  +   K  A   FN +D  G+G +    +  +  ++G   ++   F
Sbjct  1    MEEIRQAASAYYRNLATADKQMAINGFNLMDKTGNGTISLRRYSEYFKQRGLIELTYPEF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATFFTCLQCPN  421
            F  LD+DG+  LDF E +T+ Y+  + +  FC+ C  F+  ++ +CLQC N
Sbjct  61   FKALDSDGDDRLDFDEFITVYYLCMNNKLIFCEECMVFLSGSYMSCLQCFN  111



>gb|KDO52253.1| hypothetical protein CISIN_1g044607mg [Citrus sinensis]
Length=110

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E H  A   Y   + E++N A+  FNS+D +GDGR+ ++EFL F+ +        +  F 
Sbjct  4    EFHDSAIICYNNATGEVQNLAKNFFNSMDTNGDGRISRSEFLQFLGKFN-NTQWIQELFQ  62

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCD--GCGRFIPATFFTC  406
             +D +G+ +LDF E +T  Y   + R  CD  GC  ++   +FTC
Sbjct  63   SIDQNGDGSLDFVEFLTPFYFVSNWRVKCDGLGCNTWLQGLYFTC  107



>ref|XP_010064849.1| PREDICTED: uncharacterized protein LOC104452008 [Eucalyptus grandis]
 gb|KCW69482.1| hypothetical protein EUGRSUZ_F02935 [Eucalyptus grandis]
Length=241

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 76/152 (50%), Gaps = 15/152 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL   AK +YR  +   K   Q + + ++   + RV+   F+T + E+  +C S K  
Sbjct  1    MEELRAAAKVHYRDNAV-FKRAIQTINDRIEFSFEDRVNYETFVTLIEERSRRCTS-KAL  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQC---------PNY  424
            F +LD      LD  +V  L Y+  + R  C  CG  + + ++TCL C         P +
Sbjct  59   FRQLDRGEKGHLDRDDVRILYYLMDT-RGDCSCCGDILRSVYYTCLPCFDNCKSPNNPTF  117

Query  425  DLCISCYENGKSGHNHQ--FMDNYALLAVKKR  514
            ++CI+CY +    H     F+DNY LL +K+R
Sbjct  118  NVCIACYRDKAFKHPQHNVFVDNYELL-LKRR  148



>ref|XP_010474353.1| PREDICTED: 16 kDa calcium-binding protein-like [Camelina sativa]
Length=101

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS  349
            F  LD +G+  LDF EV+TL Y+ ++
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVART  86



>ref|XP_006420377.1| hypothetical protein CICLE_v10006956mg, partial [Citrus clementina]
 gb|ESR33617.1| hypothetical protein CICLE_v10006956mg, partial [Citrus clementina]
Length=105

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E H  A   Y   + E++N A+  FNS+D +GDGR+ ++EFL F+ +        +  F 
Sbjct  4    EFHDSAIICYNNATGEVQNLAKNFFNSMDTNGDGRISRSEFLQFLGKFN-NTQWIQELFQ  62

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG  376
             +D +G+ +LDF E +T  Y   + R  CDG G
Sbjct  63   SIDQNGDGSLDFVEFLTPFYFVSNWRVKCDGLG  95



>ref|XP_002528342.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF34014.1| calcium ion binding protein, putative [Ricinus communis]
Length=140

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFM-TEQGYQCMSTKR  268
            M+E+ + A AYY   S   K  A++ F ++D DGDG++   E+  ++ T +G++ +++  
Sbjct  1    MEEISETAIAYYANLSSREKRLAKKFFQAMDTDGDGKISFEEYEQYIKTRKGFKTITSPD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYI  340
            FF +LD DGN TL F E +TL Y+
Sbjct  61   FFKKLDKDGNGTLSFDEFITLHYV  84



>ref|XP_011091669.1| PREDICTED: uncharacterized protein LOC105172027 [Sesamum indicum]
Length=144

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  KLAKAYYRAGSPE-LKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNEL  283
            + A+A+Y  GSPE L+  A   F +++ +GDGRV  +EFLTFM  +GY  M +  FFNEL
Sbjct  78   RSARAHYCTGSPEALQALAYVFFETMNRNGDGRVVLSEFLTFMQHEGYSQMRSPYFFNEL  137

Query  284  DTDGN  298
            D DGN
Sbjct  138  DLDGN  142



>gb|EYU38323.1| hypothetical protein MIMGU_mgv1a025498mg [Erythranthe guttata]
Length=100

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            MD+L ++AKAY+   + E K + +  F SLD++GDG++ + +     ++   Q  +    
Sbjct  1    MDDLREVAKAYHGRATNEEKEKTKNYFRSLDSNGDGKISRAD---IKSDPALQRFTHDSL  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPAT  394
            F+ LD + N TLDF E +TL Y+ K G  +C  C  ++  +
Sbjct  58   FDCLDENNNGTLDFQEFLTLDYMRKCGMRWCKSCSDWLIGS  98



>gb|KCW60200.1| hypothetical protein EUGRSUZ_H02911 [Eucalyptus grandis]
Length=145

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M  +H  A  YY+  + + K E +  F ++D D  G +   EF+TF+T  G Q  +    
Sbjct  1    MRRVHVNALFYYQGLTTKKKQEVEIFFAAMDADRSGSISIAEFMTFLTFAGLQSENLGWL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F ELD D N TLDF EV+T  YI 
Sbjct  61   FEELDKDNNGTLDFEEVLTFFYIL  84



>ref|XP_006388949.1| hypothetical protein POPTR_0068s00210g, partial [Populus trichocarpa]
 gb|ERP47863.1| hypothetical protein POPTR_0068s00210g, partial [Populus trichocarpa]
Length=90

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  DGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDG  370
            DG++   E++ ++ +      +    F  LD DGN +LDF E + L YI +SGR   C  
Sbjct  3    DGKISLREYVDYLKKNNNTVFTHPSLFTALDRDGNGSLDFEETIVLYYIMQSGRALICQS  62

Query  371  CGRFIPATFFTCLQC  415
            C  F+   +F+C QC
Sbjct  63   CNTFLADVYFSCNQC  77



>ref|XP_002532441.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF29927.1| calcium ion binding protein, putative [Ricinus communis]
Length=149

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 10/120 (8%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            LD   DG +   +F  F+ E+G++ +S       L    +  + F + + L+YI K+ RP
Sbjct  2    LDQCTDGTI--GQFDEFLRERGHEPLSPS-ILKALGKKPDDHIGFNDFLILMYIVKTRRP  58

Query  359  FCDGCGRFIPATFFTCLQC-----PNYDLCISCYENGKSG-HNHQFM-DNYALLAVKKRA  517
             CD C  F+   +FTC  C       ++LC+SC    K+  H H  + DN+A+L  K +A
Sbjct  59   CCDLCQTFLQGLYFTCAICFETEEKPFNLCLSCISKQKNCLHGHGLLVDNFAMLHSKSKA  118



>gb|EYU38472.1| hypothetical protein MIMGU_mgv1a025022mg, partial [Erythranthe 
guttata]
Length=134

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 24/126 (19%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTL-----LYIF  343
            +D +  G+V  +E+ T ++++     +  + FN  D +G+  LD  EV+ L     +Y+ 
Sbjct  1    MDVNCKGKVSFDEYKTIVSQR----YANDKMFNSFDRNGDGNLDLEEVLVLHFVHNIYVM  56

Query  344  KSGRPFCDGCGRFIPATFFTCLQC----PN-YDLCISCYENGKSGHNH---QFMDNYA--  493
            +    +C  C   +P   F+CL C    PN +DLC SCY  GK  H+H    F+DN++  
Sbjct  57   R----WCSACTGSLPGLHFSCLTCEKNEPNTFDLCCSCYGEGKFEHHHPTSDFLDNHSMR  112

Query  494  -LLAVK  508
             LLA K
Sbjct  113  NLLAPK  118



>ref|XP_010023832.1| PREDICTED: uncharacterized protein LOC104414418 [Eucalyptus grandis]
 ref|XP_010023833.1| PREDICTED: uncharacterized protein LOC104414418 [Eucalyptus grandis]
 gb|KCW60201.1| hypothetical protein EUGRSUZ_H02912 [Eucalyptus grandis]
Length=283

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 10/118 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++   A  +Y+  S + K  A+  F ++D D  G +  +EF+TFM   G+Q  +    
Sbjct  134  MEKVRDAASVHYKGLSQDQKQAAERFFEAMDTDKSGNISIDEFVTFMGLFGFQSDNHDWL  193

Query  272  FNELDTDGNHTLDFWEVMTLLYIFK--------SGRPFCDGCGRFIPATFFTCLQCPN  421
            F +LD D N TLDF E++T  YI            RP  D   R +   F    + PN
Sbjct  194  FAKLDKDENGTLDFNELVTFFYILSRDEYKHLVDSRPSTDTPRRKV--RFGLRTRVPN  249



>ref|XP_010023827.1| PREDICTED: uncharacterized protein LOC104414416 isoform X6 [Eucalyptus 
grandis]
Length=254

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023825.1| PREDICTED: uncharacterized protein LOC104414416 isoform X4 [Eucalyptus 
grandis]
Length=268

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023830.1| PREDICTED: uncharacterized protein LOC104414416 isoform X9 [Eucalyptus 
grandis]
 gb|KCW60190.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=239

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60188.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=264

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  45   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  104

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  105  KLDKDGSKSLSFEELKTFSYVL  126



>ref|XP_010023824.1| PREDICTED: uncharacterized protein LOC104414416 isoform X3 [Eucalyptus 
grandis]
Length=281

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023828.1| PREDICTED: uncharacterized protein LOC104414416 isoform X7 [Eucalyptus 
grandis]
Length=253

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023829.1| PREDICTED: uncharacterized protein LOC104414416 isoform X8 [Eucalyptus 
grandis]
Length=253

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60195.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60196.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60189.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023821.1| PREDICTED: uncharacterized protein LOC104414416 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60194.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023822.1| PREDICTED: uncharacterized protein LOC104414416 isoform X2 [Eucalyptus 
grandis]
 gb|KCW60192.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=281

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60191.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=281

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60193.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60197.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=309

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023826.1| PREDICTED: uncharacterized protein LOC104414416 isoform X5 [Eucalyptus 
grandis]
Length=267

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF TF++  G   ++    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW44553.1| hypothetical protein EUGRSUZ_L01937 [Eucalyptus grandis]
Length=97

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +2

Query  143  ELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEV  322
            E K  A+ LF ++D D + R+  +EF  F+   GYQ     R F  LD D N  L+F E+
Sbjct  4    EQKRVAESLFEAMDADKNKRISIDEFTAFLGFAGYQSEDLARLFESLDADKNGDLNFKEL  63

Query  323  MTLLYIF  343
            +T +Y+ 
Sbjct  64   LTFVYML  70



>gb|KCW44552.1| hypothetical protein EUGRSUZ_L01936 [Eucalyptus grandis]
Length=152

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFN  277
            E  + A+  Y     + K  A++LF ++D D D R+  +EF  F+T  GYQ       F 
Sbjct  15   EPRETARDCYERMKEDQKQVAKQLFEAMDADKDHRISIDEFKDFLTFAGYQSKGLSELFK  74

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
             LD D N  LDF E++T +Y+ 
Sbjct  75   LLDKDKNGVLDFDELLTFVYML  96



>gb|KDQ10519.1| hypothetical protein BOTBODRAFT_36215 [Botryobasidium botryosum 
FD-172 SS1]
Length=149

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTK--RF  271
            +  +  +   R   PE  NE Q+ FN+ D DG+GR+ K E    M   G +  +++    
Sbjct  68   DFEEFCEVMARHADPE--NELQQAFNAFDLDGNGRISKEELANVMQSLGERLTTSQVDEI  125

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F+E+DTDG+  +DF E + LL  F
Sbjct  126  FSEVDTDGDGQIDFGEFVRLLDFF  149



>ref|XP_010277740.1| PREDICTED: uncharacterized protein LOC104612120 isoform X3 [Nelumbo 
nucifera]
Length=153

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTE-QGYQCMSTK  265
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++ + Y   S  
Sbjct  23   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHYDSN-  81

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
              F +LD + +  LDF E++   Y+ K  +P
Sbjct  82   -IFYKLDRNRDGVLDFNEIIVFFYMTKDNQP  111



>ref|XP_010277739.1| PREDICTED: uncharacterized protein LOC104612120 isoform X2 [Nelumbo 
nucifera]
Length=164

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTE-QGYQCMSTK  265
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++ + Y   S  
Sbjct  18   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHYDSN-  76

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
              F +LD + +  LDF E++   Y+ K  +P
Sbjct  77   -IFYKLDRNRDGVLDFNEIIVFFYMTKDNQP  106



>ref|XP_010277738.1| PREDICTED: uncharacterized protein LOC104612120 isoform X1 [Nelumbo 
nucifera]
Length=169

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTE-QGYQCMSTK  265
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++ + Y   S  
Sbjct  23   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHYDSN-  81

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
              F +LD + +  LDF E++   Y+ K  +P
Sbjct  82   -IFYKLDRNRDGVLDFNEIIVFFYMTKDNQP  111



>ref|XP_010033731.1| PREDICTED: neuronal calcium sensor 2-like [Eucalyptus grandis]
Length=158

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 38/73 (52%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y +   E K EA+ LF ++D D  G +  +EF  F+   GYQ       F  LD D N  
Sbjct  28   YESMKEEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLDWLFKILDADKNGD  87

Query  305  LDFWEVMTLLYIF  343
            LDF E++T +Y+ 
Sbjct  88   LDFKELLTFVYML  100



>ref|XP_004297935.1| PREDICTED: uncharacterized protein LOC101313407 [Fragaria vesca 
subsp. vesca]
Length=206

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            M+++   A AYY   S + K +A E    ++ DG   V     L     +       K+ 
Sbjct  1    MEKIRSTAFAYYENLSSDNKQKALEFIREMNIDG---VSWAISLQQYENKFGSSSRMKKC  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSG--RPFCDGCG----RFIPATFFTCLQC----PN  421
            F  +D + +  LDF E +TL Y+ KSG  R  CDG G     F+   FF C+ C     +
Sbjct  58   FEVVDRNRDGWLDFPEFVTLYYLHKSGRLRVRCDGHGCDEAPFLKGAFFVCVDCFKKHIH  117

Query  422  YDLCISCYENGKSGHNHQ---FMDNYAL  496
            + LC  CY  GK  H+ +   F DN  L
Sbjct  118  FYLCTFCYRYGKYTHSRRHTNFEDNCML  145



>gb|KCW60198.1| hypothetical protein EUGRSUZ_H02910 [Eucalyptus grandis]
Length=166

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            ++++ + A A++   + + K  A+ LF++++ D + ++  +EF TF+++ G + ++    
Sbjct  25   IEKVREAAAAHFEDLTADQKEAARSLFDTMNKDKNDKISIHEFRTFLSDAGLRTVNPDDL  84

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSG--------RPFCDGCGR  379
            F ELD D N  L F E++T  Y+            RP  D  G+
Sbjct  85   FAELDKDDNKNLSFEELVTFFYVLSRDEYKHLLKRRPSTDVRGQ  128



>ref|XP_010041117.1| PREDICTED: neuronal calcium sensor 2-like [Eucalyptus grandis]
 gb|KCW44636.1| hypothetical protein EUGRSUZ_L01846 [Eucalyptus grandis]
Length=158

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 38/73 (52%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHT  304
            Y +   E K EA+ LF ++D D  G +  +EF  F+   GYQ       F  LD D N  
Sbjct  28   YESMKEEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLDWLFKILDADKNGD  87

Query  305  LDFWEVMTLLYIF  343
            LDF E++T +Y+ 
Sbjct  88   LDFKELLTFVYML  100



>ref|XP_010023831.1| PREDICTED: uncharacterized protein LOC104414417 [Eucalyptus grandis]
 gb|KCW60199.1| hypothetical protein EUGRSUZ_H02910 [Eucalyptus grandis]
Length=176

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            ++++ + A A++   + + K  A+ LF++++ D + ++  +EF TF+++ G + ++    
Sbjct  25   IEKVREAAAAHFEDLTADQKEAARSLFDTMNKDKNDKISIHEFRTFLSDAGLRTVNPDDL  84

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSG--------RPFCDGCGR  379
            F ELD D N  L F E++T  Y+            RP  D  G+
Sbjct  85   FAELDKDDNKNLSFEELVTFFYVLSRDEYKHLLKRRPSTDVRGQ  128



>ref|XP_002968513.1| hypothetical protein SELMODRAFT_440368 [Selaginella moellendorffii]
 gb|EFJ30767.1| hypothetical protein SELMODRAFT_440368 [Selaginella moellendorffii]
Length=133

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 2/98 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            +  LH+ AKA Y     E +++A  LF  +D +    V + E   + ++   + ++    
Sbjct  18   IRRLHQEAKAAYHKLPLEQRSQALRLFKGMDQNASRGVTRTEVERY-SDPAVKAVALS-C  75

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFI  385
            F+ LD D N  LDFWE +TL +I +     C  C   +
Sbjct  76   FDALDADHNRKLDFWETVTLAHILRVPGKLCGECSTLL  113



>ref|XP_002975971.1| hypothetical protein SELMODRAFT_443090 [Selaginella moellendorffii]
 gb|EFJ22876.1| hypothetical protein SELMODRAFT_443090 [Selaginella moellendorffii]
Length=133

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 2/98 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRF  271
            +  LH+ AKA Y     E +++A  LF  +D +    V + E   + ++   + ++    
Sbjct  18   IRRLHQEAKAAYHKLPLEQRSQALRLFKGMDQNASRGVTRTEVERY-SDPAVKAVALS-C  75

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFI  385
            F+ LD D N  LDFWE +TL +I +     C  C   +
Sbjct  76   FDALDADHNRKLDFWETVTLAHILRVPGKLCGECSALL  113



>ref|XP_007510592.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18125.1| predicted protein [Bathycoccus prasinos]
Length=359

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 4/91 (4%)
 Frame = +2

Query  95   DELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEF-LTFMTEQGYQCMS---T  262
            D L K  K   R  +   + + QELF++LD+DG G V+  EF L +    G +  S    
Sbjct  77   DWLAKRKKVVKRTLTDSKRAQLQELFSALDSDGGGEVEFEEFALAWKMMAGDREESATIA  136

Query  263  KRFFNELDTDGNHTLDFWEVMTLLYIFKSGR  355
            +R F E+D DGN T+DF E   L+   + GR
Sbjct  137  RRAFKEIDVDGNGTMDFEEFARLMLDLEDGR  167



>gb|EFQ35051.1| hypothetical protein GLRG_10195 [Colletotrichum graminicola M1.001]
Length=852

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 38/78 (49%), Gaps = 2/78 (3%)
 Frame = +2

Query  290  DGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPNYDLCISCYENGKSGH-  466
            +G H     EV       +S    CDGC R+I      CL CP++D C  C  N K  H 
Sbjct  376  EGAHVPSHIEVKLAPGRNQSHNAICDGCDRYIAGVRHKCLDCPDWDYCADCIVNSKFVHP  435

Query  467  NHQFMDNYALLA-VKKRA  517
            NH+F+  Y  LA V+ RA
Sbjct  436  NHRFVPIYEPLAEVRSRA  453



>gb|KCW84064.1| hypothetical protein EUGRSUZ_B00947 [Eucalyptus grandis]
Length=128

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 0/69 (0%)
 Frame = +2

Query  137  SPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFW  316
              E K EA+ LF ++D D  G +  +EF  F+   GYQ       F  LD D N  LDF 
Sbjct  2    KEEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLDWLFKILDADKNGDLDFK  61

Query  317  EVMTLLYIF  343
            E++T +Y+ 
Sbjct  62   ELLTFVYML  70



>ref|XP_010026782.1| PREDICTED: uncharacterized protein LOC104417165 [Eucalyptus grandis]
Length=131

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLTFMTEQGYQCMSTKRFFNELDTDGNHTLDFWEVMTLLYIF  343
            +D D  G +   EF+TF+T  G Q  +    F ELD D N TLDF EV+T  YI 
Sbjct  1    MDADRSGSISIAEFMTFLTFAGLQSENLGWLFEELDKDNNGTLDFEEVLTFFYIL  55



>gb|KDN68651.1| hypothetical protein CSUB01_03110 [Colletotrichum sublineola]
Length=851

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 2/78 (3%)
 Frame = +2

Query  290  DGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATFFTCLQCPNYDLCISCYENGKSGH-  466
            +G H     EV       +S    CDGC ++I      CL CP++D C  C  N K  H 
Sbjct  376  EGAHVPSHIEVKLAPGRNQSHNAICDGCDKYIAGVRHKCLDCPDWDYCADCIVNSKFVHP  435

Query  467  NHQFMDNYALLA-VKKRA  517
            NH+F+  Y  LA V+ RA
Sbjct  436  NHRFVPIYEPLAEVRSRA  453



>pdb|2AMI|A Chain A, Solution Structure Of The Calcium-loaded N-terminal 
Sensor Domain Of Centrin
Length=96

 Score = 47.8 bits (112),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  137  SPELKNEAQELFNSLDNDGDGRVDKNEFLTFMTEQGYQCM--STKRFFNELDTDGNHTLD  310
            + E K E +E F+  D DG G +D  E    M   G++      K+  +E+D DG+ T+D
Sbjct  25   TEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTID  84

Query  311  FWEVMTLL  334
            F E +T++
Sbjct  85   FEEFLTMM  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2133824422196