BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22425_g1_i1 len=1023 path=[14:0-194 2050:195-262 277:263-329
3433:330-395 410:396-425 440:426-657 672:658-1022]

Length=1023
                                                                      Score     E

ref|XP_011091671.1|  PREDICTED: uncharacterized protein LOC105172030    173   2e-48   
gb|EYU43762.1|  hypothetical protein MIMGU_mgv1a025785mg                155   8e-42   
gb|EYU32599.1|  hypothetical protein MIMGU_mgv1a012547mg                152   7e-40   
emb|CBI23727.3|  unnamed protein product                                141   1e-36   
ref|XP_010662476.1|  PREDICTED: uncharacterized protein LOC100258685    139   1e-35   
emb|CAN77603.1|  hypothetical protein VITISV_006917                     141   4e-35   Vitis vinifera
ref|XP_010650190.1|  PREDICTED: uncharacterized protein LOC100254539    136   5e-34   
ref|XP_010650189.1|  PREDICTED: uncharacterized protein LOC100252791    135   7e-34   
emb|CAN69590.1|  hypothetical protein VITISV_042945                     134   2e-33   Vitis vinifera
ref|XP_002315167.2|  calcium-binding EF hand family protein             132   9e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002282250.3|  PREDICTED: uncharacterized protein LOC100244274    134   7e-32   Vitis vinifera
emb|CAN65651.1|  hypothetical protein VITISV_020551                     133   1e-31   Vitis vinifera
ref|XP_007214781.1|  hypothetical protein PRUPE_ppa023576mg             125   1e-30   
ref|XP_006489250.1|  PREDICTED: uncharacterized protein LOC102613415    126   1e-30   
gb|KDO52252.1|  hypothetical protein CISIN_1g026938mg                   126   1e-30   
emb|CBI23728.3|  unnamed protein product                                130   2e-30   
ref|XP_006420376.1|  hypothetical protein CICLE_v10006564mg             124   3e-30   
ref|XP_006489576.1|  PREDICTED: uncharacterized protein LOC102608184    126   2e-29   
gb|EYU32601.1|  hypothetical protein MIMGU_mgv1a025510mg                120   2e-29   
gb|KDO74849.1|  hypothetical protein CISIN_1g037528mg                   119   1e-28   
ref|XP_006489277.1|  PREDICTED: uncharacterized protein LOC102622719    120   2e-28   
ref|XP_006419790.1|  hypothetical protein CICLE_v10007030mg             118   6e-28   
ref|XP_011035987.1|  PREDICTED: uncharacterized protein LOC105133614    119   6e-28   
ref|XP_006419789.1|  hypothetical protein CICLE_v10005927mg             118   9e-28   
ref|XP_007224696.1|  hypothetical protein PRUPE_ppa025456mg             117   1e-27   
ref|XP_010274595.1|  PREDICTED: plastin-2-like isoform X1               115   8e-27   
ref|XP_004306583.1|  PREDICTED: uncharacterized protein LOC101310252    115   9e-27   
ref|XP_004306582.1|  PREDICTED: uncharacterized protein LOC101309960    114   2e-26   
ref|XP_008224031.1|  PREDICTED: uncharacterized protein LOC103323795    114   5e-26   
gb|EYU32592.1|  hypothetical protein MIMGU_mgv1a013813mg                113   6e-26   
ref|XP_007035299.1|  Calcium-binding EF-hand family protein, puta...    113   6e-26   
ref|XP_008224098.1|  PREDICTED: uncharacterized protein LOC103323855    113   9e-26   
ref|XP_010110693.1|  hypothetical protein L484_009721                   112   1e-25   
gb|KDO74847.1|  hypothetical protein CISIN_1g0274422mg                  109   4e-25   
ref|XP_007226431.1|  hypothetical protein PRUPE_ppa023963mg             111   5e-25   
ref|XP_002863242.1|  hypothetical protein ARALYDRAFT_358968             109   9e-25   
ref|XP_007223977.1|  hypothetical protein PRUPE_ppa014649mg             109   1e-24   
ref|XP_010999446.1|  PREDICTED: uncharacterized protein LOC105107269    108   1e-24   
ref|NP_193080.1|  EF-hand, calcium binding motif-containing protein     108   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274594.1|  PREDICTED: uncharacterized protein LOC104609873    109   3e-24   
ref|XP_006419794.1|  hypothetical protein CICLE_v10007025mg             107   3e-24   
ref|XP_006371124.1|  hypothetical protein POPTR_0019s04360g             108   3e-24   
ref|XP_010069095.1|  PREDICTED: uncharacterized protein LOC104456073    108   3e-24   
ref|XP_010550855.1|  PREDICTED: uncharacterized protein LOC104821630    108   4e-24   
gb|KDP33328.1|  hypothetical protein JCGZ_12877                         106   7e-24   
gb|KDP33333.1|  hypothetical protein JCGZ_12882                         110   8e-24   
gb|EYU38473.1|  hypothetical protein MIMGU_mgv1a021207mg                105   8e-24   
ref|XP_009350825.1|  PREDICTED: uncharacterized protein LOC103942366    108   9e-24   
ref|XP_002528341.1|  calcium ion binding protein, putative              106   1e-23   Ricinus communis
gb|KFK36230.1|  hypothetical protein AALP_AA4G095100                    106   1e-23   
ref|XP_010277593.1|  PREDICTED: uncharacterized protein LOC104611989    106   2e-23   
gb|EYU38467.1|  hypothetical protein MIMGU_mgv1a018857mg                104   3e-23   
ref|XP_010105214.1|  hypothetical protein L484_011271                   105   3e-23   
ref|XP_006480237.1|  PREDICTED: uncharacterized protein LOC102612370    105   3e-23   
ref|XP_006284534.1|  hypothetical protein CARUB_v10005736mg             105   3e-23   
ref|XP_006284535.1|  hypothetical protein CARUB_v10005736mg             105   4e-23   
ref|XP_006371134.1|  hypothetical protein POPTR_0019s04450g             102   2e-22   
ref|XP_010256259.1|  PREDICTED: uncharacterized protein LOC104596703    103   2e-22   
ref|XP_009113944.1|  PREDICTED: uncharacterized protein LOC103839...    102   2e-22   
ref|XP_011011795.1|  PREDICTED: uncharacterized protein LOC105116...    102   3e-22   
ref|XP_007226919.1|  hypothetical protein PRUPE_ppa015959mg             102   3e-22   
ref|XP_009113946.1|  PREDICTED: uncharacterized protein LOC103839...    102   3e-22   
ref|XP_011011797.1|  PREDICTED: uncharacterized protein LOC105116...    102   3e-22   
ref|XP_006371129.1|  hypothetical protein POPTR_0019s04400g             102   4e-22   
ref|XP_011012321.1|  PREDICTED: uncharacterized protein LOC105116...    101   5e-22   
ref|XP_011012322.1|  PREDICTED: uncharacterized protein LOC105116...    101   7e-22   
ref|XP_004297939.1|  PREDICTED: uncharacterized protein LOC101315429    100   2e-21   
gb|EYU32593.1|  hypothetical protein MIMGU_mgv1a021501mg              98.2    3e-21   
ref|WP_033634418.1|  hypothetical protein                             97.1    3e-21   
gb|ABK94726.1|  unknown                                                 100   3e-21   Populus trichocarpa [western balsam poplar]
gb|EYU38471.1|  hypothetical protein MIMGU_mgv1a021889mg              98.6    3e-21   
ref|XP_006371128.1|  hypothetical protein POPTR_0019s04390g           99.4    4e-21   
ref|XP_008353259.1|  PREDICTED: proline-rich receptor-like protei...    100   5e-21   
ref|XP_007226352.1|  hypothetical protein PRUPE_ppa022625mg           97.4    6e-21   
ref|XP_006388264.1|  hypothetical protein POPTR_0257s00210g           99.0    7e-21   
ref|XP_011011798.1|  PREDICTED: uncharacterized protein LOC105116...  98.6    7e-21   
ref|XP_010256260.1|  PREDICTED: uncharacterized protein LOC104596704  99.0    8e-21   
ref|XP_011011799.1|  PREDICTED: uncharacterized protein LOC105116...  98.6    8e-21   
ref|XP_009113947.1|  PREDICTED: uncharacterized protein LOC103839...  97.8    8e-21   
ref|XP_006371132.1|  hypothetical protein POPTR_0019s04430g           97.1    1e-20   
ref|XP_009113943.1|  PREDICTED: uncharacterized protein LOC103839...  97.8    1e-20   
ref|XP_004296541.1|  PREDICTED: uncharacterized protein LOC101310401  98.2    1e-20   
ref|XP_011091670.1|  PREDICTED: uncharacterized protein LOC105172028  97.8    1e-20   
ref|XP_009113945.1|  PREDICTED: uncharacterized protein LOC103839...  97.8    1e-20   
ref|XP_006388948.1|  hypothetical protein POPTR_0068s00200g           97.4    2e-20   
ref|XP_006371123.1|  hypothetical protein POPTR_0019s04350g           97.1    2e-20   
ref|XP_010428593.1|  PREDICTED: uncharacterized protein LOC104713...  97.1    3e-20   
gb|EYU38469.1|  hypothetical protein MIMGU_mgv1a0149542mg             95.1    5e-20   
ref|XP_006371125.1|  hypothetical protein POPTR_0019s04370g           94.7    7e-20   
ref|XP_006371126.1|  hypothetical protein POPTR_0019s04380g           94.0    9e-20   
ref|XP_010471684.1|  PREDICTED: uncharacterized protein LOC104751...  94.7    2e-19   
ref|XP_010471683.1|  PREDICTED: uncharacterized protein LOC104751...  94.7    2e-19   
ref|XP_010428594.1|  PREDICTED: uncharacterized protein LOC104713...  94.4    2e-19   
ref|XP_010471689.1|  PREDICTED: uncharacterized protein LOC104751...  94.0    2e-19   
ref|XP_010471688.1|  PREDICTED: uncharacterized protein LOC104751...  94.0    2e-19   
ref|XP_008224099.1|  PREDICTED: uncharacterized protein LOC103323856  92.4    3e-19   
emb|CDY36976.1|  BnaC09g17920D                                        92.8    3e-19   
ref|XP_011012576.1|  PREDICTED: uncharacterized protein LOC105116792  93.6    4e-19   
gb|AIU48193.1|  MSH1                                                  97.8    1e-18   
ref|XP_004297941.1|  PREDICTED: DNA mismatch repair protein MSH1,...  97.4    1e-18   
ref|XP_006371135.1|  hypothetical protein POPTR_0019s04460g           90.5    4e-18   
ref|XP_010110690.1|  hypothetical protein L484_009718                 87.8    7e-18   
ref|XP_009341628.1|  PREDICTED: uncharacterized protein LOC103933660  90.1    7e-18   
gb|EYU38474.1|  hypothetical protein MIMGU_mgv11b018110mg             88.6    8e-18   
gb|KDP33330.1|  hypothetical protein JCGZ_12879                       87.4    5e-17   
ref|XP_004296539.1|  PREDICTED: uncharacterized protein LOC101309628  87.8    6e-17   
gb|KCW46930.1|  hypothetical protein EUGRSUZ_K00744                   85.9    8e-17   
ref|XP_010243843.1|  PREDICTED: uncharacterized protein LOC104587...  90.9    1e-16   
ref|XP_010243839.1|  PREDICTED: uncharacterized protein LOC104587...  90.5    2e-16   
ref|XP_010243840.1|  PREDICTED: uncharacterized protein LOC104587...  90.5    2e-16   
ref|XP_010243842.1|  PREDICTED: uncharacterized protein LOC104587...  90.5    2e-16   
ref|XP_010243841.1|  PREDICTED: uncharacterized protein LOC104587...  90.5    2e-16   
gb|EYU17886.1|  hypothetical protein MIMGU_mgv1a0207622mg             83.6    3e-16   
ref|XP_010274596.1|  PREDICTED: uncharacterized protein LOC104609...  83.2    1e-15   
gb|KCW54062.1|  hypothetical protein EUGRSUZ_I00042                   79.7    5e-15   
gb|EYU32602.1|  hypothetical protein MIMGU_mgv1a022976mg              79.0    9e-15   
ref|XP_011011800.1|  PREDICTED: uncharacterized protein LOC105116...  78.2    7e-14   
ref|XP_004296537.1|  PREDICTED: uncharacterized protein LOC101308274  76.6    5e-13   
ref|XP_007206780.1|  hypothetical protein PRUPE_ppa025480mg           73.9    5e-13   
gb|KDO52253.1|  hypothetical protein CISIN_1g044607mg                 73.6    1e-12   
gb|KCW52370.1|  hypothetical protein EUGRSUZ_J01776                   72.0    4e-12   
gb|EYU43763.1|  hypothetical protein MIMGU_mgv1a018413mg              73.2    4e-12   
ref|XP_002522873.1|  calcium ion binding protein, putative            73.2    5e-12   Ricinus communis
gb|KDP33332.1|  hypothetical protein JCGZ_12881                       72.0    5e-12   
gb|KDP33329.1|  hypothetical protein JCGZ_12878                       73.6    1e-11   
gb|EYU38472.1|  hypothetical protein MIMGU_mgv1a025022mg              68.9    7e-11   
ref|XP_006420377.1|  hypothetical protein CICLE_v10006956mg           68.2    9e-11   
ref|XP_002527293.1|  calcium ion binding protein, putative            67.0    1e-09   Ricinus communis
ref|XP_010474353.1|  PREDICTED: 16 kDa calcium-binding protein-like   63.2    5e-09   
ref|XP_002528342.1|  calcium ion binding protein, putative            63.5    7e-09   Ricinus communis
gb|EYU38323.1|  hypothetical protein MIMGU_mgv1a025498mg              62.0    1e-08   
ref|XP_011091669.1|  PREDICTED: uncharacterized protein LOC105172027  61.6    4e-08   
ref|XP_010062355.1|  PREDICTED: uncharacterized protein LOC104449789  61.2    7e-08   
gb|KCW60200.1|  hypothetical protein EUGRSUZ_H02911                   60.5    8e-08   
ref|XP_006388949.1|  hypothetical protein POPTR_0068s00210g           58.5    2e-07   
ref|XP_010064849.1|  PREDICTED: uncharacterized protein LOC104452008  59.7    5e-07   
ref|XP_010023827.1|  PREDICTED: uncharacterized protein LOC104414...  59.7    6e-07   
ref|XP_010023825.1|  PREDICTED: uncharacterized protein LOC104414...  59.7    6e-07   
gb|KCW60188.1|  hypothetical protein EUGRSUZ_H02908                   59.7    7e-07   
ref|XP_010023830.1|  PREDICTED: uncharacterized protein LOC104414...  59.3    8e-07   
ref|XP_010023824.1|  PREDICTED: uncharacterized protein LOC104414...  59.7    8e-07   
ref|XP_010023829.1|  PREDICTED: uncharacterized protein LOC104414...  59.3    8e-07   
ref|XP_010023822.1|  PREDICTED: uncharacterized protein LOC104414...  59.7    8e-07   
ref|XP_010023828.1|  PREDICTED: uncharacterized protein LOC104414...  59.3    8e-07   
gb|KCW60196.1|  hypothetical protein EUGRSUZ_H02908                   59.7    8e-07   
gb|KCW60197.1|  hypothetical protein EUGRSUZ_H02908                   60.1    9e-07   
ref|XP_010023826.1|  PREDICTED: uncharacterized protein LOC104414...  59.3    9e-07   
gb|KCW60195.1|  hypothetical protein EUGRSUZ_H02908                   59.7    9e-07   
gb|KCW60191.1|  hypothetical protein EUGRSUZ_H02908                   59.7    9e-07   
gb|KCW60189.1|  hypothetical protein EUGRSUZ_H02908                   59.7    9e-07   
ref|XP_010023821.1|  PREDICTED: uncharacterized protein LOC104414...  59.7    9e-07   
gb|KCW60193.1|  hypothetical protein EUGRSUZ_H02908                   59.7    1e-06   
ref|XP_010023832.1|  PREDICTED: uncharacterized protein LOC104414418  58.5    2e-06   
gb|KDQ10519.1|  hypothetical protein BOTBODRAFT_36215                 55.8    4e-06   
ref|XP_010277740.1|  PREDICTED: uncharacterized protein LOC104612...  54.7    1e-05   
ref|XP_010277739.1|  PREDICTED: uncharacterized protein LOC104612...  54.3    1e-05   
ref|XP_010277738.1|  PREDICTED: uncharacterized protein LOC104612...  54.3    1e-05   
gb|KCW60198.1|  hypothetical protein EUGRSUZ_H02910                   53.9    2e-05   
ref|XP_010023831.1|  PREDICTED: uncharacterized protein LOC104414417  53.9    2e-05   
ref|XP_002532441.1|  calcium ion binding protein, putative            53.5    2e-05   Ricinus communis
gb|EFQ35051.1|  hypothetical protein GLRG_10195                       55.1    6e-05   
ref|XP_007510592.1|  predicted protein                                53.9    9e-05   
gb|KCW44552.1|  hypothetical protein EUGRSUZ_L01936                   51.6    9e-05   
ref|XP_010041117.1|  PREDICTED: neuronal calcium sensor 2-like        51.2    1e-04   
gb|EYU23821.1|  hypothetical protein MIMGU_mgv1a022630mg              51.6    1e-04   
ref|XP_010033731.1|  PREDICTED: neuronal calcium sensor 2-like        51.2    2e-04   
gb|KDN68651.1|  hypothetical protein CSUB01_03110                     53.5    2e-04   
gb|KCW44553.1|  hypothetical protein EUGRSUZ_L01937                   49.7    2e-04   
ref|XP_009216716.1|  ZZ type zinc finger domain-containing protein    52.4    5e-04   
gb|KCW84064.1|  hypothetical protein EUGRSUZ_B00947                   49.3    5e-04   
ref|XP_010039331.1|  PREDICTED: caltractin-like                       48.5    8e-04   
ref|XP_010026782.1|  PREDICTED: uncharacterized protein LOC104417165  48.5    9e-04   



>ref|XP_011091671.1| PREDICTED: uncharacterized protein LOC105172030 [Sesamum indicum]
Length=218

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL ++A+A+YRAGSPE++  A E F ++D +GDGRVD +EFL+FM Q+GY  M +  F
Sbjct  1    MEELREIARAHYRAGSPEVQALAYEFFKTMDTNGDGRVDLSEFLTFMRQEGYSQMRSPYF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            FNELD DGN  LDF EVMTL YI KSGRPFCDGCG FIP  +F+C++C      +++LC 
Sbjct  61   FNELDHDGNGALDFSEVMTLYYIIKSGRPFCDGCGNFIPGIFFSCVECFKNPQRSFNLCR  120

Query  437  SCYGNGKSGHNH----PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
             CY + K  HNH     F+D+Y LL   K+  D+ Q    +      T+   IVP
Sbjct  121  DCYRSTKCNHNHDGRVQFLDNYTLLE-AKRDEDLAQSAGVNSNEPWITSSNAIVP  174



>gb|EYU43762.1| hypothetical protein MIMGU_mgv1a025785mg [Erythranthe guttata]
Length=193

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 116/200 (58%), Gaps = 27/200 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR-  268
            MDEL + AKA+YRAGSPE++  A + F S+D DGDGRVD +EFL+FM  Q  RY N +  
Sbjct  1    MDELRETAKAHYRAGSPEVQQLAYDFFKSMDTDGDGRVDLSEFLAFMRAQEGRYSNMRNR  60

Query  269  -FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN------YD  427
             FF+ELD D N TLDF EVM+L YI KS RPFCD CG+FIP  +F+C++C N      +D
Sbjct  61   YFFDELDQDANGTLDFSEVMSLYYIIKSRRPFCDFCGQFIPGIFFSCVECFNDSSGAPFD  120

Query  428  LCISCYGNGKSGHNH----PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAE  595
            LC  CY      H H     F+D+Y LL   K+ SD+              A+   +   
Sbjct  121  LCPVCYKAKSCKHEHDGRFQFLDNYTLLE-TKRDSDL--------------ALATSLNTN  165

Query  596  KYRKRMFALKALQATLEVAT  655
            + RK   AL AL+  L   +
Sbjct  166  QRRKWKAALTALEIALHAGS  185



>gb|EYU32599.1| hypothetical protein MIMGU_mgv1a012547mg [Erythranthe guttata]
Length=247

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 98/155 (63%), Gaps = 10/155 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ L  +A A+YRA  P  K  A E F +LD+DGDGRV  NEFLS M +QG+  +    F
Sbjct  1    MERLRAIADAHYRASPPAAKALAYEFFKTLDSDGDGRVSINEFLSLMKEQGHVRLANPYF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F ELD++GN +LDFWEV+TL YI KSGRP C+ CG  +  T+F+C++C       Y LCI
Sbjct  61   FRELDSNGNGSLDFWEVLTLYYIVKSGRPVCECCGILVTGTFFSCVECFDSPAGAYSLCI  120

Query  437  SCYGNGKSGHNH----PFMDSYALLAVVKKRSDVN  529
             CY + KS HNH     F+D++ LL   KKR   N
Sbjct  121  LCYRSNKSDHNHGGRQQFLDAFTLLE-TKKRFSAN  154



>emb|CBI23727.3| unnamed protein product [Vitis vinifera]
Length=199

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 104/199 (52%), Gaps = 6/199 (3%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY AG+ E K  A   F +LD DGDG V   EF++F+  +GYR  +   F
Sbjct  1    MEEIREAALAYYEAGTQEQKQLAWAFFQTLDVDGDGTVSVQEFVNFLRGRGYRLFDNPNF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            +  LD DGN  LDF EV+T  YI KSGRPFCDGCG F+   +FTCL C       +DLC 
Sbjct  61   YRALDRDGNGCLDFHEVLTFFYIIKSGRPFCDGCGIFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYGNGKSGHNH-PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKYRKRM  613
            +CY   +  H H   +D+Y LL   +  +       +  Q  S  +         + K  
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLTHKRMMTMAGYGQPNMSQPTSRGSSSLKQGKSSHEKVK  180

Query  614  FALKALQATLEVATNCNTM  670
             A +A    + +A  C+TM
Sbjct  181  VAFEAFNTGVAIANACSTM  199



>ref|XP_010662476.1| PREDICTED: uncharacterized protein LOC100258685 [Vitis vinifera]
Length=206

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 6/142 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY AG+ E +  A+  F +LD DGDG V   EF+ F+  +GYR ++   F
Sbjct  1    MEEIREAALAYYEAGTQEQRQLARAFFQTLDVDGDGIVSVQEFVDFLRGRGYRLLDNPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F  LD DGN  LDF+EV+TL YI KSGRPFCDGCG F+   +FTCL C       ++LC 
Sbjct  61   FQALDRDGNGCLDFYEVLTLYYIIKSGRPFCDGCGVFLKGLFFTCLDCYESSHTTFNLCS  120

Query  437  SCYGNGKSGHNH-PFMDSYALL  499
            +CY   +  H H   +D+Y LL
Sbjct  121  ACYRGKRFSHQHAAILDNYTLL  142



>emb|CAN77603.1| hypothetical protein VITISV_006917 [Vitis vinifera]
Length=343

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 88/142 (62%), Gaps = 6/142 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY AG+ E +  A   F +LD DGDG V   EF++F+   GYR ++   F
Sbjct  1    MEEIREAALAYYEAGTQEQRQLAWAFFQALDVDGDGTVSVQEFVNFLRGSGYRLLDNPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F  LD DGN  LDF+EV+TL YI KSGRPFCDGCG F+   +FTCL C       +DLC 
Sbjct  61   FQALDRDGNGCLDFYEVLTLYYIIKSGRPFCDGCGVFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYGNGKSGHNH-PFMDSYALL  499
            +CY   +  H H   +D+Y LL
Sbjct  121  ACYRGKRFSHQHAAILDNYTLL  142



>ref|XP_010650190.1| PREDICTED: uncharacterized protein LOC100254539 [Vitis vinifera]
Length=238

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 86/143 (60%), Gaps = 6/143 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY AG+ E K  A   F +LD DGDG V   EF++F+  +GYR  +   F
Sbjct  1    MEEIREAALAYYEAGTQEQKQLAWAFFQTLDVDGDGTVSVQEFVNFLRGRGYRLFDNPNF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            +  LD DGN  LDF EV+T  YI KSGRPFCDGCG F+   +FTCL C       +DLC 
Sbjct  61   YRALDRDGNGCLDFHEVLTFFYIIKSGRPFCDGCGIFLKGLFFTCLNCYESSHTTFDLCS  120

Query  437  SCYGNGKSGHNH-PFMDSYALLA  502
            +CY   +  H H   +D+Y LL 
Sbjct  121  ACYRGKRFSHQHAAILDNYTLLT  143



>ref|XP_010650189.1| PREDICTED: uncharacterized protein LOC100252791 [Vitis vinifera]
Length=211

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY  GS E K  A++ FNSLD DG+G VD +EF+  ++++G+  +N   F
Sbjct  1    MEEISEAALAYYENGSEEQKQLARDFFNSLDEDGNGTVDVHEFIKILSEEGHGLVNNSGF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS-GRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            F ELD DGN +LDF E +TL YI KS  RPFC GCG F+ + +F+C +C       +DLC
Sbjct  61   FQELDRDGNESLDFNEFLTLFYIIKSRSRPFCAGCGIFLKSLFFSCAKCHESSDETFDLC  120

Query  434  ISCYGNGKSGHNH-PFMDSYALLA  502
             +CY   +  H H  F+D+Y LLA
Sbjct  121  SACYRGKRFSHQHAAFLDNYTLLA  144



>emb|CAN69590.1| hypothetical protein VITISV_042945 [Vitis vinifera]
Length=208

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY  GS E K  A++ FNSLD DG+G VD +EF+  + ++G+  +N   F
Sbjct  1    MEEISEAALAYYENGSEEQKQLARDFFNSLDEDGNGTVDVHEFIKILGEEGHGLVNNSGF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS-GRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            F ELD DGN +LDF E +TL YI KS  RPFC GCG F+ + +F+C +C       +DLC
Sbjct  61   FQELDRDGNESLDFNEFLTLFYIIKSRSRPFCAGCGIFLKSLFFSCAKCHESSDETFDLC  120

Query  434  ISCYGNGKSGHNH-PFMDSYALLA  502
             +CY   +  H H  F+D+Y LLA
Sbjct  121  SACYRGKRFSHQHAAFLDNYTLLA  144



>ref|XP_002315167.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEF01338.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=230

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 6/142 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELHK+AKAYY   + E K+    LF  +D DGDG++  +EFL+F+  +G   M +  F
Sbjct  1    MDELHKIAKAYYETANSENKDLGHRLFKRMDVDGDGQISLHEFLAFLKNEGRGEMASPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F EL+ +G   LD  E MTL YI +SGR FC+GCG F+   + +C++C      +++LC 
Sbjct  61   FKELNKNGTGRLDLMEAMTLCYIIESGRKFCNGCGEFMKGIFLSCMECFDHEDRSFNLCC  120

Query  437  SCYGNGKSGHNH-PFMDSYALL  499
            +C+  G+  H+H  F+D+Y LL
Sbjct  121  ACFEQGRYVHSHKKFLDNYVLL  142



>ref|XP_002282250.3| PREDICTED: uncharacterized protein LOC100244274 [Vitis vinifera]
Length=471

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +M+++ ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L+F  ++GY  M+ Q 
Sbjct  11   RMEKMREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQE  70

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PN-YDLC  433
            +F +LD D   +L F +VMTL YI KSGRPFC GCG F+   +FTC++C    P+ + +C
Sbjct  71   WFRKLDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVC  130

Query  434  ISCYGNGKSGHNHP-FMDSYALLAVVKKRS  520
            + CY +    H H  F+D++ALL   +++S
Sbjct  131  LQCYESNNIEHEHKEFLDNFALLEAKRRKS  160


 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 102/194 (53%), Gaps = 27/194 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLSFMTQQGYR-----  250
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM ++ Y+     
Sbjct  187  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  246

Query  251  -----YMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC  415
                 +MNT  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   +FTC+ C
Sbjct  247  NLDLEFMNTPEFFRKLDKD-KKGLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  305

Query  416  -----PNYDLCISCYGNGK---SGHNHPFMDSYALLAVVKK------RSDVNQVTDDDDQ  553
                   + LC+ CY   K   S  +H F+D+YALL  +++      R   +   +D  Q
Sbjct  306  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALLEAMRETAWKANRPKTHVKVNDSKQ  365

Query  554  SESYTAMRGIVPAE  595
            S S   +  I  +E
Sbjct  366  SASLAMLLKIDTSE  379



>emb|CAN65651.1| hypothetical protein VITISV_020551 [Vitis vinifera]
Length=460

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 99/149 (66%), Gaps = 6/149 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++ ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L+F  ++GY  M+ Q +
Sbjct  1    MEKMREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQEW  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PN-YDLCI  436
            F +LD D   +L F +VMTL YI KSGRPFC GCG F+   +FTC++C    P+ + +C+
Sbjct  61   FRKLDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVCL  120

Query  437  SCYGNGKSGHNHP-FMDSYALLAVVKKRS  520
             CY +    H H  F+D++ALL   +++S
Sbjct  121  QCYESNNIEHEHKEFLDNFALLEAKRRKS  149


 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 102/194 (53%), Gaps = 27/194 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLSFMTQQGYR-----  250
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM ++ Y+     
Sbjct  176  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  235

Query  251  -----YMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC  415
                 +MNT  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   +FTC+ C
Sbjct  236  NLDLEFMNTPEFFRKLDKD-KKGLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  294

Query  416  -----PNYDLCISCYGNGK---SGHNHPFMDSYALLAVVKK------RSDVNQVTDDDDQ  553
                   + LC+ CY   K   S  +H F+D+YALL  +++      R   +   +D  Q
Sbjct  295  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALLEAMRETAWKANRPKTHVKVNDSKQ  354

Query  554  SESYTAMRGIVPAE  595
            S S   +  I  +E
Sbjct  355  SASLAMLLKIDTSE  368



>ref|XP_007214781.1| hypothetical protein PRUPE_ppa023576mg [Prunus persica]
 gb|EMJ15980.1| hypothetical protein PRUPE_ppa023576mg [Prunus persica]
Length=189

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 94/154 (61%), Gaps = 9/154 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ELH+ A AYY  GS  L+  A   F S+D +GDGRV K+EF++F+ Q GY ++N   F
Sbjct  1    MEELHQAALAYYNNGSQNLQLLAANFFRSMDRNGDGRVSKSEFITFLRQNGYGWINPS-F  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            FN LD + +  LDF EV+T  YI K+   +CDGCG  +   YFTC++C       YDLC 
Sbjct  60   FNNLDRNRDGGLDFEEVLTFYYIIKTRNLWCDGCGVCLKGLYFTCVECFDRAANTYDLCS  119

Query  437  SCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQV  535
             CY + +  HNH  F+D++ LL    KR+ + Q 
Sbjct  120  RCYSSRRFRHNHTCFLDNHMLLR--SKRTQLRQA  151



>ref|XP_006489250.1| PREDICTED: uncharacterized protein LOC102613415 [Citrus sinensis]
Length=211

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 116/211 (55%), Gaps = 18/211 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+GRV   EF  FM+Q+ +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNGRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   YF C++C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFACMKCFETGSAAYSIC  120

Query  434  ISCYGNGKS-GHNHP---FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGI-----V  586
            + C+ +G S  HNH    F+D+++LL  ++K+   N     +  SES + +  +     +
Sbjct  121  LECFRDGASLNHNHVRFNFVDNFSLLESLRKKPLPNHQPSLNSCSESSSHLVIVPYNPNI  180

Query  587  PAEKYRKRMFALKALQATLEVA---TNCNTM  670
            P E+      ALK  +A L +A     C+ M
Sbjct  181  PGERRGLWQAALKVFEAALPIAGIVAGCSIM  211



>gb|KDO52252.1| hypothetical protein CISIN_1g026938mg [Citrus sinensis]
Length=230

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 14/183 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M++L+++A AYY +G+ E +    + F S+D DG+GRV   EF  FM+ + Y R M T+ 
Sbjct  1    MEDLNEVALAYYESGTDEERRLFDQFFESMDEDGNGRVSYREFSEFMSLEAYDRNMCTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN-----YDLC  433
            FFN+LD DG+  LDF EV+TL YI KSGRP C  C  FI   YFTC +C       Y++C
Sbjct  61   FFNDLDVDGSRGLDFNEVLTLYYIIKSGRPICRQCKIFITNEYFTCTRCFKTRSFPYNIC  120

Query  434  ISCYGNGKSGH-NHP-----FMDSYALLAVVKKRS-DVNQVTDDDDQSESYTAMRGIVPA  592
            + C+  G+ GH NH      F+D++ALL  ++K + + N+     + S S +  + IVP 
Sbjct  121  LECF-RGEEGHFNHTHSLEQFVDNFALLECLRKEALEENREDGYYEPSPSRSRSQRIVPY  179

Query  593  EKY  601
             +Y
Sbjct  180  SRY  182



>emb|CBI23728.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = +2

Query  101  LHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNE  280
            + ++A AYY+AG+ ++K  A + FNS+D +GD RV   E+L+F  ++GY  M+ Q +F +
Sbjct  1    MREVADAYYKAGAEDIKQLAHDFFNSMDLNGDRRVILREYLAFTEKRGYIRMSNQEWFRK  60

Query  281  LDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PN-YDLCISCY  445
            LD D   +L F +VMTL YI KSGRPFC GCG F+   +FTC++C    P+ + +C+ CY
Sbjct  61   LDKDRKGSLGFHDVMTLCYIVKSGRPFCKGCGEFMSGVFFTCVKCFDHSPSCFSVCLQCY  120

Query  446  GNGKSGHNHP-FMDSYALLAVVKKRS  520
             +    H H  F+D++ALL   +++S
Sbjct  121  ESNNIEHEHKEFLDNFALLEAKRRKS  146


 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 102/194 (53%), Gaps = 27/194 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQ--ELFNSLDNDGDGRVDKNEFLSFMTQQGYR-----  250
            M EL ++A AY R+ S ++K + +  + F+S+      RV  +EFL FM ++ Y+     
Sbjct  173  MKELRQIATAYCRSTSEDIKEKEKIRKFFSSMHYGNHERVALHEFLEFMRRKAYKHLTNN  232

Query  251  -----YMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC  415
                 +MNT  FF +LD D    L+F +V TL YI +SGRPFC GCG FI   +FTC+ C
Sbjct  233  NLDLEFMNTPEFFRKLDKDKK-GLNFSDVKTLYYIIQSGRPFCKGCGEFIEGMFFTCVSC  291

Query  416  -----PNYDLCISCYGNGK---SGHNHPFMDSYALLAVVKK------RSDVNQVTDDDDQ  553
                   + LC+ CY   K   S  +H F+D+YALL  +++      R   +   +D  Q
Sbjct  292  FERGSTCFSLCLHCYNAQKFIHSATHHLFLDNYALLEAMRETAWKANRPKTHVKVNDSKQ  351

Query  554  SESYTAMRGIVPAE  595
            S S   +  I  +E
Sbjct  352  SASLAMLLKIDTSE  365



>ref|XP_006420376.1| hypothetical protein CICLE_v10006564mg [Citrus clementina]
 gb|ESR33616.1| hypothetical protein CICLE_v10006564mg [Citrus clementina]
Length=191

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 13/155 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M++L+++A AYY +G+ E +    + F S+D DG+GRV   EF  FM+ + Y R M T+ 
Sbjct  1    MEDLNEVALAYYESGTDEERRLFDQFFESMDEDGNGRVSYREFSEFMSLEAYDRNMCTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN-----YDLC  433
            FFN+LD DG+  LDF EV+TL YI KSGRP C  C  FI   YFTC +C       Y++C
Sbjct  61   FFNDLDVDGSRGLDFNEVLTLYYIIKSGRPICRQCKIFITNEYFTCTRCFKTRSFPYNIC  120

Query  434  ISCYGNGKSGH-NHP-----FMDSYALLAVVKKRS  520
            + C+  G+ GH NH      F+D++ALL  ++K +
Sbjct  121  LECF-RGEEGHFNHTHSLEQFVDNFALLECLRKEA  154



>ref|XP_006489576.1| PREDICTED: uncharacterized protein LOC102608184 [Citrus sinensis]
Length=375

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+GRV   EF  FM+Q+ +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNGRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   YFTC+ C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFTCMSCFEPQTAAYSIC  120

Query  434  ISCY-GNGKSGHNH---PFMDSYALLAVVKKRSDVNQ------------VTDDDDQSESY  565
            + C+   G+  HNH    F+D+++LL  ++K+   N              T   D SES 
Sbjct  121  LECFCDKGRHDHNHGRSHFVDNFSLLESLRKKPLPNHQSMFRSISTQGIATSQPDHSESP  180

Query  566  TAMRGI  583
            +  R I
Sbjct  181  STFRSI  186



>gb|EYU32601.1| hypothetical protein MIMGU_mgv1a025510mg [Erythranthe guttata]
Length=122

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ L  +A A+YRA  P     A E F +LD+DGDGRV  NEFLS M +QG+  +    F
Sbjct  1    MERLRAIADAHYRASPPA----AYEFFKTLDSDGDGRVSINEFLSLMKEQGHVSLANPYF  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC  415
            F ELD++ N +LDFWEV+TL YI KSGRP CD CG  +   +F+C++C
Sbjct  57   FRELDSNSNGSLDFWEVLTLYYIVKSGRPVCDCCGILVHGIFFSCVEC  104



>gb|KDO74849.1| hypothetical protein CISIN_1g037528mg, partial [Citrus sinensis]
Length=158

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 91/152 (60%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+ Q +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSLQAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD DG+  LDF EV+TL YI KS RP C  C  FI   YF C++C       Y +C
Sbjct  61   FFNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCRIFITNEYFACMRCFETGSAAYSIC  120

Query  434  ISCYGN-GKSGHNHP---FMDSYALLAVVKKR  517
            + C+G+ G   HNH    F+D+++LL  ++K+
Sbjct  121  LECFGDKGSLNHNHVRSYFVDNFSLLESLRKK  152



>ref|XP_006489277.1| PREDICTED: uncharacterized protein LOC102622719 [Citrus sinensis]
Length=237

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+Q+ +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSQKAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD DG+  LDF EV+TL YI KS RP C  C  FI   YF C++C       Y +C
Sbjct  61   FFNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCRIFITNEYFACMRCFETGSAAYSIC  120

Query  434  ISCYGN-GKSGHNHP---FMDSYALLAVVKKRSDVNQ  532
            + C+G+ G   HNH    F+D+++LL  ++K+   N 
Sbjct  121  LECFGDKGSLNHNHVRSYFVDNFSLLESLRKKPLPNH  157



>ref|XP_006419790.1| hypothetical protein CICLE_v10007030mg, partial [Citrus clementina]
 gb|ESR33030.1| hypothetical protein CICLE_v10007030mg, partial [Citrus clementina]
Length=204

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 91/151 (60%), Gaps = 10/151 (7%)
 Frame = +2

Query  95   DELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQRF  271
            + L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+Q+ +   M T+ F
Sbjct  22   EALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFSDFMSQKAHDENMRTRDF  81

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            FN+LD DG+  LDF EV+TL YI KS RP C  C  FI   YF C++C       Y +C+
Sbjct  82   FNQLDIDGSGRLDFKEVLTLYYILKSRRPICGRCKIFITNEYFACMRCFETGSAAYSICL  141

Query  437  SCYGN-GKSGHNHP---FMDSYALLAVVKKR  517
             C+G+ G   HNH    F+D+++LL  ++K+
Sbjct  142  ECFGDKGSLNHNHVRSYFVDNFSLLESLRKK  172



>ref|XP_011035987.1| PREDICTED: uncharacterized protein LOC105133614 [Populus euphratica]
Length=220

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 100/178 (56%), Gaps = 17/178 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDEL+K+AKAYY   + + K     +F  +D D DG++  +EFL+F+  +G R + +  F
Sbjct  1    MDELYKIAKAYYETANIDNKGLGHRVFKRMDMDDDGQISLHEFLAFLKNEGRREIASPSF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPNYD-----LCI  436
              EL+ +G   LD  E MTL YI +SGR FCDGCG F+   + +C++C +++     LC 
Sbjct  61   SKELNKNGTGRLDLMEAMTLCYIIESGRKFCDGCGEFMKGIFLSCMECFDHEDTTLNLCC  120

Query  437  SCYGNGKSGHNH-PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGI-VPAEKYR  604
            +C   G+  H+H  F+D+Y  L    KR D  +        E  TA R + + AEK R
Sbjct  121  ACCEQGRYVHSHKKFLDNYVFLET--KRLDALK--------EKNTAKRKLQLEAEKKR  168



>ref|XP_006419789.1| hypothetical protein CICLE_v10005927mg [Citrus clementina]
 gb|ESR33029.1| hypothetical protein CICLE_v10005927mg [Citrus clementina]
Length=200

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ + ++   + F S+D DG+GRV   E+  FM+Q+ +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDQERSLFNQFFQSMDKDGNGRVSYREYSDFMSQKAHDENMRTRY  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   YF C++C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFNEVLTLYYILKSGRPICGQCKIFITNEYFACMKCFETGSAAYSIC  120

Query  434  ISCY-GNGKSGHNHP---FMDSYALLAVVKKRSDVNQ  532
            + C+   G   HNH    F+D+++LL  ++K+   N 
Sbjct  121  LECFRAKGSLNHNHVRFNFVDNFSLLESLRKKPLPNH  157



>ref|XP_007224696.1| hypothetical protein PRUPE_ppa025456mg [Prunus persica]
 gb|EMJ25895.1| hypothetical protein PRUPE_ppa025456mg [Prunus persica]
Length=201

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 85/147 (58%), Gaps = 11/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYM-NTQR  268
            M+ELH  A AYY  GSPEL+  A   F S+D + DGR+  +EF  F+ Q GY ++ N   
Sbjct  1    MEELHAAALAYYSNGSPELQRLAWSFFQSMDTNNDGRISSSEFYEFLQQSGYGWIVNDPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PN  421
            FF +LD +G+  LDF+EV+T  YI K+    C GC  ++   YFTC+ C           
Sbjct  61   FFTKLDRNGDGGLDFYEVLTFYYIVKTRNILCQGCRVYLCGLYFTCVACFDVGAGHHQGT  120

Query  422  YDLCISCYGNGKSGHNHP-FMDSYALL  499
            YDLC +CYG     H+H  F+D++ LL
Sbjct  121  YDLCAACYGVKNFYHHHTYFLDNHVLL  147



>ref|XP_010274595.1| PREDICTED: plastin-2-like isoform X1 [Nelumbo nucifera]
Length=219

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 112/225 (50%), Gaps = 36/225 (16%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSF-MTQQGYRYMNT  262
             +++++ K+A AYY+  S E K  A++LF  +D DGDG+V  NEF  F M  +G      
Sbjct  1    MELEQIRKVALAYYQGSSDETKQHAEKLFKKMDADGDGKVSFNEFSDFFMKSKGLTV--P  58

Query  263  QRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PN  421
            +  F ELD DGN  +D  E + L YI ++ R  CDGCG  I   YFTC+QC        N
Sbjct  59   KLCFEELDKDGNGFMDLEESIVLFYIIQTRRISCDGCGSLIKGMYFTCVQCFFNTKTAVN  118

Query  422  YDLCISCYGNGKSG---HNHPFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMR-----  577
            Y+LC  C+ +GKS     ++  +D+YALL  +K   ++ +     D+SE           
Sbjct  119  YNLCCDCHRSGKSAAGCEHNTLVDNYALLQDIKATLNMEKA----DKSEELLGENIGEEL  174

Query  578  ------------GIVPA--EKYRKRMFALKALQATLEVATNCNTM  670
                        GI+ A  E       A + L   ++VATNC+ M
Sbjct  175  IDRAWDIFGEDIGILDAAGEAVEAGNAAGEILLNAIDVATNCSIM  219



>ref|XP_004306583.1| PREDICTED: uncharacterized protein LOC101310252 [Fragaria vesca 
subsp. vesca]
Length=213

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 24/215 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL++ A AYY  GS  L+  A + F SLD +GDG V  +EF+SF+ Q GY        
Sbjct  1    MEELNQAAIAYYNNGSQNLQTLALDFFQSLDTNGDGGVSWSEFISFLQQSGYDI--DPDM  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            FN LD DG+  LDF EV+TL YI K+    C GCG  +   YFTC++C       +DLC 
Sbjct  59   FNVLDEDGDGYLDFREVLTLYYIIKTRFFSCVGCGERLLGLYFTCVECFDRANDTFDLCS  118

Query  437  SCYGNGKSGHNHP-FMDSYALLAVVKKRS----DVNQVTDDDD--QSESYTAMRGIVPAE  595
            +CY   +  H H  F+D++ LL   ++++    +++Q        Q+   +A R IVPA 
Sbjct  119  NCYAEKQFRHRHTLFLDNHMLLIAKRRQALGNHNLSQAIGRQTSYQAPPTSASRAIVPAR  178

Query  596  KY------RKRMFA-LKALQATLEVA---TNCNTM  670
            +       R R+ +  +AL+  + VA    +C  M
Sbjct  179  QQPPATPARNRLRSTFRALETAVGVANLMASCTIM  213



>ref|XP_004306582.1| PREDICTED: uncharacterized protein LOC101309960 [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 105/209 (50%), Gaps = 29/209 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDEL + A AYY  GSPE++  A   F S+D + DG+VD NEF +F+ Q G +++ +  F
Sbjct  1    MDELRQAASAYYNNGSPEIEQLAWCFFQSMDTNCDGQVDWNEFSAFLYQSGNQWI-SPSF  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            FN+LD + +  LDF EV+T  YI K+   +C  CG  +   YFTC++C        YDLC
Sbjct  60   FNDLDRNHDGALDFMEVLTFYYIIKTRSFWCSVCGICLTGLYFTCVECFDNVNSNTYDLC  119

Query  434  ISCYG--------NGKSGHNHP-FMDSYALLAVVK-KRSDVNQVTDDDDQSESYTAMRGI  583
              CY         N +S H+H  FMD++ LL   +      N   D        T MR  
Sbjct  120  PGCYESKPERQRYNRQSDHHHAYFMDNHMLLRSKRGGYGSSNLAIDSPGGGPGRTRMRQ-  178

Query  584  VPAEKYRKRMFALKALQATLEVATNCNTM  670
                        +KAL   + VAT C+ M
Sbjct  179  -----------TMKALDTAVNVATLCSIM  196



>ref|XP_008224031.1| PREDICTED: uncharacterized protein LOC103323795 [Prunus mume]
Length=226

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 108/215 (50%), Gaps = 29/215 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL ++A AYY      +K   QE  + +D DG+ +V   EFL++M   +  +++ T  
Sbjct  1    MEELRQIALAYYEDVPEHMKTWVQEFLSEIDKDGNEKVSLQEFLAYMGMHEDSKHLCTPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC-----PNYDL  430
            FF+EL  +G   L+F +++ L YI  +GRPFC+G C  FI   YFTC+QC       +DL
Sbjct  61   FFDELKQEGREELEFMDLLALFYIVSTGRPFCNGHCKNFIKGGYFTCVQCFYHSPKTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAM-------RGIV  586
            C  CY +GK  H H  F+D++ +L   +   D N   D   ++ S T+         G  
Sbjct  121  CPVCYLDGKYVHGHKNFLDNFLVLKTKRTVGD-NLNQDQHGEASSITSKAKAPESGTGST  179

Query  587  PAEKY-------------RKRMFALKALQATLEVA  652
            PAE               R R  ALKA++  L + 
Sbjct  180  PAETINALVPVNPRPNDTRARRKALKAIEILLALG  214



>gb|EYU32592.1| hypothetical protein MIMGU_mgv1a013813mg [Erythranthe guttata]
Length=209

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 107/214 (50%), Gaps = 26/214 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ ++AKAYY   + E K  A   F SLD +GDG++   E+   +      + +  R 
Sbjct  1    MNEIREVAKAYYSRATAEEKKLATMYFRSLDLNGDGKISLAEYKKMVNP----WFSNNRL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PN-YDLCI  436
            F ELD +GN TLDF E + L Y+ +   P CD C   +  +YF+CL C    PN YDLC 
Sbjct  57   FTELDRNGNGTLDFDEFLALFYMQRVPIPKCDACNNMLFGSYFSCLLCEKDFPNSYDLCC  116

Query  437  SCYGNGKSGHNHP---FMDSYA---LLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEK  598
             CYG GK  H+HP   FMD+ +   LLA   K+S V  V DD+   E+   +   +    
Sbjct  117  RCYGGGKYKHHHPRASFMDNRSQRLLLAEFMKQSQVT-VPDDEVMMENVQTISRSLSKPG  175

Query  599  YRKRMF----------ALKALQATLEVATNCNTM  670
              ++MF           +     TL VA  C+ M
Sbjct  176  TGRQMFEAFSNGLNIGGVIVTIGTLGVAAGCSIM  209



>ref|XP_007035299.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY06225.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=220

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 90/157 (57%), Gaps = 12/157 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MD+L ++A AYY      ++ EAQ+ FN +D +GDG ++  EFL FM Q+      +   
Sbjct  1    MDKLRQIANAYYELAPKNIQKEAQKFFNEIDFNGDGHIELEEFLEFMKQKPCDAYRSSNL  60

Query  272  FNEL--DTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PNYDLC  433
            F EL    D N  L F +VMTL YI +SGRPFC+GC  FI   YF C++C      Y LC
Sbjct  61   FKELCAGNDAN-KLGFMDVMTLYYIVQSGRPFCNGCDEFIKDIYFCCVECFHSSTKYCLC  119

Query  434  ISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVNQV  535
            + CY   K   +HP   F+D+++LL    +R+ +N V
Sbjct  120  LQCY-KAKKYRSHPHRQFLDNFSLLE-ANRRTALNGV  154



>ref|XP_008224098.1| PREDICTED: uncharacterized protein LOC103323855 [Prunus mume]
Length=236

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 96/159 (60%), Gaps = 12/159 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL + A AYY+    +++    E F  +D+D D RV  +EFL++M   +   +++  R
Sbjct  1    MEELRQTAFAYYQDAPEQIRRWVDEFFLEMDHDEDDRVSLHEFLTYMEMHEDCTHLSNHR  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC--------PN  421
            FF+EL  +G+  LDF +V+TL YI  SG+PFC+G C +F+   YFTC++C          
Sbjct  61   FFDELKKEGSEELDFLDVVTLFYIVYSGKPFCNGDCKKFVKGVYFTCVKCFDHASDAANT  120

Query  422  YDLCISCYGNGKSGHNH-PFMDSYALLAVVKKRSDVNQV  535
            +++C +CY +GK  H H  F+D++ LL   K+   +NQ+
Sbjct  121  FNVCTACYVDGKYVHGHKKFLDNFLLLQ-TKRMEALNQL  158



>ref|XP_010110693.1| hypothetical protein L484_009721 [Morus notabilis]
 gb|EXC27697.1| hypothetical protein L484_009721 [Morus notabilis]
Length=195

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 101/198 (51%), Gaps = 15/198 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY    P+ +N+A E F S+D DGDGR+   EF  F+   GY +++ + +
Sbjct  1    MEELRRAAVAYYNNSCPDFQNKAWEFFKSMDTDGDGRIRFAEFNQFLHWSGYGFVD-RNW  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----PNYDLCIS  439
            F  LD + +  LDFWEV+TL Y+ K+   +C  C   +   YFTC++C     +YDLC  
Sbjct  60   FVHLDANRDGCLDFWEVLTLYYVLKTRGVWCAQCHTQLHGLYFTCVECFDAACSYDLCSD  119

Query  440  CYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKYRKRMF  616
            CY +    H H  F+DS+ LL     RS +     + + + +  A   I          F
Sbjct  120  CYSHRNFSHYHSLFLDSFVLL-----RSKLGTPGQNVNMAITQPAQNEISS----NSANF  170

Query  617  ALKALQATLEVATNCNTM  670
             L AL   L VA    T+
Sbjct  171  WLNALDVALSVANIAQTL  188



>gb|KDO74847.1| hypothetical protein CISIN_1g0274422mg, partial [Citrus sinensis]
Length=158

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 90/152 (59%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGY-RYMNTQR  268
            M+ L K+A AYY +G+ E +    + F S+D DG+ RV   EF  FM+ Q +   M T+ 
Sbjct  1    MEALRKVALAYYNSGTDEERRLFNQFFQSMDKDGNRRVSYREFADFMSLQAHDENMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FF++L+ + +  LD  EV+TL YI KSGRP C  C  F+   YFTC++C       Y +C
Sbjct  61   FFDKLNINRSGGLDSMEVLTLYYILKSGRPICGQCKTFVTNEYFTCMKCFERQTAAYSIC  120

Query  434  ISCYGN-GKSGHNHP---FMDSYALLAVVKKR  517
            + C+ + G   HNH    F+D+++LL  ++K+
Sbjct  121  LKCFRDKGGLDHNHARSYFVDNFSLLESLRKK  152



>ref|XP_007226431.1| hypothetical protein PRUPE_ppa023963mg [Prunus persica]
 gb|EMJ27630.1| hypothetical protein PRUPE_ppa023963mg [Prunus persica]
Length=236

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 96/159 (60%), Gaps = 12/159 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL + A AYY+    +++    E F  +D+D D +V  +EFL++M   +   +++  R
Sbjct  1    MEELRQTAFAYYKDAPEQIRRWVDEFFLEMDHDEDDQVSLHEFLTYMEMHEDCTHLSNPR  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC--------PN  421
            FF+EL  +G+  LDF +V+TL YI  SG+PFC+G C +F+   YFTC++C          
Sbjct  61   FFDELKKEGSEELDFLDVVTLFYIVYSGKPFCNGDCKKFVKGVYFTCVKCFDHASDAANT  120

Query  422  YDLCISCYGNGKSGHNH-PFMDSYALLAVVKKRSDVNQV  535
            +++C +CY +GK  H H  F+D++ LL   K+   +NQ+
Sbjct  121  FNVCTACYVDGKYVHGHKKFLDNFLLLQ-TKRMEALNQL  158



>ref|XP_002863242.1| hypothetical protein ARALYDRAFT_358968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39501.1| hypothetical protein ARALYDRAFT_358968 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 97/194 (50%), Gaps = 22/194 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELH+ A AYY  GS E +N + + F ++D +GDGRV   E+  F+ Q           
Sbjct  1    MDELHEAAIAYYNNGSMEQQNLSWQFFRAMDVNGDGRVSLQEYTEFLRQTAGLAWVHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            F ELD +G+  LDFWEV+TL Y+ ++    C  C R +   YFTC+ C        +DLC
Sbjct  61   FRELDRNGDGQLDFWEVLTLYYVARTRTISCRTCLRILNGLYFTCVTCFESPCGNTFDLC  120

Query  434  ISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKYRKR  610
            + CY      H H  F+DSY LL    +   ++      DQ+           AE+   R
Sbjct  121  VKCYMRRTYCHPHRLFLDSYVLL----RSRRIHHPLPPGDQN----------LAEQQPSR  166

Query  611  MFALKALQATLEVA  652
            M    AL+A +EVA
Sbjct  167  MGWWNALRA-MEVA  179



>ref|XP_007223977.1| hypothetical protein PRUPE_ppa014649mg [Prunus persica]
 gb|EMJ25176.1| hypothetical protein PRUPE_ppa014649mg [Prunus persica]
Length=215

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL ++A AYY+     +K   QE  + +D DG+ +V   EFL++M   +  +++ T  
Sbjct  1    MEELRQIAFAYYKDVPEHVKMWVQEFLSEIDRDGNEKVSLQEFLAYMGMHEDSKHLCTPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC-----PNYDL  430
            FF+EL  +G   L+F +++ L YI  +GRPFC G C  FI   YFTC+QC       +DL
Sbjct  61   FFDELKQEGREELEFIDLLALFYIVSTGRPFCSGHCKNFIKGGYFTCVQCFYHSPKTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD  523
            C  CY +GK  H H  F+D + +L   +   D
Sbjct  121  CAVCYLDGKYVHRHKNFLDDFLVLKTKRAVGD  152



>ref|XP_010999446.1| PREDICTED: uncharacterized protein LOC105107269 [Populus euphratica]
Length=185

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 10/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A+AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     ++    
Sbjct  1    MEEIRRAAEAYYENLSDEKKRNARFSFNEMDKNGDGKINLDEYVEYLKKDNNTVLSHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR  FC  C  F+   YF+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFKETIVLYYIMQSGRALFCQSCNTFLADVYFSCSQCFFNDDSDSTYE  120

Query  428  LCISCYGNGKSGHN--HPFMDSYALLA  502
            +C  CYG  K  HN  H F D+Y LL+
Sbjct  121  ICCDCYGGKKFRHNDGHIFCDNYTLLS  147



>ref|NP_193080.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 emb|CAB40779.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83279.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=154

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 78/143 (55%), Gaps = 7/143 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELH+ A AYY  GS E +N + + F ++D +GDGRV   E+  F+ Q           
Sbjct  1    MDELHEAAIAYYNNGSMEQQNLSWQFFRAMDVNGDGRVSLQEYTDFLRQTAGLAWIHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            F ELD +G+  LDFWEV+TL Y+ ++    C  C R +   YFTC+ C        +DLC
Sbjct  61   FRELDRNGDGQLDFWEVLTLYYVARTRTINCRTCLRILNGLYFTCVTCFESSCGNTFDLC  120

Query  434  ISCYGNGKSGHNHP-FMDSYALL  499
            + CY      H H  F+DSY LL
Sbjct  121  VKCYMRRTYCHPHRLFLDSYVLL  143



>ref|XP_010274594.1| PREDICTED: uncharacterized protein LOC104609873 [Nelumbo nucifera]
Length=230

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 82/159 (52%), Gaps = 10/159 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMN--TQ  265
            M+E+ + A  YYR   PE+K +A E F S+D DGDG+V   EF  ++   G       ++
Sbjct  1    MEEIRQAALCYYRDSEPEIKMKAAEQFMSMDGDGDGKVSITEFTEYLKSAGCNVDKNLSR  60

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYD  427
              F ELD D N  LDF E +   YI       C GCG FI   YFTC+QC        Y+
Sbjct  61   NLFEELDRDKNGVLDFEEAIVFFYISTKRMIICGGCGSFIRDVYFTCIQCFRNKSQDAYN  120

Query  428  LCISCY--GNGKSGHNHPFMDSYALLAVVKKRSDVNQVT  538
            LC  CY  G G+S  +  F+D++  L  +++  +  Q +
Sbjct  121  LCCDCYASGQGRSDEHKVFLDNFTALKFIRQSIEKGQTS  159



>ref|XP_006419794.1| hypothetical protein CICLE_v10007025mg [Citrus clementina]
 gb|ESR33034.1| hypothetical protein CICLE_v10007025mg [Citrus clementina]
Length=146

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 7/134 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYR-YMNTQR  268
            M+ L K+A AYY +G+ E +      F S+D DG+GRV   E+  FM+ + +   M T+ 
Sbjct  1    MEALSKVALAYYNSGTDEERRLFNLFFLSMDQDGNGRVSYREYSDFMSLEAHDDNMRTRD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            FFN+LD D +  LDF EV+TL YI KSGRP C  C  FI   YFTC+ C       Y +C
Sbjct  61   FFNQLDIDRSGGLDFKEVLTLYYILKSGRPICGQCKIFITNEYFTCMSCFEPQTAAYSIC  120

Query  434  ISCYGN-GKSGHNH  472
            + C+ + G+  HNH
Sbjct  121  LECFCDKGRHDHNH  134



>ref|XP_006371124.1| hypothetical protein POPTR_0019s04360g [Populus trichocarpa]
 gb|ERP48921.1| hypothetical protein POPTR_0019s04360g [Populus trichocarpa]
Length=193

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 87/164 (53%), Gaps = 19/164 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A+AYY+  S E K  A+  FN +D DGDGR++ +E++ ++ +     +     
Sbjct  1    MEEIRRAAEAYYKNLSEEKKRNARFYFNEMDIDGDGRINLDEYVEYLKKDNNTVLTHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E +   YI +SGR  FC  C  F+   YF+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVWYYIMQSGRALFCQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYGNGKSGH--NHPFMDSYALL---------AVVKKRSDV  526
            LC  CYG  +  H  +  F D+Y LL         A V+KR +V
Sbjct  121  LCCDCYGGKRFTHHDDAVFWDNYTLLSQSRSLALEAPVQKRRNV  164



>ref|XP_010069095.1| PREDICTED: uncharacterized protein LOC104456073 [Eucalyptus grandis]
Length=205

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 93/177 (53%), Gaps = 11/177 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M++L + AK Y+ A +  +K  AQ+    +D+D DG V  +EFLSF   +GY  M+    
Sbjct  1    MEDLQRTAKVYFDAAAENVKQLAQDFVTEMDHDHDGVVCLSEFLSFTKVKGYVRMSNPYL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F +L+  G   L F E +T  YI  S RP CDGCG      +FTC++C         ++L
Sbjct  61   FKQLNVSGTGKLSFDEAITFFYIATSARPLCDGCGCLALGMFFTCVKCFKDAGEAETFNL  120

Query  431  CISCYGNGKSGHNH-PFMDSYALLAVVKK--RSDVNQVTDDDDQSESYTAMRGIVPA  592
            C  C+ +G   H H  F+D++ +L  +++  R + N+       + + T+   IVPA
Sbjct  121  CSDCFSHGNYTHPHNDFLDNFVMLEAMRRELRQEKNKFQPPATDANTSTSF-AIVPA  176



>ref|XP_010550855.1| PREDICTED: uncharacterized protein LOC104821630 [Tarenaya hassleriana]
Length=204

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 107/207 (52%), Gaps = 17/207 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ELH+ A AYY  G+ E +  A + F ++D D DGRV  +E+  F+ + G  ++  Q F
Sbjct  1    MEELHEAAIAYYNNGTDEQRALAWQFFQAMDTDHDGRVSFHEYSDFLRRTG-GFLRPQSF  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC--------PNYD  427
              +LD D N +LDFWEV+TL YI ++    C  C R +   +FTCL C          +D
Sbjct  60   -QDLDRDRNGSLDFWEVLTLYYIARTRTLTCRTCHRSLEGLHFTCLACFDSPSHESATFD  118

Query  428  LCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEK-Y  601
            LC+SCY      H+H  F+DSY LL   ++R+             ++   + I   +   
Sbjct  119  LCVSCYRARTYDHHHRLFLDSYVLLR-SRRRNHPQLPDPPVAPPPNHNPPQDIAALQNPA  177

Query  602  RKRMF-ALKALQATLEV---ATNCNTM  670
            R R + ALKA++  L V   AT C  M
Sbjct  178  RMRWWHALKAMEIALAVGNLATFCTIM  204



>gb|KDP33328.1| hypothetical protein JCGZ_12877 [Jatropha curcas]
Length=172

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 94/156 (60%), Gaps = 10/156 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMT-QQGYRYMNTQR  268
            M+E+ + AKAYY   S + K  A++ FN +D DGDG++  +E+   +  ++G+  + +  
Sbjct  1    MEEISETAKAYYANLSEKQKRLAKDFFNEMDKDGDGKITFDEYEQRIKPKKGFNPIASSD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQCPN-----YDL  430
            FF +LD DGN TLDF E +TL YI  + R F CD C  F+   YFTC+QC N     YDL
Sbjct  61   FFRKLDKDGNGTLDFDEFVTLHYICATRRVFYCDECRVFLDRVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVN  529
            C+SCY +    ++H    F+D+Y +L   + +++ +
Sbjct  121  CVSCYRDKNIINHHKDAVFLDNYTMLHAKRNQNNAS  156



>gb|KDP33333.1| hypothetical protein JCGZ_12882 [Jatropha curcas]
Length=417

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 97/156 (62%), Gaps = 10/156 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+E+ + AKAYY   S + K  A++ FN +D DGDG++  +E+  ++ T++G++ + +  
Sbjct  1    MEEISETAKAYYANLSEKQKRLAKDFFNEMDKDGDGKITFDEYEQYIKTKKGFKTIASSD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQCPN-----YDL  430
            FF +LD DGN +LDF E +T+ YI  S R F CD C  F+   YFTC+QC N     YDL
Sbjct  61   FFRKLDKDGNGSLDFDEFVTVHYICASERVFYCDECRVFLDRVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVN  529
            C+SCY +    ++H    F+D+Y +L   + +++ +
Sbjct  121  CVSCYRDKNIINHHKDAVFLDNYTMLQAKRNQNNAS  156


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 76/150 (51%), Gaps = 10/150 (7%)
 Frame = +2

Query  119  AYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGN  298
            +YYR+  P    +A++ F+++D  G G+V   E+  +  Q+G   +     F  LDT+G+
Sbjct  185  SYYRSLPPAEMQKAKDGFSAMDKTGSGKVSLKEYSEYFKQRGLVELTYPDLFKALDTNGD  244

Query  299  HTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATYFTCLQCPN------YDLCISCYGNGK  457
              LDF E +T+ Y+  + +  +C  CG F+  +Y +C QC N      Y++C  CY    
Sbjct  245  GRLDFDEYITVYYLCMNNKLIYCGECGVFLSGSYMSCRQCFNNGSGDPYNICYDCYSRNN  304

Query  458  SGHNH--PFMDSYALLA-VVKKRSDVNQVT  538
              H+    F+D+  L    VK  +D N  T
Sbjct  305  IDHHKDATFVDNIQLHCFAVKGSADNNGST  334



>gb|EYU38473.1| hypothetical protein MIMGU_mgv1a021207mg, partial [Erythranthe 
guttata]
Length=161

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 15/166 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MD+LH +AKAYY   + E K +A+  F SLD +  G++   E+ S +      Y  +   
Sbjct  1    MDQLHLVAKAYYARATDEEKEKAENYFRSLDVNCTGKISLAEYKSLVNP----YYASDAV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF--CDGCGRFIPATYFTCLQC----PN-YDL  430
            F  LD +G+ +LDF EV+ L +I K  RP   CD C   +   YF+CL C    PN YD+
Sbjct  57   FKWLDKNGDGSLDFEEVLALYFIHKI-RPLRRCDACRGSLQGPYFSCLMCEKNHPNTYDI  115

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVNQVTDDDDQSE  559
            C  CYGNGK  H+HP   F+DSY++  +  ++ +  Q++  DD  E
Sbjct  116  CCGCYGNGKFEHHHPTTSFLDSYSMRRLQTQKLNSAQISLVDDAPE  161



>ref|XP_009350825.1| PREDICTED: uncharacterized protein LOC103942366 [Pyrus x bretschneideri]
Length=244

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 96/169 (57%), Gaps = 12/169 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQG-YRYMNTQR  268
            M++L + A AYY+  S +++  A E F  +D D + RV   EF  +M + G Y+++    
Sbjct  1    MEDLRQTAFAYYKYASTDVQRLADESFYEMDLDKNDRVSLQEFTEYMERHGDYKHLCNSP  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC---------P  418
            FF+EL  +G   LDF +VMTLLYI  SG+PFC+G C +FI   YF C++C          
Sbjct  61   FFDELKKEGREELDFMDVMTLLYINYSGKPFCNGQCKKFIKGVYFACVKCFDDCATDATN  120

Query  419  NYDLCISCYGNGKSGHNH-PFMDSYALLAVVKKRSDVNQVTDDDDQSES  562
             +++C +CY +GK  H H  F+D++ LL   +      Q T   ++S++
Sbjct  121  TFNVCPACYADGKYFHGHDKFLDNFLLLQRNRMTILNQQATSVTNESQA  169



>ref|XP_002528341.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF34013.1| calcium ion binding protein, putative [Ricinus communis]
Length=183

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 89/152 (59%), Gaps = 9/152 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQ-QGYRYMNTQR  268
            M+E+ + AKAYY   S   K   +E F ++D DGDG++   E+   + + +G++ +++  
Sbjct  1    MEEISETAKAYYANLSDRQKRLGKEFFQAMDTDGDGKITLEEYAQCIKEKKGFKTISSPD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQCPN-----YDL  430
            FF +LD DGN TLDF E + + YI  + R  FCD C  F+   YFTC+QC N     YDL
Sbjct  61   FFKKLDKDGNGTLDFDEFIIVHYICSTERVYFCDECKVFLAGVYFTCVQCFNGSGNTYDL  120

Query  431  CISCYGNGKSGHNHP--FMDSYALLAVVKKRS  520
            C SCY +    H+    F+D+Y LL   ++++
Sbjct  121  CSSCYRDKNINHHKDALFLDNYTLLQAKRQQN  152



>gb|KFK36230.1| hypothetical protein AALP_AA4G095100 [Arabis alpina]
Length=202

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 105/201 (52%), Gaps = 22/201 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELH+ A AYY  G+ E ++ A + F ++D DG+GRV   E+  F+ +           
Sbjct  1    MDELHEAAIAYYNNGTMEQQSFAWQFFQAMDIDGNGRVSLQEYTDFLCRSAGLAWVHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C R +   YFTC+ C         +DL
Sbjct  61   FIELDRNRDGQLDFWEVLTLYYVARTRTISCRTCHRALNGLYFTCITCFDSPYGGDTFDL  120

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKY  601
            C+ CY NG+S ++HP   F+DSY LL   K+     Q  D+ +    +        AE+ 
Sbjct  121  CVKCY-NGRS-YSHPHCLFLDSYVLLR-SKRSHQPLQPPDNQNLPGDHNL------AEEN  171

Query  602  RKRM---FALKALQATLEVAT  655
             +RM    AL+A++  L V T
Sbjct  172  PERMGWRTALRAMEVALAVGT  192



>ref|XP_010277593.1| PREDICTED: uncharacterized protein LOC104611989 [Nelumbo nucifera]
Length=215

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 91/166 (55%), Gaps = 13/166 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ ++A +YY A S E K      F  LD+D +G +  NEF  ++ ++G   +N   F
Sbjct  1    MEEIREVALSYYHACSAETKQMILNFFRELDSDQNGYITINEFTDYLMRKGCSCLNPN-F  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATYFTCLQC-------PNYD  427
            F ELD D N  LDF EV+T  YI +  R  FCDGCG F+ ++YFTC+ C         YD
Sbjct  60   FLELDKDRNGLLDFEEVITFYYIVEFMRLVFCDGCGCFLKSSYFTCVDCYYSNEDNNTYD  119

Query  428  LCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSES  562
            LC  CY  G     H  F+D++ALL +  K   +   T+ + QS S
Sbjct  120  LCPRCYRTGNYARGHELFLDNHALLQLTGK---LIHETNQNQQSAS  162



>gb|EYU38467.1| hypothetical protein MIMGU_mgv1a018857mg, partial [Erythranthe 
guttata]
Length=165

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 91/170 (54%), Gaps = 19/170 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDEL  + KAY+   + + K  A+E F SLD D DGRV   E+ + +++    Y N    
Sbjct  1    MDELRAVGKAYFARATDQEKELAKEFFRSLDGDSDGRVSLAEYKTLVSRP---YAN-DTL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF--CDGCGRFIPATYFTCLQCP-----NYDL  430
            F  LD +G+ +LDF EV+ L +I   G P   C  C R +P  YF+C+ C       YDL
Sbjct  57   FTGLDRNGDESLDFDEVLALHFIMTKG-PLRTCHACARSMPGAYFSCIPCEKNHPDTYDL  115

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVN----QVTDDDDQSE  559
            C SCYG G+  H HP   F+DS+++  ++ K  +      +   DDDQ E
Sbjct  116  CCSCYGAGQYDHQHPAADFLDSHSMRNLLAKNFNTAGPQLRPPHDDDQEE  165



>ref|XP_010105214.1| hypothetical protein L484_011271 [Morus notabilis]
 gb|EXC04079.1| hypothetical protein L484_011271 [Morus notabilis]
Length=184

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 7/142 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL   A+AYY   S +L+N A   F S+D + DG V   EF  F+   GY ++N    
Sbjct  1    MEELRLAARAYYNNSSSDLQNLAINFFRSMDANRDGWVSFQEFTRFLRHNGYNWVNPN-M  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F++LDT+ +  L FWEV+T  YI K+   +C  CG  +   +FTC+ C       +DLC 
Sbjct  60   FSQLDTNNDGGLGFWEVLTFYYIIKTRAVWCRACGAQLHGLHFTCVACFDGGQNTFDLCA  119

Query  437  SCYGNGKSGHNH-PFMDSYALL  499
             CYG  +  H+H  F+D+Y LL
Sbjct  120  RCYGGRQFRHHHRVFLDNYILL  141



>ref|XP_006480237.1| PREDICTED: uncharacterized protein LOC102612370 [Citrus sinensis]
 ref|XP_006480238.1| PREDICTED: uncharacterized protein LOC102612675 [Citrus sinensis]
 ref|XP_006480239.1| PREDICTED: uncharacterized protein LOC102612979 [Citrus sinensis]
Length=201

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 101/202 (50%), Gaps = 39/202 (19%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQQGY-RYMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGR  355
            +D DG+GRV   EF  FM+ + Y R M T+ FFN+LD DG+  LDF EV+TL YI KSGR
Sbjct  1    MDEDGNGRVSYREFSEFMSLEAYDRNMCTRDFFNDLDVDGSRGLDFNEVLTLYYIIKSGR  60

Query  356  PFCDGCGRFIPATYFTCLQCPN-----YDLCISCYGNGKSGH-NHP-----FMDSYALLA  502
            P C  C  FI   YFTC +C       Y++C+ C+  G+ GH NH      F+D++ALL 
Sbjct  61   PICRQCKIFITNEYFTCTRCFKTRSFPYNICLECF-RGEEGHFNHTHSLEQFVDNFALLE  119

Query  503  VVKK-----------------RSDVNQVTDDDDQSESYTAMRGIV------PAEKYRKRM  613
             ++K                 RS   ++          ++   IV      PAE+  +  
Sbjct  120  CLRKEALEEDREDEYYEPSPSRSRSQRIVHYSRYPSENSSHHAIVPYNPNIPAERRNRWG  179

Query  614  FALKALQATLE---VATNCNTM  670
             A + L+  L    V T+C+ M
Sbjct  180  TAFRILETGLHFASVVTSCSIM  201



>ref|XP_006284534.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
 gb|EOA17432.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
Length=207

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 82/150 (55%), Gaps = 9/150 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELH+ A AYY  GS E ++ A   F ++DNDGDGRV   E++ F+ +           
Sbjct  1    MDELHEAAIAYYNNGSREQQDLAWHFFRAMDNDGDGRVSFQEYIDFLHRTAGLAWVCPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C        +DLC
Sbjct  61   FRELDRNRDGQLDFWEVLTLYYVARTRTISCRTCLQSLSGLHFTCVTCFDTPGGETFDLC  120

Query  434  ISCYGNGKSGHNHP-FMDSYALLAVVKKRS  520
            + CY      H+H  F+DSY LL    KRS
Sbjct  121  VKCYMRRNYTHSHCLFLDSYVLLR--SKRS  148



>ref|XP_006284535.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
 gb|EOA17433.1| hypothetical protein CARUB_v10005736mg [Capsella rubella]
Length=208

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 82/150 (55%), Gaps = 9/150 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELH+ A AYY  GS E ++ A   F ++DNDGDGRV   E++ F+ +           
Sbjct  1    MDELHEAAIAYYNNGSREQQDLAWHFFRAMDNDGDGRVSFQEYIDFLHRTAGLAWVCPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   +FTC+ C        +DLC
Sbjct  61   FRELDRNRDGQLDFWEVLTLYYVARTRTISCRTCLQSLSGLHFTCVTCFDTPGGETFDLC  120

Query  434  ISCYGNGKSGHNHP-FMDSYALLAVVKKRS  520
            + CY      H+H  F+DSY LL    KRS
Sbjct  121  VKCYMRRNYTHSHCLFLDSYVLLR--SKRS  148



>ref|XP_006371134.1| hypothetical protein POPTR_0019s04450g [Populus trichocarpa]
 gb|ERP48931.1| hypothetical protein POPTR_0019s04450g [Populus trichocarpa]
Length=186

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 10/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDGR++ +E+L ++ +     +     
Sbjct  1    MEEVRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGRINLHEYLEYLKKDNNTVLTHPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRALICQSCNTFLADVYFSCSQCFFKDDSDSTYE  120

Query  428  LCISCYGNGKSGH--NHPFMDSYALLA  502
            +C  CYG  +  H  +  F D+Y LL+
Sbjct  121  ICCDCYGGKRFTHHADAIFCDNYTLLS  147



>ref|XP_010256259.1| PREDICTED: uncharacterized protein LOC104596703 [Nelumbo nucifera]
Length=205

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 97/196 (49%), Gaps = 18/196 (9%)
 Frame = +2

Query  113  AKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNT--QRFFNELD  286
            A  YYR   PE+K  AQ+ FNS+D + DG++   EF  ++  + Y   N    + F ELD
Sbjct  18   ALCYYRDSPPEIKQMAQDQFNSMDRNEDGKISITEFKEYLVGEKYGNNNNNYSKLFEELD  77

Query  287  TDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLCISCYG  448
             D N  LDF E +   YI  +    C GCG  I   YFTC++C        Y+LC  CY 
Sbjct  78   RDNNGFLDFDEAIVFFYISTARLVICGGCGILIKEIYFTCMECFCDRSLDEYNLCCDCYA  137

Query  449  NGKSGH-NH-PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKYRKRMFAL  622
            + K  H NH  F+D++A L ++  R+ + + +  + QS +      +V A+        L
Sbjct  138  SKKGRHENHKKFVDNFAALQLL--RNKIEKKSSTELQSNASGKKIAVVVAKS------VL  189

Query  623  KALQATLEVATNCNTM  670
            + +     VAT C+ M
Sbjct  190  RHVVIHTAVATFCSIM  205



>ref|XP_009113944.1| PREDICTED: uncharacterized protein LOC103839202 isoform X2 [Brassica 
rapa]
Length=196

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 103/194 (53%), Gaps = 19/194 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+ +  G+ +++++ 
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSE-  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYD  427
             F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YFTC+ C         +D
Sbjct  60   MFQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFD  119

Query  428  LCISCYGNGKSGHNHP---FMDSYALLAVVKKRSD---VNQVTDDDDQSESYTAMRGIVP  589
            LC++CY   +  +NHP   F+DS+ LL    KRS    + +   D +  E +  M G   
Sbjct  120  LCVNCY--MRRNYNHPHRVFLDSFVLLR--SKRSHPPMLQEPPGDQNMPEQHPGMMGWCT  175

Query  590  AEKYRKRMFALKAL  631
            A    +  FA+ + 
Sbjct  176  ALSAMEAAFAVGSF  189



>ref|XP_011011795.1| PREDICTED: uncharacterized protein LOC105116247 isoform X1 [Populus 
euphratica]
 ref|XP_011011796.1| PREDICTED: uncharacterized protein LOC105116247 isoform X1 [Populus 
euphratica]
Length=201

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 88/163 (54%), Gaps = 18/163 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY+      K +A+E FN++D + DG++   E++ ++ ++       Q  
Sbjct  1    MEEIRRAAGAYYKHLPENNKEQARETFNAMDKNRDGKISVREYMDYLNEKKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C +C        Y++
Sbjct  61   FSALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYGNGKSGHNHP--FMDSYALL---------AVVKKRSDV  526
            C  CYG+ K  H+    F D+Y LL         A +KKR++V
Sbjct  121  CCECYGDNKFTHHDGAIFCDNYTLLCQSRSATQAAPMKKRTNV  163



>ref|XP_007226919.1| hypothetical protein PRUPE_ppa015959mg, partial [Prunus persica]
 gb|EMJ28118.1| hypothetical protein PRUPE_ppa015959mg, partial [Prunus persica]
Length=168

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 80/153 (52%), Gaps = 17/153 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYM--NTQ  265
            M+ELH  A AYY  G+   +  A + F S+D DGDGR+   EF  F+ Q GY ++  N  
Sbjct  1    MEELHAAAYAYYDRGNEHTRRVAYDFFRSMDTDGDGRISYAEFNDFVQQSGYYWILHNDP  60

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------  415
              F +LD + +  LD  EV+T  YI K+    C GC   +   YFTC++C          
Sbjct  61   NLFAKLDRNRDGGLDLQEVLTFYYIIKTRYITCQGCRAHLCGLYFTCVECFDGGAANYHH  120

Query  416  ----PNYDLCISCYGNGKSGHNHP-FMDSYALL  499
                P YDLC +CYGN    + H  F+D++ LL
Sbjct  121  HHQYPTYDLCAACYGNANYINQHSYFLDNHVLL  153



>ref|XP_009113946.1| PREDICTED: uncharacterized protein LOC103839202 isoform X4 [Brassica 
rapa]
Length=194

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 101/191 (53%), Gaps = 15/191 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+ +  G+ +++++ 
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSE-  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYD  427
             F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YFTC+ C         +D
Sbjct  60   MFQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFD  119

Query  428  LCISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEK  598
            LC++CY   +  +NHP   F+DS+ LL   K+     +   D +  E +  M G   A  
Sbjct  120  LCVNCY--MRRNYNHPHRVFLDSFVLLR-SKRSHPPMEPPGDQNMPEQHPGMMGWCTALS  176

Query  599  YRKRMFALKAL  631
              +  FA+ + 
Sbjct  177  AMEAAFAVGSF  187



>ref|XP_011011797.1| PREDICTED: uncharacterized protein LOC105116247 isoform X2 [Populus 
euphratica]
Length=201

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 88/163 (54%), Gaps = 18/163 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY+      K +A+E FN++D + DG++   E++ ++ ++       Q  
Sbjct  1    MEEIRRAAGAYYKHLPENNKEQARETFNAMDKNRDGKISVREYMDYLNEKKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C +C        Y++
Sbjct  61   FSALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYGNGKSGHNHP--FMDSYALL---------AVVKKRSDV  526
            C  CYG+ K  H+    F D+Y LL         A ++KR++V
Sbjct  121  CCECYGDNKFTHHDGAIFCDNYTLLCQSRSATQAAPIQKRTNV  163



>ref|XP_006371129.1| hypothetical protein POPTR_0019s04400g [Populus trichocarpa]
 gb|ERP48926.1| hypothetical protein POPTR_0019s04400g [Populus trichocarpa]
Length=206

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 87/165 (53%), Gaps = 22/165 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E+++++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVAYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC--------PNY  424
            F ELD DGN TLDF E + L YI +SGR   C  C  F+   YFTC QC          +
Sbjct  59   FTELDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYGNGKSGHN--HPFMDSYALL---------AVVKKRSDV  526
            D+C  CYG  K  HN  H F D+Y LL         A ++KR+ V
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSATQAAPIQKRTKV  163



>ref|XP_011012321.1| PREDICTED: uncharacterized protein LOC105116598 isoform X1 [Populus 
euphratica]
Length=193

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 85/164 (52%), Gaps = 19/164 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     +     
Sbjct  1    MEEIRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGQINLHEYVDYLKKHNNTVLILPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRNLICQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYGNGKSGH--NHPFMDSYALL---------AVVKKRSDV  526
            LC  CYG  +  H  +  F D+Y LL         A V+KR +V
Sbjct  121  LCCDCYGGKRFTHHDDAIFWDNYTLLSQSRSLALEAPVQKRRNV  164



>ref|XP_011012322.1| PREDICTED: uncharacterized protein LOC105116598 isoform X2 [Populus 
euphratica]
Length=192

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 10/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY   S E K  A+  FN +D +GDG+++ +E++ ++ +     +     
Sbjct  1    MEEIRRAAVAYYENLSEEKKRNARFSFNEMDKNGDGQINLHEYVDYLKKHNNTVLILPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C QC         YD
Sbjct  61   FTALDKDGNGSLDFEETIVLYYIMQSGRNLICQSCNTFLADVYFSCFQCFCLDESPSTYD  120

Query  428  LCISCYGNGKSGH--NHPFMDSYALLA  502
            LC  CYG  +  H  +  F D+Y LL+
Sbjct  121  LCCDCYGGKRFTHHDDAIFWDNYTLLS  147



>ref|XP_004297939.1| PREDICTED: uncharacterized protein LOC101315429 [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 83/153 (54%), Gaps = 19/153 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRY-MNTQR  268
            M+ELH  A AYY  G+ EL++ A   F S+D +GDG +   EF  F+ Q GY + +N   
Sbjct  1    MEELHAAALAYYENGTQELRDLAWSFFRSIDTNGDGHISCLEFNDFLQQSGYNWIINDPN  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG--CGRFIPATYFTCLQC--------P  418
            FF  LD +G+  LDF EV+T  YI K+    C G  CG  +   YFTC+ C        P
Sbjct  61   FFKLLDRNGDGGLDFGEVITFYYIIKTRYIRCQGYHCGVHLCGLYFTCVACFDGVHEHRP  120

Query  419  NYDLCISCYGNGKSGHNHP------FMDSYALL  499
             +DLC +CY   K  + HP      F+D++ LL
Sbjct  121  TFDLCPACY--SKRNYYHPYQNHTYFLDNHVLL  151



>gb|EYU32593.1| hypothetical protein MIMGU_mgv1a021501mg, partial [Erythranthe 
guttata]
Length=136

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 74/133 (56%), Gaps = 9/133 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ ++A+AYY   + + KN A + F SLD++ DG +   EF   +       ++T + 
Sbjct  1    MNEIREVAEAYYARATVDEKNSALDFFRSLDDNNDGTISHAEFRKLVDPS----LSTDKL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCP-----NYDLCI  436
            F ELD + + TLDF EV+ L YI K G   CD C   +  +YF+CL C      ++DLC 
Sbjct  57   FKELDKNNDGTLDFNEVLALYYIQKCGARLCDVCRDILLTSYFSCLLCEKHLPYSFDLCC  116

Query  437  SCYGNGKSGHNHP  475
             CYG G   H HP
Sbjct  117  GCYGGGAFEHRHP  129



>ref|WP_033634418.1| hypothetical protein, partial [Serratia marcescens]
Length=101

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDELHK+A+AYY   + E K++ +  FNS+D+D + R+   E+L +M + G+  M  + F
Sbjct  1    MDELHKIARAYYTTANEESKSQGRRFFNSIDHDSNRRITIQEYLPYMKRNGHTKMANRPF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPAT  394
            F  L+      L+F EVMTL YI KSGR FCDGC   +  T
Sbjct  61   FEYLNESRTGQLEFMEVMTLFYIIKSGRKFCDGCDGLLKGT  101



>gb|ABK94726.1| unknown [Populus trichocarpa]
Length=206

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 86/165 (52%), Gaps = 22/165 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E+++++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVAYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC--------PNY  424
            F  LD DGN TLDF E + L YI +SGR   C  C  F+   YFTC QC          +
Sbjct  59   FTALDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYGNGKSGHN--HPFMDSYALL---------AVVKKRSDV  526
            D+C  CYG  K  HN  H F D+Y LL         A ++KR+ V
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSATQAAPIQKRTKV  163



>gb|EYU38471.1| hypothetical protein MIMGU_mgv1a021889mg, partial [Erythranthe 
guttata]
Length=162

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 94/166 (57%), Gaps = 17/166 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++H +AKAYY   + E K +A+  F SLD + DG++   E+ S +      Y  ++  
Sbjct  1    MEQVHLVAKAYYARATDEEKEKAKNYFRSLDVNRDGKISLAEYRSPVNP----YYASEAV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFK-SGRPFCDGCGRFIPATYFTCLQC----PNY--DL  430
            F  LD +G+ +LDF E + L +I    G  +CD CG  +   YF+CLQC    PN   DL
Sbjct  57   FKCLDKNGDGSLDFEEFLALNFIHNICGLRWCDACGGSLHGHYFSCLQCEKDYPNKSCDL  116

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKR---SDVNQVTDDDD  550
            C  CYG GK  H+HP   F+DS +L  +  ++   + + Q+TD+D+
Sbjct  117  CYGCYGAGKFKHHHPTASFLDSCSLRRLQTQKLIIAQITQLTDNDE  162



>ref|XP_006371128.1| hypothetical protein POPTR_0019s04390g [Populus trichocarpa]
 ref|XP_006371130.1| hypothetical protein POPTR_0019s04410g [Populus trichocarpa]
 gb|ERP48925.1| hypothetical protein POPTR_0019s04390g [Populus trichocarpa]
 gb|ERP48927.1| hypothetical protein POPTR_0019s04410g [Populus trichocarpa]
Length=206

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 22/165 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY     E K  A+  FN +D + DG+++ +E++ ++ +     + +   
Sbjct  1    MEEIRRAAGAYYENLPDEEKRNARFSFNEMDKNKDGKINLDEYVEYLKKDNNTVLPS--L  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC--------PNY  424
            F  LD DGN TLDF E + L YI +SGR   C  C  F+   YFTC QC          +
Sbjct  59   FTALDKDGNGTLDFDEAIVLYYIMQSGRAIICQSCKTFLAGAYFTCSQCFFNDDDSVSTF  118

Query  425  DLCISCYGNGKSGHN--HPFMDSYALL---------AVVKKRSDV  526
            D+C  CYG  K  HN  H F D+Y LL         A ++KR+ V
Sbjct  119  DVCCDCYGGKKFRHNDGHIFCDNYTLLCRSRSATQAAPIQKRTKV  163



>ref|XP_008353259.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 [Malus 
domestica]
Length=284

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ELH+ A AYY  G   L+  A   F S+D +GDG V+  EF++F+ Q GY ++  + F
Sbjct  1    MEELHRAALAYYNNGDRNLQLLASNFFQSMDQNGDGIVNLAEFVTFLQQNGYGWIG-RNF  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
            F +LD +    LDF EV+T  YI K+   +C  CG ++   YFTC++C      NYDLC 
Sbjct  60   FYDLDRNLVGGLDFHEVLTFYYIIKTRNLWCRRCGVWLTGLYFTCVECFDGAPDNYDLCS  119

Query  437  SCY  445
             CY
Sbjct  120  GCY  122



>ref|XP_007226352.1| hypothetical protein PRUPE_ppa022625mg, partial [Prunus persica]
 gb|EMJ27551.1| hypothetical protein PRUPE_ppa022625mg, partial [Prunus persica]
Length=144

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 78/137 (57%), Gaps = 15/137 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL +   AYY+     +K    E F  +D DG+ RV   EFL++M   +  ++++T  
Sbjct  1    MEELRQTVLAYYKDAPQHIKRSVDECFIEMDVDGNDRVSWQEFLAYMEMHEDCKHLSTCS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC----------  415
            FFNEL  +    LDF +V+ L+YI  SG+PFC+G  G FI  TYFTC++C          
Sbjct  61   FFNELKKEEKEGLDFMDVVILVYIIYSGKPFCNGHSGSFIKGTYFTCVKCFDGHEHGQCS  120

Query  416  -PN--YDLCISCYGNGK  457
             PN  +++C  CY +GK
Sbjct  121  VPNKTFNVCTVCYVDGK  137



>ref|XP_006388264.1| hypothetical protein POPTR_0257s00210g [Populus trichocarpa]
 gb|ABK96078.1| unknown [Populus trichocarpa]
 gb|ERP47178.1| hypothetical protein POPTR_0257s00210g [Populus trichocarpa]
Length=206

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 87/163 (53%), Gaps = 18/163 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY+      K  A++ F ++D +GDG+++++E++ ++ +     +     
Sbjct  1    MEEIRRAAGAYYQHLPENNKELAKKTFAAMDKNGDGKINRDEYVEYLKKDNNTVLTLPSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C +C       +Y++
Sbjct  61   FTALDKDGNGSLDFNEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSSYEI  120

Query  431  CISCYGNGKSGHN--HPFMDSYALL---------AVVKKRSDV  526
            C  CYG  K  H+    F D+Y LL         A ++KR+ V
Sbjct  121  CCECYGGKKFTHHDGAIFCDNYTLLCRSRSATQAAPIQKRTKV  163



>ref|XP_011011798.1| PREDICTED: uncharacterized protein LOC105116248 isoform X1 [Populus 
euphratica]
Length=199

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY+      K +A++ FN++D +GDG++   E++ ++ +        Q  
Sbjct  1    MEEIRRAAGAYYKHLPENKKEQARKTFNAMDKNGDGKISVREYVDYLNENKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F+ LD D N +LDF E   L YI +SGR   C  C  F+   YF+C +C        Y++
Sbjct  61   FSALDKDSNGSLDFDEATVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYGNGKSGHNHP--FMDSYALL  499
            C  CYG+ K  H+    F D+Y LL
Sbjct  121  CCECYGDKKFTHHDGAIFCDNYTLL  145



>ref|XP_010256260.1| PREDICTED: uncharacterized protein LOC104596704 [Nelumbo nucifera]
Length=213

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 84/148 (57%), Gaps = 10/148 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++ K+A AYY+  S E K   ++LF  +D DG+ +V  +EF  +  ++  +    +  
Sbjct  1    MEQIRKVALAYYKESSDETKEHVKKLFKKIDADGNRKVSLDEFNEYCRRKSKKL--PKHC  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNYDLC  433
            FNELD +G+  LDF E++   YI ++    C GCG  +   YFTC  C       N++LC
Sbjct  59   FNELDKNGDGFLDFEEIIVFFYIIQTRTISCSGCGSLVMGMYFTCAICFYTETSVNHNLC  118

Query  434  ISCYGNGKS-GHNHP-FMDSYALLAVVK  511
             SC+ +GKS G  H   +D+YALL  +K
Sbjct  119  CSCHQSGKSAGCEHSNLVDNYALLQGIK  146



>ref|XP_011011799.1| PREDICTED: uncharacterized protein LOC105116248 isoform X2 [Populus 
euphratica]
Length=199

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY+      K +A++ FN++D +GDG++   E++ ++ +        Q  
Sbjct  1    MEEIRRAAGAYYKHLPENKKEQARKTFNAMDKNGDGKISVREYVDYLNENKATDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F+ LD D N +LDF E   L YI +SGR   C  C  F+   YF+C +C        Y++
Sbjct  61   FSALDKDSNGSLDFDEATVLYYIMQSGRAIICQSCKTFLAGAYFSCSECFFNDSVSTYEI  120

Query  431  CISCYGNGKSGHNHP--FMDSYALL  499
            C  CYG+ K  H+    F D+Y LL
Sbjct  121  CCECYGDKKFTHHDGAIFCDNYTLL  145



>ref|XP_009113947.1| PREDICTED: uncharacterized protein LOC103839202 isoform X5 [Brassica 
rapa]
Length=174

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 96/175 (55%), Gaps = 19/175 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+ +  G+ +++++ 
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSE-  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYD  427
             F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YFTC+ C         +D
Sbjct  60   MFQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFD  119

Query  428  LCISCYGNGKSGHNHP---FMDSYALLAVVKKRSD---VNQVTDDDDQSESYTAM  574
            LC++CY   +  +NHP   F+DS+ LL    KRS    + +   D +  E +  M
Sbjct  120  LCVNCY--MRRNYNHPHRVFLDSFVLLR--SKRSHPPMLQEPPGDQNMPEQHPGM  170



>ref|XP_006371132.1| hypothetical protein POPTR_0019s04430g [Populus trichocarpa]
 gb|ERP48929.1| hypothetical protein POPTR_0019s04430g [Populus trichocarpa]
Length=163

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 82/153 (54%), Gaps = 12/153 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ + ++A AYY     E K  A+ +F+ +D + DG++D +E++ ++ +           
Sbjct  1    MERIRRVAVAYYENLPEEKKRYARFIFDEMDENRDGQIDLDEYVEYLKKHNNTIFTDPSM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DG+ +LDF E +TL YI +SGR  FCD C  F+   YF+C QC         YD
Sbjct  61   FRALDKDGDGSLDFEESITLYYILQSGRALFCDCCHTFLADVYFSCFQCFCLHESASTYD  120

Query  428  LCISCYGNGKSGHNHP--FMDSYALLAVVKKRS  520
            LC  CYG  K  H+    F D+  LL+  K RS
Sbjct  121  LCCDCYGGKKFNHHDDAIFWDNCTLLS--KSRS  151



>ref|XP_009113943.1| PREDICTED: uncharacterized protein LOC103839202 isoform X1 [Brassica 
rapa]
Length=198

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 26/202 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+ +  G+ +++++ 
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSE-  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYD  427
             F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YFTC+ C         +D
Sbjct  60   MFQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFD  119

Query  428  LCISCYGNGKSGHNHP---FMDSYALLAVVKKRSD---VNQVTDDDDQSESYTAMRGIVP  589
            LC++CY   +  +NHP   F+DS+ LL    KRS    + +   D +  E +  M  +  
Sbjct  120  LCVNCY--MRRNYNHPHRVFLDSFVLLR--SKRSHPPMLQEPPGDQNMPEQHPGMFQMGW  175

Query  590  AEKYRKRMFALKALQATLEVAT  655
                     AL A++A   V +
Sbjct  176  CT-------ALSAMEAAFAVGS  190



>ref|XP_004296541.1| PREDICTED: uncharacterized protein LOC101310401 [Fragaria vesca 
subsp. vesca]
Length=218

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 94/196 (48%), Gaps = 19/196 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRY-MNTQR  268
            M+ELH  A AYY  G+ +L++ A   F S+D + DG++  +EF  F+ Q GY + +N   
Sbjct  3    MEELHAAALAYYDNGTQQLRDLAGSFFRSMDTNDDGKISCSEFNEFLQQSGYNWIINDPN  62

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG--CGRFIPATYFTCLQC--------P  418
            FF  LD +G+  LDF EV+T  YI K+    C G  CG  +   YFTC+ C         
Sbjct  63   FFKRLDRNGDGGLDFGEVLTFYYIIKTRYIRCQGYHCGVHLCGLYFTCVACFDGAHEHRS  122

Query  419  NYDLCISCYGNGKSGHNHP---FMDSYALLAVVKKRS-----DVNQVTDDDDQSESYTAM  574
             +DLC +CY N    H+     F+D++ LL   +  S     D+N           Y  +
Sbjct  123  TFDLCATCYRNRNYYHHQHHTYFLDNHVLLRSKRGLSPYAQPDLNMAITPPPPPAVYNNI  182

Query  575  RGIVPAEKYRKRMFAL  622
               + A   R   F +
Sbjct  183  NYYIAAAPERHSWFQV  198



>ref|XP_011091670.1| PREDICTED: uncharacterized protein LOC105172028 [Sesamum indicum]
Length=194

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ + ++A AYY   S E K  A+E F +LD +GDGRV     L      G  +++ +  
Sbjct  1    MEGMREIATAYYERASDEEKESAEEFFRNLDVNGDGRVS---LLELKRSVG-SWLSNENV  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATYFTCLQC-----PNYDLC  433
            F +LD +G+ TLDF+EV+ + Y+  K     C GC   +   YF+CL C       +DLC
Sbjct  57   FKQLDENGDGTLDFYEVLAVYYMVNKVNLLVCSGCWGLLVGPYFSCLLCLGKSPDTFDLC  116

Query  434  ISCYGNGKSGHNHP---FMDSYALLAVVKKRS  520
             +CY  G   H H     +D ++LLAV++ RS
Sbjct  117  CTCYRRGTVAHEHSSKYLLDHHSLLAVLRDRS  148



>ref|XP_009113945.1| PREDICTED: uncharacterized protein LOC103839202 isoform X3 [Brassica 
rapa]
Length=196

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (52%), Gaps = 22/199 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M ELH+ A AYY  GS + +  A + F S+D DG+GRV   E+  F+ +  G+ +++++ 
Sbjct  1    MQELHEAAIAYYNNGSTDQQTLAWQFFCSMDGDGNGRVSFREYTDFLCRTTGFAWVHSE-  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYD  427
             F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YFTC+ C         +D
Sbjct  60   MFQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTCVTCFESQCVGDTFD  119

Query  428  LCISCYGNGKSGHNHP---FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEK  598
            LC++CY   +  +NHP   F+DS+ LL   K+     +   D +  E +  M  +     
Sbjct  120  LCVNCY--MRRNYNHPHRVFLDSFVLLR-SKRSHPPMEPPGDQNMPEQHPGMFQMGWCT-  175

Query  599  YRKRMFALKALQATLEVAT  655
                  AL A++A   V +
Sbjct  176  ------ALSAMEAAFAVGS  188



>ref|XP_006388948.1| hypothetical protein POPTR_0068s00200g [Populus trichocarpa]
 gb|ERP47862.1| hypothetical protein POPTR_0068s00200g [Populus trichocarpa]
Length=195

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 75/153 (49%), Gaps = 12/153 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ + + A AYY     E K  A++ F ++D +GDG++   E+L ++             
Sbjct  3    MEGIRQAAVAYYEHLPEEKKKSAEDTFKAMDKNGDGKISLREYLGYLASSNNAVFTHPNI  62

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F+ LD D N  LDF E   L YI  SGR   C  CG F+   YF+C QC         YD
Sbjct  63   FSALDKDNNGNLDFEETKVLYYILFSGRALLCKCCGTFLADVYFSCFQCFCLDESASTYD  122

Query  428  LCISCYGNGKSGH--NHPFMDSYALLAVVKKRS  520
            LC  C+G  K  H   H F D+Y LL+  K RS
Sbjct  123  LCCDCFGGKKFRHLDGHIFWDNYTLLS--KSRS  153



>ref|XP_006371123.1| hypothetical protein POPTR_0019s04350g [Populus trichocarpa]
 gb|ERP48920.1| hypothetical protein POPTR_0019s04350g [Populus trichocarpa]
Length=199

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 84/164 (51%), Gaps = 20/164 (12%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M++  + A AYY     + K  A++ FN++D +GDG++   E++ ++ +        Q  
Sbjct  1    MEQTRRAAVAYYEHLPAKTKKLARKTFNAMDKNGDGQISLREYVDYLKKNKATDFTHQSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQC------PNYDL  430
            F  LD DGN +LDF E + L YI +SGR   C  C   +   YF+C QC        Y++
Sbjct  61   FTALDKDGNGSLDFEEAIVLYYIMQSGRAISCQSCKTLLAGAYFSCSQCFFNVSDSTYEI  120

Query  431  CISCYGNGKSGHNHP---FMDSYALL---------AVVKKRSDV  526
            C +CYG GK+  +H    F D+Y LL         A +KKR  V
Sbjct  121  CCACYG-GKNYTHHGDAIFCDNYTLLRQSRSVIQEAPIKKRRKV  163



>ref|XP_010428593.1| PREDICTED: uncharacterized protein LOC104713218 isoform X1 [Camelina 
sativa]
Length=200

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 97/204 (48%), Gaps = 28/204 (14%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFAEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD--------VNQVTDDDDQSESYTAMRGI  583
            C+ CY      H H  F+DS  LL    KR+D          Q  DD++QSE  + +   
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRA--KRNDPLQPPPQSPQQPPDDENQSEEESGI---  175

Query  584  VPAEKYRKRMFALKALQATLEVAT  655
                       ALKA++    V T
Sbjct  176  -------GWSGALKAMEVGFTVGT  192



>gb|EYU38469.1| hypothetical protein MIMGU_mgv1a0149542mg, partial [Erythranthe 
guttata]
Length=159

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 87/163 (53%), Gaps = 13/163 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ ++AKA Y   + E K  A++ F SLD D DG+V+  E+ S +     R    +  
Sbjct  1    MNEIRRVAKAQYLRATEEEKGAAKKFFQSLDGDCDGKVNLAEYKSLVR----RAYTHESL  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC-----PNYDLC  433
            FN LD +G+ +LDF EV+ L Y+ K G   CDG C  ++   YF+C  C       YDLC
Sbjct  57   FNCLDENGDGSLDFEEVLVLHYMQKCGMRICDGSCRGWLLGPYFSCTICEKNYPKTYDLC  116

Query  434  ISCYGNGKSGHNH---PFMDSYALLAVVKKRSDVNQVTDDDDQ  553
             +CY  GK  H+H    F+D  ++  ++ K     Q+   +D+
Sbjct  117  CTCYSGGKFKHDHSTTSFLDDRSMRMLLAKTMSTAQLGLPNDE  159



>ref|XP_006371125.1| hypothetical protein POPTR_0019s04370g, partial [Populus trichocarpa]
 gb|ERP48922.1| hypothetical protein POPTR_0019s04370g, partial [Populus trichocarpa]
Length=158

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 79/146 (54%), Gaps = 11/146 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYY     + K  A++ F ++D   DG++  +E++ ++ ++       Q  
Sbjct  1    MEEIRRAAVAYYENQPAKNKKLARKAFKAMDKSRDGKISLSEYVDYLKKKKASDFTHQSI  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDGCGRFIPATYFTCLQC------PNYDL  430
            F+ LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C QC        Y++
Sbjct  61   FSLLDKDGNGSLDFEEAIVLYYIMQSGRALICKSCNTFLAGAYFSCSQCFFNDSVSTYEI  120

Query  431  CISCYGNGKSGHNHP---FMDSYALL  499
            C  CYG GK+  +H    F D+Y LL
Sbjct  121  CCECYG-GKNFKHHDCAIFCDNYTLL  145



>ref|XP_006371126.1| hypothetical protein POPTR_0019s04380g, partial [Populus trichocarpa]
 gb|ERP48923.1| hypothetical protein POPTR_0019s04380g, partial [Populus trichocarpa]
Length=147

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 11/147 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ + + A  YY     E K  A+ +F+ +D + DG++D +E++ ++ +           
Sbjct  1    MEGIRRAAVTYYENLPEEKKRYARFIFDEMDENRDGQIDLDEYVEYLKKDNNTVFTDPSM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DG+ +LDF E +TL YI +SGR  FC  C  F+   YF+C QC         YD
Sbjct  61   FRALDKDGDGSLDFEETITLYYIMESGRALFCKTCNTFLAEVYFSCFQCFCLDESASTYD  120

Query  428  LCISCYGNGKSGHNHP---FMDSYALL  499
            LC  CYG  K   +H    F D+Y LL
Sbjct  121  LCCDCYGGKKFTDHHDDAIFCDNYTLL  147



>ref|XP_010471684.1| PREDICTED: uncharacterized protein LOC104751441 isoform X2 [Camelina 
sativa]
 ref|XP_010471687.1| PREDICTED: uncharacterized protein LOC104751443 isoform X2 [Camelina 
sativa]
Length=208

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD  523
            C+ CY      H H  F+DS  LL    KRS+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRA--KRSN  150



>ref|XP_010471683.1| PREDICTED: uncharacterized protein LOC104751441 isoform X1 [Camelina 
sativa]
 ref|XP_010471686.1| PREDICTED: uncharacterized protein LOC104751443 isoform X1 [Camelina 
sativa]
Length=209

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD  523
            C+ CY      H H  F+DS  LL    KRS+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRA--KRSN  150



>ref|XP_010428594.1| PREDICTED: uncharacterized protein LOC104713218 isoform X2 [Camelina 
sativa]
Length=199

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 75/144 (52%), Gaps = 8/144 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFAEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALL  499
            C+ CY      H H  F+DS  LL
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLL  144



>ref|XP_010471689.1| PREDICTED: uncharacterized protein LOC104751444 isoform X2 [Camelina 
sativa]
Length=192

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD  523
            C+ CY      H H  F+DS  LL    KRS+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRA--KRSN  150



>ref|XP_010471688.1| PREDICTED: uncharacterized protein LOC104751444 isoform X1 [Camelina 
sativa]
Length=193

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDL  430
            F  LD +G+  LDF EV+TL Y+ ++    CD C   +   YFTC+ C         +DL
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVARTHTVCCDVCLHALSGLYFTCVTCFESKCGDDTFDL  120

Query  431  CISCYGNGKSGHNHP-FMDSYALLAVVKKRSD  523
            C+ CY      H H  F+DS  LL    KRS+
Sbjct  121  CVKCYKRQAYSHPHRLFLDSNVLLRA--KRSN  150



>ref|XP_008224099.1| PREDICTED: uncharacterized protein LOC103323856 [Prunus mume]
Length=128

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+EL +   AY +     +K    E F  +D DG+ RV++ EFL++M   +  ++M+T  
Sbjct  1    MEELWQTVLAYCKDAPQHIKWSVDECFVEMDVDGNDRVNRQEFLAYMEIHEDCKHMSTCS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDG-CGRFIPATYFTCLQC  415
            FFNE   +    LDF +++ L+YI  SG+PFC+G CG FI  TYFTC++C
Sbjct  61   FFNEFKKEEKEGLDFMDMVILVYIIYSGKPFCNGHCGSFIKGTYFTCVKC  110



>emb|CDY36976.1| BnaC09g17920D [Brassica napus]
Length=155

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (55%), Gaps = 14/153 (9%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M EL++ A AYY  GS + +N A + F S+D DG+GRV   E+  F+ +        +  
Sbjct  1    MQELNEAAIAYYNNGSTDQQNLAWQFFLSMDGDGNGRVSFQEYTDFLCRTTGLAWVRREM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYF---TCLQ----CPNYDL  430
            F ELD + +  LDFWEV+TL Y+ ++    C  C + +   YF   TC +    C  +DL
Sbjct  61   FQELDRNRDGQLDFWEVLTLYYVARTRTIGCRTCLQPLIGLYFTFVTCFESQCVCDTFDL  120

Query  431  CISCYGNGKSGHNHP---FMDSYALLAVVKKRS  520
            C++CY   +  +NHP   F+DS+ LL    KRS
Sbjct  121  CVNCY--MRRNYNHPHRVFLDSFVLLR--SKRS  149



>ref|XP_011012576.1| PREDICTED: uncharacterized protein LOC105116792 [Populus euphratica]
Length=200

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M++  + A AYY     + K  A++ FN++D +GDG++   E++ ++ +        Q  
Sbjct  1    MEQTRRAAVAYYEHLPAKTKKLARKTFNAMDKNGDGQISLREYVDYLKKNKATDFTHQSL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC-------PNYD  427
            F  LD DGN +LDF E + L YI +SGR   C  C  F+   YF+C QC         Y+
Sbjct  61   FTALDKDGNGSLDFEEAIVLYYIMQSGRAIICQSCKTFLAGAYFSCSQCFFNNDSGSTYE  120

Query  428  LCISCYGNGKSGHNHP---FMDSYALL---------AVVKKRSDV  526
            +  +CYG GK+  +H    F D+Y LL         A +KKR  V
Sbjct  121  IFCACYG-GKNFTHHGDAIFCDNYTLLRQSRSVIQEAPIKKRRKV  164



>gb|AIU48193.1| MSH1, partial [Fragaria vesca]
Length=1398

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 7/123 (6%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRY-MNT  262
             ++++LH  A AYY  GSPEL+  A   F S+D +GD R+  +EF  F+ Q G+++ +N 
Sbjct  1    MEIEQLHPAALAYYEHGSPELQRLAWSFFQSMDTNGDQRISYSEFSDFLEQTGHKWILND  60

Query  263  QRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNY  424
              FF +LD + +  LDF EV+T  YI K+    C GC  ++   YFTC+ C        Y
Sbjct  61   PNFFKKLDRNRDGGLDFEEVLTFYYIIKTRCVICRGCSVYLCGLYFTCVACFDGADHKTY  120

Query  425  DLC  433
            DLC
Sbjct  121  DLC  123



>ref|XP_004297941.1| PREDICTED: DNA mismatch repair protein MSH1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=1279

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRY-MNT  262
             ++++LH  A AYY  GSPEL+  A   F S+D +GD R+  +EF  F+ Q G+++ +N 
Sbjct  1    MEIEQLHPAALAYYEHGSPELQRLAWSFFQSMDTNGDQRISYSEFSDFLEQTGHKWILND  60

Query  263  QRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC------PNY  424
              FF +LD + +  LDF EV+T  YI K+    C GC  ++   YFTC+ C        Y
Sbjct  61   PNFFKKLDRNRDGGLDFEEVLTFYYIIKTRCVICRGCSVYLCGLYFTCVACFDGADHKTY  120

Query  425  DLCIS  439
            DLC +
Sbjct  121  DLCAA  125



>ref|XP_006371135.1| hypothetical protein POPTR_0019s04460g [Populus trichocarpa]
 gb|ERP48932.1| hypothetical protein POPTR_0019s04460g [Populus trichocarpa]
Length=182

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 76/145 (52%), Gaps = 9/145 (6%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+ + + A+AYY       +  A + FN +D + DG++   E++ ++ ++       Q  
Sbjct  9    MEGIRRAARAYYDHLPDGERKNATKDFNDMDKNRDGKISLLEYVDYLKKKKATSFVQQSI  68

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRP-FCDGCGRFIPATYFTCLQC------PNYDL  430
            F  LD D N TLDF E + L Y+ KSGR   C GC +F+   YF+C QC        Y++
Sbjct  69   FRALDKDDNGTLDFEEAIVLFYLMKSGRAIICKGCEKFLAGAYFSCSQCFFNVSVSTYEI  128

Query  431  CISCY-GNGKSGHNHP-FMDSYALL  499
            C +CY GN  + H    F D+Y LL
Sbjct  129  CCACYRGNNFTHHGDAIFCDNYTLL  153



>ref|XP_010110690.1| hypothetical protein L484_009718 [Morus notabilis]
 gb|EXC27694.1| hypothetical protein L484_009718 [Morus notabilis]
Length=116

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL   A+AYY   S +L+N A   F S+D +GDG +   EF  F+   GY ++N    
Sbjct  1    MEELRLAARAYYNNSSSDLQNLAINFFRSMDTNGDGWISFQEFTRFLMDNGYNWVNPN-M  59

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC  415
            F++LDT+ +  LDFWEV+T  YI K+    C+ C   +   +FTC+ C
Sbjct  60   FSQLDTNLDGGLDFWEVLTFYYIIKTRGVLCNACYAPLHGLHFTCVAC  107



>ref|XP_009341628.1| PREDICTED: uncharacterized protein LOC103933660 [Pyrus x bretschneideri]
 ref|XP_009341629.1| PREDICTED: uncharacterized protein LOC103933660 [Pyrus x bretschneideri]
Length=214

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 101/215 (47%), Gaps = 52/215 (24%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQ-QGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGR  355
            +D DG+ RV   EF  +M + +  +++    FF EL  +G+  LDF +VMTL YI  SG+
Sbjct  1    MDVDGNDRVSFQEFTEYMERYEDCKHLCNSLFFEELKKEGHEELDFVDVMTLFYIVYSGK  60

Query  356  PFCDG-CGRFIPATYFTCLQC---------PNYDLCISCYGNGKSGHNH-PFMDSYALLA  502
            PFC+G C +FI   YFTC++C           +++C SCY + K  H+H   +DS+ LL 
Sbjct  61   PFCNGQCKKFIKGVYFTCVKCFDDYATYATNTFNVCPSCYADSKYVHDHDTLLDSFLLLQ  120

Query  503  VVKKRSDVNQ----VTDDD------------------------------DQSESYTAMRG  580
              K+ + +NQ    VT++                                 S++  AM  
Sbjct  121  -SKRMTALNQQAASVTNESKALEYGTTLETSNSSSPTPPAPRPLTPHAPSSSDTSNAMVL  179

Query  581  IVPAEKYRKRMFALKALQATLEV-----ATNCNTM  670
            + P+ K R    ALK ++  L +     AT C  M
Sbjct  180  VNPSPKNRAGRKALKTIEVLLALGNIFAATQCTIM  214



>gb|EYU38474.1| hypothetical protein MIMGU_mgv11b018110mg [Erythranthe guttata]
Length=148

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 10/133 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M ++HK+AKAYY   + E + +A+  F SLD + DG++   E+ + ++    R       
Sbjct  1    MADIHKIAKAYYARATEEEREKAKNYFRSLDANCDGKISFAEYKTMVS----RRCANDTM  56

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATYFTCLQC----PN-YDLC  433
            FN +D +G+ +LD  EV+ L +I  K     C+ CG  I   YF+ L C    PN Y+LC
Sbjct  57   FNAIDKNGDGSLDIEEVLALYFILMKCPLRSCNACGSSISGAYFSYLPCEKNDPNTYELC  116

Query  434  ISCYGNGKSGHNH  472
             SCYG GK  H+H
Sbjct  117  CSCYGGGKFEHHH  129



>gb|KDP33330.1| hypothetical protein JCGZ_12879 [Jatropha curcas]
Length=195

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 100/202 (50%), Gaps = 16/202 (8%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++   A AYYR   P  K   +  F++LD  G G+V   ++  +  Q+G   +     
Sbjct  1    MEKIRLDASAYYRNLPPAEKQRVKIGFSALDKTGSGKVSLKQYSEYFKQRGLVELTYPYL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATYFTCLQCPN------YDL  430
            F  LDT+G+  LDF E +T+ Y+  + +  FC+ CG F+  +Y +CLQC +      Y++
Sbjct  61   FKALDTNGDGRLDFNEYITVYYLCMNNKMIFCEECGVFLSGSYMSCLQCFDNDSGDPYNI  120

Query  431  CISCYGNGKSGHNH--PFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVPAEKYR  604
            C  CY      H+    F+D   L  +  K S       D++ S + ++   I   +K R
Sbjct  121  CYDCYNRNNIDHHKDATFVDDIKLQCLAVKGS------ADNNGSTTRSSGGKITTRDKLR  174

Query  605  KRMFALKALQATLEVATNCNTM  670
              +  + A++  + VA++C+ M
Sbjct  175  TALLVVSAVKLGV-VASSCSVM  195



>ref|XP_004296539.1| PREDICTED: uncharacterized protein LOC101309628 [Fragaria vesca 
subsp. vesca]
Length=224

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (54%), Gaps = 15/151 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQ-GYRYMNTQR  268
            M+E+ + A AYY     +L+  A   F  +D++G+G +   EF + M        +  +R
Sbjct  1    MEEIREAALAYYHNLPEDLQKLASAKFKEIDSNGNGTISLREFKNSMRSSFDNDSVIMKR  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGR--PFC--DGC---GRFIPATYFTCLQC----  415
             F ELD +G+  LDF E +TL Y+ +SGR   +C  DGC     F+   YFTC+ C    
Sbjct  61   SFKELDKNGDGKLDFNEYITLYYLLESGRLLIYCAGDGCEDDAPFLKGHYFTCVDCFHHN  120

Query  416  --PNYDLCISCYGNGKSGHNHP-FMDSYALL  499
                +DLC SCY NGK  H H  F+D++ LL
Sbjct  121  ENETFDLCTSCYRNGKFAHEHTNFLDNHVLL  151



>gb|KCW46930.1| hypothetical protein EUGRSUZ_K00744 [Eucalyptus grandis]
Length=147

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = +2

Query  104  HKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNEL  283
            H L+ AY  A +  +K  AQ+    +D+D +G V  +EFLSF   +GY          EL
Sbjct  5    HILSMAYLDAATENVKQLAQDFVTEMDHDRNGVVCLSEFLSFTKVKGY----------EL  54

Query  284  DTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDLCISC  442
            +  G   L F E +T+ YI  S RP CDGC    P  +FTC++C         ++LC  C
Sbjct  55   NACGTGKLSFDEAITVFYIATSARPLCDGCRCLTPGMFFTCVKCFKDTGEAETFNLCSDC  114

Query  443  YGNGKSGHNH  472
            + +G   H H
Sbjct  115  FSHGNHTHPH  124



>ref|XP_010243843.1| PREDICTED: uncharacterized protein LOC104587812 isoform X5 [Nelumbo 
nucifera]
Length=911

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF +F +  G      + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
            F  ELD DG+  LD+ +   +LY     R  C  C RFI   Y+TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDA-KVLYYMDLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALL  499
             + LC++CY  G+  H H F+D+YALL
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALL  834


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 83/171 (49%), Gaps = 17/171 (10%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF +F +  G   +  + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   Y++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALLA-VVKKRSDVNQVTDDDDQSESYT  568
             Y+LC SCY  G+  H H F+D+Y  L  ++   ++ N++    +++E +T
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMILSAPTNENKIATLQEENEVFT  646


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF--FNELDTDGN  298
            Y+  S E K    + F  LD++ DG++   E  +F++++GY     Q+F    ELD DG+
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGY---TGQKFKSLAELDKDGD  388

Query  299  HTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNYDLCISCYGN  451
              LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +
Sbjct  389  GYLDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHS  447

Query  452  GKSGHNHP-FMDSYALL  499
            GK  H H  F D+Y +L
Sbjct  448  GKFVHEHSTFWDNYEML  464


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     ++   R    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSES--RSQRKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATYFTCLQCPN-------  421
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C +       
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  422  ---YDLCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
               Y+LC++CY + +  H+H  F+D+Y  L + K+     ++ D     ES+ A+   + 
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKRNQMAKKLKDRKKSRESHEALEAALA  175


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 21/145 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F          + N+ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   +++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYGNGKSGHNH-PFMDSYALL  499
            LC++CY   K  H H  F D+Y LL
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLL  302



>ref|XP_010243839.1| PREDICTED: uncharacterized protein LOC104587812 isoform X1 [Nelumbo 
nucifera]
Length=995

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF +F +  G      + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   Y+TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALL  499
             + LC++CY  G+  H H F+D+YALL
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALL  834


 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 83/171 (49%), Gaps = 17/171 (10%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF +F +  G   +  + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   Y++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALLA-VVKKRSDVNQVTDDDDQSESYT  568
             Y+LC SCY  G+  H H F+D+Y  L  ++   ++ N++    +++E +T
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMILSAPTNENKIATLQEENEVFT  646


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF--FNELDTDGN  298
            Y+  S E K    + F  LD++ DG++   E  +F++++GY     Q+F    ELD DG+
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGY---TGQKFKSLAELDKDGD  388

Query  299  HTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNYDLCISCYGN  451
              LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +
Sbjct  389  GYLDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHS  447

Query  452  GKSGHNHP-FMDSYALL  499
            GK  H H  F D+Y +L
Sbjct  448  GKFVHEHSTFWDNYEML  464


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     ++   R    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSES--RSQRKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATYFTCLQCPN-------  421
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C +       
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  422  ---YDLCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
               Y+LC++CY + +  H+H  F+D+Y  L + K+     ++ D     ES+ A+   + 
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKRNQMAKKLKDRKKSRESHEALEAALA  175


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 21/145 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F          + N+ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   +++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYGNGKSGHNH-PFMDSYALL  499
            LC++CY   K  H H  F D+Y LL
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLL  302



>ref|XP_010243840.1| PREDICTED: uncharacterized protein LOC104587812 isoform X2 [Nelumbo 
nucifera]
Length=994

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF +F +  G      + 
Sbjct  689  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  748

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   Y+TC++C           
Sbjct  749  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  806

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALL  499
             + LC++CY  G+  H H F+D+YALL
Sbjct  807  THSLCLACYDTGRVNHPHVFLDNYALL  833


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 83/171 (49%), Gaps = 17/171 (10%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF +F +  G   +  + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   Y++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALLA-VVKKRSDVNQVTDDDDQSESYT  568
             Y+LC SCY  G+  H H F+D+Y  L  ++   ++ N++    +++E +T
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMILSAPTNENKIATLQEENEVFT  646


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF--FNELDTDGN  298
            Y+  S E K    + F  LD++ DG++   E  +F++++GY     Q+F    ELD DG+
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGY---TGQKFKSLAELDKDGD  388

Query  299  HTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNYDLCISCYGN  451
              LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +
Sbjct  389  GYLDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHS  447

Query  452  GKSGHNHP-FMDSYALL  499
            GK  H H  F D+Y +L
Sbjct  448  GKFVHEHSTFWDNYEML  464


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     ++   R    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSES--RSQRKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATYFTCLQCPN-------  421
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C +       
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  422  ---YDLCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
               Y+LC++CY + +  H+H  F+D+Y  L + K+     ++ D     ES+ A+   + 
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKRNQMAKKLKDRKKSRESHEALEAALA  175


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 21/145 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F          + N+ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   +++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYGNGKSGHNH-PFMDSYALL  499
            LC++CY   K  H H  F D+Y LL
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLL  302



>ref|XP_010243842.1| PREDICTED: uncharacterized protein LOC104587812 isoform X4 [Nelumbo 
nucifera]
Length=990

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF +F +  G      + 
Sbjct  685  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  744

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   Y+TC++C           
Sbjct  745  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  802

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALL  499
             + LC++CY  G+  H H F+D+YALL
Sbjct  803  THSLCLACYDTGRVNHPHVFLDNYALL  829


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 16/150 (11%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF +F +  G   +  + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   Y++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALLAVV  508
             Y+LC SCY  G+  H H F+D+Y  L ++
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMI  625


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF--FNELDTDGN  298
            Y+  S E K    + F  LD++ DG++   E  +F++++GY     Q+F    ELD DG+
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGY---TGQKFKSLAELDKDGD  388

Query  299  HTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNYDLCISCYGN  451
              LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +
Sbjct  389  GYLDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHS  447

Query  452  GKSGHNHP-FMDSYALL  499
            GK  H H  F D+Y +L
Sbjct  448  GKFVHEHSTFWDNYEML  464


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     ++   R    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSES--RSQRKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATYFTCLQCPN-------  421
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C +       
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  422  ---YDLCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
               Y+LC++CY + +  H+H  F+D+Y  L + K+     ++ D     ES+ A+   + 
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKRNQMAKKLKDRKKSRESHEALEAALA  175


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 21/145 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F          + N+ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   +++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYGNGKSGHNH-PFMDSYALL  499
            LC++CY   K  H H  F D+Y LL
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLL  302



>ref|XP_010243841.1| PREDICTED: uncharacterized protein LOC104587812 isoform X3 [Nelumbo 
nucifera]
Length=990

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            ++DE+ + A  YY + S E K     +F +LD + DG+V   EF +F +  G      + 
Sbjct  690  EIDEIREAAAIYYNSCSNEEKQRVLSMFVTLDTNNDGKVSYEEFEAFPSSVGLLKPAIED  749

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
            F  ELD DG+  LD+ +   L Y+    R  C  C RFI   Y+TC++C           
Sbjct  750  FM-ELDRDGDGYLDYQDAKVLYYM-DLTREICQVCRRFIKGMYYTCVECFDHKGRLGERK  807

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALL  499
             + LC++CY  G+  H H F+D+YALL
Sbjct  808  THSLCLACYDTGRVNHPHVFLDNYALL  834


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 83/171 (49%), Gaps = 17/171 (10%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +MDE+   A AYY         E ++ F  LD D  G+V   EF +F +  G   +  + 
Sbjct  482  EMDEIRVAAAAYYENCPKGEIQEVEKTFRDLDADSKGKVSFKEFDAFYSATG---VTDEL  538

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC----------P  418
             +  LD DG+  LD  + +   YI K+ R  C  C  FI   Y++C++C           
Sbjct  539  VY--LDRDGDGYLDLQDAIVYYYIDKT-RARCQVCKHFINGMYYSCIECFGQKGSFGDRK  595

Query  419  NYDLCISCYGNGKSGHNHPFMDSYALLA-VVKKRSDVNQVTDDDDQSESYT  568
             Y+LC SCY  G+  H H F+D+Y  L  ++   ++ N++    +++E +T
Sbjct  596  TYNLCFSCYPTGRLDHPHFFLDNYTFLQMILSAPTNENKIATLQEENEVFT  646


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 16/137 (12%)
 Frame = +2

Query  125  YRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF--FNELDTDGN  298
            Y+  S E K    + F  LD++ DG++   E  +F++++GY     Q+F    ELD DG+
Sbjct  332  YKNCSDERKEARMKTFRDLDSNSDGKISYEELKAFLSEEGY---TGQKFKSLAELDKDGD  388

Query  299  HTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNYDLCISCYGN  451
              LD W+   L Y+    R  C  CG FI    ++C +C          NY +C +CY +
Sbjct  389  GYLDQWDFNVLQYMIDK-RVSCKVCGLFIKGLCYSCAECMNKWISKSGDNYYVCPACYHS  447

Query  452  GKSGHNHP-FMDSYALL  499
            GK  H H  F D+Y +L
Sbjct  448  GKFVHEHSTFWDNYEML  464


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 19/180 (11%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+   A A Y   S E KN   E F SL +  DG+    E     ++   R    +  
Sbjct  1    MEEVRAAALAAYSDYSSEEKNLVVEAFKSLASYKDGKASCKELADLFSES--RSQRKEEI  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCG---RFIPATYFTCLQCPN-------  421
            F  +D DG+  L+ ++ +TL Y F  G   CD CG          ++C++C +       
Sbjct  59   FAGVDRDGDGYLNLYDFITLAYTF-YGTFSCDECGDRNMVTKGMSYSCVECIDLRNSNDD  117

Query  422  ---YDLCISCYGNGKSGHNHP-FMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMRGIVP  589
               Y+LC++CY + +  H+H  F+D+Y  L + K+     ++ D     ES+ A+   + 
Sbjct  118  NRSYNLCVTCYKSKQFSHHHSFFLDNY--LQLQKRNQMAKKLKDRKKSRESHEALEAALA  175


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 21/145 (14%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A AYY A S E K   ++ F  LD D DGRV   +F          + N+ R   
Sbjct  168  EALEAALAYYDACSNEEKELLEKGFMQLDFDNDGRVSSKDF------NASPFANSGRGIK  221

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN----------YD  427
             LD   N+ +DF   +  +Y  +  +  C+ C  +I   +++C++C +          YD
Sbjct  222  LLD---NYYMDFKTFIKSIYR-RDSKGCCEHCNLYIDGMFYSCVECFDRWDSSGKHCRYD  277

Query  428  LCISCYGNGKSGHNH-PFMDSYALL  499
            LC++CY   K  H H  F D+Y LL
Sbjct  278  LCVNCYRTRKFVHPHSSFFDNYVLL  302



>gb|EYU17886.1| hypothetical protein MIMGU_mgv1a0207622mg, partial [Erythranthe 
guttata]
Length=125

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 13/126 (10%)
 Frame = +2

Query  149  KNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMT  328
            + E QE+F SLD D DG+V+  E+ S +     R    +  FN LD + + +LDF EV+ 
Sbjct  1    RKERQEIFQSLDGDCDGKVNLAEYKSLVL----RAYTHESLFNCLDENSDGSLDFEEVLV  56

Query  329  LLYIFKSGRPFCDG-CGRFIPATYFTCLQC-----PNYDLCISCYGNGKSGHNHP---FM  481
            L Y+ K G   CDG C  ++   YF+C  C       YDLC +CY  GK  H+HP   F+
Sbjct  57   LHYMQKCGMRICDGSCHGWLLGPYFSCTICEKNYPKTYDLCCTCYSGGKFKHDHPTTSFL  116

Query  482  DSYALL  499
            D  ++L
Sbjct  117  DDRSIL  122



>ref|XP_010274596.1| PREDICTED: uncharacterized protein LOC104609874 isoform X2 [Nelumbo 
nucifera]
Length=187

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 96/215 (45%), Gaps = 48/215 (22%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLS-FMTQQGYRYMNT  262
             +++++ K+A AYY+  S E K  A++LF  +D DGDG+V  NEF   FM  +G      
Sbjct  1    MELEQIRKVALAYYQGSSDETKQHAEKLFKKMDADGDGKVSFNEFSDFFMKSKGLTV--P  58

Query  263  QRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPNYDLCISC  442
            +  F ELD DGN  +D  E + L YI ++ R  CDGCG  I A       C         
Sbjct  59   KLCFEELDKDGNGFMDLEESIVLFYIIQTRRISCDGCGSLIKAG------CE--------  104

Query  443  YGNGKSGHNHPFMDSYALLAVVKKRSDVNQVTDDDDQSESYTAMR---------------  577
                   HN   +D+YALL  +K   ++ +     D+SE                     
Sbjct  105  -------HN-TLVDNYALLQDIKATLNMEKA----DKSEELLGENIGEELIDRAWDIFGE  152

Query  578  --GIVPA--EKYRKRMFALKALQATLEVATNCNTM  670
              GI+ A  E       A + L   ++VATNC+ M
Sbjct  153  DIGILDAAGEAVEAGNAAGEILLNAIDVATNCSIM  187



>gb|KCW54062.1| hypothetical protein EUGRSUZ_I00042 [Eucalyptus grandis]
Length=103

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M++L   AK Y+ A +  +K  AQ+    +D+D DG V  +EFLSF   +GY  M+    
Sbjct  1    MEDLQ--AKVYFDAAAENVKRLAQDFVTEMDHDCDGVVCLSEFLSFTKIKGYGRMSNPYL  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFT  403
            F EL+  G   L F E +T  YI  S RP CDGCG      +FT
Sbjct  59   FKELNASGTGKLSFDEAITFFYIAMSARPLCDGCGCLALGMFFT  102



>gb|EYU32602.1| hypothetical protein MIMGU_mgv1a022976mg, partial [Erythranthe 
guttata]
Length=94

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = +2

Query  278  ELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPN-----YDLCISC  442
            ELD++GN +LDFWEV+TL YI KSGRP    CG  +  T+F+C++C +     Y LCI C
Sbjct  1    ELDSNGNGSLDFWEVLTLYYIVKSGRPL---CGILVTGTFFSCVECFDSPTGAYSLCIYC  57

Query  443  YGNGKSGHNH  472
            Y + KS HNH
Sbjct  58   YRSNKSDHNH  67



>ref|XP_011011800.1| PREDICTED: uncharacterized protein LOC105116248 isoform X3 [Populus 
euphratica]
Length=170

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 75/167 (45%), Gaps = 31/167 (19%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            +D +GDG++   E++ ++ +        Q  F+ LD D N +LDF E   L YI +SGR 
Sbjct  1    MDKNGDGKISVREYVDYLNENKATDFTHQSIFSALDKDSNGSLDFDEATVLYYIMQSGRA  60

Query  359  -FCDGCGRFIPATYFTCLQC------PNYDLCISCYGNGKSGHNHP--FMDSYALLAVVK  511
              C  C  F+   YF+C +C        Y++C  CYG+ K  H+    F D+Y LL    
Sbjct  61   IICQSCKTFLAGAYFSCSECFFNDSVSTYEICCECYGDKKFTHHDGAIFCDNYTLLC---  117

Query  512  KRSDVNQVTDDDDQSESYTAMRGIVPAEKYRKRMFALKALQATLEVA  652
                         QS S T       A   +K+   L  ++  L+VA
Sbjct  118  -------------QSRSAT------QAAPIQKQTMVLNVVKKGLQVA  145



>ref|XP_004296537.1| PREDICTED: uncharacterized protein LOC101308274 [Fragaria vesca 
subsp. vesca]
Length=210

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 85/189 (45%), Gaps = 25/189 (13%)
 Frame = +2

Query  158  AQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLY  337
            A+  F+ +D+D +GR+   E+   +   G         FN +D +G+  LD+WE +TL Y
Sbjct  2    AKTTFDKMDSDRNGRISLEEYRKHLANPGESTQMKSSSFNVVDKNGDGKLDYWEFITLYY  61

Query  338  IFKSGRPFC----DGC--GRFIPATYFTCLQC------PN-YDLCISCYGNGKSGHNHP-  475
            + KSGR  C     GC  G F+   YFTC+ C      P  + LC SCY N +  H H  
Sbjct  62   LDKSGRLNCWCNGHGCKNGTFLSGLYFTCVTCFSSSTEPELFYLCWSCYRNRRYTHKHDN  121

Query  476  FMDSYALLAV--------VKKRSDVN---QVTDDDDQSESYTAMRGIVPAEKYRKRMFAL  622
            F+D+Y  L +           +S V+     ++ + QS + T      P +K R     L
Sbjct  122  FLDNYTFLQMKIAPCIPAATPKSQVSGQTSTSNTESQSSNETPSSSNNPKKKARSGTQTL  181

Query  623  KALQATLEV  649
                  L +
Sbjct  182  ANYSKALNI  190



>ref|XP_007206780.1| hypothetical protein PRUPE_ppa025480mg [Prunus persica]
 gb|EMJ07979.1| hypothetical protein PRUPE_ppa025480mg [Prunus persica]
Length=84

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYM-NTQR  268
            M+ELH  A AYY  GSPE +  A   F S+D + DGR+   EF  F+ Q GY ++ N   
Sbjct  1    MEELHAAALAYYSNGSPERQRLAWSFFQSMDTNNDGRISSAEFYEFLQQSGYSWIVNDPS  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYI  340
            FF +LD + +  LDF+EV+T + I
Sbjct  61   FFTKLDRNRDGGLDFYEVLTYIVI  84



>gb|KDO52253.1| hypothetical protein CISIN_1g044607mg [Citrus sinensis]
Length=110

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 9/108 (8%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNT---QR  268
            E H  A   Y   + E++N A+  FNS+D +GDGR+ ++EFL F+     ++ NT   Q 
Sbjct  4    EFHDSAIICYNNATGEVQNLAKNFFNSMDTNGDGRISRSEFLQFLG----KFNNTQWIQE  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCD--GCGRFIPATYFTC  406
             F  +D +G+ +LDF E +T  Y   + R  CD  GC  ++   YFTC
Sbjct  60   LFQSIDQNGDGSLDFVEFLTPFYFVSNWRVKCDGLGCNTWLQGLYFTC  107



>gb|KCW52370.1| hypothetical protein EUGRSUZ_J01776 [Eucalyptus grandis]
Length=103

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 0/97 (0%)
 Frame = +2

Query  113  AKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTD  292
            AKAY+ A +  +K  AQ+    +D+D D  +  +EFLSF   +G   ++    F EL+  
Sbjct  6    AKAYFDAAAENVKRLAQDFVTEMDHDHDSVMCLSEFLSFTKIKGDGRISNPYLFKELNAS  65

Query  293  GNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFT  403
            G   L F E +T  YI  S RP CDGCG      +FT
Sbjct  66   GTGKLSFDEAITFFYIAMSARPLCDGCGCLALGMFFT  102



>gb|EYU43763.1| hypothetical protein MIMGU_mgv1a018413mg [Erythranthe guttata]
Length=176

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 9/125 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MD + ++A++YY   S + K   QE F  LD D DG+V + E     T      ++    
Sbjct  1    MDGMREIARSYYSRASEDDKKSIQEFFEKLDVDRDGKVSRPELKRSATVSA--CLSADNV  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIF-KSGRPFCDGCGRFIPATYFTCLQCP------NYDL  430
            F +LD +G+  LDF E   L Y+  K   P C GC   +   YF+C +C        YDL
Sbjct  59   FQKLDVNGDGVLDFDEAKCLYYMVNKVKIPRCCGCYDLLVGPYFSCSRCAGKSPLQRYDL  118

Query  431  CISCY  445
            C +CY
Sbjct  119  CCACY  123



>ref|XP_002522873.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF39571.1| calcium ion binding protein, putative [Ricinus communis]
Length=172

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 12/161 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDE+ K A AY+  G+ E K         LD+  DG +   +F  F+ ++G+  + +   
Sbjct  1    MDEILKAALAYFEFGNHEFKKGTLHFLEMLDHCTDGTI--GQFEEFLRERGHEPL-SPGI  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
              EL    +  L F + + LLY+ K+ RP CD C  F+   YFTC  C       +++C+
Sbjct  58   LKELGKKLDDHLGFNDFLVLLYVVKTRRPCCDLCQAFLKGLYFTCAVCFDEEEKTFNMCL  117

Query  437  SCYGNGKS---GHNHPFMDSYALLAVVKKRSDVNQVTDDDD  550
             C    K+   GH   F+D++ALL    K  ++  V+   D
Sbjct  118  DCTSKQKTCPQGHA-LFIDNFALLHSKSKAIELQLVSCSSD  157



>gb|KDP33332.1| hypothetical protein JCGZ_12881 [Jatropha curcas]
Length=124

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ + A AYYR  +   K  A   FN +D  G+G +    +  +  Q+G   +    F
Sbjct  1    MEEIRQAASAYYRNLATADKQMAINGFNLMDKTGNGTISLRRYSEYFKQRGLIELTYPEF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATYFTCLQCPN  421
            F  LD+DG+  LDF E +T+ Y+  + +  FC+ C  F+  +Y +CLQC N
Sbjct  61   FKALDSDGDDRLDFDEFITVYYLCMNNKLIFCEECMVFLSGSYMSCLQCFN  111



>gb|KDP33329.1| hypothetical protein JCGZ_12878 [Jatropha curcas]
Length=277

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 6/124 (5%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++   A AYYR  +   K  A   FN +D  G+G++    +  +  Q+G   +    F
Sbjct  1    MEKIRLDASAYYRNLATADKQMAINGFNLMDKTGNGKISLRRYSEYFKQRGLVELTYPEF  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGR-PFCDGCGRFIPATYFTCLQCPN-----YDLC  433
            F  LD++G+  LDF E +T+ Y+  + +  FC+ C  F+  +Y +CLQC N     Y++C
Sbjct  61   FKALDSNGDDRLDFDEFITVYYLCMNNKLIFCEECMVFLSGSYMSCLQCFNSGSEPYNVC  120

Query  434  ISCY  445
             +CY
Sbjct  121  CACY  124



>gb|EYU38472.1| hypothetical protein MIMGU_mgv1a025022mg, partial [Erythranthe 
guttata]
Length=134

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 78/142 (55%), Gaps = 23/142 (16%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTL-----LYIF  343
            +D +  G+V  +E+ + ++Q   RY N  + FN  D +G+  LD  EV+ L     +Y+ 
Sbjct  1    MDVNCKGKVSFDEYKTIVSQ---RYAN-DKMFNSFDRNGDGNLDLEEVLVLHFVHNIYVM  56

Query  344  KSGRPFCDGCGRFIPATYFTCLQC----PN-YDLCISCYGNGKSGHNHP---FMDSYALL  499
            +    +C  C   +P  +F+CL C    PN +DLC SCYG GK  H+HP   F+D++++ 
Sbjct  57   R----WCSACTGSLPGLHFSCLTCEKNEPNTFDLCCSCYGEGKFEHHHPTSDFLDNHSMR  112

Query  500  AVVKKRSDVNQV--TDDDDQSE  559
             ++  + +  Q+   ++D Q E
Sbjct  113  NLLAPKMNTPQLRSPNNDHQDE  134



>ref|XP_006420377.1| hypothetical protein CICLE_v10006956mg, partial [Citrus clementina]
 gb|ESR33617.1| hypothetical protein CICLE_v10006956mg, partial [Citrus clementina]
Length=105

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNT---QR  268
            E H  A   Y   + E++N A+  FNS+D +GDGR+ ++EFL F+     ++ NT   Q 
Sbjct  4    EFHDSAIICYNNATGEVQNLAKNFFNSMDTNGDGRISRSEFLQFLG----KFNNTQWIQE  59

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRPFCD--GCGRFIPATYF  400
             F  +D +G+ +LDF E +T  Y   + R  CD  GC  ++   YF
Sbjct  60   LFQSIDQNGDGSLDFVEFLTPFYFVSNWRVKCDGLGCNTWLQGLYF  105



>ref|XP_002527293.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF35137.1| calcium ion binding protein, putative [Ricinus communis]
Length=225

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 10/143 (7%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+E+ K A AY+  GS E K         LD   +G +   +F  F+ ++G+  ++    
Sbjct  1    MEEILKAALAYFELGSHEFKTGTLRFLQMLDQCTNGTI--GQFDEFLRERGHEPLSPS-I  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-----PNYDLCI  436
               L    +  + F + + L+YI K+ RP CD C  F+   YFTC  C       ++LC+
Sbjct  58   LTALGKKPDDHIGFNDFLILMYIIKTRRPCCDLCQAFLKGLYFTCAVCFETEEKTFNLCL  117

Query  437  SCYGNGKSG-HNHPFM-DSYALL  499
             C    K+  H H  + D++A+L
Sbjct  118  CCISKQKNCLHGHGLLVDNFAML  140



>ref|XP_010474353.1| PREDICTED: 16 kDa calcium-binding protein-like [Camelina sativa]
Length=101

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL + A AYY  G+ E KN A++ F ++D DG+GRV   E+  F+ +           
Sbjct  1    MEELREAAVAYYNNGTEEQKNLARQFFRAMDVDGNGRVSLREYTDFLGKTAGLASFHPEM  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKS  349
            F  LD +G+  LDF EV+TL Y+ ++
Sbjct  61   FPTLDQNGDGQLDFTEVLTLYYVART  86



>ref|XP_002528342.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF34014.1| calcium ion binding protein, putative [Ricinus communis]
Length=140

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFM-TQQGYRYMNTQR  268
            M+E+ + A AYY   S   K  A++ F ++D DGDG++   E+  ++ T++G++ + +  
Sbjct  1    MEEISETAIAYYANLSSREKRLAKKFFQAMDTDGDGKISFEEYEQYIKTRKGFKTITSPD  60

Query  269  FFNELDTDGNHTLDFWEVMTLLYI  340
            FF +LD DGN TL F E +TL Y+
Sbjct  61   FFKKLDKDGNGTLSFDEFITLHYV  84



>gb|EYU38323.1| hypothetical protein MIMGU_mgv1a025498mg [Erythranthe guttata]
Length=100

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MD+L ++AKAY+   + E K + +  F SLD++GDG++ + +  S    Q + +      
Sbjct  1    MDDLREVAKAYHGRATNEEKEKTKNYFRSLDSNGDGKISRADIKSDPALQRFTH---DSL  57

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPAT  394
            F+ LD + N TLDF E +TL Y+ K G  +C  C  ++  +
Sbjct  58   FDCLDENNNGTLDFQEFLTLDYMRKCGMRWCKSCSDWLIGS  98



>ref|XP_011091669.1| PREDICTED: uncharacterized protein LOC105172027 [Sesamum indicum]
Length=144

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +2

Query  107  KLAKAYYRAGSPE-LKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNEL  283
            + A+A+Y  GSPE L+  A   F +++ +GDGRV  +EFL+FM  +GY  M +  FFNEL
Sbjct  78   RSARAHYCTGSPEALQALAYVFFETMNRNGDGRVVLSEFLTFMQHEGYSQMRSPYFFNEL  137

Query  284  DTDGN  298
            D DGN
Sbjct  138  DLDGN  142



>ref|XP_010062355.1| PREDICTED: uncharacterized protein LOC104449789 [Eucalyptus grandis]
 gb|KCW69483.1| hypothetical protein EUGRSUZ_F02936 [Eucalyptus grandis]
Length=184

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 70/144 (49%), Gaps = 10/144 (7%)
 Frame = +2

Query  107  KLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELD  286
            +LA + +   + +LKN AQ  F++L     G V K  F   +  +    +++     ELD
Sbjct  5    RLAASIFFEQNSQLKNIAQTEFSNLTRTKQGLVTKRAFDEHLRLRQPECLSSN-LAAELD  63

Query  287  TDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC-------PNYDLCISCY  445
             + +  L F + +   Y+F++ RP C  C   +   ++TCL+C         YDLC  CY
Sbjct  64   ANNDGYLTFEDFLVYRYLFQT-RPVCRHCKAIVKLVFYTCLECFAGKLKERTYDLCPMCY  122

Query  446  GNGKSGHNHP-FMDSYALLAVVKK  514
               K  H H  F ++YA++  ++K
Sbjct  123  LGNKFSHPHKQFTNNYAVVNNIRK  146



>gb|KCW60200.1| hypothetical protein EUGRSUZ_H02911 [Eucalyptus grandis]
Length=145

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M  +H  A  YY+  + + K E +  F ++D D  G +   EF++F+T  G +  N    
Sbjct  1    MRRVHVNALFYYQGLTTKKKQEVEIFFAAMDADRSGSISIAEFMTFLTFAGLQSENLGWL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F ELD D N TLDF EV+T  YI 
Sbjct  61   FEELDKDNNGTLDFEEVLTFFYIL  84



>ref|XP_006388949.1| hypothetical protein POPTR_0068s00210g, partial [Populus trichocarpa]
 gb|ERP47863.1| hypothetical protein POPTR_0068s00210g, partial [Populus trichocarpa]
Length=90

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  DGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRPF-CDG  370
            DG++   E++ ++ +           F  LD DGN +LDF E + L YI +SGR   C  
Sbjct  3    DGKISLREYVDYLKKNNNTVFTHPSLFTALDRDGNGSLDFEETIVLYYIMQSGRALICQS  62

Query  371  CGRFIPATYFTCLQC  415
            C  F+   YF+C QC
Sbjct  63   CNTFLADVYFSCNQC  77



>ref|XP_010064849.1| PREDICTED: uncharacterized protein LOC104452008 [Eucalyptus grandis]
 gb|KCW69482.1| hypothetical protein EUGRSUZ_F02935 [Eucalyptus grandis]
Length=241

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 16/153 (10%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+EL   AK +YR  +   K   Q + + ++   + RV+   F++ + ++  R   ++  
Sbjct  1    MEELRAAAKVHYRDNAV-FKRAIQTINDRIEFSFEDRVNYETFVTLIEERSRR-CTSKAL  58

Query  272  FNELDTDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQC---------PNY  424
            F +LD      LD  +V  L Y+  + R  C  CG  + + Y+TCL C         P +
Sbjct  59   FRQLDRGEKGHLDRDDVRILYYLMDT-RGDCSCCGDILRSVYYTCLPCFDNCKSPNNPTF  117

Query  425  DLCISCYGNGKSGH--NHPFMDSYALLAVVKKR  517
            ++CI+CY +    H  ++ F+D+Y LL  +K+R
Sbjct  118  NVCIACYRDKAFKHPQHNVFVDNYELL--LKRR  148



>ref|XP_010023827.1| PREDICTED: uncharacterized protein LOC104414416 isoform X6 [Eucalyptus 
grandis]
Length=254

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023825.1| PREDICTED: uncharacterized protein LOC104414416 isoform X4 [Eucalyptus 
grandis]
Length=268

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60188.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=264

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  45   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  104

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  105  KLDKDGSKSLSFEELKTFSYVL  126



>ref|XP_010023830.1| PREDICTED: uncharacterized protein LOC104414416 isoform X9 [Eucalyptus 
grandis]
 gb|KCW60190.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=239

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023824.1| PREDICTED: uncharacterized protein LOC104414416 isoform X3 [Eucalyptus 
grandis]
Length=281

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023829.1| PREDICTED: uncharacterized protein LOC104414416 isoform X8 [Eucalyptus 
grandis]
Length=253

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023822.1| PREDICTED: uncharacterized protein LOC104414416 isoform X2 [Eucalyptus 
grandis]
 gb|KCW60192.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=281

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023828.1| PREDICTED: uncharacterized protein LOC104414416 isoform X7 [Eucalyptus 
grandis]
Length=253

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60196.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60197.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=309

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023826.1| PREDICTED: uncharacterized protein LOC104414416 isoform X5 [Eucalyptus 
grandis]
Length=267

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60195.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60191.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=281

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60189.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023821.1| PREDICTED: uncharacterized protein LOC104414416 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60194.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>gb|KCW60193.1| hypothetical protein EUGRSUZ_H02908 [Eucalyptus grandis]
Length=295

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            EL + A A+Y   + + K EA  LFN++D + DG +  +EF +F++  G   +N    F 
Sbjct  90   ELREAASAHYDGLTDDQKEEATRLFNNMDKNEDGDISIDEFKTFLSVAGLHNVNPDNLFA  149

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
            +LD DG+ +L F E+ T  Y+ 
Sbjct  150  KLDKDGSKSLSFEELKTFSYVL  171



>ref|XP_010023832.1| PREDICTED: uncharacterized protein LOC104414418 [Eucalyptus grandis]
 ref|XP_010023833.1| PREDICTED: uncharacterized protein LOC104414418 [Eucalyptus grandis]
 gb|KCW60201.1| hypothetical protein EUGRSUZ_H02912 [Eucalyptus grandis]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            M+++   A  +Y+  S + K  A+  F ++D D  G +  +EF++FM   G++  N    
Sbjct  134  MEKVRDAASVHYKGLSQDQKQAAERFFEAMDTDKSGNISIDEFVTFMGLFGFQSDNHDWL  193

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F +LD D N TLDF E++T  YI 
Sbjct  194  FAKLDKDENGTLDFNELVTFFYIL  217



>gb|KDQ10519.1| hypothetical protein BOTBODRAFT_36215 [Botryobasidium botryosum 
FD-172 SS1]
Length=149

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQ--RF  271
            +  +  +   R   PE  NE Q+ FN+ D DG+GR+ K E  + M   G R   +Q    
Sbjct  68   DFEEFCEVMARHADPE--NELQQAFNAFDLDGNGRISKEELANVMQSLGERLTTSQVDEI  125

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F+E+DTDG+  +DF E + LL  F
Sbjct  126  FSEVDTDGDGQIDFGEFVRLLDFF  149



>ref|XP_010277740.1| PREDICTED: uncharacterized protein LOC104612120 isoform X3 [Nelumbo 
nucifera]
Length=153

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++    + ++  
Sbjct  23   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHYDSNI  82

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            F+ +LD + +  LDF E++   Y+ K  +P
Sbjct  83   FY-KLDRNRDGVLDFNEIIVFFYMTKDNQP  111



>ref|XP_010277739.1| PREDICTED: uncharacterized protein LOC104612120 isoform X2 [Nelumbo 
nucifera]
Length=164

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQR  268
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++    + ++  
Sbjct  18   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHYDSNI  77

Query  269  FFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            F+ +LD + +  LDF E++   Y+ K  +P
Sbjct  78   FY-KLDRNRDGVLDFNEIIVFFYMTKDNQP  106



>ref|XP_010277738.1| PREDICTED: uncharacterized protein LOC104612120 isoform X1 [Nelumbo 
nucifera]
Length=169

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +2

Query  89   KMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQ-QGYRYMNTQ  265
            +M++  + A  +Y+   P++KN A E F ++D DGDG +   EF  F+++ + Y Y    
Sbjct  23   EMEQKRRDALTWYQGCCPQIKNLAGEFFRNMDTDGDGSISIIEFRDFLSKTEEYHY--DS  80

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
              F +LD + +  LDF E++   Y+ K  +P
Sbjct  81   NIFYKLDRNRDGVLDFNEIIVFFYMTKDNQP  111



>gb|KCW60198.1| hypothetical protein EUGRSUZ_H02910 [Eucalyptus grandis]
Length=166

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            ++++ + A A++   + + K  A+ LF++++ D + ++  +EF +F++  G R +N    
Sbjct  25   IEKVREAAAAHFEDLTADQKEAARSLFDTMNKDKNDKISIHEFRTFLSDAGLRTVNPDDL  84

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F ELD D N  L F E++T  Y+ 
Sbjct  85   FAELDKDDNKNLSFEELVTFFYVL  108



>ref|XP_010023831.1| PREDICTED: uncharacterized protein LOC104414417 [Eucalyptus grandis]
 gb|KCW60199.1| hypothetical protein EUGRSUZ_H02910 [Eucalyptus grandis]
Length=176

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            ++++ + A A++   + + K  A+ LF++++ D + ++  +EF +F++  G R +N    
Sbjct  25   IEKVREAAAAHFEDLTADQKEAARSLFDTMNKDKNDKISIHEFRTFLSDAGLRTVNPDDL  84

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F ELD D N  L F E++T  Y+ 
Sbjct  85   FAELDKDDNKNLSFEELVTFFYVL  108



>ref|XP_002532441.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF29927.1| calcium ion binding protein, putative [Ricinus communis]
Length=149

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 10/114 (9%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLYIFKSGRP  358
            LD   DG +   +F  F+ ++G+  ++       L    +  + F + + L+YI K+ RP
Sbjct  2    LDQCTDGTI--GQFDEFLRERGHEPLSPS-ILKALGKKPDDHIGFNDFLILMYIVKTRRP  58

Query  359  FCDGCGRFIPATYFTCLQC-----PNYDLCISCYGNGKSG-HNHPFM-DSYALL  499
             CD C  F+   YFTC  C       ++LC+SC    K+  H H  + D++A+L
Sbjct  59   CCDLCQTFLQGLYFTCAICFETEEKPFNLCLSCISKQKNCLHGHGLLVDNFAML  112



>gb|EFQ35051.1| hypothetical protein GLRG_10195 [Colletotrichum graminicola M1.001]
Length=852

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 37/79 (47%), Gaps = 1/79 (1%)
 Frame = +2

Query  287  TDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPNYDLCISCYGNGKSGH  466
             +G H     EV       +S    CDGC R+I      CL CP++D C  C  N K  H
Sbjct  375  VEGAHVPSHIEVKLAPGRNQSHNAICDGCDRYIAGVRHKCLDCPDWDYCADCIVNSKFVH  434

Query  467  -NHPFMDSYALLAVVKKRS  520
             NH F+  Y  LA V+ R+
Sbjct  435  PNHRFVPIYEPLAEVRSRA  453



>ref|XP_007510592.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18125.1| predicted protein [Bathycoccus prasinos]
Length=359

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +2

Query  95   DELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEF-LSFMTQQGYRYMN---T  262
            D L K  K   R  +   + + QELF++LD+DG G V+  EF L++    G R  +    
Sbjct  77   DWLAKRKKVVKRTLTDSKRAQLQELFSALDSDGGGEVEFEEFALAWKMMAGDREESATIA  136

Query  263  QRFFNELDTDGNHTLDFWEVMTLLYIFKSGR  355
            +R F E+D DGN T+DF E   L+   + GR
Sbjct  137  RRAFKEIDVDGNGTMDFEEFARLMLDLEDGR  167



>gb|KCW44552.1| hypothetical protein EUGRSUZ_L01936 [Eucalyptus grandis]
Length=152

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   ELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFN  277
            E  + A+  Y     + K  A++LF ++D D D R+  +EF  F+T  GY+       F 
Sbjct  15   EPRETARDCYERMKEDQKQVAKQLFEAMDADKDHRISIDEFKDFLTFAGYQSKGLSELFK  74

Query  278  ELDTDGNHTLDFWEVMTLLYIF  343
             LD D N  LDF E++T +Y+ 
Sbjct  75   LLDKDKNGVLDFDELLTFVYML  96



>ref|XP_010041117.1| PREDICTED: neuronal calcium sensor 2-like [Eucalyptus grandis]
 gb|KCW44636.1| hypothetical protein EUGRSUZ_L01846 [Eucalyptus grandis]
Length=158

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQ  265
             K +++ K A   Y +   E K EA+ LF ++D D  G +  +EF +F+   GY+  +  
Sbjct  15   LKDEKVLKDAWTCYESMKEEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLD  74

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIF  343
              F  LD D N  LDF E++T +Y+ 
Sbjct  75   WLFKILDADKNGDLDFKELLTFVYML  100



>gb|EYU23821.1| hypothetical protein MIMGU_mgv1a022630mg [Erythranthe guttata]
Length=174

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = +2

Query  359  FCDGCGRFIPATYFTCLQC----PN-YDLCISCYGNGKSGHNHP---FMDSYALLAVVKK  514
            +C  C   +P  +F+CL C    PN +DLC  CYG GK  H+HP   F+D++++  ++  
Sbjct  92   WCSACAGSLPGLHFSCLTCEKNEPNTFDLCCICYGEGKFDHHHPTSDFLDNHSMRNLLAP  151

Query  515  RSDVNQVTDDDDQSESY  565
            + +  Q+   +D+  ++
Sbjct  152  KMNTPQLRSPNDEVTNF  168



>ref|XP_010033731.1| PREDICTED: neuronal calcium sensor 2-like [Eucalyptus grandis]
Length=158

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  86   FKMDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQ  265
             K +++ K A   Y +   E K EA+ LF ++D D  G +  +EF +F+   GY+  +  
Sbjct  15   LKDEKVLKDAWTCYESMKEEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLD  74

Query  266  RFFNELDTDGNHTLDFWEVMTLLYIF  343
              F  LD D N  LDF E++T +Y+ 
Sbjct  75   WLFKILDADKNGDLDFKELLTFVYML  100



>gb|KDN68651.1| hypothetical protein CSUB01_03110 [Colletotrichum sublineola]
Length=851

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 37/79 (47%), Gaps = 1/79 (1%)
 Frame = +2

Query  287  TDGNHTLDFWEVMTLLYIFKSGRPFCDGCGRFIPATYFTCLQCPNYDLCISCYGNGKSGH  466
             +G H     EV       +S    CDGC ++I      CL CP++D C  C  N K  H
Sbjct  375  VEGAHVPSHIEVKLAPGRNQSHNAICDGCDKYIAGVRHKCLDCPDWDYCADCIVNSKFVH  434

Query  467  -NHPFMDSYALLAVVKKRS  520
             NH F+  Y  LA V+ R+
Sbjct  435  PNHRFVPIYEPLAEVRSRA  453



>gb|KCW44553.1| hypothetical protein EUGRSUZ_L01937 [Eucalyptus grandis]
Length=97

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  143  ELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEV  322
            E K  A+ LF ++D D + R+  +EF +F+   GY+  +  R F  LD D N  L+F E+
Sbjct  4    EQKRVAESLFEAMDADKNKRISIDEFTAFLGFAGYQSEDLARLFESLDADKNGDLNFKEL  63

Query  323  MTLLYIF  343
            +T +Y+ 
Sbjct  64   LTFVYML  70



>ref|XP_009216716.1| ZZ type zinc finger domain-containing protein [Gaeumannomyces 
graminis var. tritici R3-111a-1]
 gb|EJT80707.1| ZZ type zinc finger domain-containing protein [Gaeumannomyces 
graminis var. tritici R3-111a-1]
Length=915

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 1/60 (2%)
 Frame = +2

Query  359  FCDGCGRFIPATYFTCLQCPNYDLCISCYGNGKSGH-NHPFMDSYALLAVVKKRSDVNQV  535
             CDGC +FI      CL CP++D C  C GN    H NH F+  Y  L  V  RS   QV
Sbjct  462  ICDGCDKFIQGVRHKCLDCPDWDYCADCVGNAGFIHPNHRFVPVYDPLRDVSARSATRQV  521



>gb|KCW84064.1| hypothetical protein EUGRSUZ_B00947 [Eucalyptus grandis]
Length=128

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +2

Query  140  PELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWE  319
             E K EA+ LF ++D D  G +  +EF +F+   GY+  +    F  LD D N  LDF E
Sbjct  3    EEQKQEAERLFAAMDADKSGGISIDEFTAFLRFAGYQSEDLDWLFKILDADKNGDLDFKE  62

Query  320  VMTLLYIF  343
            ++T +Y+ 
Sbjct  63   LLTFVYML  70



>ref|XP_010039331.1| PREDICTED: caltractin-like [Eucalyptus grandis]
Length=107

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   MDELHKLAKAYYRAGSPELKNEAQELFNSLDNDGDGRVDKNEFLSFMTQQGYRYMNTQRF  271
            MDE+ + A   Y+  + E K    + F ++D DG+G +   EF++F+ Q G    +    
Sbjct  1    MDEIRREAMNDYKQRTKEQKQRVLDFFIAMDTDGNGSISVREFVAFLQQNGLYSDHFGVL  60

Query  272  FNELDTDGNHTLDFWEVMTLLYIF  343
            F EL  D + TL   E++TL ++ 
Sbjct  61   FAELQKDDDGTLGLEEIITLKFML  84



>ref|XP_010026782.1| PREDICTED: uncharacterized protein LOC104417165 [Eucalyptus grandis]
Length=131

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  179  LDNDGDGRVDKNEFLSFMTQQGYRYMNTQRFFNELDTDGNHTLDFWEVMTLLYIF  343
            +D D  G +   EF++F+T  G +  N    F ELD D N TLDF EV+T  YI 
Sbjct  1    MDADRSGSISIAEFMTFLTFAGLQSENLGWLFEELDKDNNGTLDFEEVLTFFYIL  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2327078598528