BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2241_g1_i1 len=1664 path=[1:0-1663]

Length=1664
                                                                      Score     E

ref|XP_009626940.1|  PREDICTED: uncharacterized protein LOC104117579    617   0.0      
ref|XP_006352381.1|  PREDICTED: uncharacterized protein LOC102604757    615   0.0      
ref|XP_004250244.1|  PREDICTED: uncharacterized protein LOC101249979    612   0.0      
ref|XP_009769724.1|  PREDICTED: uncharacterized protein LOC104220540    595   0.0      
emb|CDP04462.1|  unnamed protein product                                592   0.0      
ref|XP_011096020.1|  PREDICTED: uncharacterized protein LOC105175311    591   0.0      
gb|EYU27744.1|  hypothetical protein MIMGU_mgv1a006618mg                579   0.0      
gb|EPS71807.1|  hypothetical protein M569_02947                         508   1e-172   
ref|XP_003632960.2|  PREDICTED: uncharacterized protein LOC100854830    503   2e-170   
emb|CBI41058.3|  unnamed protein product                                482   9e-163   
ref|XP_006467360.1|  PREDICTED: uncharacterized protein LOC102610018    482   2e-162   
ref|XP_007214525.1|  hypothetical protein PRUPE_ppa015325mg             479   9e-161   
ref|XP_008224762.1|  PREDICTED: uncharacterized protein LOC103324482    475   5e-160   
gb|KDP20685.1|  hypothetical protein JCGZ_21156                         475   1e-159   
ref|XP_010057868.1|  PREDICTED: uncharacterized protein LOC104445657    474   2e-159   
ref|XP_007026217.1|  Uncharacterized protein isoform 1                  474   4e-159   
ref|XP_006449827.1|  hypothetical protein CICLE_v10015536mg             468   8e-158   
ref|XP_007026218.1|  Uncharacterized protein isoform 2                  469   2e-157   
ref|XP_008447712.1|  PREDICTED: uncharacterized protein LOC103490125    468   6e-157   
ref|XP_010686754.1|  PREDICTED: uncharacterized protein LOC104900923    468   6e-157   
ref|XP_004293339.1|  PREDICTED: uncharacterized protein LOC101308...    467   7e-157   
ref|XP_004151004.1|  PREDICTED: uncharacterized protein LOC101212672    467   1e-156   
ref|XP_009357514.1|  PREDICTED: uncharacterized protein LOC103948236    466   3e-156   
ref|XP_008384265.1|  PREDICTED: uncharacterized protein LOC103446889    465   4e-156   
ref|XP_008366075.1|  PREDICTED: uncharacterized protein LOC103429724    465   5e-156   
ref|XP_004486201.1|  PREDICTED: uncharacterized protein LOC101488219    461   2e-154   
ref|XP_007147672.1|  hypothetical protein PHAVU_006G144700g             459   1e-153   
ref|XP_003594165.1|  hypothetical protein MTR_2g025160                  458   3e-153   
ref|XP_004293337.1|  PREDICTED: uncharacterized protein LOC101307...    456   2e-152   
ref|NP_001240036.1|  uncharacterized protein LOC100809035               454   8e-152   
ref|XP_006452451.1|  hypothetical protein CICLE_v10008348mg             452   4e-151   
ref|XP_003534739.1|  PREDICTED: uncharacterized protein LOC100816572    452   6e-151   
ref|XP_002298818.1|  hypothetical protein POPTR_0001s36620g             451   1e-150   Populus trichocarpa [western balsam poplar]
ref|XP_010488000.1|  PREDICTED: uncharacterized protein LOC104765...    451   3e-150   
gb|KHN40846.1|  hypothetical protein glysoja_015213                     451   3e-150   
ref|XP_010508774.1|  PREDICTED: uncharacterized protein LOC104785287    451   4e-150   
ref|XP_010466213.1|  PREDICTED: uncharacterized protein LOC104746436    451   5e-150   
ref|XP_010270062.1|  PREDICTED: uncharacterized protein LOC104606514    449   1e-149   
gb|KDP39188.1|  hypothetical protein JCGZ_00945                         448   2e-149   
ref|XP_010943240.1|  PREDICTED: uncharacterized protein LOC105061026    448   3e-149   
ref|XP_002885364.1|  extracellular ligand-gated ion channel             448   4e-149   
ref|XP_004248349.1|  PREDICTED: uncharacterized protein LOC101267356    447   5e-149   
ref|XP_006297578.1|  hypothetical protein CARUB_v10013605mg             448   1e-148   
ref|XP_006406400.1|  hypothetical protein EUTSA_v10020720mg             447   1e-148   
ref|XP_010646962.1|  PREDICTED: uncharacterized protein LOC100854148    442   4e-148   
ref|XP_011046716.1|  PREDICTED: uncharacterized protein LOC105141243    445   4e-148   
ref|NP_566658.1|  uncharacterized protein                               444   2e-147   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50089.1|  BnaC01g32640D                                          441   5e-146   
ref|XP_002277314.1|  PREDICTED: uncharacterized protein LOC100245205    439   1e-145   Vitis vinifera
emb|CDP13788.1|  unnamed protein product                                436   3e-145   
ref|XP_009111188.1|  PREDICTED: uncharacterized protein LOC103836644    437   6e-145   
gb|KFK39352.1|  hypothetical protein AALP_AA3G233200                    437   7e-145   
ref|XP_009770783.1|  PREDICTED: uncharacterized protein LOC104221410    437   7e-145   
gb|KGN66826.1|  hypothetical protein Csa_1G699550                       437   8e-145   
ref|XP_010675782.1|  PREDICTED: uncharacterized protein LOC104891734    437   9e-145   
ref|XP_009589161.1|  PREDICTED: uncharacterized protein LOC104086572    436   1e-144   
emb|CDY68401.1|  BnaCnng58860D                                          437   1e-144   
ref|XP_006352526.1|  PREDICTED: uncharacterized protein LOC102597876    436   2e-144   
emb|CAN83979.1|  hypothetical protein VITISV_007068                     436   2e-144   Vitis vinifera
ref|XP_009603512.1|  PREDICTED: uncharacterized protein LOC104098475    436   3e-144   
ref|XP_007146523.1|  hypothetical protein PHAVU_006G048100g             435   4e-144   
ref|XP_010060281.1|  PREDICTED: uncharacterized protein LOC104448186    435   4e-144   
ref|XP_011097838.1|  PREDICTED: uncharacterized protein LOC105176662    434   7e-144   
ref|XP_008803503.1|  PREDICTED: uncharacterized protein LOC103717050    433   2e-143   
ref|XP_009794607.1|  PREDICTED: uncharacterized protein LOC104241364    433   2e-143   
ref|XP_009598341.1|  PREDICTED: uncharacterized protein LOC104094171    433   3e-143   
ref|XP_002531193.1|  conserved hypothetical protein                     431   3e-143   Ricinus communis
ref|XP_009796127.1|  PREDICTED: uncharacterized protein LOC104242742    432   3e-143   
ref|XP_010545495.1|  PREDICTED: uncharacterized protein LOC104817849    432   5e-143   
ref|XP_006413675.1|  hypothetical protein EUTSA_v10025231mg             432   6e-143   
gb|KFK28797.1|  hypothetical protein AALP_AA7G049500                    430   3e-142   
ref|XP_008458982.1|  PREDICTED: uncharacterized protein LOC103498231    429   5e-142   
ref|XP_010529468.1|  PREDICTED: uncharacterized protein LOC104806...    429   5e-142   
ref|XP_004513895.1|  PREDICTED: uncharacterized protein LOC101499556    427   5e-141   
ref|XP_011095451.1|  PREDICTED: uncharacterized protein LOC105174899    427   5e-141   
ref|XP_007020713.1|  F11F12.5 protein                                   426   8e-141   
ref|XP_006393128.1|  hypothetical protein EUTSA_v10011484mg             424   7e-140   
emb|CDX82254.1|  BnaA03g35670D                                          424   2e-139   
gb|KEH33913.1|  extracellular ligand-gated ion channel protein          424   2e-139   
gb|KFK35919.1|  hypothetical protein AALP_AA4G053500                    423   3e-139   
emb|CDY25409.1|  BnaA05g18750D                                          423   3e-139   
gb|EPS58234.1|  hypothetical protein M569_16581                         422   3e-139   
ref|XP_006603176.1|  PREDICTED: uncharacterized protein LOC100817487    422   2e-138   
emb|CDX98738.1|  BnaA03g45230D                                          421   2e-138   
ref|XP_010539389.1|  PREDICTED: uncharacterized protein LOC104813486    421   2e-138   
emb|CDY36047.1|  BnaC03g41510D                                          421   3e-138   
ref|XP_010675778.1|  PREDICTED: uncharacterized protein LOC104891...    420   3e-138   
ref|XP_009145645.1|  PREDICTED: uncharacterized protein LOC103869337    421   3e-138   
ref|XP_009348310.1|  PREDICTED: uncharacterized protein LOC103939943    420   4e-138   
emb|CDY29817.1|  BnaC05g31730D                                          420   5e-138   
emb|CDY22809.1|  BnaA06g02680D                                          419   6e-138   
ref|XP_010479527.1|  PREDICTED: uncharacterized protein LOC104758369    418   2e-137   
ref|XP_006283722.1|  hypothetical protein CARUB_v10004790mg             417   4e-137   
ref|XP_009147821.1|  PREDICTED: uncharacterized protein LOC103871333    417   5e-137   
emb|CDX94085.1|  BnaC07g37190D                                          416   1e-136   
ref|XP_009334182.1|  PREDICTED: uncharacterized protein LOC103927009    416   1e-136   
ref|XP_006307478.1|  hypothetical protein CARUB_v10009103mg             416   1e-136   
ref|XP_002894263.1|  predicted protein                                  416   2e-136   
ref|XP_002869830.1|  hypothetical protein ARALYDRAFT_492639             416   2e-136   
ref|XP_010500640.1|  PREDICTED: uncharacterized protein LOC104777990    416   2e-136   
emb|CBI26689.3|  unnamed protein product                                414   3e-136   
emb|CDY37123.1|  BnaC06g03760D                                          415   4e-136   
ref|XP_010096104.1|  hypothetical protein L484_012459                   414   6e-136   
ref|XP_006283720.1|  hypothetical protein CARUB_v10004790mg             414   7e-136   
ref|XP_009137245.1|  PREDICTED: uncharacterized protein LOC103861292    414   8e-136   
ref|XP_004293340.1|  PREDICTED: uncharacterized protein LOC101308...    411   2e-135   
emb|CDX79142.1|  BnaA01g12090D                                          412   3e-135   
ref|XP_009135768.1|  PREDICTED: uncharacterized protein LOC103859918    412   3e-135   
gb|EYU27375.1|  hypothetical protein MIMGU_mgv1a006628mg                412   5e-135   
emb|CDX82928.1|  BnaC01g13780D                                          411   6e-135   
ref|XP_004251922.1|  PREDICTED: uncharacterized protein LOC101243767    411   6e-135   
ref|XP_004295847.1|  PREDICTED: uncharacterized protein LOC101309337    411   1e-134   
ref|NP_567659.1|  uncharacterized protein                               411   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529467.1|  PREDICTED: uncharacterized protein LOC104806...    412   1e-134   
ref|XP_002518410.1|  conserved hypothetical protein                     409   1e-134   Ricinus communis
ref|XP_006344870.1|  PREDICTED: uncharacterized protein LOC102588767    409   3e-134   
dbj|BAB02810.1|  unnamed protein product                                409   3e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283721.1|  hypothetical protein CARUB_v10004790mg             409   1e-133   
ref|XP_010439350.1|  PREDICTED: uncharacterized protein LOC104722...    408   2e-133   
ref|XP_009415457.1|  PREDICTED: uncharacterized protein LOC103996294    407   2e-133   
ref|XP_010675783.1|  PREDICTED: uncharacterized protein LOC104891735    407   2e-133   
ref|NP_564578.1|  uncharacterized protein                               407   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135678.1|  PREDICTED: uncharacterized protein LOC103859...    406   7e-133   
ref|XP_010434064.1|  PREDICTED: uncharacterized protein LOC104718088    406   8e-133   
gb|AAK91425.1|  At1g50630/F17J6_15                                      406   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227040.1|  PREDICTED: uncharacterized protein LOC103326578    405   2e-132   
ref|XP_010675779.1|  PREDICTED: uncharacterized protein LOC104891...    405   2e-132   
gb|EYU27373.1|  hypothetical protein MIMGU_mgv1a006639mg                405   2e-132   
ref|XP_010439351.1|  PREDICTED: uncharacterized protein LOC104722...    404   4e-132   
ref|XP_003530763.1|  PREDICTED: uncharacterized protein LOC100806904    404   9e-132   
ref|XP_007214588.1|  hypothetical protein PRUPE_ppa025124mg             402   3e-131   
ref|XP_008227044.1|  PREDICTED: uncharacterized protein LOC103326581    402   3e-131   
ref|XP_009348304.1|  PREDICTED: uncharacterized protein LOC103939933    402   4e-131   
ref|XP_004293338.1|  PREDICTED: uncharacterized protein LOC101307...    400   4e-131   
ref|XP_007211685.1|  hypothetical protein PRUPE_ppa005936mg             401   6e-131   
ref|XP_008366458.1|  PREDICTED: uncharacterized protein LOC103430105    401   6e-131   
ref|XP_004145463.1|  PREDICTED: uncharacterized protein LOC101203162    414   8e-131   
ref|XP_009334156.1|  PREDICTED: uncharacterized protein LOC103926992    401   1e-130   
gb|KCW75211.1|  hypothetical protein EUGRSUZ_E03959                     398   5e-130   
ref|XP_008805602.1|  PREDICTED: uncharacterized protein LOC103718515    398   1e-129   
gb|EYU33671.1|  hypothetical protein MIMGU_mgv1a024798mg                397   5e-129   
ref|XP_009135679.1|  PREDICTED: uncharacterized protein LOC103859...    396   8e-129   
ref|XP_010448914.1|  PREDICTED: uncharacterized protein LOC104731284    396   1e-128   
ref|XP_004244094.1|  PREDICTED: uncharacterized protein LOC101266537    395   1e-128   
ref|XP_006346194.1|  PREDICTED: uncharacterized protein LOC102602141    395   2e-128   
gb|KHG15892.1|  hypothetical protein F383_23792                         392   2e-127   
ref|XP_009418874.1|  PREDICTED: uncharacterized protein LOC103998968    391   5e-127   
ref|XP_006396725.1|  hypothetical protein EUTSA_v10028658mg             390   1e-126   
gb|AAG51199.1|AC079279_20  unknown protein                              390   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006829511.1|  hypothetical protein AMTR_s00074p00134940          387   2e-125   
dbj|BAC41857.1|  unknown protein                                        386   4e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928244.1|  PREDICTED: uncharacterized protein LOC105050081    388   4e-125   
ref|XP_010433103.1|  PREDICTED: uncharacterized protein LOC104717254    386   7e-125   
ref|NP_192291.2|  uncharacterized protein                               385   9e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974507.1|  uncharacterized protein                               385   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788884.1|  PREDICTED: uncharacterized protein LOC103706529    384   5e-124   
ref|XP_006287704.1|  hypothetical protein CARUB_v10000912mg             384   9e-124   
ref|XP_010455721.1|  PREDICTED: uncharacterized protein LOC104737284    383   9e-124   
ref|XP_009398681.1|  PREDICTED: uncharacterized protein LOC103983...    382   9e-124   
gb|KEH36941.1|  extracellular ligand-gated ion channel protein          382   1e-123   
emb|CDX94537.1|  BnaC09g22990D                                          383   1e-123   
ref|XP_009114591.1|  PREDICTED: uncharacterized protein LOC103839855    380   5e-123   
emb|CBI41028.3|  unnamed protein product                                375   7e-123   
ref|XP_002874792.1|  predicted protein                                  380   2e-122   
emb|CDY16688.1|  BnaA09g20660D                                          379   3e-122   
ref|XP_009385545.1|  PREDICTED: uncharacterized protein LOC103972887    371   2e-119   
dbj|BAH19618.1|  AT1G50630                                              358   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031167.1|  uncharacterized protein                            357   5e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408724.1|  PREDICTED: uncharacterized protein LOC103991088    355   2e-113   
emb|CAA16777.1|  hypothetical protein                                   350   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001136565.1|  hypothetical protein                               350   4e-111   Zea mays [maize]
ref|XP_002438712.1|  hypothetical protein SORBIDRAFT_10g024850          343   3e-108   Sorghum bicolor [broomcorn]
gb|KHN12540.1|  hypothetical protein glysoja_035347                     338   6e-108   
ref|XP_004965802.1|  PREDICTED: uncharacterized protein LOC101778259    341   2e-107   
dbj|BAJ91857.1|  predicted protein                                      340   6e-107   
emb|CAB80805.1|  hypothetical protein                                   338   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287703.1|  hypothetical protein CARUB_v10000912mg             334   3e-105   
gb|EAZ37736.1|  hypothetical protein OsJ_22076                          332   8e-105   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058140.1|  Os06g0635200                                       333   3e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563581.1|  PREDICTED: uncharacterized protein LOC100842014    332   7e-104   
ref|XP_003575187.1|  PREDICTED: uncharacterized protein LOC100828011    327   3e-102   
gb|KHM99523.1|  hypothetical protein glysoja_006366                     322   5e-102   
ref|XP_006656279.1|  PREDICTED: uncharacterized protein LOC102707685    323   2e-100   
ref|XP_009398683.1|  PREDICTED: uncharacterized protein LOC103983...    316   2e-98    
gb|KHG27190.1|  hypothetical protein F383_14154                         312   2e-98    
gb|KHG15893.1|  hypothetical protein F383_23792                         314   3e-98    
ref|XP_010451122.1|  PREDICTED: uncharacterized protein LOC104733223    307   4e-96    
ref|XP_002987712.1|  hypothetical protein SELMODRAFT_44258              307   6e-95    
ref|XP_002983177.1|  hypothetical protein SELMODRAFT_44255              306   2e-94    
ref|XP_003581286.1|  PREDICTED: uncharacterized protein LOC100836114    305   1e-93    
dbj|BAJ86582.1|  predicted protein                                      305   2e-93    
ref|XP_004952715.1|  PREDICTED: uncharacterized protein LOC101775844    302   2e-92    
ref|XP_008669337.1|  PREDICTED: uncharacterized protein LOC103646384    301   6e-92    
ref|XP_001769393.1|  predicted protein                                  298   3e-91    
ref|XP_006653458.1|  PREDICTED: uncharacterized protein LOC102711255    292   3e-90    
ref|XP_002452309.1|  hypothetical protein SORBIDRAFT_04g023430          296   4e-90    Sorghum bicolor [broomcorn]
ref|XP_001771079.1|  predicted protein                                  296   5e-90    
ref|XP_001779543.1|  predicted protein                                  292   2e-89    
ref|XP_002446563.1|  hypothetical protein SORBIDRAFT_06g018146          288   2e-87    Sorghum bicolor [broomcorn]
gb|EAY94307.1|  hypothetical protein OsI_16076                          288   3e-87    Oryza sativa Indica Group [Indian rice]
emb|CAD40876.2|  OSJNBa0064H22.7                                        288   4e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752835.1|  predicted protein                                  289   4e-87    
gb|EAZ30889.1|  hypothetical protein OsJ_14964                          287   8e-87    Oryza sativa Japonica Group [Japonica rice]
gb|KHG22956.1|  hypothetical protein F383_04880                         281   2e-85    
gb|AFW71907.1|  hypothetical protein ZEAMMB73_453015                    282   7e-85    
ref|NP_001143249.1|  hypothetical protein                               280   5e-84    Zea mays [maize]
ref|XP_002963850.1|  hypothetical protein SELMODRAFT_64232              278   1e-83    
ref|XP_006648760.1|  PREDICTED: uncharacterized protein LOC102705507    273   2e-82    
ref|XP_009375736.1|  PREDICTED: uncharacterized protein LOC103964525    275   3e-82    
ref|XP_004978035.1|  PREDICTED: uncharacterized protein LOC101754954    275   9e-82    
ref|XP_010263393.1|  PREDICTED: uncharacterized protein LOC104601654    273   2e-81    
ref|XP_006382205.1|  hypothetical protein POPTR_0006s29350g             271   2e-80    
gb|EAY86337.1|  hypothetical protein OsI_07714                          270   3e-80    Oryza sativa Indica Group [Indian rice]
ref|NP_001047171.1|  Os02g0566400                                       270   5e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007011510.1|  Ras guanine nucleotide exchange factor K           271   5e-80    
ref|XP_004292871.1|  PREDICTED: uncharacterized protein LOC101310198    268   7e-80    
ref|XP_008378229.1|  PREDICTED: uncharacterized protein LOC103441326    271   1e-79    
ref|XP_009368026.1|  PREDICTED: uncharacterized protein LOC103957568    267   2e-79    
ref|XP_008365157.1|  PREDICTED: uncharacterized protein LOC103428821    270   4e-79    
gb|KHN18230.1|  hypothetical protein glysoja_025120                     266   7e-79    
ref|XP_001769917.1|  predicted protein                                  266   8e-79    
ref|XP_007137142.1|  hypothetical protein PHAVU_009G103200g             266   1e-78    
ref|XP_007227319.1|  hypothetical protein PRUPE_ppa016430mg             265   2e-78    
ref|XP_003527815.1|  PREDICTED: uncharacterized protein LOC100804399    265   2e-78    
ref|XP_010532188.1|  PREDICTED: uncharacterized protein LOC104808241    264   5e-78    
ref|XP_006483640.1|  PREDICTED: uncharacterized protein LOC102622...    260   3e-76    
ref|XP_008220009.1|  PREDICTED: uncharacterized protein LOC103320155    259   3e-76    
ref|XP_003545561.1|  PREDICTED: uncharacterized protein LOC100783743    259   4e-76    
ref|XP_006450085.1|  hypothetical protein CICLE_v10008275mg             259   5e-76    
ref|XP_010029421.1|  PREDICTED: uncharacterized protein LOC104419...    259   7e-76    
gb|KCW56336.1|  hypothetical protein EUGRSUZ_I02070                     258   7e-76    
ref|XP_009367974.1|  PREDICTED: uncharacterized protein LOC103957521    258   9e-76    
ref|XP_010029422.1|  PREDICTED: uncharacterized protein LOC104419...    257   2e-75    
ref|XP_008393923.1|  PREDICTED: uncharacterized protein LOC103456071    257   3e-75    
ref|XP_004498558.1|  PREDICTED: uncharacterized protein LOC101507189    256   4e-75    
ref|XP_011006658.1|  PREDICTED: uncharacterized protein LOC105112...    256   7e-75    
gb|EMS51983.1|  hypothetical protein TRIUR3_23467                       254   8e-75    
ref|XP_007140992.1|  hypothetical protein PHAVU_008G158000g             255   2e-74    
gb|KGN62851.1|  hypothetical protein Csa_2G377870                       254   3e-74    
ref|XP_011002963.1|  PREDICTED: uncharacterized protein LOC105109832    254   4e-74    
ref|XP_003551145.1|  PREDICTED: uncharacterized protein LOC100775945    253   1e-73    
gb|KHN19617.1|  hypothetical protein glysoja_048834                     253   2e-73    
ref|XP_010029424.1|  PREDICTED: uncharacterized protein LOC104419...    249   6e-73    
ref|XP_002527998.1|  conserved hypothetical protein                     250   8e-73    Ricinus communis
ref|XP_006850979.1|  hypothetical protein AMTR_s00025p00209050          251   1e-72    
ref|XP_002280927.1|  PREDICTED: uncharacterized protein LOC100262807    249   4e-72    Vitis vinifera
gb|AES58871.2|  extracellular ligand-gated ion channel protein          248   5e-72    
ref|XP_006371829.1|  hypothetical protein POPTR_0018s04020g             248   9e-72    
ref|XP_010669538.1|  PREDICTED: uncharacterized protein LOC104886749    248   1e-71    
ref|XP_010927168.1|  PREDICTED: uncharacterized protein LOC105049268    247   2e-71    
ref|XP_010416847.1|  PREDICTED: uncharacterized protein LOC104702...    244   8e-71    
ref|NP_179704.2|  uncharacterized protein                               244   8e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420001.1|  PREDICTED: uncharacterized protein LOC103999850    243   3e-70    
ref|XP_008796963.1|  PREDICTED: uncharacterized protein LOC103712264    242   1e-69    
ref|XP_002266342.1|  PREDICTED: uncharacterized protein LOC100240965    242   1e-69    Vitis vinifera
ref|XP_010429000.1|  PREDICTED: uncharacterized protein LOC104713550    241   2e-69    
gb|EMT10115.1|  hypothetical protein F775_15235                         231   1e-67    
ref|XP_006294298.1|  hypothetical protein CARUB_v10023305mg             235   2e-67    
ref|XP_002878534.1|  hypothetical protein ARALYDRAFT_480957             234   6e-67    
emb|CBI20804.3|  unnamed protein product                                234   7e-67    
ref|XP_010416848.1|  PREDICTED: uncharacterized protein LOC104702...    233   8e-67    
ref|XP_010112129.1|  hypothetical protein L484_019867                   233   3e-66    
gb|EMT27541.1|  hypothetical protein F775_21009                         225   1e-65    
ref|XP_003588620.1|  hypothetical protein MTR_1g009230                  231   5e-65    
ref|XP_011071201.1|  PREDICTED: uncharacterized protein LOC105156...    228   2e-64    
emb|CDP13315.1|  unnamed protein product                                228   2e-64    
ref|XP_006294297.1|  hypothetical protein CARUB_v10023305mg             224   2e-63    
ref|XP_010531304.1|  PREDICTED: uncharacterized protein LOC104807629    224   1e-62    
ref|XP_006484055.1|  PREDICTED: uncharacterized protein LOC102620652    222   4e-62    
ref|NP_564899.1|  uncharacterized protein                               221   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438096.1|  hypothetical protein CICLE_v10031526mg             221   1e-61    
ref|XP_007037920.1|  Uncharacterized protein isoform 1                  221   1e-61    
gb|AAM61061.1|  unknown                                                 221   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887131.1|  predicted protein                                  221   1e-61    
gb|EYU42109.1|  hypothetical protein MIMGU_mgv1a006212mg                220   2e-61    
ref|XP_006483641.1|  PREDICTED: uncharacterized protein LOC102622...    219   5e-61    
ref|XP_010250800.1|  PREDICTED: uncharacterized protein LOC104592942    219   6e-61    
ref|NP_001143064.1|  uncharacterized protein LOC100275536               218   1e-60    Zea mays [maize]
ref|XP_006476992.1|  PREDICTED: uncharacterized protein LOC102626692    218   1e-60    
ref|XP_004297576.1|  PREDICTED: uncharacterized protein LOC101312434    218   3e-60    
gb|KFK41164.1|  hypothetical protein AALP_AA2G094000                    218   3e-60    
ref|XP_008222053.1|  PREDICTED: uncharacterized protein LOC103321979    216   5e-60    
ref|XP_010496154.1|  PREDICTED: uncharacterized protein LOC104773277    210   5e-60    
ref|XP_007226694.1|  hypothetical protein PRUPE_ppa020602mg             216   6e-60    
ref|XP_006391254.1|  hypothetical protein EUTSA_v10018471mg             216   2e-59    
ref|XP_010470668.1|  PREDICTED: uncharacterized protein LOC104750556    214   3e-59    
gb|KDO81983.1|  hypothetical protein CISIN_1g013127mg                   214   4e-59    
ref|XP_002311725.1|  hypothetical protein POPTR_0008s17820g             214   4e-59    
ref|XP_008445578.1|  PREDICTED: uncharacterized protein LOC103488559    212   6e-59    
ref|XP_006301293.1|  hypothetical protein CARUB_v10021714mg             213   8e-59    
ref|XP_004504467.1|  PREDICTED: uncharacterized protein LOC101499908    213   8e-59    
ref|XP_010415335.1|  PREDICTED: uncharacterized protein LOC104701...    213   1e-58    
ref|XP_007045013.1|  Uncharacterized protein isoform 1                  213   1e-58    
gb|KHN10257.1|  hypothetical protein glysoja_017861                     213   2e-58    
ref|XP_011029654.1|  PREDICTED: uncharacterized protein LOC105129...    213   2e-58    
ref|XP_009359324.1|  PREDICTED: uncharacterized protein LOC103949907    212   2e-58    
emb|CDY01820.1|  BnaC06g28600D                                          213   2e-58    
ref|XP_006852183.1|  hypothetical protein AMTR_s00049p00104840          212   2e-58    
ref|XP_010511702.1|  PREDICTED: uncharacterized protein LOC104787770    211   4e-58    
ref|XP_004310198.1|  PREDICTED: uncharacterized protein LOC101297985    210   1e-57    
ref|XP_009359470.1|  PREDICTED: uncharacterized protein LOC103950043    209   1e-57    
emb|CDX96082.1|  BnaA07g26490D                                          210   2e-57    
ref|XP_009105298.1|  PREDICTED: uncharacterized protein LOC103831181    210   2e-57    
ref|XP_010044771.1|  PREDICTED: uncharacterized protein LOC104433...    209   3e-57    
ref|XP_008353126.1|  PREDICTED: uncharacterized protein LOC103416675    209   3e-57    
ref|XP_008389827.1|  PREDICTED: uncharacterized protein LOC103452116    208   4e-57    
gb|KCW86881.1|  hypothetical protein EUGRSUZ_B03466                     210   4e-57    
ref|XP_011006660.1|  PREDICTED: uncharacterized protein LOC105112...    207   8e-57    
ref|XP_007158706.1|  hypothetical protein PHAVU_002G175600g             208   1e-56    
gb|KEH20560.1|  extracellular ligand-gated ion channel protein          209   1e-56    
ref|XP_007163735.1|  hypothetical protein PHAVU_001G259900g             207   1e-56    
ref|XP_004142939.1|  PREDICTED: uncharacterized protein LOC101221462    206   4e-56    
gb|AAG52311.1|AC011020_18  hypothetical protein                         207   5e-56    
ref|XP_011040400.1|  PREDICTED: uncharacterized protein LOC105136...    205   6e-56    
ref|XP_009105111.1|  PREDICTED: uncharacterized protein LOC103831020    206   7e-56    
ref|XP_003524884.1|  PREDICTED: uncharacterized protein LOC100793058    204   2e-55    
emb|CDY07415.1|  BnaA07g24940D                                          204   2e-55    
ref|XP_011044193.1|  PREDICTED: uncharacterized protein LOC105139...    204   2e-55    
ref|XP_002318706.2|  hypothetical protein POPTR_0012s09640g             204   2e-55    
ref|XP_008351748.1|  PREDICTED: uncharacterized protein LOC103415176    202   6e-55    
ref|XP_011024065.1|  PREDICTED: uncharacterized protein LOC105125358    202   9e-55    
ref|XP_009359327.1|  PREDICTED: uncharacterized protein LOC103949910    202   9e-55    
ref|XP_011073016.1|  PREDICTED: uncharacterized protein LOC105158085    201   1e-54    
ref|XP_004973917.1|  PREDICTED: uncharacterized protein LOC101763435    201   4e-54    
gb|KHG17562.1|  Zinc finger protein CONSTANS-LIKE 2                     200   5e-54    
gb|KHN12403.1|  hypothetical protein glysoja_018533                     200   8e-54    
ref|XP_003531185.1|  PREDICTED: uncharacterized protein LOC100813872    200   1e-53    
ref|XP_002322233.1|  hypothetical protein POPTR_0015s10420g             199   2e-53    
emb|CDY28876.1|  BnaC06g26640D                                          199   2e-53    
gb|AAD29808.1|  hypothetical protein                                    198   2e-53    
ref|XP_009402706.1|  PREDICTED: uncharacterized protein LOC103986415    197   4e-53    
gb|EYU23107.1|  hypothetical protein MIMGU_mgv1a022109mg                197   5e-53    
gb|KHN24083.1|  hypothetical protein glysoja_025256                     197   2e-52    
ref|XP_008444434.1|  PREDICTED: uncharacterized protein LOC103487761    194   6e-52    
ref|XP_003552789.2|  PREDICTED: uncharacterized protein LOC100796689    196   7e-52    
gb|KHG17561.1|  Zinc finger protein CONSTANS-LIKE 2                     195   7e-52    
gb|KHN34805.1|  hypothetical protein glysoja_036798                     192   9e-52    
ref|XP_009783147.1|  PREDICTED: uncharacterized protein LOC104231787    194   1e-51    
gb|EPS66830.1|  hypothetical protein M569_07947                         192   4e-51    
ref|XP_011071202.1|  PREDICTED: uncharacterized protein LOC105156...    192   4e-51    
emb|CDP15014.1|  unnamed protein product                                191   9e-51    
ref|XP_008239434.1|  PREDICTED: uncharacterized protein LOC103338033    191   1e-50    
ref|XP_010663723.1|  PREDICTED: uncharacterized protein LOC104882363    191   1e-50    
emb|CAN75660.1|  hypothetical protein VITISV_007922                     191   2e-50    
ref|XP_010319884.1|  PREDICTED: uncharacterized protein LOC101248293    189   3e-50    
ref|XP_010105165.1|  hypothetical protein L484_006903                   189   3e-50    
ref|XP_006579060.1|  PREDICTED: uncharacterized protein LOC100804523    188   8e-50    
ref|XP_004974479.1|  PREDICTED: uncharacterized protein LOC101777358    190   1e-49    
ref|XP_009385512.1|  PREDICTED: uncharacterized protein LOC103972858    187   1e-49    
ref|XP_004236344.1|  PREDICTED: uncharacterized protein LOC101266809    186   5e-49    
ref|XP_010926596.1|  PREDICTED: uncharacterized protein LOC105048...    186   8e-49    
gb|EEC83902.1|  hypothetical protein OsI_29927                          186   1e-48    
ref|XP_002511223.1|  conserved hypothetical protein                     185   1e-48    
ref|XP_009790449.1|  PREDICTED: uncharacterized protein LOC104237913    185   2e-48    
gb|KFK23943.1|  hypothetical protein AALP_AAs47289U000300               182   2e-48    
gb|EPS69426.1|  hypothetical protein M569_05342                         183   5e-48    
ref|XP_010677917.1|  PREDICTED: uncharacterized protein LOC104893506    183   6e-48    
ref|XP_006351484.1|  PREDICTED: uncharacterized protein LOC102589133    182   1e-47    
gb|EMT14280.1|  hypothetical protein F775_15615                         179   3e-47    
dbj|BAK03045.1|  predicted protein                                      180   2e-46    
ref|XP_007037921.1|  Uncharacterized protein isoform 2                  177   5e-46    
ref|XP_002443804.1|  hypothetical protein SORBIDRAFT_07g002340          177   1e-45    
gb|KFK23942.1|  hypothetical protein AALP_AAs47289U000300               173   2e-45    
ref|XP_010103194.1|  hypothetical protein L484_006745                   176   2e-45    
ref|XP_003572386.1|  PREDICTED: uncharacterized protein LOC100843...    177   2e-45    
ref|XP_007163736.1|  hypothetical protein PHAVU_001G259900g             176   3e-45    
ref|XP_009595631.1|  PREDICTED: uncharacterized protein LOC104091893    176   4e-45    
ref|XP_007209178.1|  hypothetical protein PRUPE_ppa006286mg             175   5e-45    
ref|XP_006659792.1|  PREDICTED: uncharacterized protein LOC102703606    174   6e-45    
ref|XP_003571346.1|  PREDICTED: uncharacterized protein LOC100832559    175   8e-45    
gb|KDP33413.1|  hypothetical protein JCGZ_06984                         169   1e-44    
ref|XP_011040401.1|  PREDICTED: uncharacterized protein LOC105136...    169   6e-44    
gb|EEE67982.1|  hypothetical protein OsJ_25908                          169   7e-44    
ref|XP_011044194.1|  PREDICTED: uncharacterized protein LOC105139...    168   1e-43    
ref|XP_010682847.1|  PREDICTED: uncharacterized protein LOC104897620    172   1e-43    
ref|NP_001060909.1|  Os08g0128200                                       170   8e-43    
gb|EMS55201.1|  hypothetical protein TRIUR3_27460                       165   1e-42    
gb|KDP26769.1|  hypothetical protein JCGZ_17927                         168   2e-42    
ref|XP_011029655.1|  PREDICTED: uncharacterized protein LOC105129...    166   6e-42    
gb|EMT23154.1|  hypothetical protein F775_00502                         170   1e-41    
ref|XP_002514965.1|  conserved hypothetical protein                     165   2e-41    
ref|XP_010235308.1|  PREDICTED: uncharacterized protein LOC100843...    165   4e-41    
dbj|BAK05137.1|  predicted protein                                      160   2e-40    
ref|XP_008337094.1|  PREDICTED: uncharacterized protein LOC103400212    161   2e-40    
ref|XP_010926598.1|  PREDICTED: uncharacterized protein LOC105048...    159   2e-40    
ref|XP_008650127.1|  PREDICTED: uncharacterized protein LOC103630859    164   4e-40    
gb|KHG19536.1|  Zinc finger CONSTANS-LIKE 2 -like protein               160   6e-40    
ref|XP_008647086.1|  PREDICTED: uncharacterized protein LOC103628708    153   1e-38    
gb|AFW71906.1|  hypothetical protein ZEAMMB73_453015                    153   1e-38    
dbj|BAD95208.1|  hypothetical protein                                   143   1e-36    
ref|XP_008787825.1|  PREDICTED: uncharacterized protein LOC103705753    150   2e-36    
gb|AFW74449.1|  hypothetical protein ZEAMMB73_867294                    154   2e-36    
emb|CDY03193.1|  BnaC09g19630D                                          148   2e-36    
gb|EMS68025.1|  hypothetical protein TRIUR3_00880                       139   1e-34    
gb|EMS68024.1|  hypothetical protein TRIUR3_00879                       135   2e-33    
ref|XP_006591463.1|  PREDICTED: uncharacterized protein LOC100793191    137   1e-31    
gb|EMT29017.1|  hypothetical protein F775_09132                         133   1e-31    
gb|EMS67581.1|  hypothetical protein TRIUR3_06791                       123   7e-29    
ref|XP_008645846.1|  PREDICTED: uncharacterized protein LOC103627317    120   2e-28    
gb|EMS62551.1|  hypothetical protein TRIUR3_23468                       113   6e-26    
ref|XP_006404546.1|  hypothetical protein EUTSA_v10000266mg             114   8e-25    
ref|XP_007045014.1|  Uncharacterized protein isoform 2                  110   5e-23    
gb|EMS62194.1|  hypothetical protein TRIUR3_14364                       107   1e-22    
dbj|BAC55624.1|  hypothetical protein                                   109   2e-22    
ref|NP_001062274.1|  Os08g0521300                                       110   2e-22    
gb|KCW86880.1|  hypothetical protein EUGRSUZ_B03466                   91.7    9e-17    
ref|XP_010044772.1|  PREDICTED: uncharacterized protein LOC104433...  91.3    9e-17    
ref|XP_009413210.1|  PREDICTED: uncharacterized protein LOC103994566  89.0    2e-16    
ref|XP_010926597.1|  PREDICTED: uncharacterized protein LOC105048...  88.2    9e-16    
emb|CBI41030.3|  unnamed protein product                              85.9    5e-14    
ref|XP_006440063.1|  hypothetical protein CICLE_v10023973mg           80.9    3e-13    
gb|KHN44419.1|  hypothetical protein glysoja_014460                   79.3    8e-13    
ref|XP_010065090.1|  PREDICTED: uncharacterized protein LOC104452299  77.4    9e-13    
gb|EMS62552.1|  hypothetical protein TRIUR3_23469                     74.7    4e-12    
ref|XP_009395205.1|  PREDICTED: uncharacterized protein LOC103980491  74.7    1e-11    
gb|KDP30953.1|  hypothetical protein JCGZ_11329                       68.9    2e-10    
gb|KDO52578.1|  hypothetical protein CISIN_1g029677mg                 69.7    4e-10    
emb|CDX95780.1|  BnaC05g35310D                                        68.6    1e-09    
gb|EMT27542.1|  hypothetical protein F775_25184                       65.5    4e-09    
gb|KFK23941.1|  hypothetical protein AALP_AAs47289U000300             66.6    6e-09    
gb|EMT25939.1|  hypothetical protein F775_44086                       64.3    2e-08    
gb|EMS67481.1|  hypothetical protein TRIUR3_31091                     62.0    1e-07    
gb|AFW61492.1|  hypothetical protein ZEAMMB73_890201                  61.6    3e-07    
ref|XP_008352164.1|  PREDICTED: uncharacterized protein LOC103415630  59.7    4e-06    
emb|CDY32904.1|  BnaC02g11880D                                        57.4    5e-06    
ref|XP_009417785.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    6e-05    



>ref|XP_009626940.1| PREDICTED: uncharacterized protein LOC104117579 [Nicotiana tomentosiformis]
Length=434

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/437 (71%), Positives = 375/437 (86%), Gaps = 4/437 (1%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             ++ ET ++   SK AL SS Y    N+ E+K++ SAL W+FLDQSN+WRAGLSWSLFFIL
Sbjct  2     EEGETGLLQTTSKEAL-SSGYSIHENSAEIKKIKSALTWVFLDQSNIWRAGLSWSLFFIL  60

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
             TIGVPLVS+ VF+C++CDS HQRPF+A+VQ+SLS+FAT+SF+SLS F+R+YG+R+FLFLD
Sbjct  61    TIGVPLVSHFVFACESCDSMHQRPFDAVVQVSLSLFATLSFVSLSAFSRKYGIRRFLFLD  120

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
             +L E+++KVQQ YT Q+H S+KIL++FVLP+F+A+  YKIWWF +GG QIPY YN  LSN
Sbjct  121   KLYEDSEKVQQEYTQQLHRSMKILSAFVLPSFIAESIYKIWWFSSGGTQIPYLYNAALSN  180

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIR  842
              ++CILL+ SWLYRI+ISFLVCVLFRLIC LQILRL+ FAQVFE+ES+V+ I+IEHLRIR
Sbjct  181   TLVCILLMCSWLYRISISFLVCVLFRLICCLQILRLEEFAQVFERESDVATIMIEHLRIR  240

Query  843   RNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFI  1022
             RNLRVISHRFR+FILSTLI+VT SQF++LL+TTE  S  +IF A EL L S+ +VTGLF+
Sbjct  241   RNLRVISHRFRVFILSTLILVTISQFLALLLTTEPSSTVNIFTAGELALSSITLVTGLFM  300

Query  1023  CLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwen  1202
             CLRSAAKITHKAQ+V SLAAKWHACAT+SSFD+  +ETP  +  + TPQ ++P+     +
Sbjct  301   CLRSAAKITHKAQAVTSLAAKWHACATISSFDDMDNETPTAQ--SATPQVVYPI-NSSWD  357

Query  1203  ddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
              DEEGDGDD LDNTNMVPVHAHTISY KRQALV+YFEHN+AGITVYGFMLDRTWLHTIF 
Sbjct  358   TDEEGDGDDVLDNTNMVPVHAHTISYQKRQALVSYFEHNRAGITVYGFMLDRTWLHTIFA  417

Query  1383  IQLSLTLWILNKTIGIS  1433
             IQLSLTLWILNKTIGIS
Sbjct  418   IQLSLTLWILNKTIGIS  434



>ref|XP_006352381.1| PREDICTED: uncharacterized protein LOC102604757 [Solanum tuberosum]
Length=434

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/437 (71%), Positives = 373/437 (85%), Gaps = 4/437 (1%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             ++ ET ++L+ S   L+SS Y     + E+K++ SAL W+FLDQSNLWRAGLSWSLFFIL
Sbjct  2     EEGETGLLLQ-SNKELLSSGYSIHEYSEEIKKIKSALTWVFLDQSNLWRAGLSWSLFFIL  60

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
             TIGVPLVS+ +F+C  CD+ HQRPF+A+VQ+SLS+FAT+SF+SLS FAR+YG+RKFLFLD
Sbjct  61    TIGVPLVSHFMFACLTCDTMHQRPFDALVQVSLSLFATLSFVSLSSFARKYGIRKFLFLD  120

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
             +L E+++KVQQGYT Q+H S+KIL+SFVLP+F+A+  YKIWWF +GG QIPY YN  LSN
Sbjct  121   KLYEDSEKVQQGYTEQLHRSMKILSSFVLPSFIAESIYKIWWFSSGGTQIPYLYNAALSN  180

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIR  842
             + +CILL+SSWLYRI+ISFLVCVLFRLIC LQILRL+ FAQVFEK+S+VS+I+IEHLRIR
Sbjct  181   IFVCILLISSWLYRISISFLVCVLFRLICSLQILRLEEFAQVFEKQSDVSSIMIEHLRIR  240

Query  843   RNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFI  1022
             RNLRVISHRFR+FILSTLI+VT SQF++LL+ TE  S  +IF A EL L S+ +VTGLF+
Sbjct  241   RNLRVISHRFRVFILSTLILVTISQFLALLLITEPSSTVNIFTAGELALSSITLVTGLFM  300

Query  1023  CLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwen  1202
             CLRSAAKITHKAQ+V SLAAKWHACAT+S+ D+  +ETP+ RT T   Q ++P+     +
Sbjct  301   CLRSAAKITHKAQAVTSLAAKWHACATISTLDDMTEETPMARTVTS--QVVYPI-NSSWD  357

Query  1203  ddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
              DEEGDGDD LDNTNMVP+HA TISY KRQALVTYFEHNKAGITVYGFMLDRTWLHTIF 
Sbjct  358   TDEEGDGDDVLDNTNMVPIHASTISYQKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFA  417

Query  1383  IQLSLTLWILNKTIGIS  1433
             IQLSLTLWILNKTIGIS
Sbjct  418   IQLSLTLWILNKTIGIS  434



>ref|XP_004250244.1| PREDICTED: uncharacterized protein LOC101249979 [Solanum lycopersicum]
Length=434

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/437 (70%), Positives = 372/437 (85%), Gaps = 4/437 (1%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             ++ ET ++L+ S   ++SS +    ++ E+K++ SAL W+FLDQSNLWRAGLSWS F IL
Sbjct  2     EEGETGLLLQ-SNKEMVSSGFSTNESSEEIKKIKSALTWVFLDQSNLWRAGLSWSFFSIL  60

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
             TIGVPLVS+ +F+C  CD+ HQRPF+A+VQ+SLS+FAT+SF+SLS FAR+YG+RKFLFLD
Sbjct  61    TIGVPLVSHFMFACLTCDTMHQRPFDALVQVSLSLFATLSFVSLSSFARKYGIRKFLFLD  120

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
             +L E+++KVQQGYT Q+H S+KIL+SFVLP+F+ +  YKIWWF +GG QIPY YN  LSN
Sbjct  121   KLYEDSEKVQQGYTEQLHRSMKILSSFVLPSFIVESIYKIWWFSSGGTQIPYLYNAALSN  180

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIR  842
             + +CILL+SSWLYRI+ISFLVCVLFRLIC LQILRL+ FAQVFEKE++VS+I++EHLRIR
Sbjct  181   IFVCILLISSWLYRISISFLVCVLFRLICSLQILRLEEFAQVFEKETDVSSIMMEHLRIR  240

Query  843   RNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFI  1022
             RNLRVISHRFR+FILSTLI+VT SQF++LL+TTE  S  +IF A EL L S+ +VTGLF+
Sbjct  241   RNLRVISHRFRVFILSTLILVTISQFLALLLTTEPSSTVNIFTAGELALSSITLVTGLFM  300

Query  1023  CLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwen  1202
             CLRSAAKITHKAQ+V SLAAKWHACAT+SS D+  +ETP+ R  +  PQ ++P+     +
Sbjct  301   CLRSAAKITHKAQAVTSLAAKWHACATISSLDDMTEETPMAR--SVAPQVVYPI-NSSWD  357

Query  1203  ddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
              DEEGDGDD LDNTNMVP+HA TISY KRQALVTYFEHNKAGITVYGFMLDRTWLHTIF 
Sbjct  358   TDEEGDGDDVLDNTNMVPIHASTISYQKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFA  417

Query  1383  IQLSLTLWILNKTIGIS  1433
             IQLSLTLWILNKTIGIS
Sbjct  418   IQLSLTLWILNKTIGIS  434



>ref|XP_009769724.1| PREDICTED: uncharacterized protein LOC104220540 [Nicotiana sylvestris]
Length=435

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/439 (70%), Positives = 371/439 (85%), Gaps = 4/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+ E   + +  SK AL SS Y    N+ E+K++ SAL W+FLDQSN+WRAGLSWSLFF
Sbjct  1     MEEGETGLLQITTSKEAL-SSGYSIHENSAEIKKIKSALTWVFLDQSNIWRAGLSWSLFF  59

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             ILTIGVPLVS+ VF+C++CDS HQRPF+A+VQ+SLS+FAT+SF+SLS F+R+YG+R+FLF
Sbjct  60    ILTIGVPLVSHFVFACESCDSMHQRPFDAVVQVSLSLFATLSFVSLSSFSRKYGIRRFLF  119

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LDRL E+++KVQQ YT Q+H S+KIL++FVLP+F+A+  YKIWWF +GG QIPY YN  L
Sbjct  120   LDRLYEDSEKVQQEYTQQLHRSMKILSAFVLPSFIAESIYKIWWFSSGGTQIPYLYNAAL  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             SN  +CILL+ SWLYRI+ISFLVCVLFRLI  LQI RL+ FAQVFEKES+V+ I+IEHLR
Sbjct  180   SNTFVCILLICSWLYRISISFLVCVLFRLISCLQIFRLEDFAQVFEKESDVATIMIEHLR  239

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRRNLRVISHRFR+FILSTLI+VT SQF++LL+TTE  S  +IF A EL L S+ +VTGL
Sbjct  240   IRRNLRVISHRFRVFILSTLILVTVSQFLALLLTTEPSSTVNIFTAGELALSSITLVTGL  299

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             F+CLRSAAKITHKAQ+V SLAAKWHACAT+SSFD+  +ETP  +  + T Q ++P+    
Sbjct  300   FMCLRSAAKITHKAQAVTSLAAKWHACATISSFDDIDNETPTGQ--SATTQVVYPI-NSS  356

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTI  1376
              + DEEGDGDD LDNTNMVPVHAHTISY KRQALV+YFEHN+AGITVYGFMLDRTWLHTI
Sbjct  357   WDTDEEGDGDDVLDNTNMVPVHAHTISYQKRQALVSYFEHNRAGITVYGFMLDRTWLHTI  416

Query  1377  FVIQLSLTLWILNKTIGIS  1433
             F IQLSLTLWILNKTIGIS
Sbjct  417   FAIQLSLTLWILNKTIGIS  435



>emb|CDP04462.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/439 (70%), Positives = 366/439 (83%), Gaps = 5/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+DE TE++L   K+    +S+HE      +K+  S+ AW FLDQS+LWRAGLSWSLFF
Sbjct  1     MEEDE-TEVLLSKYKSLPAENSFHEHEATVGLKKFTSSPAWFFLDQSSLWRAGLSWSLFF  59

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +LTIGVPLVS+ VF+C +CD  H RPF++IVQLSLSVFAT+SFISL  F R YG+RKFLF
Sbjct  60    LLTIGVPLVSHFVFACSSCDQDHVRPFDSIVQLSLSVFATLSFISLYSFTRSYGLRKFLF  119

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+L +E++KV+ GYTLQI  SLKIL++FVLP FLAD  YKIWWF +GG QIPYFYN+ L
Sbjct  120   LDKLSDESEKVRHGYTLQIERSLKILSAFVLPCFLADGVYKIWWFASGGTQIPYFYNVYL  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++++C+LLLSSWLYR ++SFLVCVLFRLIC+LQILRL+ FAQVFEKES+V+AIL+EHL+
Sbjct  180   SHIIVCVLLLSSWLYRTSVSFLVCVLFRLICYLQILRLEDFAQVFEKESDVAAILLEHLK  239

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRRNLRVISHRFR FILS+LI+VTASQF SLLVTTES S  +I  A EL LCS+ +VTGL
Sbjct  240   IRRNLRVISHRFRRFILSSLILVTASQFASLLVTTESSSTVNISTAGELALCSITLVTGL  299

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             FICLRSAAKITHKAQSV SLAAKWH C+T +SFD+F  ETP  R+   + QAI+     +
Sbjct  300   FICLRSAAKITHKAQSVTSLAAKWHICSTTNSFDDFDAETP--RSHITSDQAIYTDSDAY  357

Query  1197  -enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              + D+EEGDGDDE+DNTNMVPV  H +SY KRQALVTYFEHN+AGITVYGFMLDR+WLHT
Sbjct  358   CDTDNEEGDGDDEIDNTNMVPV-IHAVSYQKRQALVTYFEHNRAGITVYGFMLDRSWLHT  416

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             I  IQLSLTLWILNKTIGI
Sbjct  417   IVAIQLSLTLWILNKTIGI  435



>ref|XP_011096020.1| PREDICTED: uncharacterized protein LOC105175311 [Sesamum indicum]
 ref|XP_011096021.1| PREDICTED: uncharacterized protein LOC105175311 [Sesamum indicum]
Length=434

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/437 (69%), Positives = 365/437 (84%), Gaps = 4/437 (1%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             + E  E++L  +K+ L  +S+ E     E+K   S L W+FLD S+LWR GLSWS+FF+L
Sbjct  2     EAEVAEVLLSKNKSVLSGNSHGE--GNCELKSYSSGLKWVFLDYSSLWRTGLSWSIFFLL  59

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
              IGVPLVS+ VFSC  CD  HQRP++AIVQLSLS+FA +SFISLS FAR+YG+R+FLFLD
Sbjct  60    NIGVPLVSHFVFSCSDCDPSHQRPYDAIVQLSLSLFAALSFISLSSFARKYGLRRFLFLD  119

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
             +L +E++KV+QGYT Q+H S+K+L++FVLP F AD  YKIWWF +GG QIPY YNM LS 
Sbjct  120   KLYDESEKVRQGYTQQLHRSVKLLSAFVLPCFFADSVYKIWWFSSGGTQIPYLYNMYLSK  179

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIR  842
             V++CILL+ SWLYRI+I FLVC+LFRL C+LQILRL+ FAQVFE+ES+V++ILIEHLRIR
Sbjct  180   VIVCILLMCSWLYRISICFLVCLLFRLTCYLQILRLEEFAQVFERESDVASILIEHLRIR  239

Query  843   RNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFI  1022
             RNLRVISHRFR+FILSTLI+VT SQFVSLLVTTE +S  +I  + EL LCS+ +VTGL I
Sbjct  240   RNLRVISHRFRVFILSTLILVTISQFVSLLVTTEPRSKINISTSGELALCSITLVTGLLI  299

Query  1023  CLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwen  1202
             CLRSAAKITHKAQSV SLAAKWHACAT+ SFDE  DETP  +  +   +A +PV ++W++
Sbjct  300   CLRSAAKITHKAQSVTSLAAKWHACATIDSFDELDDETPTAQIASA--RAGYPVTSNWDS  357

Query  1203  ddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
             D EEGDGDD LDNTN+VP++A+TI+Y KRQALVTYFEHN+AGITVYGFMLDRTWLHTIF 
Sbjct  358   DTEEGDGDDALDNTNLVPIYANTITYQKRQALVTYFEHNRAGITVYGFMLDRTWLHTIFA  417

Query  1383  IQLSLTLWILNKTIGIS  1433
             IQLSLTLWILNKTIGIS
Sbjct  418   IQLSLTLWILNKTIGIS  434



>gb|EYU27744.1| hypothetical protein MIMGU_mgv1a006618mg [Erythranthe guttata]
Length=437

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/439 (67%), Positives = 360/439 (82%), Gaps = 2/439 (0%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME +  TEI+L    +     S+HE+ N+ E+K   S L W+F D S+ WRAGLSWS+FF
Sbjct  1     MEAEVITEILLPKKNSISAGDSFHEL-NSFELKSYGSGLKWVFHDYSSFWRAGLSWSVFF  59

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L +GVP+VS+ VFSC  CD  HQRP++A+VQ+SLS+FATISF+S+S FAR+YG+R+FLF
Sbjct  60    LLNVGVPIVSHFVFSCSGCDPSHQRPYDAVVQVSLSLFATISFVSISTFARKYGLRRFLF  119

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+L ++++KV+ GYT Q+H S+++L++FVLP F AD  YKIWWF +GG QIPY YNM L
Sbjct  120   LDKLSDDHEKVRLGYTDQLHKSMRLLSAFVLPCFFADSVYKIWWFTSGGNQIPYLYNMYL  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             SN ++C+LLL SWLYR++I FLVC+LFRL C LQ+LRLD FAQVFE ES+V++IL+EHLR
Sbjct  180   SNTIVCLLLLCSWLYRVSICFLVCILFRLTCFLQLLRLDEFAQVFEGESDVASILLEHLR  239

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRRNLRVISHRFRLFILSTLI+VT SQFVSLLVTTE +S  ++  A EL LCS+ +VTGL
Sbjct  240   IRRNLRVISHRFRLFILSTLILVTISQFVSLLVTTEPRSKINLATAGELALCSITLVTGL  299

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              ICLRSAAKITHKAQSV SLAAKWHACAT++SFDE  DETP       +  A + V  +W
Sbjct  300   LICLRSAAKITHKAQSVTSLAAKWHACATINSFDELEDETPRAPI-LSSANAGNSVAPNW  358

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTI  1376
             + DDEEGDGDD LDNTN+VP+ A+T+SY KRQALVTYFEHN+AGITVYGFMLDRTWLHTI
Sbjct  359   DFDDEEGDGDDSLDNTNLVPIFANTMSYQKRQALVTYFEHNRAGITVYGFMLDRTWLHTI  418

Query  1377  FVIQLSLTLWILNKTIGIS  1433
             F IQLSLTLWILNKTIGIS
Sbjct  419   FAIQLSLTLWILNKTIGIS  437



>gb|EPS71807.1| hypothetical protein M569_02947, partial [Genlisea aurea]
Length=426

 Score =   508 bits (1307),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 264/414 (64%), Positives = 317/414 (77%), Gaps = 14/414 (3%)
 Frame = +3

Query  204   REVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNA  383
              E+K   S L W FLD SNLWRAGLSWS+FF+L +GVPLVS+LVFSC  CD  HQRP++A
Sbjct  23    EEMKSYASGLMWAFLDYSNLWRAGLSWSIFFLLNVGVPLVSHLVFSCSGCDPNHQRPYDA  82

Query  384   IVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASF  563
             IVQ+ LS FA++SFISLS F  RYG+RKFLFLD+L  E++ V+ GY+ QI  SLK+L++F
Sbjct  83    IVQIFLSSFASVSFISLSSFGHRYGLRKFLFLDKLSHESETVRDGYSQQIQRSLKLLSAF  142

Query  564   VLPTFLADCAYKIWWFVT-GGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
             VLP  LA+ AYKIWWF + G G IPYFY+ +L+ +V+C+LL+SSW+YRIAI +LVC+LFR
Sbjct  143   VLPCSLAEAAYKIWWFSSVGDGGIPYFYSRLLTKLVVCLLLISSWVYRIAIGYLVCILFR  202

Query  741   LICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQF  920
             L CHLQ+LRL+ F  +F+K+S+V+AIL EHLRIRRNLRVISHRFRLFILSTL++V+ SQF
Sbjct  203   LTCHLQLLRLNEFTDLFQKQSDVTAILAEHLRIRRNLRVISHRFRLFILSTLVLVSVSQF  262

Query  921   VSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             V LLVTTE KS   I  A EL LCS+ +VTGLFICLRSAAKITHKA SVAS AAKWHACA
Sbjct  263   VFLLVTTEPKSQVSISTAGELALCSVTLVTGLFICLRSAAKITHKALSVASFAAKWHACA  322

Query  1101  TLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM-VP--VHAHT  1271
             T+++FDE  D+     T T    +                   + D  NM VP  V  ++
Sbjct  323   TINTFDEEDDDGDETTTTTAAITSAR----------LRFSAPSDEDEDNMFVPASVSWNS  372

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              SY KRQALV Y EHN+AGITVYGFMLDR+WLHTIFVIQLS TLWILNKTIGIS
Sbjct  373   ESYQKRQALVKYLEHNRAGITVYGFMLDRSWLHTIFVIQLSFTLWILNKTIGIS  426



>ref|XP_003632960.2| PREDICTED: uncharacterized protein LOC100854830 [Vitis vinifera]
Length=434

 Score =   503 bits (1294),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 264/434 (61%), Positives = 334/434 (77%), Gaps = 7/434 (2%)
 Frame = +3

Query  126   DEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             +EE E  LR +K     S Y  +    E++   S L W+ +DQSNLWR GLSWS+FF+L 
Sbjct  2     EEEREFFLRSNKAF---SGYLGLEGG-ELQSFRSCLKWVCVDQSNLWRTGLSWSIFFVLA  57

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             IGVP++S+ +FSC +CD KH RP++ IVQLSLS  A +SFISLS   ++YG+R+ LFLD+
Sbjct  58    IGVPILSHFLFSCSSCDDKHARPYDVIVQLSLSSLAALSFISLSALVKKYGLRRSLFLDK  117

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             LC+ ++KV+ GYT Q+H S+K+L+ FVLP F  + AYKIWW++TG  QIPY  N+ LS+ 
Sbjct  118   LCDVSEKVRLGYTQQLHRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLGNIYLSHA  177

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
             + C L L SWLYR AI  LVCVLFRLICH+QILRL+ FAQVF+KES+V ++L EHLRIRR
Sbjct  178   IACTLELCSWLYRTAIFLLVCVLFRLICHMQILRLEDFAQVFQKESDVGSVLKEHLRIRR  237

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
             NLR+ISHRFR+FILS+LI+VTASQ  SLL+TT S +   I+ A EL LCS+ +VTGL IC
Sbjct  238   NLRIISHRFRVFILSSLILVTASQLASLLITTRSSAKVTIYKAGELALCSISLVTGLGIC  297

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwend  1205
             LRSA KITHKAQSV  LAAKWH CAT+ +FD    ETP  R  +     + PV+ +W +D
Sbjct  298   LRSATKITHKAQSVTCLAAKWHVCATIDTFDATDGETPTIRAASA---QVFPVNTNWGSD  354

Query  1206  deegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVI  1385
             DEEGDGDD LDNT M+P++AHTIS+HKRQALVTY E+N+AGITV+GFMLDRTWLHTIF +
Sbjct  355   DEEGDGDDALDNTKMIPIYAHTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHTIFGV  414

Query  1386  QLSLTLWILNKTIG  1427
             ++SL LW+L+KTI 
Sbjct  415   EMSLVLWLLSKTIA  428



>emb|CBI41058.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   482 bits (1240),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 246/409 (60%), Positives = 311/409 (76%), Gaps = 24/409 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +DQSNLWR GLSWS+FF+L IGVP++S+ +FSC +CD KH RP++ I
Sbjct  32    ELQSFRSCLKWVCVDQSNLWRTGLSWSIFFVLAIGVPILSHFLFSCSSCDDKHARPYDVI  91

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
                                  +YG+R+ LFLD+LC+ ++KV+ GYT Q+H S+K+L+ FV
Sbjct  92    ---------------------KYGLRRSLFLDKLCDVSEKVRLGYTQQLHRSMKLLSLFV  130

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F  + AYKIWW++TG  QIPY  N+ LS+ + C L L SWLYR AI  LVCVLFRLI
Sbjct  131   LPCFAVEIAYKIWWYITGATQIPYLGNIYLSHAIACTLELCSWLYRTAIFLLVCVLFRLI  190

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CH+QILRL+ FAQVF+KES+V ++L EHLRIRRNLR+ISHRFR+FILS+LI+VTASQ  S
Sbjct  191   CHMQILRLEDFAQVFQKESDVGSVLKEHLRIRRNLRIISHRFRVFILSSLILVTASQLAS  250

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT S +   I+ A EL LCS+ +VTGL ICLRSA KITHKAQSV  LAAKWH CAT+
Sbjct  251   LLITTRSSAKVTIYKAGELALCSISLVTGLGICLRSATKITHKAQSVTCLAAKWHVCATI  310

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
              +FD    ETP  R  +     + PV+ +W +DDEEGDGDD LDNT M+P++AHTIS+HK
Sbjct  311   DTFDATDGETPTIRAASA---QVFPVNTNWGSDDEEGDGDDALDNTKMIPIYAHTISFHK  367

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALVTY E+N+AGITV+GFMLDRTWLHTIF +++SL LW+L+KTIGIS
Sbjct  368   RQALVTYLENNRAGITVFGFMLDRTWLHTIFGVEMSLVLWLLSKTIGIS  416



>ref|XP_006467360.1| PREDICTED: uncharacterized protein LOC102610018 [Citrus sinensis]
 gb|KDO78392.1| hypothetical protein CISIN_1g014115mg [Citrus sinensis]
 gb|KDO78393.1| hypothetical protein CISIN_1g014115mg [Citrus sinensis]
Length=430

 Score =   482 bits (1240),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 241/407 (59%), Positives = 314/407 (77%), Gaps = 5/407 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S L W+ +DQSN+WRAGLSWS+FF+L IG PLVS+ +  C  CD++HQRP++AI
Sbjct  26    ELKSFTSCLKWVCVDQSNIWRAGLSWSIFFLLVIGSPLVSHFLLLCSTCDNQHQRPYDAI  85

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SLSVFA ISF+SLS ++R+YG+ +FLFLD+L +E++KV Q Y  Q+  S+K+L  FV
Sbjct  86    VQVSLSVFAIISFLSLSSWSRKYGLNRFLFLDKLSDESEKVCQEYAAQLRRSMKLLCIFV  145

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F  +CAYKIWW++TG  +IPYFYN   SN++ CIL L SWLYRI+I  L C+L++LI
Sbjct  146   LPCFGFECAYKIWWYITGASEIPYFYNTYASNIIACILQLCSWLYRISIYILACILYQLI  205

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+L +++++  AQ F+KE+EV +IL EHLRIRRNLR+ISHR+R FIL +LI+VTASQFVS
Sbjct  206   CYLHLVKMEDLAQFFQKEAEVVSILHEHLRIRRNLRIISHRYRAFILLSLILVTASQFVS  265

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL  T S +H +IF A EL LCS+ +VTGLFICLRSAAKITH+AQS+ SLAA+WH CAT+
Sbjct  266   LLTITRSSAHNNIFEAGELALCSISLVTGLFICLRSAAKITHRAQSITSLAARWHVCATI  325

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             +S+D+   ETP   T   T   + PV  DWE+D+E    D +    N  P++  T+SY K
Sbjct  326   NSYDDLDGETP---TAQITAPQVFPVTDDWESDEEVDGDDLDNTKIN--PIYPQTVSYQK  380

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             RQALVTY E+N+AGITV+GFM+DRTWLH IF I+L L LW+LNKTI 
Sbjct  381   RQALVTYLENNRAGITVFGFMMDRTWLHAIFGIELGLLLWLLNKTIA  427



>ref|XP_007214525.1| hypothetical protein PRUPE_ppa015325mg [Prunus persica]
 gb|EMJ15724.1| hypothetical protein PRUPE_ppa015325mg [Prunus persica]
Length=484

 Score =   479 bits (1234),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 326/437 (75%), Gaps = 11/437 (3%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSY-HEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             MED+ ++     LSK   IS    HE     E+K   + L W+F+DQSN+WR G+SWS+F
Sbjct  1     MEDERQS----FLSKDRAISGYIAHE---GLELKNFDACLKWVFVDQSNVWRTGISWSIF  53

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+L IGVPLVS+ + SC  CD  H RP++ + QLSLS+F+ ++FISLSC+ R+YG+R+FL
Sbjct  54    FVLAIGVPLVSHFLLSCSDCDENHSRPYHVVSQLSLSLFSVLAFISLSCWTRKYGLRRFL  113

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+L + ++KV+ GY  Q  +SLK+L   V P F A+C YKIWW+V+G  ++PY+ N+ 
Sbjct  114   FLDKLYDASEKVRHGYKQQFQNSLKLLCMIVFPCFAAECLYKIWWYVSGATELPYYGNIY  173

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             LSN ++C L L SWLYR  I FLVCVLFRLICHLQILRL+ FAQVF+KE+EV  IL+EHL
Sbjct  174   LSNTILCTLELCSWLYRTTIFFLVCVLFRLICHLQILRLENFAQVFQKETEVELILMEHL  233

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRRNLR++SHRFR+FIL +LI+VTASQ +SL++ T S +H +IF A EL LCS+ +V  
Sbjct  234   KIRRNLRLMSHRFRVFILLSLIMVTASQLISLVMVTRSSAHVNIFKAGELALCSISLVIS  293

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             LFICLRSA KITHKAQS+  LAAKWH CAT+ SFD    ETP+    +     + P  AD
Sbjct  294   LFICLRSATKITHKAQSITGLAAKWHVCATIQSFDYTESETPMAPISSA---QVFPFGAD  350

Query  1194  wenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              E++D+E   DD+LDNT +VP++  TIS+ KRQALV Y E+N+AGITV+GF +DR WLH+
Sbjct  351   TESEDDEAGEDDDLDNTRLVPIYTQTISFQKRQALVKYLENNRAGITVFGFTVDRMWLHS  410

Query  1374  IFVIQLSLTLWILNKTI  1424
             IF IQL+L LW+LNKTI
Sbjct  411   IFAIQLALLLWLLNKTI  427



>ref|XP_008224762.1| PREDICTED: uncharacterized protein LOC103324482 [Prunus mume]
Length=428

 Score =   475 bits (1223),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 326/438 (74%), Gaps = 11/438 (3%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSY-HEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             MED+ ++     LSK   IS    HE     E+K   + L W+F+DQSN+WR G+SWS+F
Sbjct  1     MEDERQS----FLSKHRAISGYIGHE---GLELKNFDACLKWVFVDQSNVWRTGISWSIF  53

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+L IGVPLVS+ + SC  CD  H RP++ + QLSLS+F+ ++FISLSC+ R+YG+R+FL
Sbjct  54    FVLAIGVPLVSHFLLSCSDCDENHSRPYHVVSQLSLSLFSVLAFISLSCWTRKYGLRRFL  113

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+L + ++KV+ GY  Q  +S K+L   V P F A+C YKIWW+V+G  ++PY+ N+ 
Sbjct  114   FLDKLYDASEKVRHGYKQQFQNSTKLLCMIVFPCFAAECLYKIWWYVSGATELPYYGNIY  173

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             LS+ ++C L L SWLYR  I FLVCVLFRLICHLQILRL+ FAQVF+KE+EV  IL+EHL
Sbjct  174   LSDTILCTLELCSWLYRTTIFFLVCVLFRLICHLQILRLENFAQVFQKETEVELILMEHL  233

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRRNLR++SHRFR+FIL +LI+VTASQ +SL++ T S +H +IF A +L LCS+ +V  
Sbjct  234   KIRRNLRLMSHRFRVFILLSLIMVTASQLISLVMVTRSSAHVNIFKAGDLALCSISLVIS  293

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             LFICLRSA KITHKAQS+  LAAKWH CAT+ SFD    ETP+    +     + P  AD
Sbjct  294   LFICLRSATKITHKAQSITGLAAKWHVCATIQSFDYTESETPMAPISSA---QVFPFGAD  350

Query  1194  wenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              E++D+E   DD+LDNT +VP++  TIS+ KRQALV Y E+N+AGITV+GF +DR WLH+
Sbjct  351   TESEDDEAGEDDDLDNTRLVPIYTQTISFQKRQALVKYLENNRAGITVFGFTVDRMWLHS  410

Query  1374  IFVIQLSLTLWILNKTIG  1427
             IF IQL+L LW+LNKTIG
Sbjct  411   IFAIQLALLLWLLNKTIG  428



>gb|KDP20685.1| hypothetical protein JCGZ_21156 [Jatropha curcas]
Length=434

 Score =   475 bits (1222),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 236/398 (59%), Positives = 311/398 (78%), Gaps = 0/398 (0%)
 Frame = +3

Query  231   LAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVF  410
             L W+  D+SN+WR  LSWS+FFIL I VPLVS+ +F C  CDSKH+RP++A+VQLSLS+F
Sbjct  33    LNWVCPDRSNIWRTSLSWSIFFILVIVVPLVSHFLFLCSNCDSKHRRPYDAVVQLSLSIF  92

Query  411   ATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADC  590
             A ISF+SLS ++ +YG+ KFLFLD+L +E ++++  Y  Q+ +S K+L  FVLP F  + 
Sbjct  93    AIISFLSLSSWSHKYGLNKFLFLDKLNDETERIRGEYKQQLQTSTKLLCIFVLPCFALES  152

Query  591   AYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRL  770
             AY+IWW+ TG  +IPYF NM +S+ +IC+L LSSW+YR++I  +VC+L++LIC+LQ+LRL
Sbjct  153   AYRIWWYATGVSEIPYFGNMYISDTIICLLQLSSWVYRMSIYIVVCILYKLICYLQVLRL  212

Query  771   DGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESK  950
             + F QVF+KES+VS+IL EHLRIRRNLR+ISHRFR FIL +LI+VTASQF+ LL+TT S 
Sbjct  213   EDFGQVFQKESDVSSILKEHLRIRRNLRIISHRFRRFILLSLILVTASQFIYLLMTTRSS  272

Query  951   SHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD  1130
             ++ +IF A EL LCS+ +V GLFICLRSA KITHKAQSV SLA KWH CAT++S+D+   
Sbjct  273   ANNNIFEAGELALCSINLVAGLFICLRSATKITHKAQSVTSLATKWHVCATINSYDDMDG  332

Query  1131  ETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             ETP  +  T + Q  H       +D+++   DD  DN  MVP+ AHTIS+ KRQALVTY 
Sbjct  333   ETPTYQISTCSRQVFHVDIDWSLDDEDDEGDDDLDDNNKMVPIFAHTISFQKRQALVTYM  392

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+N+AG+TVYGFM+DR WLHTIF I+L+L LW+LNKTI
Sbjct  393   ENNRAGMTVYGFMMDRAWLHTIFGIELALLLWLLNKTI  430



>ref|XP_010057868.1| PREDICTED: uncharacterized protein LOC104445657 [Eucalyptus grandis]
 gb|KCW75210.1| hypothetical protein EUGRSUZ_E03959 [Eucalyptus grandis]
Length=435

 Score =   474 bits (1221),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 329/439 (75%), Gaps = 4/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+    ++ R   ++ +SS     S   E+    S   W+ +DQS+LW  GLSWS+FF
Sbjct  1     MEDEARAFVLRRKPISSYLSSPVLP-SEPVELNSFTSCFKWVCVDQSSLWLTGLSWSVFF  59

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +  + VPL S+ +  C +CD+  QRP++  VQ+SLSVFA ISF+ LS ++R+YG+RKFLF
Sbjct  60    LFAVAVPLASHFLLQCSSCDANLQRPYHIPVQISLSVFAAISFVCLSRWSRKYGIRKFLF  119

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ +D V++GY+ Q+  S+K+   FVLP F  + AYK+WWF+ G   IPY+ N+ +
Sbjct  120   LDKLCDSSDNVRRGYSQQLQRSVKLWTWFVLPCFAVETAYKLWWFIDGSTNIPYYGNLYV  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S+ ++C L L SWLYR AI  LVCVL+RLIC+L ILRL+ FA VFEKE+EV +IL EHLR
Sbjct  180   SDTILCALELLSWLYRTAIFILVCVLYRLICYLHILRLEDFAHVFEKETEVVSILKEHLR  239

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
              RR LR+ISHRFR F+L  LI+VTASQF+ +L+ T S ++A+IF A EL LCS+ ++TGL
Sbjct  240   FRRTLRIISHRFRSFLLLCLILVTASQFIFVLLLTRSGANANIFKAGELSLCSVSLLTGL  299

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             FICLRSA K++HKAQS+  LAAKWH CAT++SFD+   ETP     +     + P DA+W
Sbjct  300   FICLRSATKVSHKAQSITGLAAKWHICATINSFDDNDGETPRIEVAS---THVFPADAEW  356

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTI  1376
             E+++EEGDGDD+L+N  ++P++AHTIS+HKRQALVTY EHNKAGITVYGFMLDRT+LHTI
Sbjct  357   ESEEEEGDGDDDLNNAKIMPIYAHTISFHKRQALVTYLEHNKAGITVYGFMLDRTYLHTI  416

Query  1377  FVIQLSLTLWILNKTIGIS  1433
             F I+ +L LW+LNKTIGIS
Sbjct  417   FGIEFALFLWLLNKTIGIS  435



>ref|XP_007026217.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY28839.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=458

 Score =   474 bits (1220),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 246/411 (60%), Positives = 320/411 (78%), Gaps = 8/411 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K     L W+ LDQS+LWR GLSWS+FF+L +GVP+VS+ V  C  CD +HQRP++ +
Sbjct  25    ELKSFRLCLYWVCLDQSSLWRVGLSWSVFFVLAVGVPIVSHFVLLCSNCDEEHQRPYDGL  84

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS FA ISFISLS +AR+YG+R+FLFLD+LC+ +DKV+QGY  ++  S+K+L  FV
Sbjct  85    VQLSLSSFAAISFISLSSWARKYGIRRFLFLDKLCDVSDKVRQGYAKELQKSMKLLCIFV  144

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+ AY+IWW+ TG  QIPY  N  +S+++ C L LSSWLYR +I  L C+L++L 
Sbjct  145   LPCFAAESAYRIWWYATGASQIPYLGNYYISDIIACTLQLSSWLYRTSIFILACILYQLT  204

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL+ FAQVF+KE+EV +IL EHLRIRRNLR+ISHRFRLF+L +L+ +TASQF++
Sbjct  205   CHLQILRLEDFAQVFQKETEVGSILAEHLRIRRNLRIISHRFRLFLLLSLVFITASQFIA  264

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             L +TT + +  + + A EL LCS+ +VTGLFICLRSA KITH+AQS+ SLAAKWH CAT+
Sbjct  265   LFMTTRTSTTVNFYEAGELALCSISLVTGLFICLRSATKITHRAQSITSLAAKWHVCATI  324

Query  1107  SSFDEFGDETPVDR--TGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISY  1280
             +SFD+   ETP  +  +    P  +          +EE DG+D+LDNTN+VP+ AHTIS+
Sbjct  325   NSFDDADGETPTAQIVSSQMLPAGV------DWESEEEEDGEDDLDNTNLVPIFAHTISF  378

Query  1281  HKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              KRQALVTY EHN+AGITV+GFM+DRT +HTIFVI+L+L LW+LNKTIGIS
Sbjct  379   QKRQALVTYLEHNRAGITVFGFMVDRTGIHTIFVIELALLLWLLNKTIGIS  429



>ref|XP_006449827.1| hypothetical protein CICLE_v10015536mg [Citrus clementina]
 gb|ESR63067.1| hypothetical protein CICLE_v10015536mg [Citrus clementina]
Length=391

 Score =   468 bits (1205),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 306/389 (79%), Gaps = 5/389 (1%)
 Frame = +3

Query  267   RAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFA  446
             RAGLSWS+FF+L IG PLVS+ +  C ACD++HQRP++AIVQ+SLSVFA ISF+SLS ++
Sbjct  6     RAGLSWSIFFLLVIGSPLVSHFLLLCSACDNQHQRPYDAIVQVSLSVFAIISFLSLSSWS  65

Query  447   RRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG  626
             R+YG+ +FLFLD+L +E++KV Q Y  Q+  S+K+L  FVLP F  +CAYKIWW++TG  
Sbjct  66    RKYGLNRFLFLDKLSDESEKVCQEYAAQLRRSMKLLCIFVLPCFGFECAYKIWWYITGAS  125

Query  627   QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESE  806
             +IPYFYN   SN++ CIL L SWLYRI+I  L C+L++L+C+L +++++ FAQ F+KE+E
Sbjct  126   EIPYFYNTHASNIIACILQLCSWLYRISIYILACILYQLVCYLHLVKMEDFAQFFQKEAE  185

Query  807   VSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELG  986
             V +IL EHLRIRRNLR+ISHR+R FIL +LI+VTASQF+SLL  T S +H +IF A EL 
Sbjct  186   VVSILQEHLRIRRNLRIISHRYRAFILLSLILVTASQFISLLTITRSSAHNNIFEAGELA  245

Query  987   LCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTP  1166
             LCS+ +VTGLFICLRSAAKITH+AQS+ SLAA+WH CAT++S+D+   ETP   T   T 
Sbjct  246   LCSISLVTGLFICLRSAAKITHRAQSITSLAARWHVCATINSYDDLDGETP---TAQITA  302

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGF  1346
               + PV  DWE+D+E    D +    N  P++A T+SY KRQALVTY E+N+AGITV+GF
Sbjct  303   PQVFPVTDDWESDEEVDGDDLDNTKIN--PIYAQTVSYQKRQALVTYLENNRAGITVFGF  360

Query  1347  MLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             M+DRTWLH IF I+L L LW+LNKTIGIS
Sbjct  361   MMDRTWLHAIFGIELGLLLWLLNKTIGIS  389



>ref|XP_007026218.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY28840.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=430

 Score =   469 bits (1206),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/407 (60%), Positives = 316/407 (78%), Gaps = 4/407 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K     L W+ LDQS+LWR GLSWS+FF+L +GVP+VS+ V  C  CD +HQRP++ +
Sbjct  25    ELKSFRLCLYWVCLDQSSLWRVGLSWSVFFVLAVGVPIVSHFVLLCSNCDEEHQRPYDGL  84

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS FA ISFISLS +AR+YG+R+FLFLD+LC+ +DKV+QGY  ++  S+K+L  FV
Sbjct  85    VQLSLSSFAAISFISLSSWARKYGIRRFLFLDKLCDVSDKVRQGYAKELQKSMKLLCIFV  144

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+ AY+IWW+ TG  QIPY  N  +S+++ C L LSSWLYR +I  L C+L++L 
Sbjct  145   LPCFAAESAYRIWWYATGASQIPYLGNYYISDIIACTLQLSSWLYRTSIFILACILYQLT  204

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL+ FAQVF+KE+EV +IL EHLRIRRNLR+ISHRFRLF+L +L+ +TASQF++
Sbjct  205   CHLQILRLEDFAQVFQKETEVGSILAEHLRIRRNLRIISHRFRLFLLLSLVFITASQFIA  264

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             L +TT + +  + + A EL LCS+ +VTGLFICLRSA KITH+AQS+ SLAAKWH CAT+
Sbjct  265   LFMTTRTSTTVNFYEAGELALCSISLVTGLFICLRSATKITHRAQSITSLAAKWHVCATI  324

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             +SFD+   ETP   T       + P   DWE+++EE   DD  + TN+VP+ AHTIS+ K
Sbjct  325   NSFDDADGETP---TAQIVSSQMLPAGVDWESEEEEDGEDDLDN-TNLVPIFAHTISFQK  380

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             RQALVTY EHN+AGITV+GFM+DRT +HTIFVI+L+L LW+LNKTI 
Sbjct  381   RQALVTYLEHNRAGITVFGFMVDRTGIHTIFVIELALLLWLLNKTIA  427



>ref|XP_008447712.1| PREDICTED: uncharacterized protein LOC103490125 [Cucumis melo]
Length=434

 Score =   468 bits (1203),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 235/410 (57%), Positives = 314/410 (77%), Gaps = 3/410 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQS++W AGLSWS+FF+  I VP  S+ + +C +CDS H RPF+ +
Sbjct  27    ELHSFRSYLRWMCVDQSDIWTAGLSWSMFFLFAIIVPATSHFLLACSSCDSNHARPFDRV  86

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F RRYG+R+FLF D+LC+E++ V++GYT++++ SL++L++FV
Sbjct  87    VQLSLSSVATVSFLCLSSFIRRYGLRRFLFFDKLCDESETVRRGYTIKLNRSLRVLSTFV  146

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+ AYKIWW+ +G  QIP+  N+I+S+VV C + L SWLYR  + FLVC+LFRLI
Sbjct  147   IPCFAAESAYKIWWYASGASQIPFLGNVIVSDVVACCMELLSWLYRTTVIFLVCILFRLI  206

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C LQILRL  FA VF+ +S+V+++L EHLRIRR+LR+ISHR+R+FIL +L++VT SQF S
Sbjct  207   CDLQILRLQDFATVFQVDSDVASVLSEHLRIRRHLRIISHRYRVFILGSLVLVTGSQFTS  266

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT+S S+ +I+ A EL LCSM ++T L I LRSA KITHKAQSV +LAAKWH CATL
Sbjct  267   LLITTKSSSNLNIYIAGELALCSMTLLTSLMILLRSATKITHKAQSVTALAAKWHVCATL  326

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYH  1283
              SFD    ETP+  T        H V    E++ +EG  +D+LDNT ++P +A+ TIS+ 
Sbjct  327   DSFDVTDGETPMASTIHQAFPTHHGV--GEESEGDEGCDEDDLDNTKLIPAYAYSTISFQ  384

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             KRQALVTYFE+N+AGIT+YGF LDRT LHTIF I+LSL LW+L KTIG S
Sbjct  385   KRQALVTYFENNRAGITIYGFTLDRTTLHTIFGIELSLVLWLLGKTIGFS  434



>ref|XP_010686754.1| PREDICTED: uncharacterized protein LOC104900923 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   468 bits (1204),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 254/440 (58%), Positives = 334/440 (76%), Gaps = 4/440 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED E          ++  +  Y       E+K L   L W  +DQSN W+  LSWS+FF
Sbjct  1     MEDQERENNNNNHLLSSKTTQKYILHYEDSELKNLRVFLTWACVDQSNPWKTSLSWSVFF  60

Query  297   ILTIGVPLVSYLVFSCDAC-DSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             +  IGVP+V++ V  C +C D  H +PF++IV+LSLS  + +SF+SL+ FA++YG+++FL
Sbjct  61    LFCIGVPVVAHFVLFCSSCEDEDHLQPFDSIVELSLSAISILSFLSLTKFAKKYGLKRFL  120

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+LCEE+++V+QGYT+Q+  S+KIL  FVLP F+AD AYKIWW+VTGG +IP+F N++
Sbjct  121   FLDKLCEESERVRQGYTIQLQRSIKILCMFVLPCFVADTAYKIWWYVTGGPKIPHFGNLV  180

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +S+ V C L   SWLYR +I FL CVL+R+ C+LQILRL+ FAQVF+ E++V+ +L+EHL
Sbjct  181   VSHTVACFLEQCSWLYRTSIFFLACVLYRVSCYLQILRLEDFAQVFQLETDVALVLLEHL  240

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             R+RR LR+ISHRFR F+L TL++VTASQF SLLVTT+S S   I+ A EL LCS+ +VTG
Sbjct  241   RVRRTLRIISHRFRTFLLFTLLLVTASQFASLLVTTKSDSSIDIYTAGELALCSLTLVTG  300

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             + ICLRSAAKITHKAQ++ SLAAKWH CAT+ SFD    ET +  T + +P A  P  A 
Sbjct  301   VCICLRSAAKITHKAQAITSLAAKWHVCATIDSFDVVEGETQI--TSSTSPLAF-PYSAH  357

Query  1194  wenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              E+DDEEGDGDD LDNT M+PV A+TISY KRQALVTY E+N+AGITVYGFMLDR++LHT
Sbjct  358   SESDDEEGDGDDYLDNTKMIPVFANTISYQKRQALVTYLENNRAGITVYGFMLDRSYLHT  417

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF ++LSL LW+L+KT+GIS
Sbjct  418   IFGVELSLVLWLLSKTVGIS  437



>ref|XP_004293339.1| PREDICTED: uncharacterized protein LOC101308260 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=427

 Score =   467 bits (1202),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 246/437 (56%), Positives = 320/437 (73%), Gaps = 10/437 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED  +T+ IL        S+S HE   A E K   S L W+F+DQS++WR GLSWSLFF
Sbjct  1     MED--QTQPILPKQN----SNSGHE---ALEFKSFSSCLKWVFVDQSSIWRTGLSWSLFF  51

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L IGVPLVS  + SC +CD+ H RP++ + QLSLS+FA +SF+SLS + R++G R+FLF
Sbjct  52    VLAIGVPLVSNFLLSCSSCDANHSRPYHVVSQLSLSLFAGLSFVSLSFWTRKFGPRRFLF  111

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ ++KV+Q Y    H+S+K+L   V P F A+C YKIWW+V+G  ++PY+ NM L
Sbjct  112   LDKLCDASEKVRQEYKQLFHNSMKLLCFIVFPCFAAECVYKIWWYVSGATELPYYGNMYL  171

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S+ ++C+L L SWLYR  I FLVCV+FRLIC  QI+R++  AQVF+KE+EV  I++EH +
Sbjct  172   SDTILCMLELCSWLYRTTIFFLVCVMFRLICRCQIIRIESCAQVFQKETEVETIMMEHNK  231

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR+ LRVISHRFR+FIL +LI+VTASQ  SL+  T S +H +IF A EL LCS+ +VT L
Sbjct  232   IRKTLRVISHRFRVFILISLIMVTASQLASLVTITRSSAHVNIFKAGELALCSISLVTSL  291

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             FICLRSA K+THKA S+  LAAKW+ CAT+ SFD    ETP+    +   Q + P  AD 
Sbjct  292   FICLRSATKLTHKAHSITGLAAKWNVCATIHSFDYAETETPMIPQVSSDHQ-VFPFGADL  350

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTI  1376
             E+DDEE D DD+LDN  +VPV  +TIS+ KR ALV Y EHN+AGITV+G M+DRTWLH+I
Sbjct  351   ESDDEEADEDDDLDNAKLVPVFTNTISFQKRHALVKYLEHNRAGITVFGTMVDRTWLHSI  410

Query  1377  FVIQLSLTLWILNKTIG  1427
             F IQL+L LW LNKTI 
Sbjct  411   FGIQLALLLWTLNKTIS  427



>ref|XP_004151004.1| PREDICTED: uncharacterized protein LOC101212672 [Cucumis sativus]
 ref|XP_004156355.1| PREDICTED: uncharacterized protein LOC101230635 [Cucumis sativus]
 gb|KGN44085.1| hypothetical protein Csa_7G179620 [Cucumis sativus]
Length=434

 Score =   467 bits (1201),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/411 (57%), Positives = 310/411 (75%), Gaps = 5/411 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQS++W AGLSWS+FF+  I VP  S+ V +C +CDS H RPF+ +
Sbjct  27    ELHSFRSYLRWMCVDQSDIWTAGLSWSMFFLFAIIVPATSHFVLACSSCDSNHARPFDRV  86

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F RRYG+R+FLF D+LC+E++ V++GYT++ + SL++L++FV
Sbjct  87    VQLSLSSVATVSFLCLSSFIRRYGLRRFLFFDKLCDESETVRRGYTIKFNRSLRVLSTFV  146

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+ AYKIWW+ +G  QIP+  N+I+S+ V C + L SWLYR  + FLVC+LFRLI
Sbjct  147   IPCFAAESAYKIWWYASGASQIPFLGNVIVSDAVACAMELLSWLYRTTVIFLVCILFRLI  206

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C LQILRL  FA VF+ +S+V+++L EHLRIRR+LR+ISHR+R+FIL +L++VT SQF S
Sbjct  207   CDLQILRLQDFATVFQVDSDVASVLSEHLRIRRHLRIISHRYRVFILGSLVLVTGSQFTS  266

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT+S S+ +I+ A EL LCSM ++T L I LRSA KITHKAQSV +LAAKWH CATL
Sbjct  267   LLITTKSSSNLNIYIAGELALCSMTLLTSLMILLRSATKITHKAQSVTALAAKWHVCATL  326

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegd-gddeldnTNMVPVHAH-TISY  1280
              SFD    ETP+  T     QA  P     E  + +    +D+LDNT ++P +A+ TIS+
Sbjct  327   DSFDVTDGETPMAST---IHQAFPPHHGVGEESEGDEGCDEDDLDNTKLIPAYAYSTISF  383

Query  1281  HKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              KRQALVTYFE+N+AGIT+YGF LDRT LHTIF I+LSL LW+L KTIG S
Sbjct  384   QKRQALVTYFENNRAGITIYGFTLDRTTLHTIFGIELSLVLWLLGKTIGFS  434



>ref|XP_009357514.1| PREDICTED: uncharacterized protein LOC103948236 [Pyrus x bretschneideri]
Length=427

 Score =   466 bits (1198),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/411 (57%), Positives = 313/411 (76%), Gaps = 3/411 (1%)
 Frame = +3

Query  198   NAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPF  377
                E K     L W+F+DQS++WR G SWS+FF+L IGVPLVS+ + +C  CD+ H RP+
Sbjct  20    EGSEFKSFGVCLKWVFVDQSSIWRTGFSWSVFFVLAIGVPLVSHFLLACSDCDANHSRPY  79

Query  378   NAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
             + + QLSLS+F+ ++F+SLS +  RYG+RKFLFLDRL E ++KV+ GY  Q  +S+K+L 
Sbjct  80    HVVSQLSLSLFSVLAFVSLSIWTHRYGLRKFLFLDRLYESSEKVRHGYKQQFQNSMKLLC  139

Query  558   SFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLF  737
               V+P F+ +C YKIWW+++G  ++PY+ N+ LSN ++C+L L SWLYR  I FLVCVLF
Sbjct  140   LIVIPCFVLECVYKIWWYISGASELPYYGNIYLSNSILCMLELISWLYRTTIFFLVCVLF  199

Query  738   RLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             RL+CHLQILRL  FAQVF++E+EV  IL+EHL+IRRNLR +SHRFR+FIL +LI+VTASQ
Sbjct  200   RLVCHLQILRLQNFAQVFQEETEVELILMEHLKIRRNLRSMSHRFRIFILFSLIMVTASQ  259

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               SL++ T S +H +I+ A EL LCS+ +VT LFICLRSA KITHKAQS+  LA KWH C
Sbjct  260   LTSLVLVTRSSAHVNIYKAGELALCSISLVTSLFICLRSATKITHKAQSITGLATKWHVC  319

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
             ATL SFD    ETP+    + TP    P   D E++DEEG  DD+LDNT +VP+++ TIS
Sbjct  320   ATLHSFDYTETETPMAPI-SSTPA--FPFGVDMESEDEEGVEDDDLDNTKLVPIYSQTIS  376

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             + KRQ+LVTY E+N+AGITV+GF +DR WLH+IF IQL+L LW+LNKT+G+
Sbjct  377   FQKRQSLVTYLENNRAGITVFGFTVDRMWLHSIFAIQLALLLWLLNKTLGV  427



>ref|XP_008384265.1| PREDICTED: uncharacterized protein LOC103446889 [Malus domestica]
Length=427

 Score =   465 bits (1197),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/411 (57%), Positives = 312/411 (76%), Gaps = 3/411 (1%)
 Frame = +3

Query  198   NAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPF  377
                E K     L W+F+DQS++WR GLSWS+FF+L IGVPL S+ + +C  CD+ H RP+
Sbjct  20    EGSEFKSFGVCLXWVFVDQSSIWRTGLSWSVFFVLAIGVPLASHFLLACSDCDTNHSRPY  79

Query  378   NAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
             + + QLSLS+F+ ++F+SLS +  RYG+RKFLFLD L E ++KV+ GY  Q  +S+K+L 
Sbjct  80    HVVSQLSLSLFSVLAFVSLSIWTHRYGLRKFLFLDXLYESSEKVRHGYKQQFQNSMKLLC  139

Query  558   SFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLF  737
               V+P F+ +C YKIWW+V+G  ++PY+ N+ LSN ++C+L L SWLYR  I FLVCVLF
Sbjct  140   LIVIPCFVLECVYKIWWYVSGARELPYYGNVYLSNTILCMLELISWLYRTTIFFLVCVLF  199

Query  738   RLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             RL+CHLQILRL  FAQVF++E+EV  IL+EHL+IRRNLR +SHRFR+FIL +LI+VTASQ
Sbjct  200   RLVCHLQILRLQNFAQVFQEETEVELILMEHLKIRRNLRSMSHRFRIFILFSLIMVTASQ  259

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               SL++ T S +H +I+ A EL LCS+ +VT LFICLRSA KITHKAQS+  LA KWH C
Sbjct  260   LTSLVLVTRSSAHVNIYKAGELALCSISLVTSLFICLRSATKITHKAQSITGLATKWHVC  319

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
             ATL SFD    ETP+    + TP    P   D E++DEEG  DD+LD+T +VP+++ TIS
Sbjct  320   ATLHSFDXTETETPMAPI-SSTPA--FPFGVDMESEDEEGVEDDDLDSTKLVPIYSQTIS  376

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             + KRQALVTY E+N+AGITV+GF +DR WLH+IF IQL+L LW+LNKT+G+
Sbjct  377   FZKRQALVTYLENNRAGITVFGFTVDRMWLHSIFAIQLALLLWLLNKTLGV  427



>ref|XP_008366075.1| PREDICTED: uncharacterized protein LOC103429724 [Malus domestica]
Length=427

 Score =   465 bits (1197),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 236/411 (57%), Positives = 311/411 (76%), Gaps = 3/411 (1%)
 Frame = +3

Query  198   NAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPF  377
                E K     L W+F+DQS++WR GLSWS+FF+L IGVPL S+ + +C  CD+ H RP+
Sbjct  20    EGSEFKSFGVCLXWVFVDQSSIWRTGLSWSVFFVLAIGVPLASHFLLACSDCDTNHSRPY  79

Query  378   NAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
             + + QLSLS+F+ ++F+SLS +  RYG+RKFLFLD L E ++KV+ GY  Q  +S+K+L 
Sbjct  80    HVVSQLSLSLFSVLAFVSLSIWTHRYGLRKFLFLDXLYESSEKVRHGYKQQFQNSMKLLC  139

Query  558   SFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLF  737
               V+P F+ +C YKIWW+V+G  ++PY+ N  LSN ++C+L L SWLYR  I FLVCVLF
Sbjct  140   LIVIPCFVLECVYKIWWYVSGAXELPYYGNXYLSNTILCMLELISWLYRTTIFFLVCVLF  199

Query  738   RLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             RL+CHLQILRL  FAQVF++E+EV  IL+EHL+IRRNLR +SHRFR+FIL +LI+VTASQ
Sbjct  200   RLVCHLQILRLQNFAQVFQEETEVELILMEHLKIRRNLRSMSHRFRIFILFSLIMVTASQ  259

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               SL++ T S +H +I+ A EL LCS+ +VT LFICLRSA KITHKAQS+  LA KWH C
Sbjct  260   LTSLVLVTRSSAHVNIYKAGELALCSISLVTSLFICLRSATKITHKAQSITGLATKWHVC  319

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
             ATL SFD    ETP+    + TP    P   D E++DEEG  DD+LD+T +VP+++ TIS
Sbjct  320   ATLHSFDYTETETPMAPI-SSTPA--FPFGVDMESEDEEGVEDDDLDSTKLVPIYSQTIS  376

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             + KRQALVTY E+N+AGITV+GF +DR WLH+IF IQL+L LW+LNKT+G+
Sbjct  377   FQKRQALVTYLENNRAGITVFGFTVDRMWLHSIFAIQLALLLWLLNKTLGV  427



>ref|XP_004486201.1| PREDICTED: uncharacterized protein LOC101488219 [Cicer arietinum]
Length=433

 Score =   461 bits (1186),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/412 (57%), Positives = 311/412 (75%), Gaps = 2/412 (0%)
 Frame = +3

Query  198   NAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDA-CDSKHQRP  374
             +  E++R  S L WL++DQSNLW+A +SWSLFF L   VP++S+ +  C   CD  H+RP
Sbjct  23    DGSELRRFRSYLRWLYVDQSNLWKACISWSLFFTLAFVVPILSHFLLDCSTTCDEDHRRP  82

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             ++  VQ+SLSVFAT+SFISLS + RRYG  +FLFLD++ +E+ K+Q+GY  Q+  ++K++
Sbjct  83    YHVPVQISLSVFATLSFISLSEWDRRYGFSRFLFLDKVSDESLKIQRGYARQMKRTMKLI  142

Query  555   ASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVL  734
               + LP F+A+C YKIWW+++G  QIP++  + +S++++C L L SWLYR +I FLVCVL
Sbjct  143   LLWGLPCFIAECVYKIWWYISGSSQIPHYGEIYVSSIILCTLELCSWLYRTSIFFLVCVL  202

Query  735   FRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
             FRLI +L I RLD FA VF++E+EV  IL+EHLRIRRNLRVISHRFR FILS+L++VTAS
Sbjct  203   FRLIGYLHIQRLDEFASVFQRETEVGTILLEHLRIRRNLRVISHRFRAFILSSLLLVTAS  262

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             Q + LL+  +  +   I    ELGL S+ +V+GL+I LRSA KITHKAQS+  LAAKWH 
Sbjct  263   QLIFLLMVIKPHADVDILRGGELGLVSITLVSGLYILLRSATKITHKAQSITGLAAKWHI  322

Query  1095  CATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTI  1274
             CAT++SFD    ETP     T + QA+        +DDE GD +DELDNT ++P+  HTI
Sbjct  323   CATINSFDNVDGETPTAH-DTASAQAMAANITWGSSDDEIGDEEDELDNTKLLPIFTHTI  381

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             S+HKRQALVTY E+N+AGITVYGFMLDR+WLH+IF IQL+L LW+LNKT+GI
Sbjct  382   SFHKRQALVTYMENNRAGITVYGFMLDRSWLHSIFGIQLALCLWLLNKTVGI  433



>ref|XP_007147672.1| hypothetical protein PHAVU_006G144700g [Phaseolus vulgaris]
 ref|XP_007147673.1| hypothetical protein PHAVU_006G144700g [Phaseolus vulgaris]
 gb|ESW19666.1| hypothetical protein PHAVU_006G144700g [Phaseolus vulgaris]
 gb|ESW19667.1| hypothetical protein PHAVU_006G144700g [Phaseolus vulgaris]
Length=430

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/408 (56%), Positives = 311/408 (76%), Gaps = 1/408 (0%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S + W+++D SN+W+AG SWS+FF L   VP++S+ +  C  CD  H RP++  
Sbjct  24    ELKNFRSYMRWVYVDHSNVWKAGFSWSVFFTLAFVVPILSHFLLDCPTCDQDHSRPYHIP  83

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SLSVFA +SFIS+S + R+YG  KFLFLD+L +E+ K+Q+GY+ Q+  ++K++  + 
Sbjct  84    VQISLSVFAALSFISISSWDRKYGFSKFLFLDKLGDESLKIQRGYSEQMQGTMKLIFRWG  143

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F+A+C YKIWW+V+G  QIP++ NM +S++++C   L SW+YR ++ FLVCVLFRLI
Sbjct  144   LPCFIAECGYKIWWYVSGVSQIPHYGNMYVSSIILCTFELCSWIYRTSLFFLVCVLFRLI  203

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRLD FA+VF +E+EV +I++EHLR+RRNLR+ISHRFR FILS+L++VTASQ + 
Sbjct  204   CYLQILRLDEFARVFHRETEVGSIMLEHLRMRRNLRIISHRFRGFILSSLLLVTASQLIF  263

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+ T+  +   I  A EL L S+ +V+GLF+ LR A KITHKA SV  LAAKWH CAT+
Sbjct  264   LLMATKPHADVDIMKAGELALVSITLVSGLFLLLRGATKITHKAHSVTGLAAKWHICATI  323

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             +SFD    ETP       + QAI    +   +DDEEGDG+DELDN  ++P++  TIS+HK
Sbjct  324   NSFDNIEGETPTSAHAI-SAQAIAANISWVSSDDEEGDGEDELDNAKLIPIYTQTISFHK  382

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             RQALVTY E+N+AGITV+GFMLDRTWLH+IF IQL+L LW+LNKTIG+
Sbjct  383   RQALVTYLENNRAGITVFGFMLDRTWLHSIFGIQLALCLWLLNKTIGV  430



>ref|XP_003594165.1| hypothetical protein MTR_2g025160 [Medicago truncatula]
 gb|ABD32643.1| AT3g20300/MQC12_5 [Medicago truncatula]
 gb|AES64416.1| extracellular ligand-gated ion channel protein [Medicago truncatula]
Length=431

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 322/439 (73%), Gaps = 9/439 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME++ E    L ++K    S  YH+    +E++R  + L W+++DQSNL +AG+SWS+FF
Sbjct  1     MEEEREVSF-LAMNKEN--SGIYHD---GKELRRFRAYLRWVYVDQSNLCKAGISWSVFF  54

Query  297   ILTIGVPLVSYLVFSCDA-CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              L   VP++S+ +  C   CD+ H+RP++  VQ+SLSVFAT+SFISLS + R+YG  KFL
Sbjct  55    TLAYVVPILSHFLLDCSTTCDADHRRPYHVPVQISLSVFATLSFISLSKWDRKYGFSKFL  114

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD++ +E+ K+Q+GY +Q+  ++K++  + LP F+  C YKIWW+++G  QIPY+  + 
Sbjct  115   FLDKVSDESLKIQRGYAIQMKRTMKLILLWGLPCFICQCVYKIWWYISGASQIPYYGEVY  174

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +S +++C L L SW YR +I FLVCVLFRLI +LQI RLD FA VF++E+EV  IL+EHL
Sbjct  175   VSGIILCTLELCSWFYRTSIFFLVCVLFRLIGYLQIQRLDEFAPVFQRETEVGTILLEHL  234

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRRNLRVISHRFR FILS+L++VTASQ + LL+  +  +   I    ELGL S+ +V+G
Sbjct  235   RIRRNLRVISHRFRAFILSSLLLVTASQLIFLLMVIKPHADVDILKGGELGLVSITLVSG  294

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L+I LRSA KITHKAQS+  LA+KWH CAT++SFD    ETP     +   QA+    + 
Sbjct  295   LYILLRSATKITHKAQSLTGLASKWHICATINSFDNIDGETPTALIASA--QAMAADISW  352

Query  1194  wenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
               ++DE GD +DEL+NT M+P+   TIS+HKRQALVTY E+N+AGITVYGFMLDRTWLH+
Sbjct  353   GSSEDESGDEEDELNNTKMMPIQTRTISFHKRQALVTYMENNRAGITVYGFMLDRTWLHS  412

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             IF IQL+L LW+LNKT+GI
Sbjct  413   IFGIQLALCLWLLNKTVGI  431



>ref|XP_004293337.1| PREDICTED: uncharacterized protein LOC101307759 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 244/443 (55%), Positives = 321/443 (72%), Gaps = 22/443 (5%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED  +T+ IL        S+S HE   A E K  +  L W+F+DQS++WR GLSWSLFF
Sbjct  1     MED--QTQPILPKQN----SNSGHE---ALEFKSFIPWLEWVFVDQSSIWRTGLSWSLFF  51

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L IGVPLVS  + SC +CD+ H RP++ + QLSLS+FA +SF+SLS + R++G R+FLF
Sbjct  52    VLAIGVPLVSNFLLSCPSCDANHSRPYHVVSQLSLSLFAGLSFVSLSFWTRKFGPRRFLF  111

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ ++KV+Q Y    H+S+K+L   V P F A+C YKIWW+V+G  ++PY+ NM L
Sbjct  112   LDKLCDASEKVRQEYKQIFHNSMKLLCFIVFPCFAAECVYKIWWYVSGATELPYYGNMYL  171

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S+ ++C+L L SWLYR  I FLVCV+F+L+C  QI+RL+ FAQ+F+K++EV  I++EH +
Sbjct  172   SDTILCLLQLCSWLYRTTIFFLVCVMFQLMCRCQIIRLESFAQIFQKDTEVETIMMEHNK  231

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR+ LRVISHRFR+FIL +LI+VTASQ  SL+  T S +H  IF A EL LCS+ ++T L
Sbjct  232   IRKTLRVISHRFRMFILISLIMVTASQLASLVTVTWSSAHVDIFEAGELALCSISLITSL  291

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACAT--LSSFDEFGDETPVDRTGTGTPQA-----I  1175
             FICLRSA K+THKAQS+  LAAKW+ CAT  + SFD    ETP+       PQ      +
Sbjct  292   FICLRSATKLTHKAQSITGLAAKWNVCATIHIHSFDYAETETPM------IPQVSLDHHV  345

Query  1176  HPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLD  1355
              P  AD E+DDEE D DD+LDN  +VPV  +TIS+ KR ALV Y EHN+AGITV+G M+D
Sbjct  346   FPFGADLESDDEEADEDDDLDNGKLVPVFRNTISFQKRHALVKYLEHNRAGITVFGTMVD  405

Query  1356  RTWLHTIFVIQLSLTLWILNKTI  1424
             RTWLH+IF IQL+L LW LNKTI
Sbjct  406   RTWLHSIFGIQLALLLWTLNKTI  428



>ref|NP_001240036.1| uncharacterized protein LOC100809035 [Glycine max]
 gb|ACU22993.1| unknown [Glycine max]
 gb|KHN32983.1| hypothetical protein glysoja_009974 [Glycine soja]
Length=435

 Score =   454 bits (1169),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 322/439 (73%), Gaps = 5/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED   + ++L   K     +  H+     E++   S L W+++D SN+ +AGLSWS+FF
Sbjct  1     MEDARGSSLLL--PKNMEEHNPTHD-HGTTELRNFRSYLRWVYVDHSNVCKAGLSWSVFF  57

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
              L   VP +S+ +  C  CD  H RP++  VQ+SLSVFA +SFIS+S + RRYG RKFLF
Sbjct  58    TLAFVVPTLSHFLLDCPTCDRDHSRPYHIPVQISLSVFAALSFISISSWDRRYGFRKFLF  117

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+L +E+ K+Q+GY+ Q+  ++K++  + LP F+A+C YKIWW+V+G  QIP++ N+ +
Sbjct  118   LDKLGDESLKIQRGYSEQMQGTMKLILRWGLPCFIAECGYKIWWYVSGASQIPHYGNIYV  177

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++++C L L SWLYR +I FLVCVLFRLIC+LQILRLD FA+VF++E+EV +IL+E+LR
Sbjct  178   SSIILCTLDLCSWLYRTSIFFLVCVLFRLICYLQILRLDEFARVFQRETEVGSILLEYLR  237

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             +RRNLR+ISHRFR FIL++L++VTASQ + LL+ T+  +   I  A EL L S+ +V+GL
Sbjct  238   MRRNLRIISHRFRGFILASLLLVTASQLIFLLMVTKPYADVDILKAGELALVSITLVSGL  297

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              I LR A KITHKA S+  LAAKWH CAT++SFD    ETP       + QAI    +  
Sbjct  298   LILLRGATKITHKAHSITGLAAKWHICATINSFDNIEGETPTTANAI-SAQAIAANISWG  356

Query  1197  enddeegdgddeldnTN-MVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              +DDE GD +DELDNT  ++P++  TIS+HKRQALVTY E+N+AGITV+GFMLDRTWLH+
Sbjct  357   SDDDEVGDEEDELDNTKLLLPIYTQTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHS  416

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             IF IQL+L LW+LNKT+G+
Sbjct  417   IFGIQLALCLWLLNKTVGV  435



>ref|XP_006452451.1| hypothetical protein CICLE_v10008348mg [Citrus clementina]
 ref|XP_006475007.1| PREDICTED: uncharacterized protein LOC102613657 [Citrus sinensis]
 gb|ESR65691.1| hypothetical protein CICLE_v10008348mg [Citrus clementina]
 gb|KDO62118.1| hypothetical protein CISIN_1g014012mg [Citrus sinensis]
Length=432

 Score =   452 bits (1164),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 235/416 (56%), Positives = 309/416 (74%), Gaps = 5/416 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             IS+A+ E+    S L W+ +DQSN + A LSWS+F + TI VP +S+ V +CD CD  H+
Sbjct  20    ISHAQDELHSFRSYLKWMCVDQSNCFTACLSWSMFVLFTIVVPAISHFVLACDTCDGTHK  79

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++ +VQLSLS  A +SFI LS F ++YG+R+FLFLD+LC+E++ V+  Y  Q++ SLK
Sbjct  80    RPYDGVVQLSLSSVAALSFICLSSFVKKYGLRRFLFLDKLCDESEMVRSRYMEQLNRSLK  139

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FVLP FL + AYKIWW+ +G  QIP+  N+ LS+ V CI+ L SWLYR  + FLVC
Sbjct  140   ILSIFVLPCFLVESAYKIWWYASGASQIPFLGNVYLSDTVACIMELCSWLYRTTVIFLVC  199

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRL+CHLQILRL  FAQVF+ +S+V ++L EHLRIR++LR+ISHR+R FIL  LI+VT
Sbjct  200   VLFRLVCHLQILRLLDFAQVFQTDSDVDSVLAEHLRIRKHLRIISHRYRAFILWFLIMVT  259

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT+  +  +I+ A EL LCSM +V GL I LRSA KITHKAQ+V  LAAKW
Sbjct  260   GSQFASLLMTTKPSAVVNIYIAGELALCSMTLVAGLLILLRSATKITHKAQAVTCLAAKW  319

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             H CAT+ SFD    ETP  R      +A  P+     + D+ GD +D+LDN+N++P +A+
Sbjct  320   HVCATVDSFDVNDGETP--RIPDAAGRAF-PICHGESDCDDAGDEEDDLDNSNLIPAYAY  376

Query  1269  -TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              TIS+ KRQALV YFE+N+AGITV+GF LDR+ LHTIF IQLSL LW+L KT+G+S
Sbjct  377   STISFQKRQALVNYFENNRAGITVFGFTLDRSTLHTIFGIQLSLVLWLLGKTVGLS  432



>ref|XP_003534739.1| PREDICTED: uncharacterized protein LOC100816572 [Glycine max]
Length=435

 Score =   452 bits (1164),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 231/439 (53%), Positives = 318/439 (72%), Gaps = 5/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+  +   L L K        H+     E++   S L W+++D SN+ +AGLSW++FF
Sbjct  1     MEDERGS---LLLPKNMEEHHPAHD-RGTTELRNFRSYLRWVYVDHSNVCKAGLSWTVFF  56

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
              L   VP +S+ +  C  CD  H RP++  VQ+SLSVFA +SFIS+S + RRYG RKFLF
Sbjct  57    TLAFVVPTLSHFLLDCPTCDRDHSRPYHIPVQISLSVFAALSFISISSWDRRYGFRKFLF  116

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+L +E+ K+Q+GY+ Q+  ++K++  + LP F+A+CAYKIWW+V+G  QIP++ ++ +
Sbjct  117   LDKLGDESLKIQRGYSEQMQGTMKLIMRWGLPCFIAECAYKIWWYVSGASQIPHYGSIYV  176

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++++C L L SWLYR +I FLVCVLFRLIC+LQILRLD FA+VF++E+EV +IL+EHLR
Sbjct  177   SSIILCTLDLCSWLYRTSIFFLVCVLFRLICYLQILRLDEFARVFQRETEVGSILLEHLR  236

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             +RRNLR+ISHRFR FIL++L++VTASQ + LL+ T+  +   I  A EL L S+ +V+GL
Sbjct  237   MRRNLRIISHRFRGFILASLLLVTASQLIFLLMVTKPHADVDILKAGELALVSITLVSGL  296

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              I LR A KITHKA S+  LAAKWH CAT++SFD    ETP              +    
Sbjct  297   LILLRGATKITHKAHSITGLAAKWHICATINSFDNIEGETPTTAHAISAQAIATNISWGS  356

Query  1197  enddeegdgddeldnTN-MVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              +DDE GD +D+LDNT  ++P++  TIS+HKRQALVTY E+N+AGITV+GFMLDRTWLH+
Sbjct  357   SDDDEVGDEEDDLDNTKLLLPIYTQTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHS  416

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             IF IQL+L LW+LNKT+G+
Sbjct  417   IFGIQLALCLWLLNKTVGV  435



>ref|XP_002298818.1| hypothetical protein POPTR_0001s36620g [Populus trichocarpa]
 gb|EEE83623.1| hypothetical protein POPTR_0001s36620g [Populus trichocarpa]
Length=433

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 320/441 (73%), Gaps = 13/441 (3%)
 Frame = +3

Query  120   EDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             E++    +I R +K +   S  ++     E+K   S L W+ +DQS++  A LSW++F +
Sbjct  3     ENNNRESLINRNNKLSRSQSHAYD-----ELKSFRSYLRWMCVDQSSMGTACLSWTMFVL  57

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
               + VP  S+ V +C +CDS+H RP++++VQLSLS  AT+SF+ LS F R+YG+R+FLF 
Sbjct  58    FGLVVPATSHFVLACSSCDSRHGRPYDSVVQLSLSSVATLSFVCLSRFVRKYGLRRFLFF  117

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILS  659
             D+L +E++ V++GYT Q++SSLK+L  FV+P F+A+CAYKIWW+ +G  QIP+  N++LS
Sbjct  118   DKLWDESETVRRGYTNQLNSSLKLLLIFVIPCFVAECAYKIWWYASGASQIPFLGNVVLS  177

Query  660   NVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRI  839
             + V CI+ L SWLYR  + FLVCVLF LICHLQILRL  FA+VF+ +S+V ++L EH RI
Sbjct  178   DTVACIMELCSWLYRTIVIFLVCVLFHLICHLQILRLQDFARVFQVDSDVGSVLSEHFRI  237

Query  840   RRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLF  1019
             RR+LR+ISHR+R F+L +LI++T SQF SLL+TT++ +   I+ A EL LCS+ +VTGL 
Sbjct  238   RRHLRIISHRYRGFVLCSLILITGSQFSSLLITTKAHAVVDIYRAGELALCSITLVTGLL  297

Query  1020  ICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwe  1199
             I LRSA KITHKAQ+V SLAAKWH CATL +FD    ETP   +G      + PV     
Sbjct  298   IILRSATKITHKAQAVTSLAAKWHICATLDTFDATEGETPRHDSG-----QVFPVVGTDG  352

Query  1200  nddeegdgddeldnTN--MVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               D +  GD+E +  N  ++P +A+ TIS+ KRQALVTYFE+N+AGITVYGF+LDR+ LH
Sbjct  353   ESDGDDAGDEEDELDNSKLIPAYAYSTISFQKRQALVTYFENNRAGITVYGFILDRSTLH  412

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             +IF ++L+L LW+L KTIGIS
Sbjct  413   SIFGVELALVLWLLGKTIGIS  433



>ref|XP_010488000.1| PREDICTED: uncharacterized protein LOC104765908 isoform X1 [Camelina 
sativa]
 ref|XP_010488001.1| PREDICTED: uncharacterized protein LOC104765908 isoform X2 [Camelina 
sativa]
Length=450

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 233/413 (56%), Positives = 307/413 (74%), Gaps = 6/413 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +DQS+ W A LSWS+F + TI VP  S+ + +C  CDS H RP +++
Sbjct  40    ELQSFRKYLRWMCVDQSSPWTALLSWSMFVVFTIVVPATSHFMLACSDCDSHHSRPHDSV  99

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS FA +SF+ LS F  +YG+R+FLF D+L +E++ V++GYT Q++ SLKIL+ FV
Sbjct  100   VQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSLKILSYFV  159

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  160   TPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLI  219

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF S
Sbjct  220   CHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYS  279

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+
Sbjct  280   LLITTKAYADLNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATI  339

Query  1107  SSFDEFGDETP--VDR-TGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TI  1274
              SF+    ETP  VDR +G G  Q    +     + ++ GD +D+ DN N++P +A+ TI
Sbjct  340   ESFETVDGETPRLVDRASGPGYYQTDGDI--GGSDSEDYGDEEDDFDNNNLIPAYAYSTI  397

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             S+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  398   SFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  450



>gb|KHN40846.1| hypothetical protein glysoja_015213 [Glycine soja]
Length=435

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 318/439 (72%), Gaps = 5/439 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+  +   L L K        H+     E++   S L W+++D SN+ +AGLSW++FF
Sbjct  1     MEDERGS---LLLPKNMEEHHPAHD-RGTTELRNFRSYLRWVYVDHSNVCKAGLSWTVFF  56

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
              L   VP +S+ +  C  CD  H RP++  VQ+SLSVFA +SFIS+S + RRYG RKFLF
Sbjct  57    TLAFVVPTLSHFLLDCPTCDRDHSRPYHIPVQISLSVFAALSFISISSWDRRYGFRKFLF  116

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+L +E+ K+Q+GY+ Q+  ++K++  + LP F+A+CAYKIWW+V+G  QIP++ ++ +
Sbjct  117   LDKLGDESLKIQRGYSEQMQGTMKLIMRWGLPCFIAECAYKIWWYVSGASQIPHYGSIYV  176

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++++C L L SWLYR +I FLVCVLFRLIC+LQILRLD FA+VF++E+EV +IL+E+LR
Sbjct  177   SSIILCTLDLCSWLYRTSIFFLVCVLFRLICYLQILRLDEFARVFQRETEVGSILLEYLR  236

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             +RRNLR+ISHRFR FIL++L++VTASQ + LL+ T+  +   I  A EL L S+ +V+GL
Sbjct  237   MRRNLRIISHRFRGFILASLLLVTASQLIFLLMVTKPHADVDILKAGELALVSITLVSGL  296

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              I LR A KITHKA S+  LAAKWH CAT++SFD    ETP              +    
Sbjct  297   LILLRGATKITHKAHSITGLAAKWHICATINSFDNIEGETPTTAHAISAQAIATNISWGS  356

Query  1197  enddeegdgddeldnTN-MVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              +DDE GD +D+LDNT  ++P++  TIS+HKRQALVTY E+N+AGITV+GFMLDRTWLH+
Sbjct  357   SDDDEVGDEEDDLDNTKLLLPIYTQTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHS  416

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             IF IQL+L LW+LNKT+G+
Sbjct  417   IFGIQLALCLWLLNKTVGV  435



>ref|XP_010508774.1| PREDICTED: uncharacterized protein LOC104785287 [Camelina sativa]
Length=451

 Score =   451 bits (1160),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 323/451 (72%), Gaps = 18/451 (4%)
 Frame = +3

Query  96    NQGKPIAMEDDEETEIILRLSK-TALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
             N G+  A E      +I R +K T  +S +  E+ + R+  R      W+ +DQS+ W A
Sbjct  14    NDGRGGARE-----RLINRETKFTRSVSHAQDELQSFRKYLR------WMCVDQSSPWTA  62

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSWS+F + TI VP  S+ + +C  CDS H RP +++VQLSLS FA +SF+ LS F  +
Sbjct  63    LLSWSMFVVFTIVVPATSHFMLACADCDSHHSRPHDSVVQLSLSSFAALSFLCLSRFVSK  122

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             YG+R+FLF D+L +E++ V++GYT Q++ SLKIL+ FV P FLA  +YKIWW+ +G  QI
Sbjct  123   YGLRRFLFFDKLWDESETVRRGYTNQLNRSLKILSYFVTPCFLAMSSYKIWWYASGASQI  182

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V 
Sbjct  183   PFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVG  242

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF SLL+TT++ +  +I+ A EL LC
Sbjct  243   SILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYADLNIYRAGELALC  302

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDR-TGTGT  1163
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+    ETP  VDR +G G 
Sbjct  303   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGETPRLVDRASGPGY  362

Query  1164  PQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVY  1340
              Q    +     + ++ GD +D+ DN N++P +A+ TIS+ KRQALV YFE+NKAGITV+
Sbjct  363   YQTDGDI--GGSDSEDYGDEEDDFDNNNLIPAYAYSTISFQKRQALVNYFENNKAGITVF  420

Query  1341  GFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  421   GFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>ref|XP_010466213.1| PREDICTED: uncharacterized protein LOC104746436 [Camelina sativa]
Length=451

 Score =   451 bits (1159),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 323/451 (72%), Gaps = 18/451 (4%)
 Frame = +3

Query  96    NQGKPIAMEDDEETEIILRLSK-TALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
             N G+  A E      +I R +K T  +S +  E+ + R+  R      W+ +DQS+ W A
Sbjct  14    NHGEGGARE-----RLIKRETKFTRSVSHAQDELQSFRKYLR------WMCVDQSSPWTA  62

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSWS+F + TI VP  S+ + +C  CDS H RP +++VQLSLS FA +SF+ LS F  +
Sbjct  63    LLSWSMFVVFTIVVPATSHFMLACADCDSHHSRPHDSVVQLSLSSFAALSFLCLSRFVSK  122

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             YG+R+FLF D+L +E++ V++GYT Q++ SLKIL+ FV P FLA  +YKIWW+ +G  QI
Sbjct  123   YGLRRFLFFDKLWDESETVRRGYTNQLNRSLKILSYFVTPCFLAMSSYKIWWYASGASQI  182

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V 
Sbjct  183   PFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVG  242

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF SLL+TT++ +  +I+ A EL LC
Sbjct  243   SILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYADLNIYRAGELALC  302

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDR-TGTGT  1163
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+    ETP  VDR +G G 
Sbjct  303   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGETPRLVDRASGPGY  362

Query  1164  PQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVY  1340
              Q    +     + ++ GD +D+ DN N++P +A+ TIS+ KRQALV YFE+NKAGITV+
Sbjct  363   YQTDGDI--GGSDSEDYGDEEDDFDNNNLIPAYAYSTISFQKRQALVNYFENNKAGITVF  420

Query  1341  GFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  421   GFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>ref|XP_010270062.1| PREDICTED: uncharacterized protein LOC104606514 [Nelumbo nucifera]
Length=441

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 314/445 (71%), Gaps = 8/445 (2%)
 Frame = +3

Query  111   IAMEDDEETEIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWS  287
             + M DD E   +L  +      S     SN R E++   S L ++ +DQSN     LSW+
Sbjct  1     MKMGDDREA--LLNRTPRTRARSLTRCFSNPRDELQSFRSWLRYMCVDQSNTCTTFLSWT  58

Query  288   LFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRK  467
              F  + I VPL++Y   +C +CD KH+R F+ +VQLSLS  AT+SF+ LS F R+YG+R+
Sbjct  59    FFLFMNIVVPLITYFFLACRSCDHKHRRRFDGVVQLSLSSVATVSFLCLSAFIRKYGLRR  118

Query  468   FLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYN  647
             FLFLD+LC+E++KV+ GY  Q++ SLK+LA FV+P+F A+ +YKIWW+ +G   IP+  N
Sbjct  119   FLFLDKLCDESEKVRHGYIQQLNKSLKMLAVFVVPSFAAESSYKIWWYSSGKAGIPFLIN  178

Query  648   MILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIE  827
             + +S+ + C L L SWLYR +I FLVCVLFRLIC+LQILR+  FAQVF+KES V  +L E
Sbjct  179   IYVSDTLACALELCSWLYRTSIFFLVCVLFRLICYLQILRIQDFAQVFQKESNVGLVLKE  238

Query  828   HLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMV  1007
             HLRIRR+LR+ISHRFR FIL TL +VTAS F  LLVTT + ++  I  + EL +CS+ +V
Sbjct  239   HLRIRRHLRIISHRFRAFILYTLTLVTASLFACLLVTTRAHANVTILKSGELAMCSITLV  298

Query  1008  TGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVd  1187
             TGLFICLRSA KITHKAQS+  LAA WH  AT+  FD     TP  +T T +   I P D
Sbjct  299   TGLFICLRSAIKITHKAQSIKCLAALWHVFATIDFFDGTDSHTPTSQTPTYSK--IFPSD  356

Query  1188  adwenddeegdgddeldnTN---MVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
              + E DDEE D D + D  N   +VP +AHTIS+ KRQALVTYFE+N AGITVYGF+LDR
Sbjct  357   GNDELDDEEEDNDGDDDLDNINIIVPAYAHTISFQKRQALVTYFENNGAGITVYGFLLDR  416

Query  1359  TWLHTIFVIQLSLTLWILNKTIGIS  1433
             T+LHTI ++++SL LWIL KTIGIS
Sbjct  417   TFLHTIVMVEMSLVLWILGKTIGIS  441



>gb|KDP39188.1| hypothetical protein JCGZ_00945 [Jatropha curcas]
Length=426

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 311/427 (73%), Gaps = 23/427 (5%)
 Frame = +3

Query  171   ISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDA  350
             +S +Y E+ + R   R      W+ +DQSN+W   LSW +F + +I VP +S+ + +C  
Sbjct  17    VSHAYDELQSFRYYLR------WMCVDQSNIWLVCLSWFMFILFSIIVPAISHFLLACST  70

Query  351   CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQ  530
             CD KH+RP++++VQLSLS  AT+SF+ LS F  +YG+R+FLF D+LC+E++ V++GYT Q
Sbjct  71    CDGKHKRPYDSVVQLSLSSVATLSFVCLSRFVSKYGLRRFLFFDKLCDESETVRKGYTNQ  130

Query  531   IHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIA  710
             ++ SL++L+ FV P F+A+ AYKIWW+ +G  QIP+  N+ILS+ V CI+ L SWLYR  
Sbjct  131   LNRSLQLLSIFVAPCFIAESAYKIWWYASGASQIPFLGNVILSDTVACIMELCSWLYRTT  190

Query  711   ISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILS  890
             I FLVCVLF LICHLQILRL  FA+VF+ +S+V ++L EHLRIRR+LR+ISHR+R F+L 
Sbjct  191   IIFLVCVLFHLICHLQILRLQDFAKVFQTDSDVESVLSEHLRIRRHLRIISHRYRFFVLW  250

Query  891   TLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVA  1070
              LI+VT SQF SLL TT+S +   ++ A EL LCS+ +VTGL I LRSA KITHKAQSV 
Sbjct  251   ALILVTGSQFASLLTTTKSGAVVDLYRAGELALCSITLVTGLLILLRSATKITHKAQSVT  310

Query  1071  SLAAKWHACATLSSFDEFGDETP-----VDRTGTGTPQAIHPVdadwenddeegdgddel  1235
             +LAAKWH CATL SFD    ETP        T  G+ +A           D+ GD +DEL
Sbjct  311   NLAAKWHICATLDSFDASEGETPRFQRVTSSTEDGSEEA-----------DDVGDEEDEL  359

Query  1236  dnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWIL  1412
             DN+ ++P +A+ TIS+ KRQALVTYFE+N+AGITVYGF LDR+ LH+IF ++L+L LW+L
Sbjct  360   DNSKLIPAYAYSTISFQKRQALVTYFENNRAGITVYGFTLDRSTLHSIFGVELALVLWLL  419

Query  1413  NKTIGIS  1433
              KT+GIS
Sbjct  420   GKTVGIS  426



>ref|XP_010943240.1| PREDICTED: uncharacterized protein LOC105061026 [Elaeis guineensis]
Length=432

 Score =   448 bits (1152),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 303/410 (74%), Gaps = 9/410 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +DQS+ WRA +SWSLFF+L++ VP+VS+ V S +     H+RP++  
Sbjct  31    ELRGFQSCLRWMCMDQSDRWRALMSWSLFFVLSLAVPIVSHFVLSYN----PHRRPYDLS  86

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  + +SFI LS   RRYG+R+FLFLD+L  E++ V+ GYT  +  S ++L+ FV
Sbjct  87    VQLSLTAASALSFICLSAVTRRYGLRRFLFLDKLRGESEHVRLGYTAHLDRSFRLLSCFV  146

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+ AYK+WW+  G G+IP+  N + S+VV C+  L+SW+YR A  FL+CVLFRLI
Sbjct  147   LPLFAAETAYKVWWYCAGAGRIPFLGNPVASDVVACVFELASWIYRTATFFLLCVLFRLI  206

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C LQILRL  FA VF++ESEV  +L EHLRIRR LRVISHRFR FI+S L++VTASQF +
Sbjct  207   CQLQILRLQEFAAVFQEESEVGLVLAEHLRIRRQLRVISHRFRGFIVSCLVLVTASQFAA  266

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT S S  ++F   EL LCS+++VTGL ICLRSAAKITHKAQ++ S AAKWH CAT+
Sbjct  267   LLLTTRSHSDINLFNTGELALCSIVLVTGLLICLRSAAKITHKAQALTSHAAKWHVCATI  326

Query  1107  SSFDEFGD-ETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYH  1283
              SF  + D ETP +   T  P  + PV+      DEE   +DEL++T +VP HAHTIS+ 
Sbjct  327   DSF--YADPETPCEV--TLNPNCVFPVNGGEGESDEEVSAEDELEDTKIVPPHAHTISFQ  382

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             KRQALVTY E+N+AGIT++GF LDR WLHT+F+++ +L LW+L KTIGIS
Sbjct  383   KRQALVTYLENNRAGITIFGFTLDRAWLHTVFMLETTLFLWLLGKTIGIS  432



>ref|XP_002885364.1| extracellular ligand-gated ion channel [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61623.1| extracellular ligand-gated ion channel [Arabidopsis lyrata subsp. 
lyrata]
Length=451

 Score =   448 bits (1153),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 233/414 (56%), Positives = 306/414 (74%), Gaps = 8/414 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +DQS+ W A LSWS+F + T+ VP  S+ + +C  CDS H RP++++
Sbjct  41    ELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFMLACADCDSHHSRPYDSV  100

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS FA +SF+ LS F  +YG+R+FLF D+L +E++ V++GYT Q++ SLKIL+ FV
Sbjct  101   VQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSLKILSYFV  160

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  161   TPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLI  220

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF S
Sbjct  221   CHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYS  280

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+
Sbjct  281   LLITTKAYAELNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATI  340

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddel--dnTNMVPVHAH-T  1271
              SF+    ETP  VDR    +    +P D D    D E  GD+E   DN N++P +A+ T
Sbjct  341   ESFETVDGETPRLVDR---ASGHGYYPTDDDNGESDSEDYGDEEDDFDNNNLIPAYAYST  397

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALV YFE+N+AGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  398   ISFQKRQALVNYFENNRAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>ref|XP_004248349.1| PREDICTED: uncharacterized protein LOC101267356 [Solanum lycopersicum]
 ref|XP_010327188.1| PREDICTED: uncharacterized protein LOC101267356 [Solanum lycopersicum]
 ref|XP_010327189.1| PREDICTED: uncharacterized protein LOC101267356 [Solanum lycopersicum]
Length=433

 Score =   447 bits (1151),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 232/418 (56%), Positives = 309/418 (74%), Gaps = 8/418 (2%)
 Frame = +3

Query  192   ISNA-REVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +SNA  E++   + L W+ +DQSN + A LSW +F +L + VP +S+ + + D  D+ H 
Sbjct  20    VSNAYDELRSFRTWLKWMCVDQSNAFSAFLSWFVFILLAVIVPCLSHFLLAMDDSDAAHS  79

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++ +VQLSLS  A +SF+ LS F ++YG+R+FLFLD+LC+E++ V++GYT Q++SSLK
Sbjct  80    RPYDDVVQLSLSSVAALSFVCLSQFVKKYGLRRFLFLDKLCDESETVRRGYTEQLNSSLK  139

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL  FVLP F  +CAYKIWW+ +GG +IP+  N+I+S+ V CIL LSSWLYR  + FLVC
Sbjct  140   ILFIFVLPCFAVECAYKIWWYSSGGTRIPFLGNVIVSDTVACILELSSWLYRTVVFFLVC  199

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             +LFRLIC+LQILRL  FAQVF  +S+V ++L EHLRIRR+LR+ISHR+R FIL  L++VT
Sbjct  200   ILFRLICYLQILRLQDFAQVFHVDSDVESVLREHLRIRRHLRIISHRYRSFILWALMLVT  259

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             ASQF SLL+TT S +  HI+ + EL LCS+ ++ GL I LRSA +ITHKAQSV  LAAKW
Sbjct  260   ASQFASLLMTTRSTADLHIYESGELALCSVSLLAGLMILLRSATRITHKAQSVTCLAAKW  319

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             H CAT+ SFD    +TP+ R    T   I PV     + D +  GD+E +  N   VHA+
Sbjct  320   HVCATIDSFDSTEADTPITR---ATCDHIFPV-CSEGSSDADDVGDEEDELDNTKFVHAY  375

Query  1269  ---TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
                TIS+ KRQALVTYFE+N+AG+T+YGFMLDR+ +HTIF I+LSL LW+L KTIGIS
Sbjct  376   AYSTISFQKRQALVTYFENNRAGVTIYGFMLDRSSIHTIFGIELSLVLWLLGKTIGIS  433



>ref|XP_006297578.1| hypothetical protein CARUB_v10013605mg, partial [Capsella rubella]
 gb|EOA30476.1| hypothetical protein CARUB_v10013605mg, partial [Capsella rubella]
Length=475

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 310/418 (74%), Gaps = 5/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + T+ VP  S+ + +C  CDS H 
Sbjct  59    VSHAQDELQSFRKYLRWMCVDQSSPWTALLSWSMFVVFTVVVPATSHFMLACADCDSHHS  118

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP+++ VQLSLS FA +SF+ LS F  +YG+R+FLF D+L +E++ V++GYT Q++ SLK
Sbjct  119   RPYDSAVQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSLK  178

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVC
Sbjct  179   ILSYFVTPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVC  238

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT
Sbjct  239   VLFRLICHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVT  298

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  299   GSQFYSLLITTKAYADLNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKW  358

Query  1089  HACATLSSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+    ETP  VDR  +G        D    + ++ GD +D+ DN N++P +
Sbjct  359   HVCATIESFETVDGETPRLVDR-ASGPGYYPTDGDTGGSDSEDYGDEEDDFDNNNLIPAY  417

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  418   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  475



>ref|XP_006406400.1| hypothetical protein EUTSA_v10020720mg [Eutrema salsugineum]
 gb|ESQ47853.1| hypothetical protein EUTSA_v10020720mg [Eutrema salsugineum]
Length=450

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 311/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F   T+ VP+ S+ + +C  CDS H 
Sbjct  33    VSHAQDELQSFRKYLRWMCVDQSSPWTAALSWSMFVFFTLVVPVTSHFMLACADCDSHHS  92

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS FA +SF+ LS F  +YG+R+FLF D+L +E++ V++GYT Q++ SLK
Sbjct  93    RPYDSVVQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSLK  152

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  AYKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVC
Sbjct  153   ILSYFVTPCFLAMSAYKIWWYASGASQIPFLGNVILSDTVACMMELCSWLYRTTVIFLVC  212

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT
Sbjct  213   VLFRLICHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVT  272

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  273   GSQFYSLLITTKAYAELNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKW  332

Query  1089  HACATLSSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+    ETP  VDR       +      D ++ ++ GD +D+ DN +++P +
Sbjct  333   HVCATIESFETVDGETPRLVDRASGHGFYSTDVDTGDTDDSEDYGDEEDDFDNNDLIPAY  392

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+N+AGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  393   AYSTISFQKRQALVNYFENNRAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  450



>ref|XP_010646962.1| PREDICTED: uncharacterized protein LOC100854148, partial [Vitis 
vinifera]
Length=368

 Score =   442 bits (1138),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 231/364 (63%), Positives = 288/364 (79%), Gaps = 3/364 (1%)
 Frame = +3

Query  336   FSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQ  515
             F C +CD KH RP++ IVQLSLS  A +SFISLS   ++YG+R+ LFLD+LC+ ++KV+ 
Sbjct  2     FPCSSCDDKHARPYDVIVQLSLSSLAALSFISLSALVKKYGLRRSLFLDKLCDVSEKVRL  61

Query  516   GYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSW  695
             GYT Q+H S+K+L+ FVLP F  + AYKIWW++TG  QIPY  N+ LS+ + C L L SW
Sbjct  62    GYTQQLHRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLGNIYLSHAIACTLELCSW  121

Query  696   LYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFR  875
             LYR AI  LVCVLFRLICH+QILRL+ FAQVF+KES+V ++L EHLRIRRNLR+ISHRFR
Sbjct  122   LYRTAIFLLVCVLFRLICHMQILRLEDFAQVFQKESDVGSVLKEHLRIRRNLRIISHRFR  181

Query  876   LFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHK  1055
             +FILS+LI+VTASQ  SLL+TT S +   I+ A EL LCS+ +VTGL ICLRSA KITHK
Sbjct  182   VFILSSLILVTASQLASLLITTRSSAKVTIYKAGELALCSISLVTGLGICLRSATKITHK  241

Query  1056  AQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddel  1235
             AQSV  LAAKWH CAT+ +FD    ETP  R  +     + PV+ +W +DDEEGDGDD L
Sbjct  242   AQSVTCLAAKWHVCATIDTFDATDGETPTIRAASA---QVFPVNTNWGSDDEEGDGDDAL  298

Query  1236  dnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILN  1415
             DNT M+P++AHTIS+HKRQALVTY E+N+AGITV+GFMLDRTWLHTIF +++SL LW+L+
Sbjct  299   DNTKMIPIYAHTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHTIFGVEMSLVLWLLS  358

Query  1416  KTIG  1427
             KTI 
Sbjct  359   KTIA  362



>ref|XP_011046716.1| PREDICTED: uncharacterized protein LOC105141243 [Populus euphratica]
Length=433

 Score =   445 bits (1145),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 315/443 (71%), Gaps = 14/443 (3%)
 Frame = +3

Query  117   MEDDEETE-IILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             MED+   E +I R  K +   S  ++     E+K   S L W+ +DQS++  A LSW++F
Sbjct  1     MEDNNNRESLINRNDKLSRSQSHAYD-----ELKSFRSYLRWMCVDQSSMATACLSWAMF  55

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
                 + VP  S+ V +C +CDSKH RP++++VQLSLS FAT+SF+ LS F R+YG+R+FL
Sbjct  56    VFFGLVVPATSHFVLACSSCDSKHGRPYDSVVQLSLSSFATLSFVCLSRFVRKYGLRRFL  115

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             F D+L +E++ V++GYT Q++SSLK+L  FV+P F+A+CAYKIWW+ +G  QIP+  N +
Sbjct  116   FFDKLWDESETVRRGYTNQLNSSLKLLLIFVIPCFVAECAYKIWWYASGASQIPFLGNAV  175

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             LS+ V CI+ L SWLYR  + FLVCVLF LICHLQILRL  FA+VF+ +S+V ++L EH 
Sbjct  176   LSDTVACIMELCSWLYRTIVIFLVCVLFHLICHLQILRLQDFARVFQVDSDVGSVLAEHF  235

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RI+R+LR+ISHR+R F+L +LI++T SQF SLL+TT++ +   I+ A EL   S+ +VTG
Sbjct  236   RIKRHLRIISHRYRGFVLCSLILITGSQFASLLITTKAHAVVDIYRAGELARRSITLVTG  295

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L I LRSA KITHKAQ+V SLAAKWH CATL +FD    ETP           + PV   
Sbjct  296   LLIILRSATKITHKAQAVTSLAAKWHICATLDTFDATEGETPRHDIAQ-----VFPVVGI  350

Query  1194  wenddeegdgddeldnTN--MVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTW  1364
                 D +  GD+E +  N  ++P +A+ TIS+ KRQALVTYFE+N+AGITVYGF LDRT 
Sbjct  351   DGESDGDDAGDEEDELDNSKLIPAYAYSTISFQKRQALVTYFENNRAGITVYGFTLDRTT  410

Query  1365  LHTIFVIQLSLTLWILNKTIGIS  1433
             LH+IF ++L+L LW+L KTIGIS
Sbjct  411   LHSIFGVELALVLWLLGKTIGIS  433



>ref|NP_566658.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL67091.1| AT3g20300/MQC12_5 [Arabidopsis thaliana]
 gb|AAM61562.1| unknown [Arabidopsis thaliana]
 gb|AAM98095.1| AT3g20300/MQC12_5 [Arabidopsis thaliana]
 gb|AEE76361.1| uncharacterized protein AT3G20300 [Arabidopsis thaliana]
Length=452

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 232/414 (56%), Positives = 304/414 (73%), Gaps = 8/414 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +DQS+ W A LSWS+F + T+ VP  S+ + +C  CDS H RP++++
Sbjct  42    ELHSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFMLACSDCDSHHSRPYDSV  101

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS FA +SF+ LS F  +YG+R+FLF D+L +E++ V+ GYT Q++ SLKIL+ FV
Sbjct  102   VQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRLGYTNQLNRSLKILSYFV  161

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  162   SPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLI  221

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF S
Sbjct  222   CHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYS  281

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+
Sbjct  282   LLITTKAYAELNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATI  341

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddel--dnTNMVPVHAH-T  1271
              SF+    ETP  VDR    +    +P D D    D E  GD+E   DN N++P +A+ T
Sbjct  342   ESFETVDGETPRLVDR---ASGHGYYPTDDDNGESDSEDYGDEEDDFDNNNLIPAYAYST  398

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALV YFE+N++GITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  399   ISFQKRQALVNYFENNRSGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  452



>emb|CDY50089.1| BnaC01g32640D [Brassica napus]
Length=451

 Score =   441 bits (1133),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 316/450 (70%), Gaps = 11/450 (2%)
 Frame = +3

Query  102   GKPIAMEDD---EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
             G      DD       +I R  K     S+ H+     E+      L W+ +DQS+ W A
Sbjct  7     GTAAERNDDGGGRREPLINREKKFKRSVSNVHD-----ELHSFRKYLRWMCVDQSSPWTA  61

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSWS+F + T+ VP +S+ + +C  CDS H RP+++ VQLSLS FA +SF+ LS F  +
Sbjct  62    VLSWSMFVVFTLVVPAMSHFMLACANCDSHHSRPYDSGVQLSLSSFAALSFLCLSRFVSK  121

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             +G+R+FLF D+L +E+  V++GYT Q++ SLKIL+ FV P FLA  +YKIWW+ +G  QI
Sbjct  122   FGLRRFLFFDKLWDESSTVRRGYTNQLNRSLKILSYFVAPCFLAMSSYKIWWYASGASQI  181

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V 
Sbjct  182   PFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVG  241

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R+FILS+LI+VT SQF SLL+TT+S +  ++ +A EL LC
Sbjct  242   SILSEHLRIRRHLRIISHRYRIFILSSLILVTGSQFYSLLITTKSHAGLNVNSAGELALC  301

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDRTGTGTP  1166
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+     TP  VDR      
Sbjct  302   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGGTPRLVDRASGHGF  361

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYG  1343
              +      D ++ ++ G+ +D+ DN +++P +A+ TIS+ KRQALV YFE+NKAGITV+G
Sbjct  362   YSTDVEIGDTDDSEDYGEEEDDFDNNDLIPAYAYSTISFQKRQALVHYFENNKAGITVFG  421

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  422   FTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>ref|XP_002277314.1| PREDICTED: uncharacterized protein LOC100245205 [Vitis vinifera]
Length=435

 Score =   439 bits (1128),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 230/440 (52%), Positives = 317/440 (72%), Gaps = 12/440 (3%)
 Frame = +3

Query  129   EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTI  308
             +E E +LR +K    S SY +     E++   S L W+ +DQS +    LSWS+F +L I
Sbjct  3     DERERLLRKNKFQR-SISYAQ----DELQSFRSWLRWMCVDQSTISTGCLSWSVFILLAI  57

Query  309   GVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRL  488
              VP++S+ + +C +CD+KHQRP++A+VQLSLS  A +SF+ LS F R YG+R+FLF D+L
Sbjct  58    AVPVMSHFLLACSSCDAKHQRPYDAVVQLSLSSVAVLSFLCLSRFIRNYGLRRFLFFDKL  117

Query  489   CEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVV  668
              +E++ V++ YT Q++ S+KIL+ FVLP F A+  YKIWW+ +G  +IP+  N+ +S+V+
Sbjct  118   RDESEMVRKNYTEQLNRSMKILSLFVLPCFAAEATYKIWWYSSGRSRIPFLGNVYVSDVI  177

Query  669   ICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRN  848
              C L L SWLYR ++ FLVCVLFRLICHLQILRL  FA+VF+ ES+V ++L EHLRIRR+
Sbjct  178   ACTLELCSWLYRTSVFFLVCVLFRLICHLQILRLQDFARVFQAESDVESVLKEHLRIRRH  237

Query  849   LRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICL  1028
             LR+ISHR R+FIL  L+ VTASQF SLL TT S++  ++F A EL LCS+ +VTGL +  
Sbjct  238   LRIISHRNRVFILFALMFVTASQFASLLSTTRSRADVNMFTAGELALCSITLVTGLMVLF  297

Query  1029  RSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwendd  1208
             RSA KITHKAQ++  LAAKWH CAT+ SF+    E+P  R     P+      ++  + +
Sbjct  298   RSATKITHKAQAITCLAAKWHVCATIDSFESNEPESP--RIQIPCPRPFPSRASNENDVE  355

Query  1209  e----egdgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
                   GD +D++D+T ++P +A  TIS+ KRQALV YFE+N+AGITVYGFMLDRT L+T
Sbjct  356   SDGEDAGDEEDDVDSTKLIPAYASSTISFQKRQALVVYFENNRAGITVYGFMLDRTSLNT  415

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF+I++SL LW+L KTIGIS
Sbjct  416   IFMIEMSLVLWLLGKTIGIS  435



>emb|CDP13788.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   436 bits (1122),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/397 (57%), Positives = 297/397 (75%), Gaps = 3/397 (1%)
 Frame = +3

Query  246   LDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISF  425
             +DQS+ W A LSWS+F +L + VP +S+   +C  CDS+H RP++ IVQLSLS  A +SF
Sbjct  3     VDQSDWWTAFLSWSVFVVLAVVVPCLSHFFLACSDCDSRHSRPYDTIVQLSLSTLAALSF  62

Query  426   ISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIW  605
             I LS F R+YG+R+FLF DRLC++++ V++GYT+Q++ SLKI+  FV+P F  +CAYKIW
Sbjct  63    ICLSQFVRKYGLRRFLFFDRLCDDSETVRKGYTVQLNRSLKIVFIFVIPCFTVECAYKIW  122

Query  606   WFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQ  785
             W+ +GG +IP+  N+I+S+ V CIL L SWLYR  + FLVC+LFRLIC+LQILRL  FAQ
Sbjct  123   WYSSGGTRIPFLGNIIVSDTVACILELCSWLYRTVVFFLVCILFRLICYLQILRLQDFAQ  182

Query  786   VFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHI  965
             VF+ ES+V ++L EHLRIRR+LR+ISHR+R FIL  LI++T SQF SLL+TT S +   I
Sbjct  183   VFQVESDVESVLREHLRIRRHLRIISHRYRSFILWALIIITVSQFASLLMTTRSTADLSI  242

Query  966   FAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVD  1145
             +   EL LCS+ ++ GL I LRSA +ITHKAQ+V  LAAKWH CAT+ SFD    ETP+ 
Sbjct  243   YKTGELALCSVSLLAGLMILLRSATRITHKAQAVTCLAAKWHVCATIDSFDTTEAETPIS  302

Query  1146  RTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNK  1322
             R                + DD+ GD +D++D+T +VP + + TIS+ KRQALVTYFE+N+
Sbjct  303   RVPVN--HVFPVSSDGSDADDDVGDEEDDIDHTKLVPSYNYNTISFQKRQALVTYFENNR  360

Query  1323  AGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             AG+T+YGFMLDRT LHTIF I+LSL LW+L KTIGIS
Sbjct  361   AGVTIYGFMLDRTSLHTIFGIELSLVLWLLGKTIGIS  397



>ref|XP_009111188.1| PREDICTED: uncharacterized protein LOC103836644 [Brassica rapa]
Length=451

 Score =   437 bits (1125),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 315/450 (70%), Gaps = 11/450 (2%)
 Frame = +3

Query  102   GKPIAMEDD---EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
             G      DD       +I R +K     S+ H+     E+      L W+ +DQS+ W A
Sbjct  7     GTAAERNDDGGGRREPLINRENKFKRSVSNVHD-----ELHSFRKYLRWMCVDQSSPWTA  61

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSWS+F + T+ VP +S+ + +C  CDS H RP+++ VQLSLS FA +SF+ LS F  +
Sbjct  62    VLSWSMFVVFTLVVPAMSHFMLACANCDSHHSRPYDSGVQLSLSSFAALSFLCLSRFVSK  121

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             +G+R+FLF D+L +E+  V++GYT Q++ SLKIL+ FV P FLA  +YKIWW+ +G  QI
Sbjct  122   FGLRRFLFFDKLWDESSTVRRGYTNQLNRSLKILSYFVAPCFLAMSSYKIWWYASGASQI  181

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V 
Sbjct  182   PFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVG  241

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R+FILS+LI+VT  QF  LL+TT+S +  ++ +A EL LC
Sbjct  242   SILSEHLRIRRHLRIISHRYRIFILSSLILVTGGQFYPLLITTKSHAGLNVNSAGELALC  301

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDRTGTGTP  1166
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+     TP  VDR      
Sbjct  302   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGGTPRLVDRASGHGF  361

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYG  1343
              +      D ++ ++ G+ +D+ DN +++P +A+ TIS+ KRQALV YFE+NKAGITV+G
Sbjct  362   YSTDVEIGDTDDSEDYGEEEDDFDNNDLIPAYAYSTISFQKRQALVHYFENNKAGITVFG  421

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  422   FTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>gb|KFK39352.1| hypothetical protein AALP_AA3G233200 [Arabis alpina]
Length=454

 Score =   437 bits (1125),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 236/446 (53%), Positives = 322/446 (72%), Gaps = 16/446 (4%)
 Frame = +3

Query  105   KPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSW  284
             +P+ + ++ E +       T  +S +  E+ + R+  R      W+ +DQS+ W A LSW
Sbjct  22    EPLIINNNRENKF------TRCVSHAQDELHSFRKYLR------WMCVDQSSPWTAVLSW  69

Query  285   SLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVR  464
             S+F + T+ VP  S+ + +C  CDS H RP++++VQLSLS FA +SF+ LS F  +YG+R
Sbjct  70    SMFVVFTLVVPATSHFMLACSDCDSHHSRPYDSVVQLSLSSFAALSFLCLSRFISKYGLR  129

Query  465   KFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFY  644
             +FLF D+L +E++ V++GYT Q++ SLKIL+ FV P FLA  +YKIWW+ +G  QIP+  
Sbjct  130   RFLFFDKLWDESETVRRGYTNQLNRSLKILSYFVTPCFLAMSSYKIWWYASGASQIPFLG  189

Query  645   NMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILI  824
             N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V +IL 
Sbjct  190   NVILSDTVACVMELFSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVGSILS  249

Query  825   EHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIM  1004
             EHLRIRR+LR+ISHR+R FIL +LI+VT SQF SLL+TT++ +  +I+ A EL LCSM +
Sbjct  250   EHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYAELNIYRAGELALCSMTL  309

Query  1005  VTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDRTGTGTPQAIH  1178
             +T L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+    ETP  VDRT +G      
Sbjct  310   LTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGETPRLVDRT-SGHGFHST  368

Query  1179  PVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLD  1355
              VD    + ++ GD +D+ DN N++P +A+ TIS+ KRQALV YFE+N+AGITV+GF LD
Sbjct  369   DVDTGGSDSEDYGDEEDDFDNNNLIPAYAYSTISFQKRQALVNYFENNRAGITVFGFTLD  428

Query  1356  RTWLHTIFVIQLSLTLWILNKTIGIS  1433
             R+ LHTIF I++SL LW+L KTIGIS
Sbjct  429   RSTLHTIFGIEMSLVLWLLGKTIGIS  454



>ref|XP_009770783.1| PREDICTED: uncharacterized protein LOC104221410 [Nicotiana sylvestris]
Length=440

 Score =   437 bits (1124),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 320/441 (73%), Gaps = 11/441 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTAL-ISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             M D  ET +I +  +    +S+ Y E+ + R      + L W+ +DQS+ + A LSW +F
Sbjct  9     MCDKNETLLINKNKELGRSVSNEYDELRSFR------TWLKWMCVDQSDPFSACLSWFVF  62

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              +L I VP +S+   +C  CD+ + RP++ +VQLSLS  A +SFI LS F ++YG+R+FL
Sbjct  63    VLLAIVVPCLSHFSLACSDCDAAYNRPYDNVVQLSLSSVAALSFICLSRFVKKYGLRRFL  122

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+LC+E++ V++ YT Q++SSLKIL  FVLP F A+CAYKIWW+ +GG QIP+  N+I
Sbjct  123   FLDKLCDESETVRKCYTQQLNSSLKILFIFVLPCFAAECAYKIWWYSSGGTQIPFLGNVI  182

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
              S++V CIL L+SWLYR  + FLVC+LFRLIC+LQ+LRL  FAQVF  +S+V ++L EHL
Sbjct  183   ASDIVACILELTSWLYRTVVFFLVCILFRLICYLQVLRLQDFAQVFHVDSDVESVLREHL  242

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+LR+ISHR+R FIL  L+ +TASQF SLL+TT S +  HI+ + EL LCS+ ++ G
Sbjct  243   RIRRHLRIISHRYRAFILWALMFITASQFASLLMTTRSTADLHIYKSGELALCSVSLLAG  302

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L I LRSA KITHKAQSV  LAAKWH CAT+ SFD    ETP+ R   G      P  ++
Sbjct  303   LMILLRSATKITHKAQSVTCLAAKWHVCATIDSFDSIEGETPISRATCGQS---FPACSE  359

Query  1194  wenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               + D+ GD +DELDNT  VP +A+ TIS+ KRQALV YFE+N+AG+T+YGFMLDR+ +H
Sbjct  360   GSDSDDVGDEEDELDNTKFVPAYAYSTISFQKRQALVKYFENNRAGVTIYGFMLDRSSIH  419

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             TIF ++LSL LW+L KTIGIS
Sbjct  420   TIFGLELSLVLWLLGKTIGIS  440



>gb|KGN66826.1| hypothetical protein Csa_1G699550 [Cucumis sativus]
Length=434

 Score =   437 bits (1123),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 312/441 (71%), Gaps = 12/441 (3%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWL-FLDQSNLWRAGLSWSLF  293
             +E   + +I  + SK+A + S       A E+++L S L W+  +D SNL+RA +S  +F
Sbjct  4     VEKKSQPQIDSQKSKSAELESELE----APELRKLESFLRWICIMDHSNLYRASVSCIMF  59

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+  I VP+ S+   SC  CD  HQRPF+ +VQLSLS  AT+SF+ LS + R +G+ +FL
Sbjct  60    FVFGIAVPIASHFGLSCSDCDEDHQRPFHVVVQLSLSAVATLSFLCLSLWLRVFGLNRFL  119

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYF-YNM  650
             FLD+LCE + K++  Y  Q+  S+K+++ F+LP F+A+  YKIWW+++   +IPY+  NM
Sbjct  120   FLDKLCEASPKIRAEYFRQLQKSMKLMSFFLLPCFMAEAGYKIWWYISAAKEIPYYTNNM  179

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
              +S V  C L L SWLYR +I F VC+ FRLIC LQ++RL+ FA  F  E+EV  ILI+H
Sbjct  180   YISYVTSCTLELCSWLYRTSIFFFVCIFFRLICCLQMIRLEDFASSFRSETEVGTILIQH  239

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVT  1010
             L +RR   VISHRFR+F+L +LI+VTASQF+SLL+TT SK+HA++  + +L LCS+ +VT
Sbjct  240   LGLRRTFTVISHRFRVFMLLSLILVTASQFISLLMTTRSKAHANLSKSGQLALCSISLVT  299

Query  1011  GLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVda  1190
             GLFICLRSAAKITHKAQS+  LAAKWH  A +++FDE      +D   T T   +  V  
Sbjct  300   GLFICLRSAAKITHKAQSITCLAAKWHVSAVINTFDE------LDTEMTPTASFVPNVVE  353

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
                +D++  + +D+LD+  ++PV AHTIS+ KRQALVTY  +NKAGITVYGFM+DRTWL 
Sbjct  354   SNSDDEDGDEDEDDLDDAKLMPVFAHTISFQKRQALVTYLRNNKAGITVYGFMVDRTWLK  413

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             +IF I+L+L LW+LNKT+G+S
Sbjct  414   SIFAIELALFLWLLNKTVGVS  434



>ref|XP_010675782.1| PREDICTED: uncharacterized protein LOC104891734 [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   437 bits (1123),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 229/432 (53%), Positives = 309/432 (72%), Gaps = 11/432 (3%)
 Frame = +3

Query  150   RLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSY  329
             R S   L+S ++ E+ + R      S L W+ +DQSN++ A LSW +F +  I VP  S+
Sbjct  19    RKSFNRLLSHAHDELHSFR------SYLRWMCVDQSNIYTAFLSWFVFLVFAIVVPAFSH  72

Query  330   LVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKV  509
                +C  CD+KH RP++ +VQLSLS  AT+SF+ +S F R+YG+R+FLFLD+L +E+D V
Sbjct  73    FYLACPTCDAKHDRPYDTLVQLSLSSIATLSFVCISQFVRKYGLRRFLFLDKLVDESDSV  132

Query  510   QQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLS  689
             +  YT +++ SLKIL+ FVLP F+A+C YK+WW+ +G  QIP+  N+ILS++V C L L 
Sbjct  133   RHHYTTELNRSLKILSIFVLPCFVAECTYKVWWYSSGSSQIPFLGNIILSDIVACSLELI  192

Query  690   SWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHR  869
             SWLYR  + FLVCVLFRLIC+LQILRL  FA VF+ +S+V ++L+EHLRIRR+LR+ISHR
Sbjct  193   SWLYRTLVFFLVCVLFRLICYLQILRLKDFATVFQVDSDVGSVLVEHLRIRRHLRIISHR  252

Query  870   FRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKIT  1049
             +R FIL  L ++T+SQF +LL TT++ +   IF A EL L SM ++TGL I LRSA KIT
Sbjct  253   YRAFILYALTIITSSQFAALLFTTKNHADMSIFRAGELALSSMTLMTGLAIILRSATKIT  312

Query  1050  HKAQSVASLAAKWHACATLSSFDEFGD-ETPVDR---TGTGTPQAIHPVdadwenddeeg  1217
             HKAQ+V +L+ KWH CAT+ SF    + ETPV +   TG           +   ++DE G
Sbjct  313   HKAQAVTALSTKWHVCATIDSFFTTSETETPVAQNTSTGGAASPGFFDARSGDSDEDEAG  372

Query  1218  dgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLS  1394
               +D++DNT  +P +A+ +I + KRQALVTYFE+NKAGITVYGFMLDRTWL  IF I+LS
Sbjct  373   SEEDDVDNTKFLPAYAYSSIGFQKRQALVTYFENNKAGITVYGFMLDRTWLQLIFGIELS  432

Query  1395  LTLWILNKTIGI  1430
             L LW+L KTIGI
Sbjct  433   LVLWLLGKTIGI  444



>ref|XP_009589161.1| PREDICTED: uncharacterized protein LOC104086572 [Nicotiana tomentosiformis]
Length=433

 Score =   436 bits (1122),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 314/441 (71%), Gaps = 10/441 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+ E E++   +K  L+ S  H      E++   +   W+ +DQS+ W A LSW +F 
Sbjct  1     MEDENE-ELV---NKKVLVRSGSHMYD---ELRSFRTWFKWMCVDQSDTWSACLSWFVFI  53

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
              L + VP +S+ + +C  CD+ H RP++++VQLSLS  A +SFI LS F ++YG+R+FLF
Sbjct  54    WLAVVVPWLSHYLLACTDCDADHSRPYDSVVQLSLSSVAALSFICLSRFNKKYGLRRFLF  113

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC E++ V+  YT Q++ S+KIL  FV+P F A+  YKIWW+ +GG + P+  N+++
Sbjct  114   LDKLCGESETVRNCYTQQLNRSMKILFIFVMPCFAAEITYKIWWYSSGGTRFPFLGNVVM  173

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQV-FEKESEVSAILIEHL  833
             SN+V CIL L+SWLYR  + FLVCVLFRLIC+LQILRL  FAQV F  +S+V ++L EHL
Sbjct  174   SNIVACILELTSWLYRTVVFFLVCVLFRLICYLQILRLQDFAQVLFHVDSDVESVLREHL  233

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+LR+ISHR+R+FIL  LI +TAS F SLL+TT   +  HI+ + EL LCS+ ++ G
Sbjct  234   RIRRHLRIISHRYRVFILWALIFITASLFASLLMTTRPNADLHIYKSGELALCSVSLLAG  293

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L I LRSA +ITHKAQ+V SLAAKWH CAT+ S+D    ET    T     Q  HP    
Sbjct  294   LMILLRSATRITHKAQAVTSLAAKWHVCATIGSYDWAKAETS-PATQVACNQDFHPSSNG  352

Query  1194  wenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               + ++ GD +DELDNT  VP +A+ TIS+ KRQALVTYFE+N+AG+T+YGFMLDR+ LH
Sbjct  353   SSDAEDVGDEEDELDNTKFVPSYAYSTISFQKRQALVTYFENNRAGVTIYGFMLDRSSLH  412

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             TIF I+L+L LW+L KT+G+S
Sbjct  413   TIFGIELTLMLWLLGKTVGVS  433



>emb|CDY68401.1| BnaCnng58860D [Brassica napus]
Length=451

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 314/450 (70%), Gaps = 11/450 (2%)
 Frame = +3

Query  102   GKPIAMEDD---EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
             G      DD       +I R  K     S+ H+     E+      L W+ +DQS+ W A
Sbjct  7     GTAAERNDDGGGRREPLINREKKFKRSVSNVHD-----ELHSFRKYLRWMCVDQSSPWTA  61

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSWS+F + T+ VP +S+ + +C  CDS H RP+++ VQLSLS FA +SF+ LS F  +
Sbjct  62    VLSWSMFVVFTLVVPAMSHFMLACANCDSHHSRPYDSGVQLSLSSFAALSFLCLSKFVSK  121

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             +G+R+FLF D+L +E+  V++GYT Q++ SLKIL  FV P FLA  +YKIWW+ +G  QI
Sbjct  122   FGLRRFLFFDKLWDESSTVRRGYTSQLNRSLKILFYFVAPCFLAMSSYKIWWYASGASQI  181

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQVF+ +S+V 
Sbjct  182   PFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDVG  241

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R+FILS+LI+VT SQF SLL++T+S +  ++ +A EL LC
Sbjct  242   SILSEHLRIRRHLRIISHRYRIFILSSLILVTGSQFYSLLISTKSHAGLNVNSAGELALC  301

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDRTGTGTP  1166
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+ SF+     TP  VDR      
Sbjct  302   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATIESFETVDGGTPRLVDRASGHGF  361

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYG  1343
              +      D ++ ++ G+ +D+ DN + +P +A+ TIS+ KRQALV YFE+NKAGITV+G
Sbjct  362   YSTDVEIGDTDDSEDYGEEEDDFDNNDRIPAYAYSTISFQKRQALVHYFENNKAGITVFG  421

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  422   FTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  451



>ref|XP_006352526.1| PREDICTED: uncharacterized protein LOC102597876 [Solanum tuberosum]
Length=433

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 309/418 (74%), Gaps = 8/418 (2%)
 Frame = +3

Query  192   ISNA-REVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +SNA  E++   + L W+ +DQSN + A LSW +F +L + VP +S+ + + D  D+ H 
Sbjct  20    VSNAYDELRSFRTWLKWMCVDQSNAFSACLSWFVFILLAVIVPCLSHFLLARDDSDAAHS  79

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++ +VQLSLS  + +SF+ LS F ++YG+R+FLFLD+LC+E++ V++GYT Q++SSLK
Sbjct  80    RPYDNVVQLSLSSVSALSFVCLSQFVKKYGLRRFLFLDKLCDESETVRRGYTEQLNSSLK  139

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL  FVLP F  +CAYKIWW+ +GG +IP+  N+I+S+ V CIL LSSWLYR  + FLVC
Sbjct  140   ILFIFVLPCFAVECAYKIWWYSSGGTRIPFLGNVIVSDTVACILELSSWLYRTVVFFLVC  199

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             +LFRLIC+LQILRL  FAQVF  +S+V ++L EHLRIRR+LR+ISHR+R FIL  L++VT
Sbjct  200   ILFRLICYLQILRLQDFAQVFHVDSDVESVLREHLRIRRHLRIISHRYRSFILWALMLVT  259

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             ASQF SLL+TT S +  HI+ + EL LCS+ ++ GL I LRSA +ITHKAQSV  LAAKW
Sbjct  260   ASQFASLLMTTRSTADLHIYKSGELALCSVSLLAGLMILLRSATRITHKAQSVTCLAAKW  319

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             H CAT+ SFD    +TP+ R    T   + PV     + D +  GD+E +  N   VHA+
Sbjct  320   HVCATIDSFDSTEADTPITR---ATSDHVFPV-CSEGSSDADDVGDEEDELDNTKFVHAY  375

Query  1269  ---TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
                TIS+ KRQALVTYFE+N+AG+T+YGFMLDR+ +HTIF I+LSL LW+L KTIGIS
Sbjct  376   AYSTISFQKRQALVTYFENNRAGVTIYGFMLDRSSIHTIFGIELSLVLWLLGKTIGIS  433



>emb|CAN83979.1| hypothetical protein VITISV_007068 [Vitis vinifera]
Length=435

 Score =   436 bits (1120),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 315/440 (72%), Gaps = 12/440 (3%)
 Frame = +3

Query  129   EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTI  308
             +E E +LR +K    S SY +     E++   S L W+ +DQS +    LSWS+F +L I
Sbjct  3     DERERLLRKNKFQR-SISYAQ----DELQSFRSWLRWMCVDQSTISTGCLSWSVFILLAI  57

Query  309   GVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRL  488
              VP++S+ + +C +CD+KHQRP++A+VQLSLS  A +SF+ LS F R YG+R+FLF D+L
Sbjct  58    AVPVMSHFLLACSSCDAKHQRPYDAVVQLSLSSVAVLSFLCLSRFIRNYGLRRFLFFDKL  117

Query  489   CEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVV  668
              +E++ V+  YT Q++ S+KIL+ FVLP F A+  YKIWW+ +G  +IP+  N+ +S+V+
Sbjct  118   RDESEMVRXNYTEQLNRSMKILSLFVLPCFAAEATYKIWWYSSGRSRIPFLGNVYVSDVI  177

Query  669   ICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRN  848
              C L L SWLYR ++ FLVCVLFRLICHLQILRL  FA+VF+ ES+V ++L EHLRIRR+
Sbjct  178   ACTLELCSWLYRTSVFFLVCVLFRLICHLQILRLQDFARVFQAESDVESVLREHLRIRRH  237

Query  849   LRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICL  1028
             LR+ISHR R+FIL  L+ VTASQF SLL TT S++  ++F A EL LCS+ +VTGL +  
Sbjct  238   LRIISHRNRVFILFALMFVTASQFASLLSTTRSRADVNMFTAGELALCSITLVTGLLVLF  297

Query  1029  RSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwendd  1208
             R A KITHKAQ++  LAAKWH CAT+ SF+    E+P  R     P+      ++  + +
Sbjct  298   RGATKITHKAQAITCLAAKWHVCATIDSFESNEPESP--RIQIPCPRPFPSRASNENDVE  355

Query  1209  e----egdgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
                   GD +D++D+T ++P +A  TIS+ KRQALV YFE+N+AGITVYGFMLDRT L+T
Sbjct  356   SDGEDAGDEEDDVDSTKLIPAYASSTISFQKRQALVVYFENNRAGITVYGFMLDRTSLNT  415

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF+I++SL LW+L KTIGIS
Sbjct  416   IFMIEMSLVLWLLGKTIGIS  435



>ref|XP_009603512.1| PREDICTED: uncharacterized protein LOC104098475 [Nicotiana tomentosiformis]
Length=447

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 236/422 (56%), Positives = 311/422 (74%), Gaps = 10/422 (2%)
 Frame = +3

Query  171   ISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDA  350
             +S+ Y E+ + R      + L W+ +DQS+ + A LSW +F +L I VP +S+   +C  
Sbjct  35    VSNEYDELRSFR------TWLKWMCVDQSDPFSACLSWFVFALLAIVVPCLSHFSLACSD  88

Query  351   CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQ  530
             CD+ H RP++ +VQLSLS  A +SFI LS F ++YG+R+FLFLD+LC+E++ V++ YT Q
Sbjct  89    CDAAHSRPYDNVVQLSLSSVAALSFICLSRFVKKYGLRRFLFLDKLCDESETVRKCYTQQ  148

Query  531   IHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIA  710
             ++SSLKIL  FVLP F A+CAYKIWW+ +GG QIP+  N+I S++V CIL LSSWLYR  
Sbjct  149   LNSSLKILFIFVLPCFAAECAYKIWWYSSGGTQIPFLGNVIASDIVACILELSSWLYRTV  208

Query  711   ISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILS  890
             + FLVCVLFRLIC+LQ+LRL  FAQVF  +S+V ++L EHLRIRR+LR+ISHR+R FIL 
Sbjct  209   VFFLVCVLFRLICYLQVLRLQDFAQVFHVDSDVESVLREHLRIRRHLRIISHRYRAFILW  268

Query  891   TLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVA  1070
              L+ +TASQF SLL+TT S +  HI+ + EL LCS+ ++ GL I LRSA KITHKAQSV 
Sbjct  269   ALMFITASQFASLLMTTRSTADLHIYKSGELALCSVSLLAGLMILLRSATKITHKAQSVT  328

Query  1071  SLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM  1250
              LAAKWH CAT+ SFD    ETP+ R   G      P  +   + D+ GD +DELDNT  
Sbjct  329   CLAAKWHVCATIDSFDSIEGETPITRATCGQG---FPECSKGSDSDDVGDEEDELDNTIF  385

Query  1251  VPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             VP +A+ TIS+ KRQALV YFE+N+AG+T+YGFMLDR+ +HTIF ++LSL LW+L KTIG
Sbjct  386   VPAYAYSTISFQKRQALVKYFENNRAGVTIYGFMLDRSSIHTIFGLELSLVLWLLGKTIG  445

Query  1428  IS  1433
             IS
Sbjct  446   IS  447



>ref|XP_007146523.1| hypothetical protein PHAVU_006G048100g [Phaseolus vulgaris]
 gb|ESW18517.1| hypothetical protein PHAVU_006G048100g [Phaseolus vulgaris]
Length=434

 Score =   435 bits (1118),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 228/443 (51%), Positives = 305/443 (69%), Gaps = 17/443 (4%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             M D   T ++ R  K    + S   +++  E     S L W+ +DQSN + A LSWS+F 
Sbjct  1     MSDTAATALLDRRGK---YNRSVSHVND--EFHTFRSYLRWMCVDQSNAFTAALSWSVFL  55

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L + VP  S+ + +C  CD  H RP++ +VQ+SL+  A +SF+ L+ F R+YG+R+FLF
Sbjct  56    LLAVVVPAASHFLLACPDCDGHHSRPYDGVVQVSLTTVAALSFLCLAGFVRKYGLRRFLF  115

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+LC+E++ V+  Y  Q++ SLKIL+ FV P F+ +CAYKIWW+ +G  QIP+  N+ +
Sbjct  116   FDKLCDESETVRTNYMAQLNRSLKILSVFVGPCFVVECAYKIWWYASGASQIPFLGNVYV  175

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S+ V CIL L SWLYRI + FLVCVLFRLICHLQILRL  FA  F  +S+V++++ EHLR
Sbjct  176   SDAVACILELCSWLYRITVIFLVCVLFRLICHLQILRLRDFAGFFHVDSDVASVMSEHLR  235

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRR+LR+ISHRFR FIL  L++VT SQF SLLVTT+     +++ A EL LCS+ +++ L
Sbjct  236   IRRHLRIISHRFRAFILLALVLVTGSQFASLLVTTKHSGSMNLYMAGELALCSVTLLSAL  295

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEF--GDETPVDRTGTGTPQAIHPVd-  1187
              I LRSA KITHKAQ++  LAAKWH CATL SFD      ETP+       PQ+ H    
Sbjct  296   CILLRSATKITHKAQAITGLAAKWHVCATLDSFDGVLTDGETPM------APQSSHETVF  349

Query  1188  --adwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
                  + + + GD +DE+D T  +P +A+ TISY KRQALV YFE+N+AGITVYGFMLDR
Sbjct  350   PNVGTDGESDAGDEEDEIDTTKFIPSYAYSTISYQKRQALVNYFENNRAGITVYGFMLDR  409

Query  1359  TWLHTIFVIQLSLTLWILNKTIG  1427
             + LHTIF IQLSL LW+L KTIG
Sbjct  410   STLHTIFGIQLSLVLWLLGKTIG  432



>ref|XP_010060281.1| PREDICTED: uncharacterized protein LOC104448186 [Eucalyptus grandis]
 gb|KCW66913.1| hypothetical protein EUGRSUZ_F00658 [Eucalyptus grandis]
Length=436

 Score =   435 bits (1118),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 308/417 (74%), Gaps = 7/417 (2%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++   S L W+ +DQSN W A LSWS+F I  I VP  S+ + +C +CD+KH 
Sbjct  24    VSHAQDELQSFRSYLRWMCVDQSNAWTACLSWSMFLIFAIAVPAASHFLLACSSCDAKHA  83

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RPF+ +VQLSLS  AT+SF+ LS F R+YG+R+FLF D+L +E++ V+ GYT Q++ SLK
Sbjct  84    RPFDGVVQLSLSSLATLSFVCLSRFVRKYGLRRFLFFDKLWDESETVRDGYTDQLNRSLK  143

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FVLP F A+ AYKIWW+ +G  QIP+  N+ LS+ V CI+ L SWLYR  + FLVC
Sbjct  144   ILSIFVLPCFAAESAYKIWWYASGASQIPFLGNVYLSDTVACIMELCSWLYRTMVIFLVC  203

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLIC LQILRL  F Q+F+ +++V+++L EH +IRR+LR+ISHR+R FIL  L++VT
Sbjct  204   VLFRLICSLQILRLQDFPQLFQVDTDVASVLSEHHKIRRHLRIISHRYRAFILWALVLVT  263

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLLVTT+S +  +I+ A EL LCSM +V  L I LRSA KITHKAQSV  LAAKW
Sbjct  264   GSQFASLLVTTKSTADVNIYRAGELALCSMTLVAALLILLRSATKITHKAQSVTCLAAKW  323

Query  1089  HACATL-SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHA  1265
             H CATL  SF+    ETPV +   G   A+  +    E++ + GD +D LDN+ ++  +A
Sbjct  324   HICATLGDSFEANDGETPVAQAAHGQVFAVRSI----ESESDAGDEEDGLDNSKLIAEYA  379

Query  1266  H-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + TISY KRQALVTYFE+N+AGITVYGF LDRT LHTIF I+LSL LW+L KT+GIS
Sbjct  380   YSTISYQKRQALVTYFENNRAGITVYGFTLDRTTLHTIFGIELSLVLWLLGKTVGIS  436



>ref|XP_011097838.1| PREDICTED: uncharacterized protein LOC105176662 [Sesamum indicum]
Length=434

 Score =   434 bits (1117),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 311/437 (71%), Gaps = 7/437 (2%)
 Frame = +3

Query  129   EETEIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             +E   +L   K    + S   +S+A+ E++   + L WL +DQSN W A LSW +F  L 
Sbjct  3     DEKAALLNPGKNRAFARS---VSHAQDELQGFRTWLKWLCVDQSNHWTAALSWFVFVGLA  59

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             I VP +S+ V +C  CDS H RP++A+ QLSLS  A +SFI LS F R+YG+R+FLF D+
Sbjct  60    IIVPALSHFVLACADCDSLHNRPYDAVAQLSLSGVAALSFICLSGFVRKYGLRRFLFFDK  119

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             LC+E++ V++GYT Q + S+K+L  FVLP F A+ AYKIWW+ +GG +IP+  N+I+SN 
Sbjct  120   LCDESETVRKGYTKQFNRSMKLLFIFVLPCFAAESAYKIWWYSSGGTRIPFLGNVIVSNT  179

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
             V CIL L SW YR  + FLVC+LFRLIC+LQILRL  FAQVF+ +S+V ++L EHLRIRR
Sbjct  180   VACILELCSWFYRTVVFFLVCILFRLICYLQILRLQDFAQVFQVDSDVESVLREHLRIRR  239

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
             +LR+ISHR+R FIL  LI +TASQF SLL+TT S +  +I+   EL +CS+ ++ GL I 
Sbjct  240   HLRIISHRYRSFILLALIFITASQFASLLMTTRSSADVNIYHTGELAVCSLSLLAGLLIL  299

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwend  1205
             LRSA +ITHKAQ+V  LAAKWH CAT+ SFD    ETPV R      Q          + 
Sbjct  300   LRSATRITHKAQAVTCLAAKWHVCATIDSFDTAETETPVAR--VSDEQIFTGSSDGSSDL  357

Query  1206  deegdgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
             D+ GD +DELDN+  +P +A  TIS+ KRQALVTYFE+N+AGIT+YGFMLDRT LHTIF 
Sbjct  358   DDVGDEEDELDNSKFLPAYAFSTISFQKRQALVTYFENNRAGITIYGFMLDRTSLHTIFG  417

Query  1383  IQLSLTLWILNKTIGIS  1433
             I+LSL LW+L KT+GIS
Sbjct  418   IELSLVLWLLGKTVGIS  434



>ref|XP_008803503.1| PREDICTED: uncharacterized protein LOC103717050 [Phoenix dactylifera]
Length=438

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 296/409 (72%), Gaps = 7/409 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQS+     +SWSLFF+L++ VP+VS+ V S +     H+RP++  
Sbjct  37    ELGGFRSCLRWMCMDQSDRCHGLMSWSLFFVLSLAVPIVSHFVLSYN----PHRRPYDLA  92

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  + +SF+ LS   RRYG+ +FLFLD+L +E + V+ GYT  +  S ++L+ FV
Sbjct  93    VQLSLTAASALSFLCLSAVTRRYGLHRFLFLDKLRDETEHVRLGYTAHLDRSFRLLSYFV  152

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+ AYKIWW+  G G+IP+  N + S+VV C+L L+SW+YR A   L+CVLFRLI
Sbjct  153   LPLFAAEMAYKIWWYCAGAGRIPFLGNPVASDVVACVLELASWIYRTATFILLCVLFRLI  212

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C LQILRL  FA VF++ESEV  +L EHLRIRR LRVISHRFR FILS L++VTASQF +
Sbjct  213   CQLQILRLQDFAAVFQEESEVGLVLAEHLRIRRQLRVISHRFRAFILSCLVLVTASQFAA  272

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT S S  ++F   EL LCS+++VTGLFICLRSAAKITHKAQ++ S AAKWH CAT+
Sbjct  273   LLLTTRSHSDVNLFNTGELALCSIVLVTGLFICLRSAAKITHKAQALTSHAAKWHVCATI  332

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
              SFD    ETP +   T  P  +  V+   +  DE+   +DEL++  ++P HAHTIS+ K
Sbjct  333   DSFDA-DPETPGEV--TLNPNCVFAVNGGEDESDEDVSAEDELEDMKILPPHAHTISFQK  389

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALVTY E+NKAGIT++GF LDR WL+TIF+++ +L LW+L KT GIS
Sbjct  390   RQALVTYLENNKAGITIFGFTLDRAWLYTIFMLETTLFLWLLGKTTGIS  438



>ref|XP_009794607.1| PREDICTED: uncharacterized protein LOC104241364 [Nicotiana sylvestris]
Length=439

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 314/442 (71%), Gaps = 8/442 (2%)
 Frame = +3

Query  114   AMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             A ++  +++ +L  S  A   S  H     R  +R    L W+ +DQS+ W   LSW +F
Sbjct  4     ATQNQSQSQSLLPKS-IAYNRSKSHAYDELRSFRRW---LKWMCVDQSDTWSTCLSWFVF  59

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              + TI VP +S+ + +C  CD+ H RP++ +VQLSLS  A +SFI LS F +++G+R+FL
Sbjct  60    IVFTIIVPCLSHFLLACADCDATHDRPYDNVVQLSLSGVAALSFICLSGFVKKFGLRRFL  119

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+LC+E++ V++GY  Q+H SLKIL  FVLP F A+  YKIWW+ +GG QIP+  N+I
Sbjct  120   FLDKLCDESETVRKGYMQQLHRSLKILFIFVLPCFAAESIYKIWWYSSGGTQIPFLGNVI  179

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +S+ V CIL LSSWLYR  + FLVCVLFRLIC+LQILRL  FAQVF  +S+V ++L EHL
Sbjct  180   VSDTVACILELSSWLYRTTVFFLVCVLFRLICYLQILRLQDFAQVFHVDSDVESVLREHL  239

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+LR+ISHR+R FI+  L+ +TASQF SL ++T S S  HI+ + EL LCS+ ++ G
Sbjct  240   RIRRHLRIISHRYRRFIVLALVFITASQFASLFMSTRSSSDLHIYKSGELALCSVSLLAG  299

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L I LRSA +ITHKAQ+V  LAAKWH CAT+ SFD    ETP           + PV + 
Sbjct  300   LLILLRSAVRITHKAQAVTCLAAKWHVCATIDSFDSVEGETP--PISQIVSNQVFPVSSQ  357

Query  1194  wenddeeg-dgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWL  1367
               +D ++  D +DELDNT  VP +A+ TIS+ KRQALVTYFE+N+AG+T+YGFMLDR++L
Sbjct  358   GSSDADDVGDEEDELDNTQFVPSYAYSTISFQKRQALVTYFENNRAGVTLYGFMLDRSYL  417

Query  1368  HTIFVIQLSLTLWILNKTIGIS  1433
             HTIF I+L+L LW+L KTIGIS
Sbjct  418   HTIFGIELALVLWLLGKTIGIS  439



>ref|XP_009598341.1| PREDICTED: uncharacterized protein LOC104094171 [Nicotiana tomentosiformis]
Length=439

 Score =   433 bits (1113),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 301/410 (73%), Gaps = 2/410 (0%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +DQS+ W   LSW +F + TI VP +S+ + +C  CD+ H RP++ +
Sbjct  31    ELRSFRRWLKWMCVDQSDTWSTCLSWFVFIVFTIVVPCLSHFLLACADCDATHDRPYDNV  90

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SFI LS F +++G+R+FLFLD+LC+E++ V++GY  Q+H SLKIL  FV
Sbjct  91    VQLSLSGVAALSFICLSGFVKKFGLRRFLFLDKLCDESETVRKGYMQQLHRSLKILFIFV  150

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+  YKIWW+ +GG QIP+  N+I+S+ V CIL LSSWLYR  + FLVCVLFRLI
Sbjct  151   LPCFAAESIYKIWWYSSGGTQIPFLGNVIVSDTVACILELSSWLYRTTVFFLVCVLFRLI  210

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FAQVF  +S+V ++L EHLRIRR+LR+ISHR+R FI+  L+ +TASQF S
Sbjct  211   CYLQILRLQDFAQVFHVDSDVESVLREHLRIRRHLRIISHRYRRFIVLALVFITASQFAS  270

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             L ++T S S  HI+ + EL LCS+ ++ GL I LRSA +ITHKAQ+V  LAAKWH CAT+
Sbjct  271   LFMSTRSSSDLHIYKSGELALCSVSLLAGLLILLRSAVRITHKAQAVTCLAAKWHVCATI  330

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYH  1283
              SFD    ETP   +   + Q          + D+ GD +DELDNT  VP +A+ TIS+ 
Sbjct  331   DSFDSVEGETP-PISQIASNQVFPVSSQGSSDADDVGDEEDELDNTQFVPSYAYSTISFQ  389

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             KRQALVTYFE+N+AG+T+YGFMLDR++LHTIF I+L+L LW+L KTIGIS
Sbjct  390   KRQALVTYFENNRAGVTLYGFMLDRSYLHTIFGIELALVLWLLGKTIGIS  439



>ref|XP_002531193.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31170.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   431 bits (1108),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 288/377 (76%), Gaps = 9/377 (2%)
 Frame = +3

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             I VP +S+ V +C  CDSKH+RP++++VQLSLS  AT+SF+ LS F R+YG+R+FLFLD+
Sbjct  23    IVVPAISHFVLACSTCDSKHKRPYDSVVQLSLSSVATLSFVCLSKFIRKYGLRRFLFLDK  82

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             LC+E++ V++GYT Q++ SLK+L+ FVLP F+A+ AYKIWW+ +G  QIP+  N+ILS+ 
Sbjct  83    LCDESETVRKGYTDQLNWSLKLLSIFVLPCFVAESAYKIWWYASGASQIPFLGNVILSDT  142

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
             V CI+ L SWLYR  I FLVCVLF LICHLQILRL  FAQVF+ +S+V ++L EHLRI+R
Sbjct  143   VACIMELCSWLYRTTIIFLVCVLFHLICHLQILRLQDFAQVFQVDSDVESVLSEHLRIKR  202

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
             +LR+ISHR+R F+L  LI+ T SQF SLL+TT+S +   ++ A EL LCS+ +VTGL I 
Sbjct  203   HLRIISHRYRAFVLWALILATGSQFASLLITTKSGAVVDVYRAGELALCSITLVTGLLII  262

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwend  1205
             LRSA KITHKAQSV SLAAKWH CATL +FD    ETP   T  G          D E  
Sbjct  263   LRSATKITHKAQSVTSLAAKWHICATLDTFDSTEGETPRTPTANG--------ITDDEEG  314

Query  1206  deegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
             D+ GD +DELDN+ ++P +A+ TIS+ KRQALV YFE+N+AGITVYGF LDR+ LH+IF 
Sbjct  315   DDAGDEEDELDNSKLIPAYAYSTISFQKRQALVNYFENNRAGITVYGFTLDRSTLHSIFG  374

Query  1383  IQLSLTLWILNKTIGIS  1433
             ++L+L LW+L KT+GIS
Sbjct  375   VELALVLWLLGKTVGIS  391



>ref|XP_009796127.1| PREDICTED: uncharacterized protein LOC104242742 [Nicotiana sylvestris]
Length=433

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 313/440 (71%), Gaps = 11/440 (3%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             +DE+ E+   L+K  L+ S  H      E++   +   W+ +DQS+ W A LSW +F  L
Sbjct  2     EDEDKEL---LNKKVLVRSGSHMYD---ELRSFRTWFKWMCVDQSDTWSACLSWFVFIWL  55

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
              + VP +S+ + +C  C S H RP++++VQLSLS  A +SFI LS F ++YG+R+FLFLD
Sbjct  56    AVVVPWLSHYLLACTDCVSDHSRPYDSVVQLSLSSVAALSFICLSRFNKKYGLRRFLFLD  115

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
             +LC E++ V+  YT Q++ S+KIL  FV+P F A+  YKIWW+ +GG + P+  N+++SN
Sbjct  116   KLCGESETVRNCYTQQLNRSMKILFIFVMPCFAAEITYKIWWYSSGGTRFPFLGNVVMSN  175

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQV-FEKESEVSAILIEHLRI  839
             +V CIL L+SWLYR  + FLVCVLFRLIC+LQILRL  FAQV F  +S+V ++L EHLRI
Sbjct  176   IVACILELTSWLYRTVVFFLVCVLFRLICYLQILRLQDFAQVLFHVDSDVESVLREHLRI  235

Query  840   RRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLF  1019
             RR+LR+ISHR+R+FIL  LI +TAS F SLL+TT   +  HI+ + EL LCS+ ++ GL 
Sbjct  236   RRHLRIISHRYRVFILWALIFITASLFASLLMTTRPNADLHIYKSGELALCSVSLLAGLM  295

Query  1020  ICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFG-DETPVDRTGTGTPQAIHPVdadw  1196
             I LRSA +ITHKAQ+V SLAAKWH CAT+ S+D    + +P   T     Q  HP     
Sbjct  296   ILLRSATRITHKAQAVTSLAAKWHVCATIDSYDWAKVENSPA--TQVAYNQDFHPSSNGS  353

Query  1197  enddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              + ++ GD +DELDNT  VP +A+ TIS+ KRQALVTYFE+N+AG+T+YGFMLDR+ LHT
Sbjct  354   SDAEDVGDEEDELDNTKFVPSYAYSTISFQKRQALVTYFENNRAGVTIYGFMLDRSSLHT  413

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF I+L+L LW+L KT+G+S
Sbjct  414   IFGIELTLMLWLLGKTVGVS  433



>ref|XP_010545495.1| PREDICTED: uncharacterized protein LOC104817849 [Tarenaya hassleriana]
Length=436

 Score =   432 bits (1111),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 228/416 (55%), Positives = 312/416 (75%), Gaps = 3/416 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQSN W A LSWS+F + T+ VP  S+++ +C  CDS+H 
Sbjct  22    VSHAQDELQSFRKYLRWMCVDQSNPWTAVLSWSMFVVFTLVVPATSHVLLACADCDSRHS  81

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             R ++A+V+LSLS  A++SF+ LS F  +YG+R+FLF D+L  E++ V++GYT ++++S+K
Sbjct  82    RRYDAVVELSLSSVASLSFLCLSRFVSKYGLRRFLFFDKLWNESETVRRGYTDKLNTSVK  141

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +L+ FV P FLA+ AYKIWW+ +G  QIP+  N++LS+ V C++ L SWLYR  + FLVC
Sbjct  142   LLSYFVAPCFLAESAYKIWWYGSGASQIPFLGNVVLSDTVACLMELLSWLYRTTVIFLVC  201

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FA +F+ +S+V ++L EHLRIRR+LR+ISHRFR FIL +LI+VT
Sbjct  202   VLFRLICHLQILRLQDFASLFQVDSDVGSVLSEHLRIRRHLRIISHRFRTFILWSLILVT  261

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLLVTT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  262   GSQFTSLLVTTKAYAEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKW  321

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             H CATL SF+    ETP   +    P  + P D      D+ GD +D+LDN N++P +A+
Sbjct  322   HVCATLESFETMDGETPRLASRDAAPHGVDP-DMGDTESDDYGDEEDDLDNNNLIPAYAY  380

Query  1269  -TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              TIS+ KRQALVTYFE+N+AGITV+GF LDR+ LHTIF I++SL LW+L KT+GIS
Sbjct  381   STISFQKRQALVTYFENNRAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTVGIS  436



>ref|XP_006413675.1| hypothetical protein EUTSA_v10025231mg [Eutrema salsugineum]
 gb|ESQ55128.1| hypothetical protein EUTSA_v10025231mg [Eutrema salsugineum]
Length=437

 Score =   432 bits (1111),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 227/396 (57%), Positives = 300/396 (76%), Gaps = 4/396 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L +GVP++S+ +  C  CDS H+RP++A+VQLSLSVFA I
Sbjct  41    LWFDQSNRGTALLSWSVFFLLVVGVPMISHFMLVCSDCDSYHRRPYDAVVQLSLSVFAGI  100

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+RKFLFLD+L + +DKV+ GY  +I  SLK L  FVLP+   +  Y+
Sbjct  101   SFVSLSLWSRKFGMRKFLFLDKLWDVSDKVRIGYEAEIQRSLKRLMIFVLPSLTLEAIYR  160

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+V+ C L LSSWLYR AI   VC+L+++ CHLQ LRLD F
Sbjct  161   IWWYISGSNQIPYIINPVLSHVIACTLQLSSWLYRNAIYITVCILYQITCHLQTLRLDDF  220

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +L++VTA+QF +LL TT +   
Sbjct  221   ARCFASEITDVGSALAEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFTALLTTTRASVA  280

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  281   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVESFDSLDGET  340

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
             P   T +     I P     ++ DEEG+GDD+LDNT + P++A+TISY KRQALVTY E+
Sbjct  341   P---TASMIESQISPCGNGMDSSDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYLEN  397

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             N+AGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  398   NRAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  433



>gb|KFK28797.1| hypothetical protein AALP_AA7G049500 [Arabis alpina]
Length=430

 Score =   430 bits (1106),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 300/396 (76%), Gaps = 4/396 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  34    LWFDQSNRSTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  93

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+ GY  +I  S+K L  FVLP+   +  Y+
Sbjct  94    SFVSLSIWSRKFGMRRFLFLDKLLDFSDKVRIGYEAEIQRSMKRLMIFVLPSLTLEAIYR  153

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  +IPY  N ILS+V+ C L LSSWLYR ++  +VC+L+++ CHLQ LRLD F
Sbjct  154   IWWYISGSQEIPYIINPILSHVIACTLQLSSWLYRNSVFIIVCILYQITCHLQTLRLDDF  213

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +LI+VTA+QF++LL T  +   
Sbjct  214   ARCFASEITDVGSALAEHQKIRRNLRIVSHRFRRFILLSLILVTATQFMALLTTIRASVA  273

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  274   VNIYEVGELMLCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDNLDGET  333

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
             P   T +     I P  A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY E+
Sbjct  334   P---TASMIEAQITPCGAFDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYLEN  390

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  391   NKAGITVYGFLVDRSWLHTIFGIELALILWLLNKTI  426



>ref|XP_008458982.1| PREDICTED: uncharacterized protein LOC103498231 [Cucumis melo]
Length=435

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 296/409 (72%), Gaps = 10/409 (2%)
 Frame = +3

Query  213   KRLMSALAWL-FLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIV  389
             +R  S L W+  +D SNL+RA LS  +FF+  I VP+ S+   SC  CD  HQRPF+ +V
Sbjct  35    RRFESFLKWICIMDHSNLYRASLSCIVFFVFGIAVPIASHFALSCSDCDEDHQRPFHVVV  94

Query  390   QLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVL  569
             QLSLS  AT+SF+ LS + R +G+ +FLFLD+L E + K++  Y  Q+  S+++++ F+L
Sbjct  95    QLSLSAVATLSFLCLSLWLRLFGLNRFLFLDKLSEASPKIRAEYFRQLQRSMELMSFFLL  154

Query  570   PTFLADCAYKIWWFVTGGGQIPYF-YNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             P F+A+  YKIWW+++   +IPY+  NM +S +  C L L SWLYR +I F VC+LFRLI
Sbjct  155   PCFMAEAGYKIWWYISAAKEIPYYTNNMYISYITSCTLELCSWLYRTSIFFFVCILFRLI  214

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C LQ++RL+ FA +F  E+EV  ILI+HL +RR   +ISHRFR+F+L +LI+VTASQF+S
Sbjct  215   CCLQMIRLEDFASIFRSETEVGTILIQHLGLRRTFTIISHRFRVFMLLSLILVTASQFIS  274

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT SK+H ++  A +L LCS+ +VTGLFICLRSAAKITHKAQS+  LAAKWH  A +
Sbjct  275   LLMTTRSKAHVNLSKAGQLALCSISLVTGLFICLRSAAKITHKAQSITCLAAKWHVSAVI  334

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             ++FD+   ETP   T +  P  +        N D+E   +D+LD+  ++PV AHTIS+ K
Sbjct  335   NTFDDLDTETP--PTASLVPNIVE------SNSDDEDGDEDDLDDPKLMPVFAHTISFQK  386

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALVTY  +NKAGITVYGFM+DRTWL +IF I+L+L LW+LNKT+G+S
Sbjct  387   RQALVTYLRNNKAGITVYGFMVDRTWLKSIFAIELALFLWLLNKTVGVS  435



>ref|XP_010529468.1| PREDICTED: uncharacterized protein LOC104806325 isoform X2 [Tarenaya 
hassleriana]
Length=430

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 299/397 (75%), Gaps = 10/397 (3%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             ++ DQSN   A +SWS+FF+L +GVP++S+ V  C  CD +H+RP++A+VQLSLS FA I
Sbjct  40    VWFDQSNRGGAVVSWSIFFLLAVGVPIMSHFVLICSDCDFQHRRPYDAVVQLSLSGFAGI  99

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R+YG+R+FLFLD+L + +D  + GY  QI  S+K+L  FVLP+   +  Y+
Sbjct  100   SFVSLSSWSRKYGIRRFLFLDKLWDVSDMARLGYESQIQKSMKLLTIFVLPSLTLESVYR  159

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+VTG  +IPY  N  LS+VV C L LSSWLYR ++   VC+L++L CHLQILRL+ F
Sbjct  160   IWWYVTGFDEIPYTINPFLSHVVACTLQLSSWLYRTSLFIFVCLLYQLTCHLQILRLEDF  219

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E S+VS+IL EHL+IRRNLRV+SHRFR FILS+L++VTA+QF++LL+T  +   
Sbjct  220   ARCFSSEISDVSSILAEHLKIRRNLRVVSHRFRRFILSSLVLVTATQFMALLMTIRASVS  279

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +V GLFICLRSA KITHK QSV SLAAKW+ CAT+ SFD+  +ET
Sbjct  280   FNIYEVGELLLCSITLVAGLFICLRSATKITHKGQSVTSLAAKWNVCATIDSFDDLDEET  339

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
                          H V    + DDEEGDGDD+LDNT ++P++A TIS+ KRQALVTY E+
Sbjct  340   --------LNHQFH-VIESEDEDDEEGDGDDDLDNTKILPIYARTISFQKRQALVTYLEN  390

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             N+AGITVYGFM+DR WLHTIF I+L+L LW+LNKTI 
Sbjct  391   NRAGITVYGFMVDRAWLHTIFGIELALFLWLLNKTIA  427



>ref|XP_004513895.1| PREDICTED: uncharacterized protein LOC101499556 [Cicer arietinum]
Length=447

 Score =   427 bits (1099),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 290/412 (70%), Gaps = 5/412 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQSN + A LSW +F +  + VP +S+   +C  CD++H RP++A+
Sbjct  38    ELHSFRSYLRWMCVDQSNAFTATLSWFVFLLFAVVVPALSHFFLACSDCDARHSRPYDAV  97

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF+ LS F R+YG+++FLF D+LC+E++ V++ Y  Q++ SLK+L+ F 
Sbjct  98    VQLSLSSIAALSFLCLSSFVRKYGLKRFLFFDKLCDESETVRRNYMAQLNRSLKLLSVFA  157

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A  AYKIWW+ +GG QIP+  N+ +S+ V CIL L SWLYR  + FLVCVLFRLI
Sbjct  158   GPCFVAMVAYKIWWYASGGSQIPFLGNVYVSDAVACILELCSWLYRTTVIFLVCVLFRLI  217

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA  F  +S+V ++L EHLRIRR+LR+ISHRFR FIL  L++VT S FV 
Sbjct  218   CHLQILRLKDFATYFHVDSDVQSVLSEHLRIRRHLRIISHRFRAFILLALVLVTGSLFVC  277

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LLVTT+++   +I+   EL LCS+ +++ L I  RSA KITHKAQ++  LAAKWH CATL
Sbjct  278   LLVTTKARHDLNIYKTGELALCSVTLLSALSIMFRSATKITHKAQAITGLAAKWHVCATL  337

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTN--MVPVHAH-TIS  1277
              SFD       +  T   +   I+P        + +  GD+E D  N  ++P +A+ TIS
Sbjct  338   DSFDGVAQGDTL--TAQISHDRIYPTVGTDGESETDDAGDEEDDINNTKLIPSYAYSTIS  395

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             Y KRQALV YFE+NKAGITVYGFMLDR+ LHTIF I+LSL LW+L KTIGIS
Sbjct  396   YQKRQALVNYFENNKAGITVYGFMLDRSTLHTIFGIELSLVLWLLGKTIGIS  447



>ref|XP_011095451.1| PREDICTED: uncharacterized protein LOC105174899 [Sesamum indicum]
Length=436

 Score =   427 bits (1098),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 312/441 (71%), Gaps = 7/441 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             M D+ E  ++  L+K+   +     +S+ R E++   + L WL +DQSN   A LSW +F
Sbjct  1     MGDEREALLLNHLNKSRAFARC---VSHPRDELQSFRTWLKWLCVDQSNPLTACLSWFVF  57

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F   I VP VS+ V SC  CDS+H RP++ + QLSLS  AT+SF+ LS F R+YG+R+FL
Sbjct  58    FAFAIVVPAVSHFVLSCSDCDSRHSRPYDTVAQLSLSGVATLSFVCLSTFVRKYGLRRFL  117

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             F D+L +E++ V++GYT Q H SLKIL SFVLP F+A+  YKIWWF +GG +IP+  ++I
Sbjct  118   FFDKLRDESETVRKGYTQQFHRSLKILFSFVLPCFVAESVYKIWWFGSGGTRIPFLGHVI  177

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +SN V CIL L SW YR  + FLVC+LFRLIC+LQILRL  FAQVF+ +S+V +++ EHL
Sbjct  178   VSNTVACILELCSWFYRAMVFFLVCILFRLICYLQILRLQDFAQVFQVDSDVESVMKEHL  237

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+L +ISHR+R FIL  LI +TASQF SLL+TT   +  +IF A EL +CS+ +++G
Sbjct  238   RIRRHLSIISHRYRAFILWALIFITASQFASLLMTTRPNADVNIFHAGELAVCSVSLLSG  297

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L   LRSAA+ITHKAQ+V SLAAKWH CAT+ SF+    ET          Q        
Sbjct  298   LLSLLRSAARITHKAQAVTSLAAKWHVCATIDSFNT--TETENAAAQVAREQVFAESSQG  355

Query  1194  wenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               + D+ GD +D+LDNT  +P +A+ TIS+ KRQALVTYFE N+AGITVYGFMLDR++LH
Sbjct  356   SSDLDDVGDEEDDLDNTKFLPSYAYSTISFQKRQALVTYFEQNRAGITVYGFMLDRSYLH  415

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             TIF I+ SL LW+L KTIGIS
Sbjct  416   TIFGIEFSLVLWLLGKTIGIS  436



>ref|XP_007020713.1| F11F12.5 protein [Theobroma cacao]
 gb|EOY12238.1| F11F12.5 protein [Theobroma cacao]
Length=433

 Score =   426 bits (1096),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 316/437 (72%), Gaps = 7/437 (2%)
 Frame = +3

Query  126   DEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             D    ++ R      IS ++ E+ + R      + L W+ +DQS++W A LSW +F +L 
Sbjct  3     DNREPLVDRTRFMRTISHAHDELQSFR------TYLRWMCVDQSDVWTACLSWFVFILLG  56

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             + VP +S+ + +C  CD++H RP++ +VQLSLS  A++SF+ L+ F ++YG+R+FLF D+
Sbjct  57    LVVPAMSHFLLACSTCDARHARPYDWVVQLSLSSVASLSFVCLTRFVKKYGLRRFLFFDK  116

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             LC+E++ V++GYT Q++ SLKI++ FVLP F+A+ AYK+WW+ +G  QIP+   + LS+ 
Sbjct  117   LCDESETVRKGYTGQLNRSLKIVSIFVLPCFVAESAYKVWWYASGASQIPFLGIVWLSDA  176

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
             + C++ L SWLYR  + FLVCVLFRLIC+LQ+LR+  FAQVF+ +S+V ++L EHLRIRR
Sbjct  177   MACMMELCSWLYRTTVFFLVCVLFRLICNLQVLRIQDFAQVFQVDSDVGSVLSEHLRIRR  236

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
             +LR+ISHR+R FIL  LI+VT SQF SLL+TT++ +  +I+ A EL +CS+ ++TGL I 
Sbjct  237   HLRIISHRYRAFILWCLILVTGSQFTSLLITTKANAELNIYKAGELAMCSITLLTGLSIL  296

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwend  1205
             LRSA KITHKAQSV  LAAKWH CATL SFD    ETP      G     +       + 
Sbjct  297   LRSATKITHKAQSVTCLAAKWHVCATLDSFDANDGETPRIPAIHGCQSFPYVGTDGESDG  356

Query  1206  deegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
             ++ GD +D++DN+ ++P +A+ TISY KRQALVTYFE+N+AGIT+YGF LDR+ LHTIF 
Sbjct  357   EDAGDEEDDIDNSKLIPAYAYSTISYQKRQALVTYFENNRAGITIYGFTLDRSTLHTIFG  416

Query  1383  IQLSLTLWILNKTIGIS  1433
             I+LSL LW+L KTIGIS
Sbjct  417   IELSLVLWLLGKTIGIS  433



>ref|XP_006393128.1| hypothetical protein EUTSA_v10011484mg [Eutrema salsugineum]
 gb|ESQ30414.1| hypothetical protein EUTSA_v10011484mg [Eutrema salsugineum]
Length=443

 Score =   424 bits (1091),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 232/441 (53%), Positives = 316/441 (72%), Gaps = 9/441 (2%)
 Frame = +3

Query  138   EIILRLSKTALISSSYHEISN------AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             +I + + K  LI+   +++ N        E++     L W+ +D S+ W A LSW++F +
Sbjct  3     DIAIGVGKEPLINREKNKVFNRCVSHQQDELQSFRKYLRWMCVDHSSPWTAILSWTMFVV  62

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
              T+ VP +S+ + +C  CDS H RP++++VQLSLS  A +SF+ L+ F  +YG+R+FLF 
Sbjct  63    FTLVVPAISHFLLACADCDSYHSRPYDSVVQLSLSSVAAVSFLCLTRFVSKYGLRRFLFF  122

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILS  659
             D+L +E++ V++ YT Q+++SL I++ FV+P FLA  AYKIWW+ +GG QIP+  N+ILS
Sbjct  123   DKLWDESETVRRNYTNQLNTSLHIVSYFVIPCFLAMSAYKIWWYASGGSQIPFLGNVILS  182

Query  660   NVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRI  839
             + V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FA++F+ +S+V +IL EHLRI
Sbjct  183   DTVACVMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAKLFQIDSDVGSILSEHLRI  242

Query  840   RRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLF  1019
             RR+LR+ISHR+R FIL  L++VT SQF SLL+TT++ +  +I+ A EL LCSM +VT L 
Sbjct  243   RRHLRIISHRYRSFILCLLVLVTGSQFSSLLITTKAYAEVNIYRAGELALCSMTLVTALL  302

Query  1020  ICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETPVDRTGTGTPQAIHPVdadw  1196
             I LRSA+KITHKAQ+V  LAAKWH CATL SFDE  D ETP            H V    
Sbjct  303   ILLRSASKITHKAQAVTCLAAKWHVCATLESFDETADGETPTLVARNNNNNKGHDVITVA  362

Query  1197  enddeeg-dgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
             E+D EE  D +D+LDN N++P +A  T+S+ KRQALV+YFE+N+AGITVYGF LDR  LH
Sbjct  363   ESDSEEYGDEEDDLDNNNIIPAYAFSTMSFQKRQALVSYFENNRAGITVYGFTLDRGTLH  422

Query  1371  TIFVIQLSLTLWILNKTIGIS  1433
             TIF ++LSL LW+L KTIGIS
Sbjct  423   TIFGLELSLVLWLLGKTIGIS  443



>emb|CDX82254.1| BnaA03g35670D [Brassica napus]
Length=447

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 308/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + T+ VP  S+ V +C  CDS H 
Sbjct  30    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFVIACADCDSHHS  89

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS FA++SF+ LS F  +YG+R+FLF D+L  E++ V+QGYT Q++ SLK
Sbjct  90    RPYDSVVQLSLSSFASLSFLCLSRFVSKYGLRRFLFFDKLWHESETVRQGYTNQLNRSLK  149

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  AYKIWW+ +G  +IP+  N++LS+ V C++ + SWLYR  + FLVC
Sbjct  150   ILSYFVTPCFLATSAYKIWWYASGASRIPFLGNVLLSDTVACLMEICSWLYRTTVIFLVC  209

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V  IL EHLRIRR+LR+ISHRFR FIL +LI+VT
Sbjct  210   VLFRLICHLQILRLQDFAQVFQTDSDVGTILSEHLRIRRHLRIISHRFRTFILLSLILVT  269

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+   EL LCS+ +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  270   GSQFYSLLITTKAHAELNIYKTGELALCSVTLVTALLILLRSASKITHKAQAVTCLAAKW  329

Query  1089  HACATLSSFD--EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+  E G    VDR       +      D ++ ++ GD +D+ DN N++P +
Sbjct  330   HVCATIESFEAVEGGSPRLVDRESGHGFSSKDVDTGDTDDSEDYGDEEDDFDNNNLIPAY  389

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  390   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  447



>gb|KEH33913.1| extracellular ligand-gated ion channel protein [Medicago truncatula]
Length=450

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 292/410 (71%), Gaps = 5/410 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQSN   A LSW +FF+  + VP +S+   +C+ CD++H RP++++
Sbjct  41    ELHTFRSYLRWMCVDQSNAIHATLSWFVFFVFALAVPALSHFFLACEDCDARHSRPYDSV  100

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SLS  A +SF+ LS F ++YG+R+FLFLD+LC+E++ V+  Y +Q++ SLK+++ F 
Sbjct  101   VQISLSSVAVLSFLCLSTFVKKYGLRRFLFLDKLCDESENVRMNYMVQLNRSLKLISVFS  160

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A   YKIWW+ +GG QIP+  N+ LS+ V CIL L SWLYR    FLVCVLFRLI
Sbjct  161   GPCFIAMATYKIWWYASGGSQIPFLGNVYLSDAVACILELCSWLYRTTTIFLVCVLFRLI  220

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA +F  +S+V +++ EHLRIRR+LR+ISHR+R FIL  L++VT SQF  
Sbjct  221   CHLQILRLKDFATLFHVDSDVHSVMSEHLRIRRHLRIISHRYRAFILLALVLVTGSQFAC  280

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LLVT +++   +++   EL LCS+ +++ L I  RSA KITHKAQ++  LAAKWH CATL
Sbjct  281   LLVTMKARHDLNVYKTGELALCSVTLLSALSIMFRSATKITHKAQAITGLAAKWHVCATL  340

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdad--wenddeegdgddeldnTNMVPVHAH-TIS  1277
              SFD  G+   +  +   + + I+P          D+ G  +DE+D T M+P +++ TIS
Sbjct  341   DSFDGVGEGETL--SAQISRERIYPSVGTDGESETDDAGSEEDEIDTTKMIPSYSYSTIS  398

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             Y KRQALV YFE+NKAGITVYGFMLDR+ LHTIF I++SL LW+L KTIG
Sbjct  399   YQKRQALVNYFENNKAGITVYGFMLDRSTLHTIFGIEMSLVLWLLGKTIG  448



>gb|KFK35919.1| hypothetical protein AALP_AA4G053500 [Arabis alpina]
Length=445

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 315/450 (70%), Gaps = 14/450 (3%)
 Frame = +3

Query  93    TNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRA  272
              N  +P+   ++   ++  R      +S    E+ + R+  R      W+ +D S+L   
Sbjct  7     NNGNEPLINHENNNNKVFNRC-----VSHQQDELHSFRKYLR------WMCVDHSSLLTT  55

Query  273   GLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARR  452
              LSW++F I TI VP +S+ + +C  CDS H RP++++VQLSLS  AT+SF+ L+ F  +
Sbjct  56    TLSWTMFIIFTIVVPSISHFLLACADCDSYHSRPYDSVVQLSLSSVATVSFLCLTRFVSK  115

Query  453   YGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQI  632
             YG+R+FLF D+L +E++ V++ YT Q+H+SL I++ FV+P F A  AYKIWW+ +GG QI
Sbjct  116   YGLRRFLFFDKLWDESETVRRNYTNQLHTSLHIVSYFVIPCFTAMSAYKIWWYASGGSQI  175

Query  633   PYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVS  812
             P+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FAQ+F+ +S+V 
Sbjct  176   PFLGNVILSDTVACVMELCSWLYRTTVIFLVCVLFRLICHLQILRLHDFAQLFQIDSDVG  235

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
             +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF SLL+TT++ +  +I+ A EL LC
Sbjct  236   SILSEHLRIRRHLRIISHRYRFFILCLLILVTGSQFSSLLITTKAYTEVNIYRAGELALC  295

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP--VDRTGTGTP  1166
             SM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL SF+    ETP  V R      
Sbjct  296   SMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATLESFEIADGETPTLVARNNNNNN  355

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYG  1343
             +    +     + D+ GD +D+LDN N++P +A  TIS+ KRQALVTYFE+N+AGITVYG
Sbjct  356   KGHDVITIIESDSDDYGDEEDDLDNNNIIPAYAFSTISFQKRQALVTYFENNRAGITVYG  415

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  416   FTLDRGTLHTIFGLELSLVLWLLGKTIGIS  445



>emb|CDY25409.1| BnaA05g18750D [Brassica napus]
Length=450

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 311/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + TI VP  S+ + +C  CDS H 
Sbjct  33    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTIVVPATSHFMLACADCDSHHS  92

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS  A +SFI LS F  +YG+R+FLF D+L +E++ V++GYT Q++ S+K
Sbjct  93    RPYDSVVQLSLSSLAALSFICLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSVK  152

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVC
Sbjct  153   ILSYFVTPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVC  212

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT
Sbjct  213   VLFRLICHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVT  272

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+ A EL LCSM ++T L I LRSA+KITHKAQ+V  LAAKW
Sbjct  273   GSQFYSLLITTKAYAELNIYRAGELALCSMTLLTALLILLRSASKITHKAQAVTCLAAKW  332

Query  1089  HACATLSSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+    ETP  VDR+      A      D ++ ++ GD +D+ DN +++P +
Sbjct  333   HVCATIESFETVDGETPRLVDRSSGHGYYATDVDAGDLDDSEDYGDEEDDFDNNDLIPAY  392

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  393   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  450



>gb|EPS58234.1| hypothetical protein M569_16581 [Genlisea aurea]
Length=436

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 231/415 (56%), Positives = 296/415 (71%), Gaps = 4/415 (1%)
 Frame = +3

Query  195   SNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQR  371
             SNAR E+    S L WL +DQS+ W A LSW +F +L I VP VS+   SC  CD+ H R
Sbjct  23    SNARDELHSFRSWLKWLCVDQSDAWTACLSWIVFSVLAIAVPAVSHFGLSCGECDALHSR  82

Query  372   PFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKI  551
             PF+A+ Q+SLS  A +SF+ LS F RR+G+R+FLF DRL +E++ V++ YTLQ   S  +
Sbjct  83    PFDAVAQVSLSSIAALSFVCLSTFVRRFGLRRFLFFDRLRDESETVRKEYTLQFQRSFTL  142

Query  552   LASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
             L  FVLP F A+ AYKIWW+ +GG +IP+  N I+SN V C+L LSSW YR A+ FLVC+
Sbjct  143   LFVFVLPCFAAESAYKIWWYTSGGTRIPFLGNHIVSNTVACVLELSSWFYRTAVFFLVCI  202

Query  732   LFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             LFRLIC+LQILR+  FA VF  +S V ++L +HLRIRR+LR+ISHR+R FIL  LI +TA
Sbjct  203   LFRLICYLQILRMKDFANVFLVDSHVESVLRKHLRIRRHLRIISHRYRPFILWALIFITA  262

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             S F SLLVTT+     +I+ + EL L S+ ++ GL I LRSAA+ITHKAQ+V +LAAKWH
Sbjct  263   SLFASLLVTTKPGGDVNIYHSGELALSSVSLLAGLTILLRSAARITHKAQAVTALAAKWH  322

Query  1092  ACATL-SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
              CAT+ SSFD    ETPV   G    +     D    +     D +DE+DNT +VP +A+
Sbjct  323   VCATIDSSFDGTETETPVGGGGGAAEEVEF-CDGVSSDSSSLCDEEDEVDNTKLVPSYAY  381

Query  1269  -TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
              TIS+ KRQALV+YFE+N+AGITVYGFMLDRT LHT+F I+LSL LW+L KTIGI
Sbjct  382   STISFQKRQALVSYFENNRAGITVYGFMLDRTSLHTVFGIELSLVLWLLGKTIGI  436



>ref|XP_006603176.1| PREDICTED: uncharacterized protein LOC100817487 [Glycine max]
Length=488

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/417 (53%), Positives = 294/417 (71%), Gaps = 14/417 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E     S + W+ +DQSN + A LSWSLF +L + VP  S+ + +C  CD++H RP++A+
Sbjct  78    EFHTFRSYIRWMCVDQSNPFTAALSWSLFLLLAVAVPAASHFLLACPDCDARHSRPYDAV  137

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  + +SF+ L+ F R+YG+R+FLF D+LC+E++ V+  Y  Q + SLKIL+ FV
Sbjct  138   VQLSLTSVSALSFLCLAVFVRKYGLRRFLFFDKLCDESETVRTNYMAQHNRSLKILSVFV  197

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A+CAYKIWW+ +G  QIP+  N+ +S+ V CIL L SWLYR  + FLVCVLFRLI
Sbjct  198   GPCFVAECAYKIWWYTSGAPQIPFLGNVYVSDAVACILELWSWLYRTTVIFLVCVLFRLI  257

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA+ F  +S+V++++ EHLRIRR+LR+ISHRFR FIL  L++VT SQF  
Sbjct  258   CHLQILRLCDFARFFHVDSDVASVMSEHLRIRRHLRIISHRFRAFILLALVLVTGSQFAC  317

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LLVTT+     +I+   EL LCS+ +++ L I LRSA KITHKAQ++  LAAKWH CATL
Sbjct  318   LLVTTKHTKDMNIYKTGELALCSVTLLSALCILLRSATKITHKAQAITGLAAKWHVCATL  377

Query  1107  SSFDEFGDETPVDRTGTGT-PQAIHPV------dadwenddeegdgddeldnTNMVPVHA  1265
               FD    E      GT T PQ+ H               DE GD +DE+D T ++P +A
Sbjct  378   -DFDGVLTE-----GGTPTAPQSSHETMFPNVGTDGESETDEAGDEEDEIDTTKLIPSYA  431

Query  1266  H-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + TISY KRQALV YFE+N+AGITVYGFMLDR+ L+TIF I+LSL LW+L KTIG S
Sbjct  432   YSTISYQKRQALVKYFENNRAGITVYGFMLDRSTLNTIFGIELSLVLWLLGKTIGFS  488



>emb|CDX98738.1| BnaA03g45230D [Brassica napus]
Length=441

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 298/398 (75%), Gaps = 4/398 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+   A +SWS+FF+L +G PL+S+ V  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  45    LWFDQSSRGTALISWSVFFLLVVGAPLISHFVLVCSDCDFHHRRPYDAVVQLSLSLFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+RKFLFLD+L + +DKV+  Y  +I  S + L  FVLP+   +  Y+
Sbjct  105   SFVSLSYWSRKFGMRKFLFLDKLWDVSDKVRIEYEAEIQRSTRRLMIFVLPSLTLEAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPYF N +LSNV+ C L LSSWLYR AI   VC+L+++ CHLQ LRL+ F
Sbjct  165   IWWYISGSNQIPYFINPVLSNVLACTLQLSSWLYRNAIFITVCILYQITCHLQTLRLNDF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V   L EH +IRRNLR++SHRFR FILS+L++VT +QF++LL TT +   
Sbjct  225   ARCFSSEIADVGVALAEHQKIRRNLRIVSHRFRRFILSSLVLVTGTQFMALLTTTRASVA  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF     ET
Sbjct  285   VNIYEVGELALCSLCLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFGHLDCET  344

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
             P   TG+       P+  D  +DDEEG+GDD+L NT + P +A+TISY KRQALVTY E+
Sbjct  345   P---TGSMVESHTTPLHLDTTSDDEEGEGDDDLANTKIHPSYANTISYQKRQALVTYLEN  401

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             NKAGITVYGF++DR+WLHTIF ++L+L LW+LNKTIGI
Sbjct  402   NKAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTIGI  439



>ref|XP_010539389.1| PREDICTED: uncharacterized protein LOC104813486 [Tarenaya hassleriana]
Length=437

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 298/397 (75%), Gaps = 5/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+   A +SWS+FF+L +GVP+VS+ V  C  CD +H+RP++A+VQLSL+VFA I
Sbjct  40    LWFDQSSRGGAVVSWSIFFLLAVGVPMVSHFVLICSDCDFQHRRPYDAVVQLSLTVFAGI  99

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R+YG+R+FLFLD+L + +DKV+ GY  +I  S+K+L  FVLP+   + AY+
Sbjct  100   SFVSLSAWSRKYGLRRFLFLDKLWDVSDKVRLGYEAEIQKSMKLLTIFVLPSLTLEAAYR  159

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+VTG  +IPY  N + S+V+ C L L SWLYR ++   VC+L+++ CHLQILRL+ F
Sbjct  160   IWWYVTGFDEIPYIINPVFSHVMACTLQLFSWLYRTSLFIFVCLLYQITCHLQILRLEDF  219

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E S+VS+IL EHL+IRRNLRV+SHRFR FIL +L++VTASQF++LL T  +   
Sbjct  220   ARCFASEISDVSSILSEHLKIRRNLRVVSHRFRRFILLSLVLVTASQFMALLTTIRASIS  279

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTGLFICLRSA KITHK QSV SLAAKW+ CAT+ SF++   ET
Sbjct  280   FNIYEVGELVLCSLSLVTGLFICLRSATKITHKGQSVTSLAAKWNICATIDSFEDLDGET  339

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeld-nTNMVPVHAHTISYHKRQALVTYFE  1313
             P   T       I PV    E+DDEE    D+   NT ++P++A TIS+ KRQALVTY E
Sbjct  340   P---TALVHQSHIFPVRNVIESDDEEEGEGDDDLDNTKILPIYARTISFQKRQALVTYLE  396

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +N+AGITVYGFM+DR WLHTIF I+L+L LW+LNKTI
Sbjct  397   NNRAGITVYGFMVDRAWLHTIFGIELALLLWLLNKTI  433



>emb|CDY36047.1| BnaC03g41510D [Brassica napus]
Length=449

 Score =   421 bits (1081),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 228/418 (55%), Positives = 307/418 (73%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A +SWS+F + T+ VP  S+ V +C  CDS H 
Sbjct  32    VSHAQDELQSFRKYLRWMCVDQSSPWTAVMSWSMFVVFTLVVPATSHFVIACADCDSHHS  91

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS FA++SF+ LS F  +YG+R+FLF D+L  E++ V+QGYT Q++ SLK
Sbjct  92    RPYDSVVQLSLSSFASLSFLCLSRFVSKYGLRRFLFFDKLWHESETVRQGYTNQLNRSLK  151

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P  LA  AYKIWW+ +G  +IP+  N++LS+ V C++ + SWLYR  + FLVC
Sbjct  152   ILSYFVTPCVLATSAYKIWWYASGASRIPFLGNVLLSDTVACLMEICSWLYRTTVIFLVC  211

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V  IL EHLRIRR+LR+ISHRFR FIL +LI+VT
Sbjct  212   VLFRLICHLQILRLQDFAQVFQMDSDVGTILSEHLRIRRHLRIISHRFRTFILLSLILVT  271

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+   EL LCS+ +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  272   GSQFYSLLITTKAHAELNIYKTGELALCSVTLVTALLILLRSASKITHKAQAVTCLAAKW  331

Query  1089  HACATLSSFD--EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+  E G    VDR       +      D ++ ++ GD +D+ DN N++P +
Sbjct  332   HVCATIESFETVEGGSPRLVDRESGHGFSSKDVDTGDTDDSEDYGDEEDDFDNNNLIPAY  391

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  392   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  449



>ref|XP_010675778.1| PREDICTED: uncharacterized protein LOC104891732 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=432

 Score =   420 bits (1079),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/440 (49%), Positives = 306/440 (70%), Gaps = 9/440 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+  T      + T + S +  E+ + R      + L+W+ +DQS  +   LSW +F 
Sbjct  1     MEDETLTHKNQNKTYTRVFSHAQDELHSVR------TYLSWMCVDQSTYFNTFLSWFVFL  54

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             I  I VP +S+   +C +CD+KH++P++A+VQLSL+  AT+SF+ L+ F+R+YGVR+FLF
Sbjct  55    IFAIIVPAISHFYLTCPSCDAKHKQPYDAVVQLSLTSIATLSFLCLTYFSRKYGVRRFLF  114

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L  E+D V+  YT Q++ SL IL+ FV+P F+A+C YK+WW+ +G   IP+  N IL
Sbjct  115   FDKLVNESDSVRHHYTTQLNRSLNILSVFVVPCFVAECTYKVWWYASGASHIPFLGNAIL  174

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++V C L L+SW+YR  + FLVCVLFRL+C+LQILRL  FA VFE +S+V++IL+EHLR
Sbjct  175   SDIVACSLELTSWIYRTLVFFLVCVLFRLVCYLQILRLKDFATVFEVDSDVASILVEHLR  234

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRR+LR+ISHR+R FIL  LI++T SQ   L++TT+  +   IF A EL LCS+ ++ GL
Sbjct  235   IRRHLRIISHRYRAFILCALILITLSQLTFLMLTTKPNADVSIFRAGELALCSVTLLAGL  294

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              I LRSA KITHKAQ++ +L+AKWH CAT+ SF     ET +  T T          +  
Sbjct  295   MIILRSATKITHKAQAITALSAKWHICATIDSF--VTSETELPGTNTSNDAGRFDASSFN  352

Query  1197  enddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              +DD+ G  +D++DNT  +P +A+ ++S+ KR ALVTYFE N+AGIT+YG MLDRTWL  
Sbjct  353   SDDDDAGSEEDDVDNTKFLPAYAYSSMSFQKRHALVTYFEKNRAGITLYGSMLDRTWLQL  412

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF ++LSL LW+L +TI IS
Sbjct  413   IFGVELSLVLWLLKETITIS  432



>ref|XP_009145645.1| PREDICTED: uncharacterized protein LOC103869337 [Brassica rapa]
 ref|XP_009145646.1| PREDICTED: uncharacterized protein LOC103869337 [Brassica rapa]
Length=453

 Score =   421 bits (1081),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 310/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A L WS+F + TI VP  S+ + +C  CDS H 
Sbjct  36    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLFWSMFVVFTIVVPATSHFMLACADCDSHHS  95

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS  A +SFI LS F  +YG+R+FLF D+L +E++ V++GYT Q++ S+K
Sbjct  96    RPYDSVVQLSLSSLAALSFICLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSVK  155

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVC
Sbjct  156   ILSYFVTPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVC  215

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT
Sbjct  216   VLFRLICHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVT  275

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+ A EL LCSM ++T L I LRSA+KITHKAQ+V  LAAKW
Sbjct  276   GSQFYSLLITTKAYAELNIYRAGELALCSMTLLTALLILLRSASKITHKAQAVTCLAAKW  335

Query  1089  HACATLSSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+    ETP  VDR+      A      D ++ ++ GD +D+ DN +++P +
Sbjct  336   HVCATIESFETVDGETPRLVDRSSGHGYYATDVDAGDLDDSEDYGDEEDDFDNNDLIPAY  395

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  396   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  453



>ref|XP_009348310.1| PREDICTED: uncharacterized protein LOC103939943 [Pyrus x bretschneideri]
Length=441

 Score =   420 bits (1079),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 299/413 (72%), Gaps = 5/413 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S + W+ +DQSN WRA +SWS+F +  I VP +S+ VF+C +CD KH+RP++ +
Sbjct  30    ELKSFRSYVRWMCVDQSNAWRACISWSIFILFAIVVPAISHFVFTCASCDGKHKRPYDGV  89

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F R++G+R+FLF D+L  E++ V++ YT Q++ SLKIL  FV
Sbjct  90    VQLSLSSVATVSFLCLSWFVRKFGLRRFLFFDKLYNESETVRREYTQQLNRSLKILCIFV  149

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+  YKIWW+ +   Q+P+  N+ +S++V C L L SWLYR  + FLVCVLFRLI
Sbjct  150   MPCFAAESVYKIWWYASRASQMPFLGNVYVSDMVACTLELCSWLYRTTVFFLVCVLFRLI  209

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA VF+++S+V ++L EHLRIRR+L +ISHR+R FIL +LI+VT SQF  
Sbjct  210   CYLQILRLQDFATVFQEQSDVGSVLSEHLRIRRHLTIISHRYRGFILWSLILVTGSQFSL  269

Query  927   LLVTTESKSHAH--IFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             LL+TT S + A+  ++ + EL LCS+ +VTG+ I LRSA KITHKAQ+V  LA KWH CA
Sbjct  270   LLITTRSSATANLDVYRSGELALCSITLVTGVLILLRSATKITHKAQAVTCLATKWHVCA  329

Query  1101  TLSSFD-EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TI  1274
             TL SFD   GD  P D TG G   +         + D   D  DEL+N   VP +A+ TI
Sbjct  330   TLESFDANEGDSPPPDETGNGLVVS-GASSDRESDSDLASDDQDELENAKFVPSYAYSTI  388

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             SY KRQALVTY E+N+AGIT+YGF LDR+ LHTIF+++LSL LW+L KT+GIS
Sbjct  389   SYQKRQALVTYLENNRAGITIYGFTLDRSTLHTIFMLELSLILWLLGKTVGIS  441



>emb|CDY29817.1| BnaC05g31730D [Brassica napus]
Length=450

 Score =   420 bits (1079),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 311/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + TI VP  S+ + +C  CDS H 
Sbjct  33    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTIVVPATSHFMLACADCDSHHS  92

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS  A +SFI LS F  +YG+R+FLF D+L +E++ V++GYT Q++ S+K
Sbjct  93    RPYDSVVQLSLSSLAALSFICLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSVK  152

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVC
Sbjct  153   ILSYFVTPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVC  212

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT
Sbjct  213   VLFRLICHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVT  272

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+ A EL LCSM ++T L I LRSA+KITHKAQ+V  LAAKW
Sbjct  273   GSQFYSLLITTKAYAELNIYRAGELALCSMTLLTALLILLRSASKITHKAQAVTCLAAKW  332

Query  1089  HACATLSSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+    ETP  V+R+      A      D ++ ++ GD +D+ DN +++P +
Sbjct  333   HVCATIESFETVDGETPRLVNRSSGHGYYATDVDAGDLDDSEDYGDEEDDFDNNDLIPAY  392

Query  1263  AHT-ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A++ IS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  393   AYSAISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  450



>emb|CDY22809.1| BnaA06g02680D [Brassica napus]
Length=444

 Score =   419 bits (1078),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 223/412 (54%), Positives = 305/412 (74%), Gaps = 4/412 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +D S+LW A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  34    ELQSFRKYLRWMCVDHSSLWTAILSWTMFVVFTLVVPAISHFLLACADCDSYHSRPYDSV  93

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  94    VQLSLSSVAAVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  153

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P FLA  AYKIWW+ +GG QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  154   IPCFLAMSAYKIWWYASGGSQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVCVLFRLI  213

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  L++VT SQF S
Sbjct  214   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLVLVTGSQFSS  273

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +++ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  274   LLITTKAYTEVNMYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  333

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHA-HTIS  1277
              SF+    ETP  V R  +   +    +     + D+ GD +D+LDN N++P +A  TIS
Sbjct  334   ESFEIADGETPTLVAR-NSNNNKGNDVITLAESDSDDYGDEEDDLDNNNIIPAYAFSTIS  392

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + KRQALV+YFE+N+AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  393   FQKRQALVSYFENNRAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  444



>ref|XP_010479527.1| PREDICTED: uncharacterized protein LOC104758369 [Camelina sativa]
Length=449

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 316/447 (71%), Gaps = 15/447 (3%)
 Frame = +3

Query  138   EIILRLSKTALISSSYHEISNA----------REVKRLMSALAWLFLDQSNLWRAGLSWS  287
             +I + L K  LI+   +  +N            E+      L W+ +D S+ W A LSW+
Sbjct  3     DIDIGLGKEPLINHENNNKTNKIFNRCVSHQQDELHSFRKYLRWMCVDHSSPWTAILSWT  62

Query  288   LFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRK  467
             +F + T+ VP +S+ + +C  CDS H RP++++VQLSLS  AT+SF+ L+ F  +YG+R+
Sbjct  63    MFVVFTLVVPAISHFLLACAECDSYHSRPYDSVVQLSLSSVATVSFLCLTRFVSKYGLRR  122

Query  468   FLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYN  647
             FLF D+L +E++ V++ YT Q+++SL I++ FV+P F A  AYKIWW+ +GG QIP+  N
Sbjct  123   FLFFDKLWDESETVRRNYTNQLNTSLHIVSYFVIPCFSAMSAYKIWWYASGGSQIPFLGN  182

Query  648   MILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIE  827
             ++LS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL  FA++F+ +S+V +IL E
Sbjct  183   VVLSDTVACVMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAKLFQIDSDVGSILSE  242

Query  828   HLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMV  1007
             HLRIRR+LR+ISHR+R FIL  LI+VT SQF SLL+TT++ +  +I+ A EL LCSM +V
Sbjct  243   HLRIRRHLRIISHRYRSFILCLLILVTGSQFSSLLITTKAYTEVNIYRAGELALCSMTLV  302

Query  1008  TGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETP--VDRTGTGTPQAIH  1178
             T L I LRSA+KITHKAQ+V  LAAKWH CATL SFD+  D ETP  V R         H
Sbjct  303   TALLILLRSASKITHKAQAVTCLAAKWHVCATLESFDQTVDGETPTLVARNNNIDNNRGH  362

Query  1179  PVdadwenddeeg-dgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFML  1352
              V    E+D EE  D +D+LDN N++P +A  T+S+ KRQALV+YFE+N+AGITVYGF L
Sbjct  363   DVVTLTESDSEEYGDEEDDLDNNNIIPAYAFSTMSFQKRQALVSYFENNRAGITVYGFTL  422

Query  1353  DRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             DR  LHTIF ++LSL LW+L KT+GIS
Sbjct  423   DRGTLHTIFGLELSLVLWLLGKTVGIS  449



>ref|XP_006283722.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
 gb|EOA16620.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
Length=443

 Score =   417 bits (1072),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 227/400 (57%), Positives = 303/400 (76%), Gaps = 6/400 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  45    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF SLS ++R++G+RKFLFLD+L + +DKV+  +  +I  SLK L  FV P+   +  Y+
Sbjct  105   SFFSLSIWSRKFGMRKFLFLDKLWDVSDKVRIEHEAEIQRSLKRLMIFVFPSLTLEAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV C L LSSWLYR AI  +VC+L+++ CHLQ LRL+ F
Sbjct  165   IWWYISGFNQIPYIINPVLSHVVACTLQLSSWLYRNAIFIVVCILYQITCHLQTLRLEDF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++VS+ L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  225   ARCFASEITDVSSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASVA  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  285   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  344

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   T +     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  345   P---TASMVESQISPCGINAVDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  401

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTIGI
Sbjct  402   ENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTIGI  441



>ref|XP_009147821.1| PREDICTED: uncharacterized protein LOC103871333 [Brassica rapa]
Length=444

 Score =   417 bits (1072),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 222/412 (54%), Positives = 304/412 (74%), Gaps = 4/412 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  34    ELQSFRKYLRWMCVDHSSPWTAILSWTMFVVFTLVVPAISHFLLACADCDSYHSRPYDSV  93

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  94    VQLSLSSVAAVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  153

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P FLA  AYKIWW+ +GG QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  154   IPCFLAMSAYKIWWYASGGSQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVCVLFRLI  213

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  L++VT SQF S
Sbjct  214   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLVLVTGSQFSS  273

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +++ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  274   LLITTKAYTEVNMYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  333

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHA-HTIS  1277
              SF+    ETP  V R  +   +    +     + D+ GD +D+LDN N++P +A  TIS
Sbjct  334   ESFEIADGETPTLVAR-NSNNNKGNDVITLAESDSDDYGDEEDDLDNNNIIPAYAFSTIS  392

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + KRQALV+YFE+N+AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  393   FQKRQALVSYFENNRAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  444



>emb|CDX94085.1| BnaC07g37190D [Brassica napus]
Length=441

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 221/398 (56%), Positives = 296/398 (74%), Gaps = 4/398 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+   A +SWS+FF+L +G PL+S+ V  C  CD  H+RP++++VQLSLS+FA I
Sbjct  45    LWFDQSSRGTALISWSVFFLLVVGAPLISHFVLVCSDCDFHHRRPYDSVVQLSLSLFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+RKFLFLD+L + +DKV+  Y  +I  S K L  FVLP+   +  Y+
Sbjct  105   SFVSLSYWSRKFGMRKFLFLDKLWDVSDKVRIEYEAEIQRSTKRLMIFVLPSLTLEAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPYF N +LSN + C L LSSW YR AI   VC+L+++ CHLQ LRL+ F
Sbjct  165   IWWYISGSNQIPYFINPVLSNSLACTLQLSSWFYRNAIFITVCILYQISCHLQTLRLNDF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V   L EH +IRRNLR++SHRFR FILS+L++VT +QF++LL TT +   
Sbjct  225   ARCFSSEIADVGVALAEHQKIRRNLRIVSHRFRRFILSSLVLVTGTQFMALLTTTRASVA  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF     ET
Sbjct  285   VNIYEVGELALCSLCLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFGHLDYET  344

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
             P   TG+       P+  D  +DDEEG+GDD+L NT + P +A+TISY KRQALVTY E+
Sbjct  345   P---TGSMVESHTTPLHLDTTSDDEEGEGDDDLANTKIHPSYANTISYQKRQALVTYLEN  401

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             N+AGITVYGF++DR+WLHTIF ++L+L LW+LNKTIGI
Sbjct  402   NRAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTIGI  439



>ref|XP_009334182.1| PREDICTED: uncharacterized protein LOC103927009 [Pyrus x bretschneideri]
Length=441

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 222/413 (54%), Positives = 298/413 (72%), Gaps = 5/413 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S + W+ +DQSN WR  +SWS+F +  I VP +S+ VF+C +CD KH+RP++ +
Sbjct  30    ELKSFRSYVRWMCVDQSNAWRTCISWSIFILFAIVVPAISHFVFTCASCDGKHKRPYDGV  89

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F R++G+R+FLF D+L  E++ V++ YT Q++ SLKIL  FV
Sbjct  90    VQLSLSSVATVSFLCLSWFVRKFGLRRFLFFDKLYNESETVRREYTQQLNRSLKILCIFV  149

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+  YKIWW+ +   Q+P+  N+ +S++V C L L SWLYR  + FLVCVLFRLI
Sbjct  150   MPCFAAESVYKIWWYASRASQMPFLGNVYVSDMVACTLELCSWLYRTTVFFLVCVLFRLI  209

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA VF+++S+V ++L EHLRIRR+L +ISHR+R FIL +LI+VT SQF  
Sbjct  210   CYLQILRLQDFATVFQEQSDVGSVLSEHLRIRRHLTIISHRYRGFILWSLILVTGSQFSL  269

Query  927   LLVTTESKSHAH--IFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             LL+TT + + A+  ++ + EL LCS+ +VTG+ I LRSA KITHKAQ+V  LA KWH CA
Sbjct  270   LLITTRASATANLDVYRSGELVLCSITLVTGVLILLRSATKITHKAQAVTCLATKWHVCA  329

Query  1101  TLSSFD-EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TI  1274
             TL SFD   GD  P D TG G   +         + D   D  DEL+N   VP +A+ TI
Sbjct  330   TLESFDANEGDSPPPDETGNGRVVS-GASSDRESDSDLASDDQDELENAKFVPSYAYSTI  388

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             SY KRQALVTY E+N+AGIT+YGF LDR+ LHTIF+++LSL LW+L KT+GIS
Sbjct  389   SYQKRQALVTYLENNRAGITIYGFTLDRSTLHTIFMLELSLILWLLGKTVGIS  441



>ref|XP_006307478.1| hypothetical protein CARUB_v10009103mg [Capsella rubella]
 gb|EOA40376.1| hypothetical protein CARUB_v10009103mg [Capsella rubella]
Length=453

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/414 (54%), Positives = 304/414 (73%), Gaps = 5/414 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +D S+ W A LSW++FF+ T+ VP  S+   +C  CDS H RP++++
Sbjct  40    ELQSFRKFLRWMCVDHSSPWTAILSWTMFFVFTLLVPSFSHFFLACADCDSYHSRPYDSV  99

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  100   VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  159

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG QIP+  N++LS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  160   IPCFSAMSAYKIWWYASGGSQIPFLGNVVLSDTVACVMELCSWLYRTTVIFLVCVLFRLI  219

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  220   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  279

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  280   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  339

Query  1107  SSFDEFGD-ETP--VDRTGT-GTPQAIHPVdadwenddeegdgddeldnTNMVPVHA-HT  1271
              SFD+  D ETP  V R       +    +     + DE GD +D++DN N++P +A  T
Sbjct  340   ESFDQTVDGETPTLVARNNNIDNNKGQDVITLTESDSDEYGDEEDDIDNNNIIPAYAFST  399

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             +S+ KRQALV+YFE+N+AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  400   MSFQKRQALVSYFENNRAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  453



>ref|XP_002894263.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70522.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 234/449 (52%), Positives = 318/449 (71%), Gaps = 20/449 (4%)
 Frame = +3

Query  138   EIILRLSKTALISSSYHEISNAR------------EVKRLMSALAWLFLDQSNLWRAGLS  281
             +I + + K  LI+   HE +N +            E+      L W+ +D S+ W A LS
Sbjct  3     DIDIDVGKEPLIN---HENNNKKKIFNRCVSHQQDELHSFRKYLRWMCVDHSSPWTAILS  59

Query  282   WSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGV  461
             W++F + T+ VP +S+ + +C  CDS H RP++++VQLSLS  AT+SF+ L+ F  +YG+
Sbjct  60    WTMFVVFTLVVPAISHFLLACADCDSYHSRPYDSVVQLSLSSVATVSFLCLTRFVSKYGL  119

Query  462   RKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYF  641
             R+FLF D+L +E++ V++ YT Q+++SL I++ FV+P F A  AYKIWW+ +GG QIP+ 
Sbjct  120   RRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFVIPCFSAMSAYKIWWYASGGSQIPFL  179

Query  642   YNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAIL  821
              N++LS+ V CI+ L SWLYR  + FLVCVLFRLICHLQILRL  FA++F+ +S+V +IL
Sbjct  180   GNVVLSDTVACIMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAKLFQIDSDVGSIL  239

Query  822   IEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMI  1001
              EHLRIRR+LR+ISHR+R FIL  LI+VT SQF SLL+TT++ +  +++ A EL LCSM 
Sbjct  240   SEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSSLLITTKAYTEVNMYRAGELALCSMT  299

Query  1002  MVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETP--VDRTGTGTPQA  1172
             +VT L I LRSA+KITHKAQ+V  LAAKWH CATL SFD+  D ETP  V R        
Sbjct  300   LVTALLILLRSASKITHKAQAVTCLAAKWHVCATLESFDQTVDGETPTLVARNNNNDNNN  359

Query  1173  IHPVdadwenddeeg-dgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGF  1346
              H V    E+D +E  D +D+LDN N++P +A  T+S+ KRQALV+YFE+N+AGITVYGF
Sbjct  360   GHDVITLTESDSDEYGDEEDDLDNNNIIPAYAFSTMSFQKRQALVSYFENNRAGITVYGF  419

Query  1347  MLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  420   TLDRGTLHTIFGLELSLVLWLLGKTIGIS  448



>ref|XP_002869830.1| hypothetical protein ARALYDRAFT_492639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46089.1| hypothetical protein ARALYDRAFT_492639 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 301/397 (76%), Gaps = 5/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+F  I
Sbjct  39    LWFDQSNRGTALLSWSVFFLLVVIVPIISHFLLVCSDCDFHHRRPYDAVVQLSLSIFGGI  98

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  Y  +I  SLK L  FVLP+   +  Y+
Sbjct  99    SFVSLSIWSRKFGMRRFLFLDKLWDASDKVRIEYEAEIQRSLKRLMIFVLPSLTLEAIYR  158

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  +IPY  N +LS+VV C L LSSWLYR ++  +VC+L+++ CHLQ LRLD F
Sbjct  159   IWWYISGSHEIPYIINPVLSHVVACTLQLSSWLYRTSLFIIVCILYKITCHLQTLRLDDF  218

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +LI+VTA+QF++LL TT +   
Sbjct  219   ARCFASEITDVRSALGEHQKIRRNLRIVSHRFRRFILLSLILVTATQFMALLTTTRASVA  278

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  279   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  338

Query  1137  PVDRTGTGTPQAIHPV-dadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             P   TG+     + P  +A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY E
Sbjct  339   P---TGSMIESQVSPCGNAMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYLE  395

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  396   NNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  432



>ref|XP_010500640.1| PREDICTED: uncharacterized protein LOC104777990 [Camelina sativa]
Length=451

 Score =   416 bits (1069),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 221/407 (54%), Positives = 300/407 (74%), Gaps = 7/407 (2%)
 Frame = +3

Query  231   LAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVF  410
             L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++VQLSLS  
Sbjct  46    LRWMCVDHSSPWTAILSWTMFVVFTLVVPAISHFLLACAECDSYHSRPYDSVVQLSLSSV  105

Query  411   ATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADC  590
             AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV+P F A  
Sbjct  106   ATVSFLCLTRFISKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFVIPCFSAMS  165

Query  591   AYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRL  770
             AYKIWW+ +GG QIP+  N++LS+ V C++ L SWLYR  + FLVCVLFRLICHLQILRL
Sbjct  166   AYKIWWYASGGSQIPFLGNVVLSDTVACVMELCSWLYRTTVIFLVCVLFRLICHLQILRL  225

Query  771   DGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESK  950
               FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF SLL+TT++ 
Sbjct  226   QDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSSLLITTKAY  285

Query  951   SHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD  1130
             +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL SFD+  D
Sbjct  286   TEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATLESFDQTVD  345

Query  1131  -ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH---TISYHKRQ  1292
              ETP  V R         H V    E+D +E   +++  + N + +HA+   T+S+ KRQ
Sbjct  346   GETPTLVSRNNNIDNNRGHDVVTLTESDSDEYGDEEDDLDNNNI-IHAYAFSTMSFQKRQ  404

Query  1293  ALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             ALV+YFE+N+AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  405   ALVSYFENNRAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  451



>emb|CBI26689.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   414 bits (1064),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 220/440 (50%), Positives = 306/440 (70%), Gaps = 30/440 (7%)
 Frame = +3

Query  129   EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTI  308
             +E E +LR +K    S SY +     E++   S L W+ +DQS +    LSWS+F +L I
Sbjct  3     DERERLLRKNKFQR-SISYAQ----DELQSFRSWLRWMCVDQSTISTGCLSWSVFILLAI  57

Query  309   GVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRL  488
              VP++S+ + +C +CD+KHQRP++A+VQL+                  YG+R+FLF D+L
Sbjct  58    AVPVMSHFLLACSSCDAKHQRPYDAVVQLN------------------YGLRRFLFFDKL  99

Query  489   CEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVV  668
              +E++ V++ YT Q++ S+KIL+ FVLP F A+  YKIWW+ +G  +IP+  N+ +S+V+
Sbjct  100   RDESEMVRKNYTEQLNRSMKILSLFVLPCFAAEATYKIWWYSSGRSRIPFLGNVYVSDVI  159

Query  669   ICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRN  848
              C L L SWLYR ++ FLVCVLFRLICHLQILRL  FA+VF+ ES+V ++L EHLRIRR+
Sbjct  160   ACTLELCSWLYRTSVFFLVCVLFRLICHLQILRLQDFARVFQAESDVESVLKEHLRIRRH  219

Query  849   LRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICL  1028
             LR+ISHR R+FIL  L+ VTASQF SLL TT S++  ++F A EL LCS+ +VTGL +  
Sbjct  220   LRIISHRNRVFILFALMFVTASQFASLLSTTRSRADVNMFTAGELALCSITLVTGLMVLF  279

Query  1029  RSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwendd  1208
             RSA KITHKAQ++  LAAKWH CAT+ SF+    E+P  R     P+      ++  + +
Sbjct  280   RSATKITHKAQAITCLAAKWHVCATIDSFESNEPESP--RIQIPCPRPFPSRASNENDVE  337

Query  1209  e----egdgddeldnTNMVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
                   GD +D++D+T ++P +A  TIS+ KRQALV YFE+N+AGITVYGFMLDRT L+T
Sbjct  338   SDGEDAGDEEDDVDSTKLIPAYASSTISFQKRQALVVYFENNRAGITVYGFMLDRTSLNT  397

Query  1374  IFVIQLSLTLWILNKTIGIS  1433
             IF+I++SL LW+L KTIGIS
Sbjct  398   IFMIEMSLVLWLLGKTIGIS  417



>emb|CDY37123.1| BnaC06g03760D [Brassica napus]
Length=444

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 221/412 (54%), Positives = 305/412 (74%), Gaps = 4/412 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  34    ELQSFRKYLRWMCVDHSSPWTAILSWTMFVVFTLVVPAISHFLLACADCDSYHSRPYDSV  93

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  94    VQLSLSSVAAVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  153

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P FLA  AYKIWW+ +GG QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  154   IPCFLAMSAYKIWWYASGGSQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVCVLFRLI  213

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  L++VT SQF S
Sbjct  214   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLVLVTGSQFSS  273

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +++ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH C+TL
Sbjct  274   LLITTKAYTEVNMYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCSTL  333

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHA-HTIS  1277
              SF+    ETP  V R  + + +    +     + D+ GD +D+LDN N++P +A  TIS
Sbjct  334   ESFEIADGETPTLVAR-NSHSNKGNDVITLTESDSDDYGDEEDDLDNNNIIPAYAFSTIS  392

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + KRQALV+YFE+N+AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  393   FQKRQALVSYFENNRAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  444



>ref|XP_010096104.1| hypothetical protein L484_012459 [Morus notabilis]
 gb|EXB63269.1| hypothetical protein L484_012459 [Morus notabilis]
Length=441

 Score =   414 bits (1065),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 316/446 (71%), Gaps = 16/446 (4%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHE-----ISNAR-EVKRLMSALAWLFLDQSNLWRAGL  278
             MEDD++       ++ AL+S+  ++     +S+A+ E++   S L W+ +DQS+ W A L
Sbjct  1     MEDDDD-------NRDALLSNRSNKKFMRCVSHAQDELQSFRSYLRWMCVDQSSAWTACL  53

Query  279   SWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYG  458
             SWS+F + T+ VP  S+ + +C +CDSKH RP++ +VQLSLS  AT+SF+ LS F RRYG
Sbjct  54    SWSMFVLFTVVVPAASHFLIACASCDSKHARPYDPVVQLSLSAVATLSFVCLSNFVRRYG  113

Query  459   VRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPY  638
             +R+FLF D+L ++++ V++ YT Q++ SLKIL+ FV+P FLA+ AYKIWW+ +G  QIP+
Sbjct  114   LRRFLFFDKLWDDSETVRKRYTEQLNRSLKILSIFVVPCFLAESAYKIWWYASGASQIPF  173

Query  639   FYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAI  818
               N+++S+ V C++ L SWLYR  I FLVCVLFRLICHLQILRL  FA VF  +S+V +I
Sbjct  174   LGNVVVSDFVACVMELCSWLYRTTIIFLVCVLFRLICHLQILRLQDFATVFHVDSDVGSI  233

Query  819   LIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHA--HIFAAAELGLC  992
             L EHLRIRR+LR+ISHRFR FIL  LI+VT SQF SLL +T  KS    ++F   EL LC
Sbjct  234   LAEHLRIRRHLRIISHRFRAFILCALILVTCSQFASLLTSTTIKSRVDFNLFKTGELTLC  293

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQA  1172
             SM ++  + I LRSA KITHKAQ++  LA+KWH CATL SFD    ETP     T     
Sbjct  294   SMTLLAAILILLRSATKITHKAQAITCLASKWHICATLDSFDAVDGETPTADATTHQAFP  353

Query  1173  IHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFM  1349
                     ++D++E   +D++DNT  +P +A+ TIS+ KRQALVTYFE+N+AGITV+GF 
Sbjct  354   AGAEVESGDDDNDEDGEEDDVDNTKFIPAYAYSTISFQKRQALVTYFENNRAGITVFGFT  413

Query  1350  LDRTWLHTIFVIQLSLTLWILNKTIG  1427
             LDR+ +H+IF ++L+L LW+L KTI 
Sbjct  414   LDRSTIHSIFGLELALVLWLLGKTIS  439



>ref|XP_006283720.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
 gb|EOA16618.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
Length=452

 Score =   414 bits (1065),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 304/403 (75%), Gaps = 6/403 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  45    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF SLS ++R++G+RKFLFLD+L + +DKV+  +  +I  SLK L  FV P+   +  Y+
Sbjct  105   SFFSLSIWSRKFGMRKFLFLDKLWDVSDKVRIEHEAEIQRSLKRLMIFVFPSLTLEAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV C L LSSWLYR AI  +VC+L+++ CHLQ LRL+ F
Sbjct  165   IWWYISGFNQIPYIINPVLSHVVACTLQLSSWLYRNAIFIVVCILYQITCHLQTLRLEDF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++VS+ L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  225   ARCFASEITDVSSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASVA  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  285   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  344

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   T +     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  345   P---TASMVESQISPCGINAVDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  401

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS*F  1439
             E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI ++ F
Sbjct  402   ENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTIALNRF  444



>ref|XP_009137245.1| PREDICTED: uncharacterized protein LOC103861292 [Brassica rapa]
Length=441

 Score =   414 bits (1064),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 295/396 (74%), Gaps = 4/396 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+   A +SWS+FF+L +G PL+S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  45    LWFDQSSRGTALISWSVFFLLVVGAPLISHFLLVCSDCDFHHRRPYDAVVQLSLSLFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+RKFLFLD+L + +DKV+  Y  +I  S K L  FVLP+   +  Y+
Sbjct  105   SFVSLSYWSRKFGMRKFLFLDKLWDVSDKVRIEYEAEIQRSTKRLMIFVLPSLTLEAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPYF N +LSN + C L LSSWLYR AI   VC+L+++ CHLQ LRL+ F
Sbjct  165   IWWYISGSNQIPYFINPVLSNALACTLQLSSWLYRNAIFITVCILYQITCHLQTLRLNDF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V   L EH +IRRNLR++SHRFR FILS+L++VT +QF++LL TT +   
Sbjct  225   ARCFSSEIADVGVALAEHQKIRRNLRIVSHRFRRFILSSLVLVTGTQFMALLTTTRASVA  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF     ET
Sbjct  285   VNIYEVGELALCSLCLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFGHLDCET  344

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEH  1316
             P   TG+       P+  D  +DDEEG+GDD+L NT + P +A+TISY KRQALVTY E+
Sbjct  345   P---TGSMVESHSTPLHLDTTSDDEEGEGDDDLANTKIHPSYANTISYQKRQALVTYLEN  401

Query  1317  NKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             NKAGITVYGF++DR+WLHTIF ++L+L LW+LNKTI
Sbjct  402   NKAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTI  437



>ref|XP_004293340.1| PREDICTED: uncharacterized protein LOC101308260 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=395

 Score =   411 bits (1057),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 230/437 (53%), Positives = 295/437 (68%), Gaps = 42/437 (10%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED  +T+ IL        S+S HE   A E K   S L W+F+DQS++WR GLSWSLFF
Sbjct  1     MED--QTQPILPKQN----SNSGHE---ALEFKSFSSCLKWVFVDQSSIWRTGLSWSLFF  51

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L IGVPLVS  + SC +CD+ H RP++ + QLSLS+FA +SF+SLS + R++G R+FLF
Sbjct  52    VLAIGVPLVSNFLLSCSSCDANHSRPYHVVSQLSLSLFAGLSFVSLSFWTRKFGPRRFLF  111

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ ++KV+Q Y    H+S+K+L   V P F A+C YKIWW                
Sbjct  112   LDKLCDASEKVRQEYKQLFHNSMKLLCFIVFPCFAAECVYKIWW----------------  155

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
                               I FLVCV+FRLIC  QI+R++  AQVF+KE+EV  I++EH +
Sbjct  156   ----------------TTIFFLVCVMFRLICRCQIIRIESCAQVFQKETEVETIMMEHNK  199

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR+ LRVISHRFR+FIL +LI+VTASQ  SL+  T S +H +IF A EL LCS+ +VT L
Sbjct  200   IRKTLRVISHRFRVFILISLIMVTASQLASLVTITRSSAHVNIFKAGELALCSISLVTSL  259

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             FICLRSA K+THKA S+  LAAKW+ CAT+ SFD    ETP+    +   Q + P  AD 
Sbjct  260   FICLRSATKLTHKAHSITGLAAKWNVCATIHSFDYAETETPMIPQVSSDHQ-VFPFGADL  318

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTI  1376
             E+DDEE D DD+LDN  +VPV  +TIS+ KR ALV Y EHN+AGITV+G M+DRTWLH+I
Sbjct  319   ESDDEEADEDDDLDNAKLVPVFTNTISFQKRHALVKYLEHNRAGITVFGTMVDRTWLHSI  378

Query  1377  FVIQLSLTLWILNKTIG  1427
             F IQL+L LW LNKTI 
Sbjct  379   FGIQLALLLWTLNKTIS  395



>emb|CDX79142.1| BnaA01g12090D [Brassica napus]
Length=429

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 299/398 (75%), Gaps = 6/398 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ D+S+   A LSWS+FFIL +GVP++S+ V  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  31    LWFDKSSGGTALLSWSVFFILVVGVPIISHFVLVCSDCDFHHRRPYDAVVQLSLSIFAGI  90

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  Y  +I  S K L  FVLP+   +  Y+
Sbjct  91    SFVSLSYWSRKFGMRRFLFLDKLLDVSDKVRIEYEAEIQRSKKRLMIFVLPSLTLEATYR  150

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LSNV+ C L LSSWLYR AI   VC+L+++ CHLQ LRL+ F
Sbjct  151   IWWYISGSDQIPYLINPLLSNVIACTLQLSSWLYRNAIFITVCILYQITCHLQTLRLNDF  210

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V A L EH +IRRNLR++SHRFR FIL +LI+VT +QF++LL TT +   
Sbjct  211   ARCFASEITDVGAALAEHQKIRRNLRIVSHRFRRFILLSLILVTGTQFMALLTTTRASVA  270

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+I+VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF+   D E
Sbjct  271   VNIYEVGELALCSLILVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFENLHDGE  330

Query  1134  TPVDRTGTGTPQAIHPV-dadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             TP   T +     I    +    +DDEEG+GDDELDNT + P++A+TISY KRQALVTY 
Sbjct  331   TP---TASNVESQISTCRNEMDTSDDEEGEGDDELDNTKIHPIYANTISYQKRQALVTYL  387

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+N+AGITVYGF++DR+WLHTIF ++L+L LW+LNKTI
Sbjct  388   ENNRAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTI  425



>ref|XP_009135768.1| PREDICTED: uncharacterized protein LOC103859918 [Brassica rapa]
Length=428

 Score =   412 bits (1059),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 297/397 (75%), Gaps = 5/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ D+S+   A LSWS+FFIL +GVP++S+ V  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  31    LWFDKSSRGTALLSWSVFFILVVGVPIISHFVLVCSDCDFHHRRPYDAVVQLSLSIFAGI  90

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  Y  +I  S K L  FVLP+   +  Y+
Sbjct  91    SFVSLSYWSRKFGMRRFLFLDKLLDVSDKVRIEYEAEIQRSKKRLMIFVLPSLTLEATYR  150

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LSNV+ C L LSSWLYR AI   VC+L+++ CHLQ LRL+ F
Sbjct  151   IWWYISGSDQIPYLINPLLSNVIACTLQLSSWLYRNAIFITVCILYQITCHLQTLRLNDF  210

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V A L EH +IRRNLR++SHRFR FIL +LI+VT +QF++LL TT +   
Sbjct  211   ARCFASEITDVGAALAEHQKIRRNLRIVSHRFRRFILLSLILVTGTQFMALLTTTRASVA  270

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+I+VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF     ET
Sbjct  271   VNIYEVGELALCSLILVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFGHLDCET  330

Query  1137  PVDRTGTGTPQAIHPVdadw-enddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             P   T +     I     +   +DDEEG+GDDELDNT + P++A+TISY KRQALVTY E
Sbjct  331   P---TASNVESQISTCRNEMDTSDDEEGEGDDELDNTKIHPIYANTISYQKRQALVTYLE  387

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +N+AGITVYGF++DR+WLHTIF ++L+L LW+LNKTI
Sbjct  388   NNRAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTI  424



>gb|EYU27375.1| hypothetical protein MIMGU_mgv1a006628mg [Erythranthe guttata]
Length=437

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 238/448 (53%), Positives = 307/448 (69%), Gaps = 25/448 (6%)
 Frame = +3

Query  126   DEETEIILRLSKT---ALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             DEET I    +K    A  +S  H+     E++   + L WL +DQS  W A LSW +FF
Sbjct  3     DEETLISSSQTKNRSFARCASHSHD-----ELQGFRTWLKWLCVDQSTHWTACLSWFVFF  57

Query  297   ILTIGVPLVSYLVFSCDA-CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              L I VP VS+ V +C A CDS H RP++A+ QLSLS  A +SFI LS F R+YG+R+FL
Sbjct  58    ALAIVVPAVSHFVLTCGADCDSFHSRPYDAVAQLSLSGIAALSFICLSTFVRKYGLRRFL  117

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             F D+L +E++ V+ GYT Q + SLKIL  FVLP   A+ AYKIWW+ +GG +IP+  N +
Sbjct  118   FFDKLRDESETVRNGYTQQFNRSLKILFVFVLPCLAAESAYKIWWYTSGGTRIPFLGNAV  177

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +SN V C+L L SW YR  + FLVCVLFRL+C+LQILR+  FA VF+  S+V  +L EHL
Sbjct  178   VSNTVACVLELCSWFYRSMVFFLVCVLFRLLCYLQILRMQDFALVFQVNSDVETVLREHL  237

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+LR+ISHR+R FIL  L  +TASQ  SLL+TT   +  +++ + EL +CS+ +V G
Sbjct  238   RIRRHLRIISHRYRAFILCALFFITASQLSSLLMTTRPNADVNLYHSGELAVCSVSLVAG  297

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDR-------TGTGTPQA  1172
             L I LRSAA+ITHKAQ+V  LA+KWH CAT+ SFD    ETPV R       T T +  +
Sbjct  298   LLILLRSAARITHKAQAVTCLASKWHVCATIDSFDTTETETPVTRMVEERMFTATCSDGS  357

Query  1173  IHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFM  1349
                        D+ GD +DELDN+  VP++ H TIS+ KRQALVTYFE+N+AGITVYGFM
Sbjct  358   FD--------LDDVGDEEDELDNSKFVPMYTHSTISFQKRQALVTYFENNRAGITVYGFM  409

Query  1350  LDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             LDR+ LHTIF ++LSL LW+L KTIGIS
Sbjct  410   LDRSSLHTIFGLELSLVLWLLGKTIGIS  437



>emb|CDX82928.1| BnaC01g13780D [Brassica napus]
Length=429

 Score =   411 bits (1057),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 216/398 (54%), Positives = 293/398 (74%), Gaps = 6/398 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ D+S+   A LSWS+FF+L +GVP++S+ V  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  31    LWFDKSSRGTALLSWSVFFLLVVGVPIISHFVLVCSDCDFHHRRPYDAVVQLSLSIFAGI  90

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  Y  +I  S K L  FVLP+   +  Y+
Sbjct  91    SFVSLSYWSRKFGMRRFLFLDKLLDVSDKVRIEYEAEIQRSKKRLMIFVLPSLTLEATYR  150

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LSNV+ C L LSSWLYR AI   VC+L+++ CHLQ LRL+ F
Sbjct  151   IWWYISGSDQIPYLINPLLSNVIACTLQLSSWLYRNAIFITVCILYQITCHLQTLRLNDF  210

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V A L EH +IRRNLR++SHRFR FIL +LI+VT +QF++LL TT +   
Sbjct  211   ARCFASEITDVGAALAEHQKIRRNLRIVSHRFRRFILLSLILVTGTQFMALLTTTRASVA  270

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+I+VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SF+   D E
Sbjct  271   VNIYEVGELALCSLILVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFENLHDGE  330

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddel-dnTNMVPVHAHTISYHKRQALVTYF  1310
             TP   T +     I     + +  D+E    D+  DNT + P++A+TISY KRQALVTY 
Sbjct  331   TP---TASNVESQISTCRNEMDTSDDEEGEGDDELDNTKIHPIYANTISYQKRQALVTYL  387

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+N+AGITVYGF++DR+WLHTIF ++L+L LW+LNKTI
Sbjct  388   ENNRAGITVYGFLVDRSWLHTIFGVELALLLWLLNKTI  425



>ref|XP_004251922.1| PREDICTED: uncharacterized protein LOC101243767 [Solanum lycopersicum]
Length=425

 Score =   411 bits (1056),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 230/446 (52%), Positives = 305/446 (68%), Gaps = 28/446 (6%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED++E        KT L+ S  H      E++   +   W+ +DQSN   A LSW +F 
Sbjct  1     MEDEDEA----LEDKTVLVRSGSHMYD---ELRSFRTWFKWMCVDQSNPSSACLSWFVFS  53

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +LT  VP +S+ + +C  CD+ H R ++ + QLS+S  A +SFI LS F R+YG+R+FLF
Sbjct  54    LLTFVVPWLSHYLLACSECDADHSRTYDCVTQLSMSSVAGLSFICLSRFNRKYGLRRFLF  113

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+E++ V+  YT Q++ S KIL  FVLP F+A+  YKIWW+ +GG  IP+     L
Sbjct  114   LDKLCDESETVRNCYTQQLNRSTKILFIFVLPCFVAESTYKIWWYSSGGSGIPF-----L  168

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQV-FEKESEVSAILIEHL  833
              NV+ CIL LSSW YR  + FLVCVLFRLIC+LQILRL  FAQV F  +S+V ++L EHL
Sbjct  169   GNVIACILELSSWFYRTVVFFLVCVLFRLICYLQILRLQDFAQVLFHVDSDVESVLREHL  228

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+LR+ISHRFR+FIL  LI +TAS F SLL+TT   +   ++ + EL LCS+ ++ G
Sbjct  229   RIRRHLRIISHRFRVFILWALIFITASLFASLLLTTRPNADLRVYKSGELALCSISLLAG  288

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPV---  1184
             L I LRSA +ITHKAQSV  LAAKWHACAT+ S+  +  ET        +P A H V   
Sbjct  289   LMILLRSATRITHKAQSVTCLAAKWHACATIDSY--YWAETE-------SPPAAHQVDCN  339

Query  1185  --dadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLD  1355
                    + ++ GD +DELDNT  VP +A+ TIS+ KRQALVTYFE+N+AG+T+YGFMLD
Sbjct  340   NGYNGSSDAEDVGDEEDELDNTKFVPSYAYSTISFQKRQALVTYFENNRAGVTIYGFMLD  399

Query  1356  RTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RT LHTIF I+L+L LW+L KT+G+S
Sbjct  400   RTSLHTIFGIELTLMLWLLGKTVGVS  425



>ref|XP_004295847.1| PREDICTED: uncharacterized protein LOC101309337 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 296/413 (72%), Gaps = 9/413 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S L W+ +DQSN+ R  LSWS+F + TI VP VS+ VF+C  CD KH+RP++++
Sbjct  30    ELKSFRSYLRWMCVDQSNVGRLCLSWSVFVVFTIVVPAVSHFVFACSFCDGKHKRPYDSV  89

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F R++G+++FLF D+L +E++ V++GYT Q++ SLK++  FV
Sbjct  90    VQLSLSGVATLSFVCLSTFVRKFGLKRFLFFDKLYDESETVRKGYTAQLNRSLKVVCCFV  149

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P+F+A+  YKIWW+ +   QIPY  N+  S  + C++ L SWLYR  + FLVCVLFRLI
Sbjct  150   IPSFVAESVYKIWWYASEASQIPYVGNVYASAAMACLMELFSWLYRTTVIFLVCVLFRLI  209

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA +FE +S+V ++L EHLRIRR+L++ISHR R FIL TLI+VT SQF  
Sbjct  210   CYLQILRLQDFATMFEVDSDVGSVLSEHLRIRRHLKIISHRCRDFILWTLILVTGSQFAL  269

Query  927   LLVTTESK--SHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             LL+TT+S   S    +   EL LCS+ + TGL I LRSA KITHK Q+V  LAAKWH CA
Sbjct  270   LLITTKSSAISSLDFYRGGELLLCSITLNTGLLILLRSATKITHKVQAVTCLAAKWHVCA  329

Query  1101  TLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TIS  1277
             TL SFD         +  +           D E++DE  D +DELDN+ ++P +A+ TIS
Sbjct  330   TLDSFD-----ATTAQIASSGQMFRRESSKDDESEDEAEDEEDELDNSKLIPSYAYSTIS  384

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI-GIS  1433
             + KRQALVTYFE+N+AGIT+YGF LDRT LH +F+I+ SL LW+L KT+ GIS
Sbjct  385   FQKRQALVTYFENNRAGITIYGFTLDRTTLHMLFMIEFSLVLWLLGKTVNGIS  437



>ref|NP_567659.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK76630.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13113.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84584.1| uncharacterized protein AT4G22270 [Arabidopsis thaliana]
Length=437

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 310/423 (73%), Gaps = 9/423 (2%)
 Frame = +3

Query  162   TALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFS  341
             +A+I+    E   +R     MS + W   DQSN   A LSWS+FF+L + VPL+S+ +  
Sbjct  18    SAIINKQQPEFPASRFT--FMSLVLWF--DQSNFGTALLSWSVFFLLVVIVPLISHFLLV  73

Query  342   CDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGY  521
             C  CD  H+RP++ IVQLSLS+FA ISF+SLS ++R++G+R+FLFLD+L + +DKV+  Y
Sbjct  74    CSDCDFHHRRPYDVIVQLSLSIFAGISFVSLSIWSRKFGMRRFLFLDKLWDVSDKVRIEY  133

Query  522   TLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLY  701
               +I  SLK L  FVLP+   +  Y+IWW+++G  QIPY  N ILS+VV C L LSSWLY
Sbjct  134   EAEIQRSLKRLMIFVLPSLTLEATYRIWWYISGFNQIPYIINPILSHVVACTLQLSSWLY  193

Query  702   RIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRL  878
             R ++  +VC+L+++ CHLQ LRLD FA+ F  E ++V + L EH +IRRNLR++SHRFR 
Sbjct  194   RNSLFIIVCILYKITCHLQTLRLDDFARCFASEITDVRSALGEHQKIRRNLRIVSHRFRR  253

Query  879   FILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKA  1058
             FIL +LI+VTA+QF++LL TT +    +I+   EL LCS+ +VTG+FICLRSA KITHKA
Sbjct  254   FILLSLILVTATQFMALLTTTRASVAVNIYEVGELALCSLSLVTGVFICLRSATKITHKA  313

Query  1059  QSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIH-PVdadwenddeegdgddel  1235
             QSV SLAAKW+ CAT+ SFD    ETP   TG+     +    +A   +DDEEG+GDD+L
Sbjct  314   QSVTSLAAKWNVCATVDSFDHLDGETP---TGSIIESQVSLRGNAIETSDDEEGEGDDDL  370

Query  1236  dnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILN  1415
             DNT + P++A+TISY KRQALVTY E+NKAGITVYGF++DR+WL+TIF I+L+L LW+LN
Sbjct  371   DNTKIHPIYANTISYQKRQALVTYLENNKAGITVYGFLVDRSWLNTIFGIELALLLWLLN  430

Query  1416  KTI  1424
             KTI
Sbjct  431   KTI  433



>ref|XP_010529467.1| PREDICTED: uncharacterized protein LOC104806325 isoform X1 [Tarenaya 
hassleriana]
Length=464

 Score =   412 bits (1058),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 227/431 (53%), Positives = 299/431 (69%), Gaps = 44/431 (10%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             ++ DQSN   A +SWS+FF+L +GVP++S+ V  C  CD +H+RP++A+VQLSLS FA I
Sbjct  40    VWFDQSNRGGAVVSWSIFFLLAVGVPIMSHFVLICSDCDFQHRRPYDAVVQLSLSGFAGI  99

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R+YG+R+FLFLD+L + +D  + GY  QI  S+K+L  FVLP+   +  Y+
Sbjct  100   SFVSLSSWSRKYGIRRFLFLDKLWDVSDMARLGYESQIQKSMKLLTIFVLPSLTLESVYR  159

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+VTG  +IPY  N  LS+VV C L LSSWLYR ++   VC+L++L CHLQILRL+ F
Sbjct  160   IWWYVTGFDEIPYTINPFLSHVVACTLQLSSWLYRTSLFIFVCLLYQLTCHLQILRLEDF  219

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E S+VS+IL EHL+IRRNLRV+SHRFR FILS+L++VTA+QF++LL+T  +   
Sbjct  220   ARCFSSEISDVSSILAEHLKIRRNLRVVSHRFRRFILSSLVLVTATQFMALLMTIRASVS  279

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +V GLFICLRSA KITHK QSV SLAAKW+ CAT+ SFD+  +ET
Sbjct  280   FNIYEVGELLLCSITLVAGLFICLRSATKITHKGQSVTSLAAKWNVCATIDSFDDLDEET  339

Query  1137  PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQAL------  1298
                          H V    + DDEEGDGDD+LDNT ++P++A TIS+ KRQAL      
Sbjct  340   --------LNHQFH-VIESEDEDDEEGDGDDDLDNTKILPIYARTISFQKRQALGYETRV  390

Query  1299  ----------------------------VTYFEHNKAGITVYGFMLDRTWLHTIFVIQLS  1394
                                         VTY E+N+AGITVYGFM+DR WLHTIF I+L+
Sbjct  391   FIYGGLGRRLSYSFQFKRTKLSCVFLPAVTYLENNRAGITVYGFMVDRAWLHTIFGIELA  450

Query  1395  LTLWILNKTIG  1427
             L LW+LNKTI 
Sbjct  451   LFLWLLNKTIA  461



>ref|XP_002518410.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43797.1| conserved hypothetical protein [Ricinus communis]
Length=386

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 252/321 (79%), Gaps = 0/321 (0%)
 Frame = +3

Query  195   SNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP  374
             ++  E+K     L W+ LDQSN+W+ GLSWS FF+L IG+P+VS+    C  CDSKHQRP
Sbjct  22    NDGIEMKSFRLCLKWVCLDQSNIWKTGLSWSFFFLLAIGIPIVSHFFLLCSDCDSKHQRP  81

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             ++A+VQLSLS+FA +SF+SLS ++ +YG+ KFLFLD+L +E +++++GY  Q+  S+K+L
Sbjct  82    YDAVVQLSLSIFAIVSFLSLSSWSHKYGLSKFLFLDKLDDEAERIRRGYKEQLQKSMKLL  141

Query  555   ASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVL  734
               FVLP   A+ AY+IWW+ TG  QIPYF N  +S+ + CIL L SW YRI+I  LVC++
Sbjct  142   CIFVLPCLTAEAAYRIWWYTTGATQIPYFENKYVSDTIACILQLCSWAYRISIYILVCII  201

Query  735   FRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
             +RLIC+LQILRL+ FAQVF+ ES+V +IL EHLRIRRNLRVISHRFR FIL +L++VTAS
Sbjct  202   YRLICYLQILRLEDFAQVFQMESDVGSILKEHLRIRRNLRVISHRFRRFILLSLVLVTAS  261

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             Q +SLLVTT S ++ +IF A EL LCS+ +VTGLFICLRSA KITHKAQS+ SLAAKWH 
Sbjct  262   QLISLLVTTRSTANNNIFEAGELLLCSINLVTGLFICLRSATKITHKAQSITSLAAKWHV  321

Query  1095  CATLSSFDEFGDETPVDRTGT  1157
             CAT++S+D+   ETP +++ +
Sbjct  322   CATINSYDDMEGETPTNQSAS  342



>ref|XP_006344870.1| PREDICTED: uncharacterized protein LOC102588767 [Solanum tuberosum]
Length=425

 Score =   409 bits (1052),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 230/446 (52%), Positives = 304/446 (68%), Gaps = 31/446 (7%)
 Frame = +3

Query  120   EDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             ++DE  E     +KT L+ S  H      E++   +   W+ +DQS+   A LSW +F +
Sbjct  3     DEDEALE-----NKTVLVRSGSHMYD---ELRSFRTWFKWMCVDQSSPSSACLSWFVFSL  54

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
             LT+ VP +S+ + +C  CD+ H R ++ + QLS+S  A +SFI LS F ++YG+R+FLFL
Sbjct  55    LTVVVPWLSHYLLACSECDADHIRTYDCVTQLSMSSVAALSFICLSRFNKKYGLRRFLFL  114

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILS  659
             D+LC+E++ V+  YT Q++ S KIL  FVLP F+A+  YKIWW+ +GG QIP+     L 
Sbjct  115   DKLCDESETVRNCYTQQLNRSTKILFFFVLPCFVAESTYKIWWYSSGGTQIPF-----LG  169

Query  660   NVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQV-FEKESEVSAILIEHLR  836
             NV+ CIL LSSW YR  + FLVCVLFRLIC+LQILRL  FAQV F  +S+V ++L EHLR
Sbjct  170   NVIACILELSSWFYRTVVFFLVCVLFRLICYLQILRLQDFAQVLFHVDSDVESVLREHLR  229

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRR+LR+ISHRFR+FIL TLI +TAS F SLL+TT   +   I+ + EL LCS+ ++ GL
Sbjct  230   IRRHLRIISHRFRVFILWTLIFITASLFASLLLTTRPNADLRIYKSGELALCSVSLLAGL  289

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETP-----VD-RTGTGTPQAIH  1178
              I LRSA +ITHKAQSV  LAAKWHACAT+ S+    +E P     VD   G        
Sbjct  290   MILLRSATRITHKAQSVTCLAAKWHACATIDSYHWAENEFPPAAHRVDCNNGYNGSSDAE  349

Query  1179  PVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLD  1355
              V          GD +DELDNT  VP +A+ TIS+ KRQALVTYFE+N+AG+T+YGFMLD
Sbjct  350   DV----------GDEEDELDNTKFVPSYAYSTISFQKRQALVTYFENNRAGVTIYGFMLD  399

Query  1356  RTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RT LHTIF I+L+L LW+L KT+G+S
Sbjct  400   RTSLHTIFGIELTLMLWLLGKTVGVS  425



>dbj|BAB02810.1| unnamed protein product [Arabidopsis thaliana]
Length=430

 Score =   409 bits (1052),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 286/414 (69%), Gaps = 30/414 (7%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +DQS+ W A LSWS+F + T+ VP  S+ + +C  CDS H RPF   
Sbjct  42    ELHSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFMLACSDCDSHHSRPF---  98

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
                                  +YG+R+FLF D+L +E++ V+ GYT Q++ SLKIL+ FV
Sbjct  99    -------------------VSKYGLRRFLFFDKLWDESETVRLGYTNQLNRSLKILSYFV  139

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P FLA  +YKIWW+ +G  QIP+  N+ILS+ V C++ L SWLYR  + FLVCVLFRLI
Sbjct  140   SPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLI  199

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FAQVF+ +S+V +IL EHLRIRR+LR+ISHR+R FIL +LI+VT SQF S
Sbjct  200   CHLQILRLQDFAQVFQMDSDVGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYS  259

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CAT+
Sbjct  260   LLITTKAYAELNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATI  319

Query  1107  SSFDEFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddel--dnTNMVPVHAH-T  1271
              SF+    ETP  VDR    +    +P D D    D E  GD+E   DN N++P +A+ T
Sbjct  320   ESFETVDGETPRLVDR---ASGHGYYPTDDDNGESDSEDYGDEEDDFDNNNLIPAYAYST  376

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALV YFE+N++GITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  377   ISFQKRQALVNYFENNRSGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  430



>ref|XP_006283721.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
 gb|EOA16619.1| hypothetical protein CARUB_v10004790mg [Capsella rubella]
Length=444

 Score =   409 bits (1050),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 301/399 (75%), Gaps = 7/399 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  45    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHS-SLKILASFVLPTFLADCAY  596
             SF SLS ++R++G+RKFLFLD+L + +DKV+  +  +I   SLK L  FV P+   +  Y
Sbjct  105   SFFSLSIWSRKFGMRKFLFLDKLWDVSDKVRIEHEAEIQQRSLKRLMIFVFPSLTLEAIY  164

Query  597   KIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDG  776
             +IWW+++G  QIPY  N +LS+VV C L LSSWLYR AI  +VC+L+++ CHLQ LRL+ 
Sbjct  165   RIWWYISGFNQIPYIINPVLSHVVACTLQLSSWLYRNAIFIVVCILYQITCHLQTLRLED  224

Query  777   FAQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKS  953
             FA+ F  E ++VS+ L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +  
Sbjct  225   FARCFASEITDVSSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASV  284

Query  954   HAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDE  1133
               +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    E
Sbjct  285   AVNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGE  344

Query  1134  TPVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTY  1307
             TP   T +     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY
Sbjct  345   TP---TASMVESQISPCGINAVDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTY  401

Query  1308  FEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
              E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  402   LENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  440



>ref|XP_010439350.1| PREDICTED: uncharacterized protein LOC104722811 isoform X1 [Camelina 
sativa]
Length=444

 Score =   408 bits (1048),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 223/398 (56%), Positives = 301/398 (76%), Gaps = 6/398 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  46    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  105

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  +  +I  SLK L  FVLP+   +  Y+
Sbjct  106   SFVSLSIWSRKFGMRRFLFLDKLWDVSDKVRIEHEAEIQRSLKRLMIFVLPSLTLEAIYR  165

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV   L LSSWLYR  I  +VC+L+++ CHLQ LRL+ F
Sbjct  166   IWWYISGFNQIPYIINPVLSHVVAFTLQLSSWLYRNTIFIVVCILYQITCHLQTLRLEDF  225

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  226   ARCFASEIADVRSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASIA  285

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  286   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  345

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   TG+     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  346   P---TGSMIESQISPCGINAMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  402

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  403   ENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  440



>ref|XP_009415457.1| PREDICTED: uncharacterized protein LOC103996294 [Musa acuminata 
subsp. malaccensis]
Length=431

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 299/430 (70%), Gaps = 13/430 (3%)
 Frame = +3

Query  156   SKTALISSSYHEISNARE--VKRLMSALAWLFLDQSNL-WRAGLSWSLFFILTIGVPLVS  326
             ++  L S SY    + R+  ++   S L WL LDQS   +RA +SW++F +L + VP VS
Sbjct  11    ARPLLTSESYARCPSRRDDDLRNFRSCLRWLCLDQSGSGYRAAVSWAVFLLLAVAVPAVS  70

Query  327   YLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDK  506
             + V +        +RP++ +VQLSL+  + +SF++LS   R YG+R+FLFLD+L  E D+
Sbjct  71    HFVLAF----RPQRRPYDLVVQLSLTAASALSFLTLSSVTRSYGLRRFLFLDKLPGETDR  126

Query  507   VQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLL  686
             V+ GYT +++ S ++L+ FV P F A+ AYK+WW+++G G+IP+  N +LS  V C L L
Sbjct  127   VRLGYTFELNQSFRLLSCFVAPCFAAEVAYKLWWYISGAGRIPFVGNPLLSYCVSCALQL  186

Query  687   SSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISH  866
             +S +YRI+  FL CVLFRLICHLQILRL+ FA VF  ESEV A+L EHLR+RR L+VISH
Sbjct  187   ASLIYRISSFFLSCVLFRLICHLQILRLEDFAAVFRGESEVEAVLREHLRLRRQLKVISH  246

Query  867   RFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKI  1046
             RFR+FIL+ LI+VTASQF + LVT    S  ++F   EL LCS+++VTGL ICLRSAAKI
Sbjct  247   RFRVFILAGLIMVTASQFAATLVTLRPHSDDNLFNTGELALCSIVLVTGLLICLRSAAKI  306

Query  1047  THKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIH-PVdadwenddeegdg  1223
             THKAQ++   AAKWH CAT+ S+        ++ T T  P   H   + D + DDEE   
Sbjct  307   THKAQALTGHAAKWHVCATIDSY-----AVDLETTSTIAPDTNHVSPENDADTDDEEASD  361

Query  1224  ddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTL  1403
              DEL  T +V  H +T+++ KRQALVTY E+N+AGIT++GF +DR WLHTIF+++++L L
Sbjct  362   IDELICTKIVHTHVNTMAFQKRQALVTYLENNRAGITIFGFTVDRAWLHTIFMLEITLFL  421

Query  1404  WILNKTIGIS  1433
             W+L KT+GIS
Sbjct  422   WLLGKTVGIS  431



>ref|XP_010675783.1| PREDICTED: uncharacterized protein LOC104891735 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 303/439 (69%), Gaps = 10/439 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+         + T + S +  E+ + R      + L+W+ +DQS  +   LSW +F 
Sbjct  1     MEDETLIHKNQNKTYTRVFSHAQDELHSVR------TYLSWMCVDQSIYFNTFLSWFVFL  54

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             I  I VP +S+   +C +CD KH++P++A+VQLSLS  AT+SF+ L+ F+R+YGVR+FLF
Sbjct  55    IFAIIVPAISHFYLTCPSCDVKHKQPYDAVVQLSLSSIATLSFLCLTHFSRKYGVRRFLF  114

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L  E+D V+  YT Q++ SL IL+ F+LP F+A+C YK+WW+V+G   IP+  N IL
Sbjct  115   FDKLVNESDSVRHHYTTQLNRSLNILSGFILPCFVAECTYKVWWYVSGASHIPFLGNAIL  174

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S++V C L L+SW+YR  + FLVCVLFRLIC+LQILRL  FA VFE +S+V++IL+EHLR
Sbjct  175   SDIVACSLELTSWIYRTLVFFLVCVLFRLICYLQILRLKDFATVFEVDSDVASILVEHLR  234

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IRR+LR+ISHR+R FIL  L+++T SQ   L +TT++     IF A EL LCS+ ++ GL
Sbjct  235   IRRHLRIISHRYRAFILCALMLITLSQLTFLTLTTKAND-VSIFRAGELALCSVTLLAGL  293

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
              I LRSA KITHKAQ++ +L+AKWH CAT+ SF     ET +  T   +        +  
Sbjct  294   TIILRSATKITHKAQAITALSAKWHVCATIDSF--VTSETELPGTNNISNAVCSNASSVD  351

Query  1197  enddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHT  1373
              +DD+ GD +D++DNT  +P +A+ ++S+ KR ALVTY E NKAGIT+YG MLDRTWL  
Sbjct  352   SDDDDAGDEEDDVDNTKFLPAYAYSSMSFQKRHALVTYLEKNKAGITLYGSMLDRTWLRL  411

Query  1374  IFVIQLSLTLWILNKTIGI  1430
             IF ++LSL LW+L KTI I
Sbjct  412   IFGVELSLVLWLLKKTITI  430



>ref|NP_564578.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF87872.1|AC012561_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE32572.1| uncharacterized protein AT1G50630 [Arabidopsis thaliana]
Length=453

 Score =   407 bits (1046),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 225/418 (54%), Positives = 302/418 (72%), Gaps = 9/418 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  36    ELHSFRKYLRWMCVDHSSPWTAILSWTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  96    VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG +IP+  N +LS+ V CI+ L SWLYR  + FLVCVLFRLI
Sbjct  156   IPCFSAMSAYKIWWYASGGSRIPFLGNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLI  215

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  216   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  275

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  276   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  335

Query  1107  SSFDEFGD------ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              SFD+  +      ETP  V R           V     + DE GD +D+LDN +++PV+
Sbjct  336   ESFDQTVESFDQTVETPTLVARNNNDNNNVHDVVTLTESDSDEYGDEEDDLDNNDIIPVY  395

Query  1263  A-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A  T+S+ KRQALV+YFE+N AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  396   AFSTMSFQKRQALVSYFENNSAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  453



>ref|XP_009135678.1| PREDICTED: uncharacterized protein LOC103859848 isoform X1 [Brassica 
rapa]
Length=447

 Score =   406 bits (1044),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 309/418 (74%), Gaps = 4/418 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + T+ VP  S+ V +C  CDS H 
Sbjct  30    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFVIACADCDSHHS  89

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS FA++SF+ LS F  +YG+R+FLF D+L  E++ V+QGYT Q++ SLK
Sbjct  90    RPYDSVVQLSLSSFASLSFLCLSRFVSKYGLRRFLFFDKLWHESETVRQGYTNQLNRSLK  149

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  AYKIWW+ +G  +IP+  N++LS+ V C++ + SWLYR  + FLVC
Sbjct  150   ILSYFVTPCFLATSAYKIWWYASGASRIPFLGNVLLSDTVACLMEICSWLYRTTVIFLVC  209

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V  IL EHLRIRR LR+ISHR+R+FILS+LI+VT
Sbjct  210   VLFRLICHLQILRLQDFAQVFQTDSDVGTILSEHLRIRRRLRIISHRYRIFILSSLILVT  269

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+   EL LCS+ +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  270   GSQFYSLLITTKAHAELNIYKTGELALCSVTLVTALLILLRSASKITHKAQAVTCLAAKW  329

Query  1089  HACATLSSFD--EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+  E G    VDR       +      D ++ ++ GD +D+ DN N++P +
Sbjct  330   HVCATIESFEAVEGGSPRLVDRESGHGFSSKDVDTGDTDDSEDYGDEEDDFDNNNLIPAY  389

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L KTIGIS
Sbjct  390   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS  447



>ref|XP_010434064.1| PREDICTED: uncharacterized protein LOC104718088 [Camelina sativa]
Length=447

 Score =   406 bits (1044),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 221/398 (56%), Positives = 301/398 (76%), Gaps = 6/398 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA +
Sbjct  49    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGV  108

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD++ + +DKV+  +  +I  SLK L  FVLP+   +  Y+
Sbjct  109   SFVSLSIWSRKFGMRRFLFLDKVWDVSDKVRIEHEAEIQRSLKRLMIFVLPSLTLEAIYR  168

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV   L LSSWLYR  I  +VC+L+++ CHLQ LRL+ F
Sbjct  169   IWWYISGFNQIPYIINPVLSHVVAFTLQLSSWLYRNTIFIVVCILYQITCHLQTLRLEDF  228

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  229   ARCFASEIADVRSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASIA  288

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  289   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  348

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   TG+     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  349   P---TGSMIESQISPCGINAMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  405

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  406   ENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  443



>gb|AAK91425.1| At1g50630/F17J6_15 [Arabidopsis thaliana]
 gb|AAL31153.1| At1g50630/F17J6_15 [Arabidopsis thaliana]
Length=453

 Score =   406 bits (1044),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 226/418 (54%), Positives = 302/418 (72%), Gaps = 9/418 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  36    ELHSFRKYLRWMCVDHSSPWTAILSWTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  96    VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG +IP+  N +LS+ V CI+ L SWLYR  + FLVCVLFRLI
Sbjct  156   IPCFSAMSAYKIWWYASGGSRIPFLGNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLI  215

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  216   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  275

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  276   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  335

Query  1107  SSFDE----FGD--ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              SFD+    F    ETP  V R           V     + DE GD +D+LDN +++PV+
Sbjct  336   ESFDQTVVSFDQTVETPTLVARNNNDNNNVHDVVTLTESDSDEYGDEEDDLDNNDIIPVY  395

Query  1263  A-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A  T+S+ KRQALV+YFE+N AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  396   AFSTMSFQKRQALVSYFENNSAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  453



>ref|XP_008227040.1| PREDICTED: uncharacterized protein LOC103326578 [Prunus mume]
Length=437

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 311/443 (70%), Gaps = 10/443 (2%)
 Frame = +3

Query  117   MEDD-EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             M DD    E +L  SK        H      E+K   S L W+ +DQSN WRA LSW +F
Sbjct  1     MADDIMVDEALLNRSKNKFKRCVSH---TQDELKSFRSYLRWMCVDQSNAWRACLSWFVF  57

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+  I VP +S+ VF C  CDSKH+RP++++VQLSLS  A++SF+ LS F +++G+R+FL
Sbjct  58    FLFGIFVPAMSHFVFGCGTCDSKHKRPYDSVVQLSLSSVASLSFVCLSRFVKKFGLRRFL  117

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+L +E++ V++GYT Q+  SLK+L  FV+P F+AD AYKIWW+ +   QIP+  N+ 
Sbjct  118   FLDKLYDESETVRRGYTAQLDRSLKLLCIFVIPCFVADGAYKIWWYASEARQIPFVGNVY  177

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
              S  V CI+ L SWL+R  + FLVCVLFRLIC+LQILRL  FA +FE +S+V ++L EHL
Sbjct  178   ASAAVACIMELCSWLFRTTVIFLVCVLFRLICYLQILRLQDFATMFEVDSDVGSVLSEHL  237

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAH--IFAAAELGLCSMIMV  1007
             RIRR L +ISHR R FIL +LI+VT SQF  LL+TT+S +  +  ++ A EL LCS+ +V
Sbjct  238   RIRRQLTIISHRCRAFILWSLILVTVSQFALLLITTKSSTMVNLDVYRAGELVLCSITLV  297

Query  1008  TGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVd  1187
             TGLFI LRSA KITHKAQ+V  LAAKWH CATL SFD     T  + +G   P  +   +
Sbjct  298   TGLFILLRSATKITHKAQAVTCLAAKWHVCATLDSFDA---ATAQNASGRSLPVVVGSEE  354

Query  1188  adwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTW  1364
                 +++E    +DELDNT ++P +A+ TIS+ KR ALV YFE+N+AGIT++GF LDRT 
Sbjct  355   HGESDNEEVDVEEDELDNTKLIPSYAYTTISFQKRHALVKYFENNRAGITIFGFTLDRTT  414

Query  1365  LHTIFVIQLSLTLWILNKTIGIS  1433
             LHTIF+++LSL LW+L KT+GIS
Sbjct  415   LHTIFMLELSLVLWLLGKTVGIS  437



>ref|XP_010675779.1| PREDICTED: uncharacterized protein LOC104891732 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=432

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/410 (51%), Positives = 287/410 (70%), Gaps = 3/410 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +DQSN+    LSW +F I  I VP +S+   +C +CD K  R ++ +
Sbjct  25    ELYSFRSYLRWMCVDQSNIITTLLSWCIFMIFAIIVPTISHFYLACPSCDPKLHRIYDGV  84

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF  LS F R+YG+R+FLFLD+L  E+  V+  YT +++ SL IL+ FV
Sbjct  85    VQLSLSSIATLSFCCLSMFVRKYGLRRFLFLDKLVSESTSVRCHYTAELNRSLNILSVFV  144

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F+A+C YK+WW+ +G   IP+  N ILS++V C L L+SW+YR  + FLVCVLFRL+
Sbjct  145   VPCFVAECTYKVWWYASGASHIPFLGNAILSDIVACSLELTSWIYRTLVFFLVCVLFRLV  204

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA VFE +S+V++IL+EHLRIRR+LR+ISHR+R FIL  LI++T SQ   
Sbjct  205   CYLQILRLKDFATVFEVDSDVASILVEHLRIRRHLRIISHRYRAFILCALILITLSQLTF  264

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             L++TT+  +   IF A EL LCS+ ++ GL I LRSA KITHKAQ++ +L+AKWH CAT+
Sbjct  265   LMLTTKPNADVSIFRAGELALCSVTLLAGLMIILRSATKITHKAQAITALSAKWHICATI  324

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYH  1283
              SF     ET +  T T          +   +DD+ G  +D++DNT  +P +A+ ++S+ 
Sbjct  325   DSF--VTSETELPGTNTSNDAGRFDASSFNSDDDDAGSEEDDVDNTKFLPAYAYSSMSFQ  382

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             KR ALVTYFE N+AGIT+YG MLDRTWL  IF ++LSL LW+L +TI IS
Sbjct  383   KRHALVTYFEKNRAGITLYGSMLDRTWLQLIFGVELSLVLWLLKETITIS  432



>gb|EYU27373.1| hypothetical protein MIMGU_mgv1a006639mg [Erythranthe guttata]
Length=437

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 231/443 (52%), Positives = 301/443 (68%), Gaps = 15/443 (3%)
 Frame = +3

Query  126   DEETEIILRLSKT---ALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             DEE  II   +K+   A  +S  H+     E+    + L WL +DQSN W A LSW +FF
Sbjct  3     DEENLIISSQTKSRSFARYASHSHD-----ELHDFRTWLKWLCVDQSNHWSACLSWFVFF  57

Query  297   ILTIGVPLVSYLVFSCDA-CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              L I VP VS+ V +C A CDS H RP++A+ QLSLS  A +SFI LS F R+YG+R+FL
Sbjct  58    ALAIVVPAVSHFVLTCGADCDSFHSRPYDAVTQLSLSGIAALSFICLSTFVRKYGLRRFL  117

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             F D+L +E++ V+ GYT Q + SLKIL  FVLP F A+ AYKIWW+ +GG +I +  N++
Sbjct  118   FFDKLRDESETVRNGYTQQFNRSLKILFVFVLPCFAAETAYKIWWYTSGGTRIAFLGNVV  177

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +SN V C+L L SW YR  + FLVCVLFRL+C+LQILR+  FA VF+  S V  +L EHL
Sbjct  178   VSNTVACVLELCSWFYRSMVFFLVCVLFRLLCYLQILRMQDFALVFQVNSNVETVLREHL  237

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRR+L +ISHR+R FIL  L  +TASQ  SLL+TT   +  +++ + EL +CS+ +V G
Sbjct  238   RIRRHLMIISHRYRAFILCALFFITASQLSSLLMTTRPNADVNLYHSGELAVCSVSLVAG  297

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L I LRSAA+ITHKAQ+V  LA+KWH CAT+ SFD    ETPV R      + I      
Sbjct  298   LLILLRSAARITHKAQAVTCLASKWHVCATIDSFDTTETETPVTRM---VEERIFSATCS  354

Query  1194  wenddeegdgddeldnTN--MVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTW  1364
               + D +  GD+E +  N   VP++ H TIS+ KRQALVTYFE+N+AGITVYGFMLDR+ 
Sbjct  355   DGSFDLDDVGDEEDELDNSKFVPMYTHSTISFQKRQALVTYFENNRAGITVYGFMLDRSS  414

Query  1365  LHTIFVIQLSLTLWILNKTIGIS  1433
             L+TIF ++LSL LW+L  T GIS
Sbjct  415   LNTIFGLELSLVLWLLGNTTGIS  437



>ref|XP_010439351.1| PREDICTED: uncharacterized protein LOC104722811 isoform X2 [Camelina 
sativa]
Length=429

 Score =   404 bits (1038),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/384 (56%), Positives = 289/384 (75%), Gaps = 6/384 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWS+FF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  46    LWFDQSNCGTALLSWSVFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  105

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  +  +I  SLK L  FVLP+   +  Y+
Sbjct  106   SFVSLSIWSRKFGMRRFLFLDKLWDVSDKVRIEHEAEIQRSLKRLMIFVLPSLTLEAIYR  165

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV   L LSSWLYR  I  +VC+L+++ CHLQ LRL+ F
Sbjct  166   IWWYISGFNQIPYIINPVLSHVVAFTLQLSSWLYRNTIFIVVCILYQITCHLQTLRLEDF  225

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  226   ARCFASEIADVRSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASIA  285

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  286   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  345

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   TG+     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  346   P---TGSMIESQISPCGINAMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  402

Query  1311  EHNKAGITVYGFMLDRTWLHTIFV  1382
             E+NKAGITVYGF++DR+WLHTIFV
Sbjct  403   ENNKAGITVYGFLVDRSWLHTIFV  426



>ref|XP_003530763.1| PREDICTED: uncharacterized protein LOC100806904 [Glycine max]
Length=441

 Score =   404 bits (1037),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 222/418 (53%), Positives = 295/418 (71%), Gaps = 15/418 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E     S L W+ +DQSN + A LSWSLF +L + VP  S+ + +C  CD++H RP++A+
Sbjct  30    EFHTFRSYLRWMCVDQSNNFTAALSWSLFLLLALAVPAASHFLLACPDCDARHSRPYDAV  89

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  + +SF+ L+ F R+YG+R+FLF D+LC+E++ V+  Y  Q++ S+KIL+ FV
Sbjct  90    VQLSLTSVSALSFLCLAGFVRKYGLRRFLFFDKLCDESETVRTNYMAQLNRSVKILSVFV  149

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A+CAYKIWW+ +G  QIP+  N+ +S+ V CIL L SWLYR  + FLVCVLFRLI
Sbjct  150   GPCFVAECAYKIWWYASGASQIPFLGNVYVSDAVACILELWSWLYRTTVIFLVCVLFRLI  209

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA+ F  +S+V++++ EHLRIRR+LR+ISHRFR FIL  L++VT SQ   
Sbjct  210   CHLQILRLRDFARFFHVDSDVASVMTEHLRIRRHLRIISHRFRAFILLALLLVTGSQLAC  269

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LLVTT+     +I+   EL LCS+ +++ L I LRSA KITHKAQ++  LAAKWH CATL
Sbjct  270   LLVTTKHTQDMNIYKTGELALCSVTLLSALCILLRSATKITHKAQAITGLAAKWHVCATL  329

Query  1107  SSFDEF--GDETPVDRTGTGTPQAIHPV------dadwenddeegdgddeldnTNMVPVH  1262
              SFD      ETP+       PQ+ H               DE GD +DE+D T ++P +
Sbjct  330   DSFDGVVTEGETPM------APQSSHETVFPNVGTDGESETDEAGDEEDEIDTTKLIPSY  383

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A+ TISY KRQALV YFE+N+AGITVYGFMLDR+ LHTIF I++SL LW+L KTIG S
Sbjct  384   AYSTISYQKRQALVNYFENNRAGITVYGFMLDRSTLHTIFGIEMSLVLWLLGKTIGFS  441



>ref|XP_007214588.1| hypothetical protein PRUPE_ppa025124mg [Prunus persica]
 gb|EMJ15787.1| hypothetical protein PRUPE_ppa025124mg [Prunus persica]
Length=437

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 311/443 (70%), Gaps = 10/443 (2%)
 Frame = +3

Query  117   MEDD-EETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             M DD    E +L  SK        H      E+K   S L W+ +DQSN   A LSW +F
Sbjct  1     MADDIVVDEALLNRSKNKFKRCVSH---TQDELKSFRSYLRWMCVDQSNARSACLSWFVF  57

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+  I VP +S+ VF C  CDSKH+RP++++VQLSLS  A++SF+ LS F +++G+R+FL
Sbjct  58    FLFGIFVPAMSHFVFGCGTCDSKHKRPYDSVVQLSLSSVASLSFVCLSRFVKKFGLRRFL  117

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD+L +E++ V++GYT Q+  SLK+L+ FV+P F+AD AYKIWW+ +   QIP+  N+ 
Sbjct  118   FLDKLYDESETVRRGYTAQLDRSLKLLSIFVIPCFVADSAYKIWWYASEARQIPFVGNVY  177

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
              S  V CI+ L SWLYR  + FLVCVLFRLIC+LQILRL  FA +FE +S+V ++L EHL
Sbjct  178   ASAAVACIMELCSWLYRTTVIFLVCVLFRLICYLQILRLQDFATMFEVDSDVGSVLSEHL  237

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAH--IFAAAELGLCSMIMV  1007
             RIRR L +ISHR R FIL +LI+VT SQF  LL+TT+S +  +  ++ A EL LCS+ +V
Sbjct  238   RIRRQLTIISHRCRAFILWSLILVTVSQFALLLITTKSSTMVNLDVYRAGELVLCSITLV  297

Query  1008  TGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVd  1187
             TGLFI LRSA KITHKAQ+V  LAAKWH CATL SFD     T  + +G   P A+   +
Sbjct  298   TGLFILLRSATKITHKAQAVTCLAAKWHVCATLDSFDA---ATAQNGSGRSLPVAVGSEE  354

Query  1188  adwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTW  1364
                 +++E    +DELDNT ++P +A+ TIS+ KR ALV YFE+N+AGIT++GF LDRT 
Sbjct  355   HGESDNEEVDVEEDELDNTKLIPSYAYSTISFQKRHALVKYFENNRAGITIFGFTLDRTT  414

Query  1365  LHTIFVIQLSLTLWILNKTIGIS  1433
             LHTIF+++LSL LW+L KT+GIS
Sbjct  415   LHTIFMLELSLVLWLLGKTVGIS  437



>ref|XP_008227044.1| PREDICTED: uncharacterized protein LOC103326581 [Prunus mume]
Length=436

 Score =   402 bits (1032),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 215/413 (52%), Positives = 291/413 (70%), Gaps = 6/413 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S + W+ +DQSN WRA +SWS+F +  I VP +S+ VF+C  CD KH+RP++ +
Sbjct  25    ELKSFRSYIWWMCVDQSNAWRAFISWSIFILFGILVPAISHFVFACATCDGKHKRPYDCV  84

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F R++G+R+FLF D+L  E++ V++ YT Q++ SLK+L  FV
Sbjct  85    VQLSLSSVATVSFLCLSWFVRKFGLRRFLFFDKLYNESETVRREYTEQLNRSLKLLCIFV  144

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+ AYKIWW+ +   QIP+  N+ +S  + C L L SWLYR  + FLVCVLFRLI
Sbjct  145   MPCFAAESAYKIWWYASEATQIPFLGNVYMSAAIACSLELCSWLYRTTVFFLVCVLFRLI  204

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA VF+ ES+V ++L EHLRIRR+L +ISHR+R FIL +LI+VT SQF  
Sbjct  205   CYLQILRLQDFATVFQVESDVGSVLSEHLRIRRHLTIISHRYRGFILWSLILVTGSQFAL  264

Query  927   LLVTTESKSHAH--IFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             LL+TT S + A+  ++ + EL L S+ +VTG+ I LRSA KITHKAQ+V  LA KWH CA
Sbjct  265   LLITTRSGATANLDVYRSGELALSSITLVTGVLILLRSATKITHKAQAVTCLATKWHVCA  324

Query  1101  TLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTN--MVPVHAH-T  1271
             TL SFD    ++P         + + PV       D +   DD+ +  N  + P +++ T
Sbjct  325   TLDSFDANEGDSPTTNPIAANGR-VFPVACSSGESDSDLASDDQDELENAKLDPSYSYST  383

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             ISY KRQALVTY E+N+AGIT+YGF  DRT LHTIF+++LSL LW+L KT+GI
Sbjct  384   ISYQKRQALVTYLENNRAGITIYGFTFDRTTLHTIFMLELSLILWLLGKTVGI  436



>ref|XP_009348304.1| PREDICTED: uncharacterized protein LOC103939933 [Pyrus x bretschneideri]
Length=436

 Score =   402 bits (1032),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 319/444 (72%), Gaps = 13/444 (3%)
 Frame = +3

Query  117   MEDDEET-EIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSL  290
             MEDD    E +L  SK          +S+AR E+    S L W+ +DQS++WRA LSW +
Sbjct  1     MEDDTVVDEALLNRSKNKFRRC----VSHARDELHSFRSYLRWMCVDQSSVWRACLSWFM  56

Query  291   FFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
             F +  I VP VS+ +F C ACDSKH+RP++++VQLSLS  A++SF+ L+ F +++G+R+F
Sbjct  57    FILFGIVVPAVSHFLFGCAACDSKHKRPYDSVVQLSLSSVASLSFVCLTRFVKKFGLRRF  116

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             LF D+L +E++ V++GYT Q++ SL++L  FV+P F ++  YKIWW+ +   QIP+  ++
Sbjct  117   LFFDKLYDESETVRKGYTAQLNRSLQLLCFFVIPIFASESVYKIWWYASEATQIPFLGSV  176

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
              +S  V C++ L SWLYR  + FLVCVLFRLIC+LQILRL  FA +FE +S+V ++L EH
Sbjct  177   YVSAAVACVMELCSWLYRTTVIFLVCVLFRLICYLQILRLQDFATMFEVDSDVGSVLSEH  236

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTES--KSHAHIFAAAELGLCSMIM  1004
             LRIRR+LR+ISHR R FIL +L++VT SQF  LL+TT+S  K +  ++ A EL LCS+ +
Sbjct  237   LRIRRHLRIISHRCRAFILWSLMLVTGSQFALLLITTKSSAKENLDVYRAGELVLCSITL  296

Query  1005  VTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPV  1184
             VTGLFI LRSA KITHKAQ+V  LAAKWH CATL SFD    E     +G    +A+   
Sbjct  297   VTGLFILLRSATKITHKAQAVTCLAAKWHVCATLDSFDAAAAEIT---SGRALAEAV-GT  352

Query  1185  dadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRT  1361
             +    +++E    +DELDNT ++P +A+ TIS+ KRQALVTYFE+N+AGIT++GF LDRT
Sbjct  353   ERGESDNEEGDADEDELDNTKLIPSYAYSTISFQKRQALVTYFENNRAGITIFGFTLDRT  412

Query  1362  WLHTIFVIQLSLTLWILNKTIGIS  1433
              LHTIF+++LSL LW+L KT+GIS
Sbjct  413   TLHTIFMLELSLVLWLLGKTVGIS  436



>ref|XP_004293338.1| PREDICTED: uncharacterized protein LOC101307759 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=398

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 228/443 (51%), Positives = 296/443 (67%), Gaps = 54/443 (12%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED  +T+ IL        S+S HE   A E K  +  L W+F+DQS++WR GLSWSLFF
Sbjct  1     MED--QTQPILPKQN----SNSGHE---ALEFKSFIPWLEWVFVDQSSIWRTGLSWSLFF  51

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L IGVPLVS  + SC +CD+ H RP++ + QLSLS+FA +SF+SLS + R++G R+FLF
Sbjct  52    VLAIGVPLVSNFLLSCPSCDANHSRPYHVVSQLSLSLFAGLSFVSLSFWTRKFGPRRFLF  111

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ ++KV+Q Y    H+S+K+L   V P F A+C YKIWW                
Sbjct  112   LDKLCDASEKVRQEYKQIFHNSMKLLCFIVFPCFAAECVYKIWW----------------  155

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
                               I FLVCV+F+L+C  QI+RL+ FAQ+F+K++EV  I++EH +
Sbjct  156   ----------------TTIFFLVCVMFQLMCRCQIIRLESFAQIFQKDTEVETIMMEHNK  199

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR+ LRVISHRFR+FIL +LI+VTASQ  SL+  T S +H  IF A EL LCS+ ++T L
Sbjct  200   IRKTLRVISHRFRMFILISLIMVTASQLASLVTVTWSSAHVDIFEAGELALCSISLITSL  259

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACAT--LSSFDEFGDETPVDRTGTGTPQA-----I  1175
             FICLRSA K+THKAQS+  LAAKW+ CAT  + SFD    ETP+       PQ      +
Sbjct  260   FICLRSATKLTHKAQSITGLAAKWNVCATIHIHSFDYAETETPM------IPQVSLDHHV  313

Query  1176  HPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLD  1355
              P  AD E+DDEE D DD+LDN  +VPV  +TIS+ KR ALV Y EHN+AGITV+G M+D
Sbjct  314   FPFGADLESDDEEADEDDDLDNGKLVPVFRNTISFQKRHALVKYLEHNRAGITVFGTMVD  373

Query  1356  RTWLHTIFVIQLSLTLWILNKTI  1424
             RTWLH+IF IQL+L LW LNKTI
Sbjct  374   RTWLHSIFGIQLALLLWTLNKTI  396



>ref|XP_007211685.1| hypothetical protein PRUPE_ppa005936mg [Prunus persica]
 gb|EMJ12884.1| hypothetical protein PRUPE_ppa005936mg [Prunus persica]
Length=436

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 214/413 (52%), Positives = 290/413 (70%), Gaps = 6/413 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S + W+ +DQSN W+A +SWS+F +  I VP +S+ VF+C  CD KH+RP++ +
Sbjct  25    ELKSFRSYIWWMCVDQSNAWKACISWSIFILFGIVVPAISHFVFACAICDGKHKRPYDCV  84

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ LS F R++G+R+FLF D+L  E++ V++ YT Q++ SLK+L  FV
Sbjct  85    VQLSLSSVATVSFLCLSWFVRKFGLRRFLFFDKLYNESETVRREYTEQLNRSLKLLCIFV  144

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A+ AYKIWW+ +   QIP+  N+ +S  + C L L SWLYR  + FLVCVLFRLI
Sbjct  145   MPCFAAESAYKIWWYASEATQIPFLGNVYMSAAIACSLELCSWLYRTTVFFLVCVLFRLI  204

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FA VF+ ES+V ++L EHLRIRR+L +ISHR+R FIL +LI+VT SQF  
Sbjct  205   CYLQILRLQDFATVFQVESDVGSVLSEHLRIRRHLTIISHRYRGFILWSLILVTGSQFAL  264

Query  927   LLVTTESKSHAH--IFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
             LL+TT S + A+  ++ + EL LCS+ +VTG+ I LRSA KITHKAQ+V  LA KWH CA
Sbjct  265   LLITTRSGATANLDVYRSGELALCSITLVTGVLILLRSATKITHKAQAVTCLATKWHVCA  324

Query  1101  TLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM---VPVHAHT  1271
             TL SFD    ++P         + + PV +   + D +   DD+ +  N    +     T
Sbjct  325   TLDSFDANEGDSPTTNPIAANGR-VFPVASSSGDSDSDLASDDQDELENAKLDLSYSYST  383

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             ISY KRQALVTY E+N+AGIT+YGF  DRT LHTIF+++LSL LW+L KT+GI
Sbjct  384   ISYQKRQALVTYLENNRAGITIYGFTFDRTTLHTIFMLELSLILWLLGKTVGI  436



>ref|XP_008366458.1| PREDICTED: uncharacterized protein LOC103430105 [Malus domestica]
Length=436

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 315/447 (70%), Gaps = 19/447 (4%)
 Frame = +3

Query  117   MEDDEET-EIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSL  290
             MEDD    E +L  SK          +S+AR E+    S L W+ +DQS++WRA LSW +
Sbjct  1     MEDDTVVDEALLNRSKNKFRRC----VSHARDELHSFRSYLRWMCVDQSSVWRACLSWFM  56

Query  291   FFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
             F +  I VP +S+ +F C ACDSKH+RP++++VQLSLS  A++SF+ LS F +++G+R+F
Sbjct  57    FILFGIVVPAMSHFLFGCAACDSKHKRPYDSVVQLSLSSVASLSFVCLSRFVKKFGLRRF  116

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             LF D+L +E++ V++GYT Q++ SL++L  FV+P F  +  YKIWW+ +   QIP+  ++
Sbjct  117   LFFDKLYDESETVRKGYTAQLNRSLQLLCFFVIPIFAIESVYKIWWYASEATQIPFLGSV  176

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
               S  V+C++ L SWLYR  + FLVCVLFRLIC+LQILRL  FA +FE +S+V ++L EH
Sbjct  177   YASAAVVCVMELCSWLYRTTMIFLVCVLFRLICYLQILRLQDFATMFEVDSDVGSVLSEH  236

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTES--KSHAHIFAAAELGLCSMIM  1004
             LRIRR+LR+ISHR R FIL +LI+VT SQF  LL+TT+S  K +  ++ A EL LCS+ +
Sbjct  237   LRIRRHLRIISHRCRAFILWSLILVTGSQFALLLITTKSSAKENLDVYRAGELVLCSITL  296

Query  1005  VTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRT---GTGTPQAI  1175
             VTGLFI LRSA KITHKAQ+V  LAAKWH CATL SFD    E    R      GT +  
Sbjct  297   VTGLFILLRSATKITHKAQAVTCLAAKWHVCATLDSFDAAAAEITSGRVLAEAVGTERG-  355

Query  1176  HPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFML  1352
                     + +E    +DELDNT ++P +A+ TIS+ KRQALVTYFE+N+AGIT++GF L
Sbjct  356   ------ESDSEEGDADEDELDNTKLIPSYAYSTISFQKRQALVTYFENNRAGITIFGFTL  409

Query  1353  DRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             DRT LHTIF+++LSL LW+L KT+GIS
Sbjct  410   DRTTLHTIFMLELSLVLWLLGKTVGIS  436



>ref|XP_004145463.1| PREDICTED: uncharacterized protein LOC101203162 [Cucumis sativus]
Length=841

 Score =   414 bits (1064),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 214/425 (50%), Positives = 296/425 (70%), Gaps = 12/425 (3%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWL-FLDQSNLWRAGLSWSLF  293
             +E   + +I  + SK+A + S       A E+++L S L W+  +D SNL+RA +S  +F
Sbjct  4     VEKKSQPQIDSQKSKSAELESELE----APELRKLESFLRWICIMDHSNLYRASVSCIMF  59

Query  294   FILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
             F+  I VP+ S+   SC  CD  HQRPF+ +VQLSLS  AT+SF+ LS + R +G+ +FL
Sbjct  60    FVFGIAVPIASHFGLSCSDCDEDHQRPFHVVVQLSLSAVATLSFLCLSLWLRVFGLNRFL  119

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYF-YNM  650
             FLD+LCE + K++  Y  Q+  S+K+++ F+LP F+A+  YKIWW+++   +IPY+  NM
Sbjct  120   FLDKLCEASPKIRAEYFRQLQKSMKLMSFFLLPCFMAEAGYKIWWYISAAKEIPYYTNNM  179

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
              +S V  C L L SWLYR +I F VC+ FRLIC LQ++RL+ FA  F  E+EV  ILI+H
Sbjct  180   YISYVTSCTLELCSWLYRTSIFFFVCIFFRLICCLQMIRLEDFASSFRSETEVGTILIQH  239

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVT  1010
             L +RR   VISHRFR+F+L +LI+VTASQF+SLL+TT SK+HA++  + +L LCS+ +VT
Sbjct  240   LGLRRTFTVISHRFRVFMLLSLILVTASQFISLLMTTRSKAHANLSKSGQLALCSISLVT  299

Query  1011  GLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVda  1190
             GLFICLRSAAKITHKAQS+  LAAKWH  A +++FDE   E       T T   +  V  
Sbjct  300   GLFICLRSAAKITHKAQSITCLAAKWHVSAVINTFDELDTEM------TPTASFVPNVVE  353

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
                +D++  + +D+LD+  ++PV AHTIS+ KRQALVTY  +NKAGITVYGFM+DRTWL 
Sbjct  354   SNSDDEDGDEDEDDLDDAKLMPVFAHTISFQKRQALVTYLRNNKAGITVYGFMVDRTWLK  413

Query  1371  TIFVI  1385
             +IF I
Sbjct  414   SIFAI  418



>ref|XP_009334156.1| PREDICTED: uncharacterized protein LOC103926992 [Pyrus x bretschneideri]
Length=452

 Score =   401 bits (1030),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 318/444 (72%), Gaps = 13/444 (3%)
 Frame = +3

Query  117   MEDDEET-EIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSL  290
             MEDD    E +L  SK          +S+AR E+    S L W+ +DQS++WRA LSW +
Sbjct  17    MEDDTVVDEALLNRSKNKFRRC----VSHARDELHSFRSYLRWMCVDQSSVWRACLSWFM  72

Query  291   FFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
             F +  I VP VS+ +F C ACDSKH+RP++++VQLSLS  A++SF+ L+ F +++G+R+F
Sbjct  73    FILFGIVVPAVSHFLFGCAACDSKHKRPYDSVVQLSLSSVASLSFVCLTRFVKKFGLRRF  132

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             LF D+L +E++ V++GYT Q++ SL++L  FV+P F  +  YKIWW+ +   QIP+  ++
Sbjct  133   LFFDKLYDESETVRKGYTAQLNRSLQLLCFFVIPIFAIESVYKIWWYASEATQIPFLGSV  192

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
              +S  V C++ L SWLYR  + FLVCVLFRLIC+LQILRL  FA +FE +S+V ++L EH
Sbjct  193   YVSAAVACVMELCSWLYRTTVIFLVCVLFRLICYLQILRLQDFATMFEVDSDVGSVLSEH  252

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTES--KSHAHIFAAAELGLCSMIM  1004
             LRIRR+LR+ISHR R FIL +LI+VT SQF  LL+TT+S  K +  ++ A EL LCS+ +
Sbjct  253   LRIRRHLRIISHRCRAFILWSLILVTGSQFALLLITTKSSAKENLDVYRAGELVLCSITL  312

Query  1005  VTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPV  1184
             VTGLFI LRSA KITHKAQ+V  LAAKWH CATL SFD    E     +G    +A+   
Sbjct  313   VTGLFILLRSATKITHKAQAVTCLAAKWHVCATLDSFDAAAAEIT---SGRALAEAV-GT  368

Query  1185  dadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRT  1361
             +    +++E    +DELDNT ++P +A+ TIS+ KRQALVTYFE+N+AGIT++GF LDRT
Sbjct  369   ERGESDNEEGDADEDELDNTKLIPSYAYSTISFQKRQALVTYFENNRAGITIFGFTLDRT  428

Query  1362  WLHTIFVIQLSLTLWILNKTIGIS  1433
              LHTIF+++LSL LW+L KT+GIS
Sbjct  429   TLHTIFMLELSLVLWLLGKTVGIS  452



>gb|KCW75211.1| hypothetical protein EUGRSUZ_E03959 [Eucalyptus grandis]
Length=408

 Score =   398 bits (1022),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 209/394 (53%), Positives = 288/394 (73%), Gaps = 4/394 (1%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             MED+    ++ R   ++ +SS     S   E+    S   W+ +DQS+LW  GLSWS+FF
Sbjct  1     MEDEARAFVLRRKPISSYLSSPVLP-SEPVELNSFTSCFKWVCVDQSSLWLTGLSWSVFF  59

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +  + VPL S+ +  C +CD+  QRP++  VQ+SLSVFA ISF+ LS ++R+YG+RKFLF
Sbjct  60    LFAVAVPLASHFLLQCSSCDANLQRPYHIPVQISLSVFAAISFVCLSRWSRKYGIRKFLF  119

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
             LD+LC+ +D V++GY+ Q+  S+K+   FVLP F  + AYK+WWF+ G   IPY+ N+ +
Sbjct  120   LDKLCDSSDNVRRGYSQQLQRSVKLWTWFVLPCFAVETAYKLWWFIDGSTNIPYYGNLYV  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
             S+ ++C L L SWLYR AI  LVCVL+RLIC+L ILRL+ FA VFEKE+EV +IL EHLR
Sbjct  180   SDTILCALELLSWLYRTAIFILVCVLYRLICYLHILRLEDFAHVFEKETEVVSILKEHLR  239

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
              RR LR+ISHRFR F+L  LI+VTASQF+ +L+ T S ++A+IF A EL LCS+ ++TGL
Sbjct  240   FRRTLRIISHRFRSFLLLCLILVTASQFIFVLLLTRSGANANIFKAGELSLCSVSLLTGL  299

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw  1196
             FICLRSA K++HKAQS+  LAAKWH CAT++SFD+   ETP     +     + P DA+W
Sbjct  300   FICLRSATKVSHKAQSITGLAAKWHICATINSFDDNDGETPRIEVAS---THVFPADAEW  356

Query  1197  enddeegdgddeldnTNMVPVHAHTISYHKRQAL  1298
             E+++EEGDGDD+L+N  ++P++AHTIS+HKRQAL
Sbjct  357   ESEEEEGDGDDDLNNAKIMPIYAHTISFHKRQAL  390



>ref|XP_008805602.1| PREDICTED: uncharacterized protein LOC103718515 [Phoenix dactylifera]
Length=441

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/417 (51%), Positives = 290/417 (70%), Gaps = 17/417 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S L WL +DQS+  RA +SWSLFF+L + VP  S+ +       S  +RP++  
Sbjct  34    ELKSFRSCLRWLCVDQSDTPRAVVSWSLFFLLGLFVPAASHFLL----IYSPARRPYDLA  89

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  + +S++ LS F RRYG+R+FLFLD+L  E+++V+ GYT+Q++SS ++LA F+
Sbjct  90    VQLSLTAVSALSYLCLSAFHRRYGLRRFLFLDKLVGESERVRLGYTIQLNSSFRLLALFL  149

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMI-------LSNVVICILLLSSWLYRIAISFLV  725
             +P+F  D AYK+WW  TG G++P +           +S    C L L+SW+YR+AI FL+
Sbjct  150   MPSFAGDVAYKVWWHATGAGRLPEYLLFFGWRGAAWVSEAAACGLELASWVYRMAIFFLI  209

Query  726   CVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             CVLFRLIC+LQILRL  FA +F +ES+V+ +L EHLRIR+ LR+ISHR+R FILS L++V
Sbjct  210   CVLFRLICYLQILRLQDFAAIFREESDVATVLREHLRIRKQLRIISHRYRAFILSCLVLV  269

Query  906   TASQFVSLLVTT-ESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAA  1082
             +A  F SLL+TT    +  +I  A EL LCS+ ++TGL ICLRSAAKITHKAQ++ S AA
Sbjct  270   SAGNFASLLLTTGHHHTEVNIANAGELALCSIGLMTGLLICLRSAAKITHKAQAITSHAA  329

Query  1083  KWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              WH  AT+ SFD    E P   T        +P+       DEE   +DELD+  ++P H
Sbjct  330   TWHVLATIESFDA-DTEEPTSETSANA----YPLSNSTAESDEEARDEDELDDMKLMPSH  384

Query  1263  AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              +TIS+ KRQALVTY E+N+AGITV+GF++DR+WLH +F+I+ SL LW+L KTIGIS
Sbjct  385   VNTISFQKRQALVTYLENNRAGITVFGFVVDRSWLHGLFMIEFSLILWLLGKTIGIS  441



>gb|EYU33671.1| hypothetical protein MIMGU_mgv1a024798mg [Erythranthe guttata]
Length=443

 Score =   397 bits (1019),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 231/433 (53%), Positives = 304/433 (70%), Gaps = 11/433 (3%)
 Frame = +3

Query  156   SKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLV  335
             ++ A   S  H     R  +R +  L    +DQS+   A LSW +FF+LT+ VP VS+ V
Sbjct  15    NRRAFSRSQSHAHDELRGFRRWLKCLC---VDQSDRRTACLSWLVFFVLTVVVPAVSHFV  71

Query  336   FSC----DACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEEND  503
             F+C    D CDS H RP++A+ QLSLS  A +SFI LS F R++G+R+FLF D+LC+E++
Sbjct  72    FACGGRGDDCDSLHSRPYDAVAQLSLSGIAALSFICLSEFVRKFGLRRFLFFDKLCDESE  131

Query  504   KVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILL  683
              V++GYT Q + S+K+L  FVLP F A+ AYKIWW+ +GG +IP+  N ++SN V C L 
Sbjct  132   TVRKGYTKQFNRSMKLLFIFVLPCFAAEGAYKIWWYTSGGTRIPFLGNTVISNTVACALE  191

Query  684   LSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVF-EKESEVSAILIEHLRIRRNLRVI  860
             L SW YR  + FLVC+LFRLIC LQILRL  FAQVF + +S V ++L EHLRIRR+LR+I
Sbjct  192   LCSWFYRTVVFFLVCILFRLICCLQILRLQDFAQVFVQVDSNVESVLKEHLRIRRHLRII  251

Query  861   SHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAA  1040
             SHR+RLFIL  L+ +TASQF SL VTT + +  +I+   EL +CS+ ++ GL I LRSA 
Sbjct  252   SHRYRLFILWALVFITASQFASLFVTTRN-ADVNIYHTGELAVCSVSLLAGLLILLRSAT  310

Query  1041  KITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadw-enddeeg  1217
             KITHKAQSV  LAAKWH CAT+ SFD   D+      G    + +  + +D   + D+ G
Sbjct  311   KITHKAQSVTCLAAKWHVCATIDSFDHTADQAHATPVGCVADEHLFTLTSDGPSDQDDVG  370

Query  1218  dgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLS  1394
             D +DELDNT  VP +A+ TIS+ KRQALV YFE+N+AGIT++GFMLDR+ LHTIF I+LS
Sbjct  371   DEEDELDNTQFVPSYAYSTISFQKRQALVNYFENNRAGITIFGFMLDRSSLHTIFGIELS  430

Query  1395  LTLWILNKTIGIS  1433
             L LW+L KTIGIS
Sbjct  431   LVLWLLGKTIGIS  443



>ref|XP_009135679.1| PREDICTED: uncharacterized protein LOC103859848 isoform X2 [Brassica 
rapa]
Length=446

 Score =   396 bits (1017),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 224/417 (54%), Positives = 306/417 (73%), Gaps = 4/417 (1%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+A+ E++     L W+ +DQS+ W A LSWS+F + T+ VP  S+ V +C  CDS H 
Sbjct  30    VSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATSHFVIACADCDSHHS  89

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS FA++SF+ LS F  +YG+R+FLF D+L  E++ V+QGYT Q++ SLK
Sbjct  90    RPYDSVVQLSLSSFASLSFLCLSRFVSKYGLRRFLFFDKLWHESETVRQGYTNQLNRSLK  149

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             IL+ FV P FLA  AYKIWW+ +G  +IP+  N++LS+ V C++ + SWLYR  + FLVC
Sbjct  150   ILSYFVTPCFLATSAYKIWWYASGASRIPFLGNVLLSDTVACLMEICSWLYRTTVIFLVC  209

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRLICHLQILRL  FAQVF+ +S+V  IL EHLRIRR LR+ISHR+R+FILS+LI+VT
Sbjct  210   VLFRLICHLQILRLQDFAQVFQTDSDVGTILSEHLRIRRRLRIISHRYRIFILSSLILVT  269

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ +  +I+   EL LCS+ +VT L I LRSA+KITHKAQ+V  LAAKW
Sbjct  270   GSQFYSLLITTKAHAELNIYKTGELALCSVTLVTALLILLRSASKITHKAQAVTCLAAKW  329

Query  1089  HACATLSSFD--EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             H CAT+ SF+  E G    VDR       +      D ++ ++ GD +D+ DN N++P +
Sbjct  330   HVCATIESFEAVEGGSPRLVDRESGHGFSSKDVDTGDTDDSEDYGDEEDDFDNNNLIPAY  389

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             A+ TIS+ KRQALV YFE+NKAGITV+GF LDR+ LHTIF I++SL LW+L  ++ +
Sbjct  390   AYSTISFQKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLEFSVRV  446



>ref|XP_010448914.1| PREDICTED: uncharacterized protein LOC104731284 [Camelina sativa]
Length=444

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 302/398 (76%), Gaps = 6/398 (2%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN   A LSWSLFF+L + VP++S+ +  C  CD  H+RP++A+VQLSLS+FA I
Sbjct  46    LWFDQSNCGTALLSWSLFFLLVVIVPMISHFLLVCSDCDFHHRRPYDAVVQLSLSIFAGI  105

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++R++G+R+FLFLD+L + +DKV+  +  +I  SLK L  FVLP+   +  Y+
Sbjct  106   SFVSLSIWSRKFGMRRFLFLDKLWDVSDKVRIEHEAEIQRSLKRLMIFVLPSLTLEAVYR  165

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+++G  QIPY  N +LS+VV C L LSSWLYR  I  +VC+L+++ CHLQ LRL+ F
Sbjct  166   IWWYISGFNQIPYIINPVLSHVVACTLQLSSWLYRNTIFIVVCILYQITCHLQTLRLEDF  225

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++V + L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +   
Sbjct  226   ARCFASEIADVRSALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASIA  285

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDET  1136
              +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    ET
Sbjct  286   VNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGET  345

Query  1137  PVDRTGTGTPQAIHP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             P   TG+     I P  ++A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  346   P---TGSMIESQISPCGINAMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  402

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             E+NKAGITVYGF++DR+WLHTIF I+L+L LW+LNKTI
Sbjct  403   ENNKAGITVYGFLVDRSWLHTIFGIELALLLWLLNKTI  440



>ref|XP_004244094.1| PREDICTED: uncharacterized protein LOC101266537 [Solanum lycopersicum]
Length=441

 Score =   395 bits (1016),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 294/410 (72%), Gaps = 6/410 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +DQS+     LSW +F I  I VP +S+ + +C  CD+ H RP++ +
Sbjct  32    ELRVFRRWLKWMCVDQSDTLSTVLSWFVFIIFVIVVPCLSHFLLACADCDANHDRPYDNV  91

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SFI L+ F +++G+R+FLFLD+LC+E++ V++ Y  +++ SLKIL  FV
Sbjct  92    VQLSLSGVAALSFICLTGFVKKFGLRRFLFLDKLCDESETVRKCYMEELNRSLKILFIFV  151

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F A+  YKIWW+ +GG QIP+  N+I+S+VV C+L LSSWLYR  + FLVCVLFRLI
Sbjct  152   LPCFAAESIYKIWWYSSGGTQIPFLGNVIVSDVVACLLELSSWLYRTTVFFLVCVLFRLI  211

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILRL  FAQ+F  +S+V  +L EHLRIRR+LR+ISHR+R+FIL  LI VTASQF S
Sbjct  212   CYLQILRLRDFAQIFHIDSDVETVLREHLRIRRHLRIISHRYRIFILLALIFVTASQFAS  271

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT S +  HI+ + EL LCS+ ++ GL I LRSA +ITHKAQ+V  LAAKWH CAT+
Sbjct  272   LLMTTRSTADLHIYKSGELALCSLSLLAGLLILLRSAVRITHKAQAVTCLAAKWHVCATI  331

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH---TIS  1277
              SF+    ETP       T   + PV     + D +  GD+E +  N   VH++   TIS
Sbjct  332   DSFEAVEGETPP--ISQITSNQVFPV-TSEGSSDADDVGDEEDELDNTKFVHSYAYSTIS  388

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             + KRQALVTYFEHN+AGIT+YGFMLDR++LHTIF ++L+L LW+L KTI 
Sbjct  389   FQKRQALVTYFEHNRAGITLYGFMLDRSYLHTIFGMELALVLWLLGKTIA  438



>ref|XP_006346194.1| PREDICTED: uncharacterized protein LOC102602141 [Solanum tuberosum]
Length=443

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 214/400 (54%), Positives = 290/400 (73%), Gaps = 2/400 (1%)
 Frame = +3

Query  231   LAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVF  410
             L W+ +DQS+     LSW +F I  I VP +S+ + +C  CD+ H RP++ +VQLSLS  
Sbjct  42    LKWMCVDQSDTLSTVLSWFVFIIFAIVVPCLSHFLLACADCDANHDRPYDNVVQLSLSGV  101

Query  411   ATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADC  590
             A +SFI L+ F +++G+R+FLFLD+LC+E++ V++ Y  +++ SLKIL  FVLP F A+ 
Sbjct  102   AALSFICLTRFMKKFGLRRFLFLDKLCDESETVRKCYMEELNRSLKILFIFVLPCFAAES  161

Query  591   AYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRL  770
              YKIWW+ +GG QIP+  N+I+S++V C+L LSSWLYR  + FLVCVLFRLIC+LQILRL
Sbjct  162   IYKIWWYSSGGTQIPFLGNVIVSDIVACLLELSSWLYRTTVFFLVCVLFRLICYLQILRL  221

Query  771   DGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESK  950
               F+Q+F  +S+V  +L EHLRIRR+LR+ISHR+R FIL  L+ VTASQF SLL+TT S 
Sbjct  222   RDFSQIFHIDSDVETVLREHLRIRRHLRIISHRYRRFILLGLVFVTASQFASLLMTTRST  281

Query  951   SHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD  1130
             +  HI+ + EL LCS+ ++ GL I LR A +ITHKAQ+V  LAAKWH CAT+ SF+    
Sbjct  282   ADLHIYKSGELALCSLSLLAGLLILLRGAVRITHKAQAVTCLAAKWHVCATVDSFEAVEG  341

Query  1131  ETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTY  1307
             ETP   +   + Q          + D+ GD +DE DNT  V  +A+ TIS+ KRQALVTY
Sbjct  342   ETP-PISQIASNQVFPVTSEGSSDADDVGDEEDEFDNTKFVHSYAYSTISFQKRQALVTY  400

Query  1308  FEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             FEHN+AGIT+YGFMLDR++LHTIF ++L+L LW+L KT+ 
Sbjct  401   FEHNRAGITLYGFMLDRSYLHTIFGMELALVLWLLGKTVA  440



>gb|KHG15892.1| hypothetical protein F383_23792 [Gossypium arboreum]
Length=436

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 217/415 (52%), Positives = 303/415 (73%), Gaps = 3/415 (1%)
 Frame = +3

Query  189   EISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKH  365
              IS+A+ E++   + L W+ +DQSN+W   LSW LF  L + VP VS+   +C  CD+KH
Sbjct  19    SISHAKDELQSFRTYLKWMCVDQSNIWTTCLSWFLFIFLGLVVPSVSHFWLACSTCDAKH  78

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSL  545
              RP++++VQLSLS  + +SF+ L+ F + YG+++FLF D+L  E++ V++GYT Q++ SL
Sbjct  79    ARPYDSVVQLSLSSVSALSFVCLTRFVKTYGLKRFLFFDKLYVESEAVRKGYTGQLNRSL  138

Query  546   KILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLV  725
             KI+A FVLP F+A+ AYK+WW+ +G  QIP+   + LS+ V CI  L SWLYR  + FLV
Sbjct  139   KIVAVFVLPCFIAETAYKVWWYASGASQIPFLGIVWLSDTVACITELFSWLYRTTVFFLV  198

Query  726   CVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             CVLF LIC+LQ+LRL  FAQVF+ +S+V ++L EHLRIRR+LR+ISHR+R FI+  LI++
Sbjct  199   CVLFHLICNLQVLRLRDFAQVFQIDSDVGSVLSEHLRIRRHLRIISHRYRAFIICCLILI  258

Query  906   TASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAK  1085
             T SQF SLL+TT++ S  + + A EL LCS+ ++TGL I LRSA KITHKAQ++  LAAK
Sbjct  259   TGSQFTSLLITTKATSALNFYKAGELALCSITLLTGLCILLRSATKITHKAQAITCLAAK  318

Query  1086  WHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTN-MVPVH  1262
             WHACATL S +   D+ P   +   + Q    V  D E+DD +  GD++  + N M+P +
Sbjct  319   WHACATLDSLNANEDDMPRSPSVIQSHQPFPHVGTDGESDDGDDLGDEDDIDNNKMIPSY  378

Query  1263  AH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             A+ T+S+ KRQALVTYFE+N+AGIT+YGF+LDR+ LHTIF ++LSL LW+L KTI
Sbjct  379   AYSTLSFQKRQALVTYFENNRAGITIYGFVLDRSTLHTIFGLELSLVLWLLGKTI  433



>ref|XP_009418874.1| PREDICTED: uncharacterized protein LOC103998968 [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   391 bits (1004),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 202/415 (49%), Positives = 275/415 (66%), Gaps = 23/415 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++ L + L W+ LDQS+  RA +SWS+F +L + VP +S+   S     S  +RP++ +
Sbjct  32    ELRGLRTFLRWMCLDQSDRCRAAVSWSVFLLLAVAVPALSHFALSY----SPERRPYDLV  87

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
              Q+SL+  A +SF +LS   RRYG+R+FLFL++L  E+ +V+  Y  Q+  S ++LA FV
Sbjct  88    AQVSLTSAAALSFFTLSELTRRYGLRRFLFLNKLPAESGRVRLAYAAQLRRSSRLLACFV  147

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F A+ AYK+ W+  G G++P+  N  +S  V C L L+SW+YR A  FLVCVLFRLI
Sbjct  148   APCFAAEFAYKLSWYAVGAGRVPFVGNQTVSGCVACALELASWIYRTANFFLVCVLFRLI  207

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHL ILRL  FA VF++ES+V  +L EHLR+RR L+VISHRFR FIL  +I+VTASQF +
Sbjct  208   CHLHILRLQDFAAVFQEESDVEVVLKEHLRVRRQLKVISHRFRSFILLGMILVTASQFAA  267

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
              LVT    S  ++F   EL LCS+++VTGLF+CLRSAAKITHKAQ++ S A KWH CAT+
Sbjct  268   TLVTLRPHSDDNLFNTGELALCSVVLVTGLFVCLRSAAKITHKAQALTSHATKWHVCATI  327

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldn------TNMVPVHAH  1268
              SF             T  P+  H V         +   ++E         TN++  H  
Sbjct  328   DSF-------------TVEPETSHEVAFAVGEGAADSSYEEESSEEDDLEGTNVLRPHVR  374

Query  1269  TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             TI++ KRQALVTY E+N+AGIT++GF LDR WLHTIF++++ L LW+L KTIGIS
Sbjct  375   TITFQKRQALVTYLENNRAGITIFGFTLDRAWLHTIFMLEVVLFLWLLGKTIGIS  429



>ref|XP_006396725.1| hypothetical protein EUTSA_v10028658mg [Eutrema salsugineum]
 gb|ESQ38178.1| hypothetical protein EUTSA_v10028658mg [Eutrema salsugineum]
Length=443

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 203/400 (51%), Positives = 287/400 (72%), Gaps = 5/400 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN  +  LSWS+FF+L + VP++S+ V +C  CD +H RP++A+VQLSLS+FA I
Sbjct  40    LWFDQSNRVKTILSWSVFFLLAVIVPMISHFVLTCAECDFQHHRPYDALVQLSLSIFAGI  99

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+RK LFLD+L + ++KV+ GY  +I  S+K+LA FVLP+      Y+
Sbjct  100   SFVSLSDWSKKYGIRKLLFLDKLKDVSEKVRIGYESEIQRSMKLLAIFVLPSLTLQAIYR  159

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY +N ILS+V+ C L LSSWLYR ++  + C+++++ICHLQILRLD F
Sbjct  160   IWWYASGSNQIPYIFNPILSHVLACTLQLSSWLYRTSLFIIACIVYQIICHLQILRLDDF  219

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A  F  E ++ ++ L EHL+IRR L+++SHRFR FIL +L  VTA+QF++LL T  +   
Sbjct  220   ALCFASEITDFTSTLAEHLKIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVP  279

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFD--EFGD  1130
              HI+ A EL LCS+ +V+GLFICL+SA ++THKA SV S+A KW+ CATL +FD  +   
Sbjct  280   FHIYEAGELALCSISLVSGLFICLKSATQMTHKAHSVTSIATKWNVCATLDTFDGLDHDG  339

Query  1131  ETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV--PVHAHTISYHKRQALVT  1304
             ETP   T     Q +       ++ D++ +G+ + D  N    P+HA  IS+ KRQALVT
Sbjct  340   ETPRFPTSRQHFQILSRRRNVVQSSDDDEEGEGDSDLDNTTIHPIHARAISFQKRQALVT  399

Query  1305  YFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             Y E+NKAGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  400   YLENNKAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  439



>gb|AAG51199.1|AC079279_20 unknown protein [Arabidopsis thaliana]
Length=443

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 221/418 (53%), Positives = 294/418 (70%), Gaps = 19/418 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  36    ELHSFRKYLRWMCVDHSSPWTAILSWTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++           +SL I++ FV
Sbjct  96    VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESET----------TSLHIVSYFV  145

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG +IP+  N +LS+ V CI+ L SWLYR  + FLVCVLFRLI
Sbjct  146   IPCFSAMSAYKIWWYASGGSRIPFLGNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLI  205

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  206   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  265

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  266   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  325

Query  1107  SSFDEFGD------ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              SFD+  +      ETP  V R           V     + DE GD +D+LDN +++PV+
Sbjct  326   ESFDQTVESFDQTVETPTLVARNNNDNNNVHDVVTLTESDSDEYGDEEDDLDNNDIIPVY  385

Query  1263  A-HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             A  T+S+ KRQALV+YFE+N AGITVYGF LDR  LHTIF ++LSL LW+L KTIGIS
Sbjct  386   AFSTMSFQKRQALVSYFENNSAGITVYGFTLDRGTLHTIFGLELSLVLWLLGKTIGIS  443



>ref|XP_006829511.1| hypothetical protein AMTR_s00074p00134940 [Amborella trichopoda]
 gb|ERM96927.1| hypothetical protein AMTR_s00074p00134940 [Amborella trichopoda]
Length=426

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/390 (51%), Positives = 270/390 (69%), Gaps = 3/390 (1%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K     + WL +DQSN WR  +SW +F ++ + +P  S  + SC  C+  H+R  +  
Sbjct  36    ELKSFRRCVGWLCVDQSNPWRTFVSWCVFLLMVVVIPTASPFILSCSHCEPSHRRTHDTA  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A  SF+SLS F R+YG+R+FLFLD LC +++KV+  YT Q++SS K+L+ FV
Sbjct  96    VQLSLSAVAAASFLSLSKFLRKYGLRRFLFLDNLCFDSEKVRLSYTTQLNSSFKLLSCFV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP F+A+  YKIWW+  G  ++P+  N+ + + + CI+ L+SW+YR++I F+VCVL RLI
Sbjct  156   LPCFVAEAVYKIWWYAYGLAKVPFIGNVYVGDGIACIVELASWMYRMSIFFMVCVLLRLI  215

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  F +VF+ ES+V  IL EHLR+R+ LRVISHRFR FIL +L++VTASQF S
Sbjct  216   CHLQILRLQDFGKVFQGESDVGEILREHLRVRKQLRVISHRFRAFILLSLLLVTASQFAS  275

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT+S S   IF   +L +CS++++TGL +CL SAAKITHKAQS+ SLAAKWH CAT 
Sbjct  276   LLITTKSHSTLTIFRDGDLAICSVVLMTGLLMCLHSAAKITHKAQSIVSLAAKWHICATC  335

Query  1107  SSFDEFGDET--PVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISY  1280
              S +    ET     R    TP   H       +DD++ D  DE D+  ++  +A T S+
Sbjct  336   DSLESMESETTPTAQRIFPATPNGEHTFSLLDNDDDDDIDDSDENDDL-VLTAYAQTASF  394

Query  1281  HKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
              +R+ALV YFEHN+AGI+V+GFMLDR  L 
Sbjct  395   QRREALVKYFEHNRAGISVFGFMLDRASLQ  424



>dbj|BAC41857.1| unknown protein [Arabidopsis thaliana]
Length=437

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 206/438 (47%), Positives = 297/438 (68%), Gaps = 7/438 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+    +I+   ++   I       +      RL     +L+ DQSN  +  LSWS+FF
Sbjct  1     MEESSNQQILNSETRPDPIQKPPESPATKLSFPRL-----FLWFDQSNRIKTLLSWSIFF  55

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA ISF+SLS ++++YG+R+FLF
Sbjct  56    LLAVIVPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGISFVSLSDWSKKYGIRRFLF  115

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L + +DKV+ GY ++I  S+K+LA FVLP+      Y+IWW+ +G  QIPY  N  L
Sbjct  116   FDKLKDVSDKVRIGYEVKIQRSMKLLAIFVLPSTTLQAIYRIWWYASGFNQIPYIINPTL  175

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSAILIEHL  833
             S+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD FA+ F  E  + S+IL EHL
Sbjct  176   SHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEFARCFASEIKDFSSILAEHL  235

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRR L+++SHRFR FIL +L  VTA+QF++LL T  +    +I+   EL LCS  +V+G
Sbjct  236   KIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVPFNIYEVGELALCSTSLVSG  295

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETPVDRTGTGTPQAIHPVda  1190
             LFICL+SA ++THKAQSV S+A KW+ CA+L +FD   D ETP   T T   Q +     
Sbjct  296   LFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDVLYDGETPKCPTTTQHSQILSRRRN  355

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               ++ D++ +G+ + ++  + P+ A  IS  KRQALVTY E+N+AGITVYGF++D+TWL 
Sbjct  356   VVQSSDDDEEGEGDDNDLEIHPIFARAISSQKRQALVTYLENNRAGITVYGFLVDKTWLR  415

Query  1371  TIFVIQLSLTLWILNKTI  1424
              IF I+L+L LW+L KTI
Sbjct  416   MIFSIELALLLWLLKKTI  433



>ref|XP_010928244.1| PREDICTED: uncharacterized protein LOC105050081 [Elaeis guineensis]
Length=476

 Score =   388 bits (996),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 212/419 (51%), Positives = 296/419 (71%), Gaps = 20/419 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+K   S L WL +DQS+  RA LSWSLFF+L + VP  S+ +       S  +RP++  
Sbjct  68    ELKSFRSCLRWLCVDQSDGPRAVLSWSLFFLLGLFVPAASHFLL----IYSPARRPYDLA  123

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+  +++S++ LS F RRYG+R+FLFLD+L  E+++V+  YT+Q+  S ++LA F+
Sbjct  124   VQLSLTAVSSLSYLCLSAFHRRYGLRRFLFLDKLVGESERVRLDYTIQLSRSFRLLAFFI  183

Query  567   LPTFLADCAYKIWWFVTGGGQIPYF-------YNMILSNVVICILLLSSWLYRIAISFLV  725
             +P+F  D AYKIWW+ TG G++P +       +    S    C L L+SW+YR+AI FLV
Sbjct  184   MPSFGGDVAYKIWWYATGAGRVPDYLILFGGRWGAWASEAAACGLELASWIYRMAIFFLV  243

Query  726   CVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             CVLFRLIC+LQILRL  FA VF++ES+V+A+L  HLRIRR LR+ISHR+R FI+S L++V
Sbjct  244   CVLFRLICYLQILRLQDFAAVFQEESDVAAVLRAHLRIRRQLRIISHRYRAFIVSCLVLV  303

Query  906   TASQFVSLLVTTESKSHA--HIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLA  1079
             TAS FVSLL+TT  + HA  +I    EL LCS+ ++TGL ICLRSAAKITHKAQ++ S A
Sbjct  304   TASNFVSLLLTT-GRHHASTNIANTGELALCSIGLMTGLLICLRSAAKITHKAQAITSHA  362

Query  1080  AKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgdd-eldnTNMVP  1256
             A WH  AT+ SF    ++  ++     T  +++P+     + DEE  GD+  LD+T ++P
Sbjct  363   ATWHVSATIESFSADTEDLVLE-----TSASVYPLSNSGGDSDEEETGDELGLDDTKLMP  417

Query  1257  VHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              + +TIS+ KRQALVTY E+N+AGITV+GF++DR+ L  +F+I+ SL LW+L KTIGIS
Sbjct  418   SNVNTISFQKRQALVTYLENNRAGITVFGFVVDRSSLQGLFMIEFSLVLWLLGKTIGIS  476



>ref|XP_010433103.1| PREDICTED: uncharacterized protein LOC104717254 [Camelina sativa]
Length=445

 Score =   386 bits (991),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 285/397 (72%), Gaps = 2/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN  +  LSWS+FF+L + VP++S+ +  C  CD KH+RP++ +VQLSLS+FA I
Sbjct  45    LWFDQSNRVKTLLSWSIFFLLAVIVPMISHFLLRCADCDFKHRRPYDGLVQLSLSIFAGI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+R+FLF D+L + NDKV+ GY  +I  S+K+LA FVLP+      Y+
Sbjct  105   SFVSLSDWSKKYGIRRFLFFDKLKDVNDKVRIGYEAEIQRSMKLLAIFVLPSVTLQAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY  N +LS+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD F
Sbjct  165   IWWYASGFNQIPYIINPMLSHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++ S+IL EHL+IRR L+V+SHRFR FI+ +L  VTA+QF++LL T  +   
Sbjct  225   ARCFASEITDFSSILAEHLKIRRELKVVSHRFRRFIVLSLFFVTATQFMALLTTIRASIP  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+ +V+GLFICL+SA ++THKAQSV S+A KW+ CA+L SFD   D E
Sbjct  285   FNIYEVGELALCSISLVSGLFICLKSATQMTHKAQSVTSIATKWNVCASLDSFDVLDDGE  344

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             TP   T     Q +       ++ D++ +G+ + D+  + P++A  +   KRQALVTY E
Sbjct  345   TPKCPTTVQHSQILSRRRNVIQSSDDDEEGEGDHDDIEIHPIYASAVCAQKRQALVTYLE  404

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +N+AGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  405   NNRAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  441



>ref|NP_192291.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ACE79742.1| At4g03820 [Arabidopsis thaliana]
 gb|AEE82352.1| uncharacterized protein AT4G03820 [Arabidopsis thaliana]
Length=437

 Score =   385 bits (989),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 206/438 (47%), Positives = 296/438 (68%), Gaps = 7/438 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+    +I+   ++   I       +      RL     +L+ DQSN  +  LSWS+FF
Sbjct  1     MEESSNQQILNSETRPDPIQKPPESPATKLSFPRL-----FLWFDQSNRIKTLLSWSIFF  55

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA ISF+SLS ++++YG+R+FLF
Sbjct  56    LLAVIVPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGISFVSLSDWSKKYGIRRFLF  115

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L + +DKV+ GY  +I  S+K+LA FVLP+      Y+IWW+ +G  QIPY  N  L
Sbjct  116   FDKLKDVSDKVRIGYEAKIQRSMKLLAIFVLPSTTLQAIYRIWWYASGFNQIPYIINPTL  175

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSAILIEHL  833
             S+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD FA+ F  E  + S+IL EHL
Sbjct  176   SHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEFARCFASEIKDFSSILAEHL  235

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRR L+++SHRFR FIL +L  VTA+QF++LL T  +    +I+   EL LCS  +V+G
Sbjct  236   KIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVPFNIYEVGELALCSTSLVSG  295

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETPVDRTGTGTPQAIHPVda  1190
             LFICL+SA ++THKAQSV S+A KW+ CA+L +FD   D ETP   T T   Q +     
Sbjct  296   LFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDVLYDGETPKCPTTTQHSQILSRRRN  355

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               ++ D++ +G+ + ++  + P+ A  IS  KRQALVTY E+N+AGITVYGF++D+TWL 
Sbjct  356   VVQSSDDDEEGEGDDNDLEIHPIFARAISSQKRQALVTYLENNRAGITVYGFLVDKTWLR  415

Query  1371  TIFVIQLSLTLWILNKTI  1424
              IF I+L+L LW+L KTI
Sbjct  416   MIFSIELALLLWLLKKTI  433



>ref|NP_974507.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE82353.1| uncharacterized protein AT4G03820 [Arabidopsis thaliana]
Length=453

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 296/439 (67%), Gaps = 7/439 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+    +I+   ++   I       +      RL     +L+ DQSN  +  LSWS+FF
Sbjct  1     MEESSNQQILNSETRPDPIQKPPESPATKLSFPRL-----FLWFDQSNRIKTLLSWSIFF  55

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA ISF+SLS ++++YG+R+FLF
Sbjct  56    LLAVIVPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGISFVSLSDWSKKYGIRRFLF  115

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L + +DKV+ GY  +I  S+K+LA FVLP+      Y+IWW+ +G  QIPY  N  L
Sbjct  116   FDKLKDVSDKVRIGYEAKIQRSMKLLAIFVLPSTTLQAIYRIWWYASGFNQIPYIINPTL  175

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSAILIEHL  833
             S+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD FA+ F  E  + S+IL EHL
Sbjct  176   SHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEFARCFASEIKDFSSILAEHL  235

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRR L+++SHRFR FIL +L  VTA+QF++LL T  +    +I+   EL LCS  +V+G
Sbjct  236   KIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVPFNIYEVGELALCSTSLVSG  295

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETPVDRTGTGTPQAIHPVda  1190
             LFICL+SA ++THKAQSV S+A KW+ CA+L +FD   D ETP   T T   Q +     
Sbjct  296   LFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDVLYDGETPKCPTTTQHSQILSRRRN  355

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
               ++ D++ +G+ + ++  + P+ A  IS  KRQALVTY E+N+AGITVYGF++D+TWL 
Sbjct  356   VVQSSDDDEEGEGDDNDLEIHPIFARAISSQKRQALVTYLENNRAGITVYGFLVDKTWLR  415

Query  1371  TIFVIQLSLTLWILNKTIG  1427
              IF I+L+L LW+L KTI 
Sbjct  416   MIFSIELALLLWLLKKTIS  434



>ref|XP_008788884.1| PREDICTED: uncharacterized protein LOC103706529 [Phoenix dactylifera]
Length=440

 Score =   384 bits (985),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 221/438 (50%), Positives = 302/438 (69%), Gaps = 22/438 (5%)
 Frame = +3

Query  156   SKTALISSSYHE-ISNA-REVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSY  329
             ++  L+ +SY   +S+A  E+K   S L WL +DQS+  RA +SW LF  L + VP  S+
Sbjct  13    ARQPLLRASYTRCLSHAGDELKSFRSCLRWLCVDQSDTPRAVVSWFLFLFLGLFVPAASH  72

Query  330   LVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKV  509
             L+       S  +RP+N  VQLSL+  +++S++ LS F RRYG+R+FLFLD+L  E+++V
Sbjct  73    LLL----IYSPARRPYNLAVQLSLTAVSSLSYLCLSAFHRRYGLRRFLFLDKLVGESERV  128

Query  510   QQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI-------LSNVV  668
             + GYT+Q+  S ++LA FV+P F  D AYKIWW+ TG G++P +  +         S+  
Sbjct  129   RLGYTIQLSRSFRLLAFFVMPCFGGDVAYKIWWYATGAGRVPDYLILFGGRGISWASDAA  188

Query  669   ICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRN  848
              C L L+SW+YR+AI FLVCVLFRLIC+LQILRL  FA VF +ES+V+ +L EHLRIRR 
Sbjct  189   ACGLELASWMYRMAIFFLVCVLFRLICYLQILRLQDFAAVFREESDVATVLREHLRIRRQ  248

Query  849   LRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHA--HIFAAAELGLCSMIMVTGLFI  1022
             LR+ISHR+R FI+S L++VTAS F SLL+TT  + HA  +I  A EL LCS+ ++TGL I
Sbjct  249   LRIISHRYRAFIVSCLLLVTASNFASLLLTT-GRHHAEVNIVNAGELALCSVGLMTGLLI  307

Query  1023  CLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwen  1202
             CLRSAAKITHKAQ++ S AA WH  AT+ S      E P+  T      A+HP      +
Sbjct  308   CLRSAAKITHKAQAITSHAATWHVFATIES-SSADTEDPLSHTSA----AVHPSSNSGGD  362

Query  1203  ddeegdgdd-eldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIF  1379
              D+E   D+ ELD+T ++P H +TIS+ KRQALVTY E+N+AGITV+GF++DR+ L  +F
Sbjct  363   SDDEEARDELELDDTKLMPSHVNTISFQKRQALVTYLENNRAGITVFGFVVDRSSLQGLF  422

Query  1380  VIQLSLTLWILNKTIGIS  1433
             +I+ SL LW+L KTIGIS
Sbjct  423   MIEFSLVLWLLGKTIGIS  440



>ref|XP_006287704.1| hypothetical protein CARUB_v10000912mg, partial [Capsella rubella]
 gb|EOA20602.1| hypothetical protein CARUB_v10000912mg, partial [Capsella rubella]
Length=461

 Score =   384 bits (985),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 284/397 (72%), Gaps = 2/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN  +  LSWS FF+L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA I
Sbjct  61    LWFDQSNRVKTLLSWSTFFLLAVIVPMISHFVLLCSDCDFKHRRPYDGLVQLSLSIFAGI  120

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+R+FLF D+L + +DKV+ GY  +I  S+K+LA FVLP+      Y+
Sbjct  121   SFVSLSDWSKKYGIRRFLFFDKLKDVSDKVKIGYESEIQRSMKLLAMFVLPSLTLQAIYR  180

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY  N +LS+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD F
Sbjct  181   IWWYASGFNQIPYIINPMLSHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEF  240

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E S+ S++L EHL+IRR L+++SHRFR FI+ +L  VTA+QF++LL T  +   
Sbjct  241   ARCFASEISDFSSVLAEHLKIRRELKIVSHRFRRFIVLSLFFVTATQFMALLTTIRASVP  300

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+ +V+GLFICLRSA ++THKAQSV S+A KW+ CA L +FD   D E
Sbjct  301   FNIYEVGELALCSISLVSGLFICLRSATQMTHKAQSVTSIATKWNVCAALETFDVLYDGE  360

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             TP   T     Q +       ++ D++ +G+ + D+ ++ P++A  I   KRQALVTY E
Sbjct  361   TPKCPTSIQHSQILSRRRNVIQSSDDDEEGEGDHDDLHIHPIYARAICSQKRQALVTYLE  420

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +N+AGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  421   NNRAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  457



>ref|XP_010455721.1| PREDICTED: uncharacterized protein LOC104737284 [Camelina sativa]
 ref|XP_010455722.1| PREDICTED: uncharacterized protein LOC104737284 [Camelina sativa]
 ref|XP_010455723.1| PREDICTED: uncharacterized protein LOC104737284 [Camelina sativa]
Length=445

 Score =   383 bits (984),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/397 (50%), Positives = 284/397 (72%), Gaps = 2/397 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN  +  LSWS+FF+L + VP++S+ V  C  CD KH+RP++ +VQL LS+FA I
Sbjct  45    LWFDQSNRVKTLLSWSIFFLLAVIVPMISHFVLRCADCDFKHRRPYDGLVQLLLSIFAVI  104

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+R+FLF D+L + NDKV+ GY  +I  S+K+LA F+LP+      Y+
Sbjct  105   SFVSLSDWSKKYGIRRFLFFDKLKDVNDKVRIGYEAEIQRSMKLLAIFILPSVTLQAIYR  164

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY  N +LS+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD F
Sbjct  165   IWWYASGFNQIPYIINPMLSHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEF  224

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++ S+IL EHL+IRR L+V+SHRFR FI+ +L  VTA+QF++LL T  +   
Sbjct  225   ARCFASEITDFSSILAEHLKIRRELKVVSHRFRRFIVLSLFFVTATQFMALLTTIRASVP  284

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+ +V+GLFICL+SA ++THKAQSV S+A KW+ CA+L +FD   D E
Sbjct  285   FNIYEVGELALCSISLVSGLFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDVLDDGE  344

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             TP   T     Q +       ++ D++ +G+ + D+  + P++A  +   KRQALVTY E
Sbjct  345   TPKCPTTIQHSQILSRRRNVIQSSDDDEEGEGDHDDIEIHPIYASAVCAQKRQALVTYLE  404

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +N+AGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  405   NNRAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  441



>ref|XP_009398681.1| PREDICTED: uncharacterized protein LOC103983209 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009398682.1| PREDICTED: uncharacterized protein LOC103983209 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=425

 Score =   382 bits (982),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 284/410 (69%), Gaps = 8/410 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++ L S L W+  DQS+   A +SW  FF+L + +P VS+ V S        +RP++ +
Sbjct  23    ELRGLRSCLRWMCHDQSDAGLAVVSWVAFFVLAVAIPAVSHFVLSY----RPDRRPYDLV  78

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF++LS   RRYG+R+FL LD+L  ++ +V+  YT Q+  S ++LA FV
Sbjct  79    VQLSLSAAAALSFLTLSSATRRYGLRRFLLLDKLPSQSPRVRLAYTAQLRRSFRLLALFV  138

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A+ AYK WW+     +IP+  N + +  V C L L+SW+YR A  F+VCV+FR I
Sbjct  139   TPCFVAEVAYKSWWYAFSADRIPFLGNPVATGCVACALELASWIYRTASFFVVCVMFRSI  198

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA VF++ESEV  +L EHLR+RR LRVISHRFR FIL  LI+VTASQF +
Sbjct  199   CHLQILRLQEFAAVFQEESEVMVVLKEHLRVRRQLRVISHRFRGFILLGLIMVTASQFAA  258

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             + VTT   S   +F   EL +CS  +VTGL ICLR AAKITHKAQ++ S AAKWH CAT+
Sbjct  259   VFVTTRPHSDDSLFNTGELAICSFALVTGLLICLRGAAKITHKAQALTSHAAKWHVCATI  318

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVd-adwenddeegdgddeldnTNMVPVHAHTISYH  1283
              +F     ETP +     + +   PV   D ++D+EEG  +DEL+ T +V  HAHTIS+ 
Sbjct  319   ETF-AVDPETPSEAISKASSE--FPVTNGDEDSDEEEGSEEDELEGTKIVQSHAHTISFQ  375

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             KRQALVTY E+N+AGIT++GF +DR+WLHT+F+++ +L LW+L KTIGIS
Sbjct  376   KRQALVTYLENNRAGITIFGFTVDRSWLHTVFMLETTLFLWLLGKTIGIS  425



>gb|KEH36941.1| extracellular ligand-gated ion channel protein [Medicago truncatula]
Length=408

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 281/395 (71%), Gaps = 9/395 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME++ E    L ++K    S  YH   + +E++R  + L W+++DQSNL +AG+SWS+FF
Sbjct  1     MEEEREVSF-LAMNKEN--SGIYH---DGKELRRFRAYLRWVYVDQSNLCKAGISWSVFF  54

Query  297   ILTIGVPLVSYLVFSCDA-CDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFL  473
              L   VP++S+ +  C   CD+ H+RP++  VQ+SLSVFAT+SFISLS + R+YG  KFL
Sbjct  55    TLAYVVPILSHFLLDCSTTCDADHRRPYHVPVQISLSVFATLSFISLSKWDRKYGFSKFL  114

Query  474   FLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMI  653
             FLD++ +E+ K+Q+GY +Q+  ++K++  + LP F+  C YKIWW+++G  QIPY+  + 
Sbjct  115   FLDKVSDESLKIQRGYAIQMKRTMKLILLWGLPCFICQCVYKIWWYISGASQIPYYGEVY  174

Query  654   LSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHL  833
             +S +++C L L SW YR +I FLVCVLFRLI +LQI RLD FA VF++E+EV  IL+EHL
Sbjct  175   VSGIILCTLELCSWFYRTSIFFLVCVLFRLIGYLQIQRLDEFAPVFQRETEVGTILLEHL  234

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIRRNLRVISHRFR FILS+L++VTASQ + LL+  +  +   I    ELGL S+ +V+G
Sbjct  235   RIRRNLRVISHRFRAFILSSLLLVTASQLIFLLMVIKPHADVDILKGGELGLVSITLVSG  294

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdad  1193
             L+I LRSA KITHKAQS+  LA+KWH CAT++SFD    ETP     +   QA+    + 
Sbjct  295   LYILLRSATKITHKAQSLTGLASKWHICATINSFDNIDGETPTALIASA--QAMAADISW  352

Query  1194  wenddeegdgddeldnTNMVPVHAHTISYHKRQAL  1298
               ++DE GD +DEL+NT M+P+   TIS+HKRQAL
Sbjct  353   GSSEDESGDEEDELNNTKMMPIQTRTISFHKRQAL  387



>emb|CDX94537.1| BnaC09g22990D [Brassica napus]
Length=466

 Score =   383 bits (984),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 295/428 (69%), Gaps = 6/428 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+  +  +SWSLFF+L + VP++S+ V  C  CD K  RP++A+VQLSLS+FA I
Sbjct  29    LWFDQSSRLKTLISWSLFFLLAVIVPMISHFVLICSDCDFKLHRPYDALVQLSLSIFAGI  88

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS +++RYG+RKFLFL +L + +DKV+ GY  +I  S+K LA FVLP+      Y+
Sbjct  89    SFVSLSAWSKRYGIRKFLFLHKLKDVSDKVRVGYEAEIQRSMKPLAIFVLPSLALQATYR  148

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             +WW+ +G  QIPYF N  LS+V+ C L LSSWLYR ++  + C++++++CHLQILRLD F
Sbjct  149   VWWYASGSDQIPYFINPTLSHVLACTLQLSSWLYRTSLFIIACLVYQVVCHLQILRLDEF  208

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++ SA L EHL+I R L+++SHRFR F++ +L  VTA+QF++LL T  +   
Sbjct  209   ARCFSSEITDFSATLAEHLKIHRELKIVSHRFRRFLVLSLFFVTATQFMALLTTIRASVP  268

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              HI+   EL LCS+ +V+GLFICL+SA ++THKAQSV S+A KW+ CA+L +FD+    +
Sbjct  269   FHIYEVGELALCSISLVSGLFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDDLDSGD  328

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV--PVHAHTISYHKRQALVTY  1307
             TP   T     Q +        + D++ DG+ + D  N    P++A  IS+ KRQALVTY
Sbjct  329   TPKYPTSRQHFQILSRRRDVTRSSDDDEDGEVDSDLDNTTIHPIYARAISFQKRQALVTY  388

Query  1308  FEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS*FSTQIKIPT--AHF*LI  1481
              E+NKAGITVYGF++D+TWL  IF I+L+L LW+L KTIG     T + + +   H  L+
Sbjct  389   LENNKAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTIGNIHICTNMSVYSLHDHSTLL  448

Query  1482  KDYNLLIS  1505
             K  N+L S
Sbjct  449   KSENILSS  456



>ref|XP_009114591.1| PREDICTED: uncharacterized protein LOC103839855 [Brassica rapa]
Length=431

 Score =   380 bits (977),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 199/399 (50%), Positives = 282/399 (71%), Gaps = 4/399 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+  +  +SWSLFF+L + VP++S+ V  C  CD K  RP++A+VQLSLS+FA I
Sbjct  29    LWFDQSSRLKTLISWSLFFLLAVIVPMISHFVLICSDCDFKLHRPYDALVQLSLSIFAGI  88

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS +++RYG+RKFLFL +L + +DKV+ GY  +I  S+K LA FVLP+      Y+
Sbjct  89    SFVSLSAWSKRYGIRKFLFLHKLKDVSDKVRVGYEAEIQRSMKPLAIFVLPSLALQAIYR  148

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             +WW+ +G  QIPYF N  LS+V+ C L LSSWLYR ++  + C++++++CHLQILRLD F
Sbjct  149   VWWYASGSDQIPYFINPTLSHVLACTLQLSSWLYRTSLFIIACLVYQVVCHLQILRLDEF  208

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++ SA L EHL+I R L+++SHRFR F++ +L  VTA+QF++LL T  +   
Sbjct  209   ARCFSSEITDFSATLAEHLKIHRELKIVSHRFRRFLVLSLFFVTATQFMALLTTIRASVP  268

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              HI+   EL LCS+ +V+GLFICL+SA ++THKAQSV S+A KW+ CA+L +FD+    +
Sbjct  269   FHIYEVGELALCSISLVSGLFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDDLDSGD  328

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV--PVHAHTISYHKRQALVTY  1307
             TP   T     Q +        + D++ DG+ + D  N    P++A  IS+ KRQALVTY
Sbjct  329   TPKYPTSRQHFQILSRRRDVTRSSDDDEDGEVDSDLDNTTIHPIYARAISFQKRQALVTY  388

Query  1308  FEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
              E+NKAGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  389   LENNKAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  427



>emb|CBI41028.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   375 bits (964),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 242/306 (79%), Gaps = 3/306 (1%)
 Frame = +3

Query  516   GYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSW  695
             G  ++   S+K+L+ FVLP F  + AYKIWW++TG  QIPY  N+ LS+ + C L L SW
Sbjct  2     GKIVEPKRSMKLLSLFVLPCFAVEIAYKIWWYITGATQIPYLGNIYLSHAIACTLELCSW  61

Query  696   LYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFR  875
             LYR AI  LVCVLFRLICH+QILRL+ FAQVF+KES+V ++L EHLRIRRNLR+ISHRFR
Sbjct  62    LYRTAIFLLVCVLFRLICHMQILRLEDFAQVFQKESDVGSVLKEHLRIRRNLRIISHRFR  121

Query  876   LFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHK  1055
             +FILS+LI+VTASQ  SLL+TT S +   I+ A EL LCS+ +VTGL ICLRSA KITHK
Sbjct  122   VFILSSLILVTASQLASLLITTRSSAKVTIYKAGELALCSISLVTGLGICLRSATKITHK  181

Query  1056  AQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddel  1235
             AQSV  LAAKWH CAT+ +FD    ETP  R  +     + PV+ +W +DDEEGDGDD L
Sbjct  182   AQSVTCLAAKWHVCATIDTFDATDGETPTIRAASA---QVFPVNTNWGSDDEEGDGDDAL  238

Query  1236  dnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILN  1415
             DNT M+P++AHTIS+HKRQALVTY E+N+AGITV+GFMLDRTWLHTIF +++SL LW+L+
Sbjct  239   DNTKMIPIYAHTISFHKRQALVTYLENNRAGITVFGFMLDRTWLHTIFGVEMSLVLWLLS  298

Query  1416  KTIGIS  1433
             KTIGIS
Sbjct  299   KTIGIS  304



>ref|XP_002874792.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51051.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   380 bits (976),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 290/414 (70%), Gaps = 4/414 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+  +  LSWS+FF+L I VP++S+ V  C  CD KH+RP++ +VQLSLS+FA I
Sbjct  37    LWFDQSSRIKTLLSWSIFFLLAIIVPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGI  96

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+R+FLF D+L +  DKV+ GY  +I  S+K+LA FVLP+      Y+
Sbjct  97    SFVSLSDWSKKYGIRRFLFFDKLKDVTDKVRIGYEAEIQRSMKLLAIFVLPSITLQAIYR  156

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY  N ++S+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD F
Sbjct  157   IWWYASGFNQIPYIINPMVSHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEF  216

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E  + S+IL EHL+IRR L+++SHRFR FIL +L  VTA+QF++LL T  +   
Sbjct  217   ARCFASEIKDFSSILAEHLKIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVP  276

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL L S+ +V+GLFICL+SA ++THKAQ+V S+A KW+ CA+L +FD   D E
Sbjct  277   FNIYEVGELALSSISLVSGLFICLKSATQMTHKAQTVTSIATKWNVCASLDTFDVLDDGE  336

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
             TP   T     Q +       ++ D++ +G+ + ++ ++ P+ A  IS  KRQALVTY E
Sbjct  337   TPKCPTTIQHSQILSRRRNVIQSSDDDEEGEGDHNDLDIHPIFARAISSQKRQALVTYLE  396

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG--IS*FSTQIKIPTAH  1469
             +N+AGITVYGF++D+TWL  IF I+L+L LW+L KTIG  I  +S  I  P  H
Sbjct  397   NNRAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTIGNVICFYSKSIFSPLDH  450



>emb|CDY16688.1| BnaA09g20660D [Brassica napus]
Length=431

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/399 (50%), Positives = 281/399 (70%), Gaps = 4/399 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQS+  +  +SWSLFF+L + VP++S+ V  C  CD K  RP++A+VQLSLS+FA I
Sbjct  29    LWFDQSSRLKTLISWSLFFLLAVIVPMISHFVLICSDCDFKLHRPYDALVQLSLSIFAGI  88

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS + +RYG+RKFLFL +L + +DKV+ GY  +I  S+K LA FVLP+      Y+
Sbjct  89    SFVSLSAWFKRYGIRKFLFLHKLKDVSDKVRVGYEAEIQRSMKPLAIFVLPSLALQAIYR  148

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             +WW+ +G  QIPYF N  LS+V+ C L LSSWLYR ++  + C++++++CHLQILRLD F
Sbjct  149   VWWYASGSDQIPYFINPTLSHVLACTLQLSSWLYRTSLFIIACLVYQVVCHLQILRLDEF  208

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E ++ SA L EHL+I R L+++SHRFR F++ +L  VTA+QF++LL T  +   
Sbjct  209   ARCFSSEITDFSATLAEHLKIHRELKIVSHRFRRFLVLSLFFVTATQFMALLTTIRASVP  268

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              HI+   EL LCS+ +V+GLFICL+SA ++THKAQSV S+A KW+ CA+L +FD+    +
Sbjct  269   FHIYEVGELALCSISLVSGLFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDDLDSGD  328

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV--PVHAHTISYHKRQALVTY  1307
             TP   T     Q +        + D++ DG+ + D  N    P++A  IS+ KRQALVTY
Sbjct  329   TPKYPTSRQHFQILSRRRDVTRSSDDDEDGEVDSDLDNTTIHPIYARAISFQKRQALVTY  388

Query  1308  FEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
              E+NKAGITVYGF++D+TWL  IF I+L+L LW+L KTI
Sbjct  389   LENNKAGITVYGFLVDKTWLRMIFSIELALLLWLLKKTI  427



>ref|XP_009385545.1| PREDICTED: uncharacterized protein LOC103972887 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/414 (47%), Positives = 286/414 (69%), Gaps = 20/414 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++     L W+ +DQS+   A +SWS+F +L++ VP+ S+ VFSC    +  +R ++ +
Sbjct  36    ELRSFRFCLRWMCVDQSDAKHAVVSWSIFLLLSVFVPIASHFVFSC----APTRRAYDVV  91

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL   +++S++ LS F R YG+R+FLFLD+L   +++V++GY  Q++ S ++L+ FV
Sbjct  92    VQLSLISASSLSYLCLSAFVRCYGLRRFLFLDKLVGASERVREGYMDQLNRSFRLLSVFV  151

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFY--NMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
             +P F  +  YKIWW+ +G  ++P+    ++++ +VV C L L+SW+YR+++   VCVLFR
Sbjct  152   MPCFAGEVTYKIWWYSSGSERVPFEVAGSVVVGDVVACALELASWIYRMSLFLFVCVLFR  211

Query  741   LICHLQILRLDGFAQVFEK---ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             L+CHLQILRL  FA VF +   ES+V+++L EHLRIRR LR+ISHR+R FILS L++VTA
Sbjct  212   LMCHLQILRLQDFASVFREGGPESDVASVLGEHLRIRRQLRIISHRYRSFILSCLLLVTA  271

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQ  +LL+TT  ++  ++  A EL LCS+ +VTGL ICLRSAAKITHKAQ++ S AA WH
Sbjct  272   SQLATLLLTTRPRAVVNLNNAGELALCSIGLVTGLLICLRSAAKITHKAQAITSQAATWH  331

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHT  1271
             ACAT+ SFD   + +      +G                ++    D  D   M+P + +T
Sbjct  332   ACATVESFDAEPETSFPPNCSSGDESDD-----------DDDKDGDVWDVRKMMPSNINT  380

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALVTY E+N+AGITV+GF++DR WLH +F+I+ SL +W+L KT+GIS
Sbjct  381   ISFQKRQALVTYLENNRAGITVFGFVVDRAWLHALFMIEFSLVMWLLGKTVGIS  434



>dbj|BAH19618.1| AT1G50630 [Arabidopsis thaliana]
Length=428

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 263/373 (71%), Gaps = 9/373 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  36    ELHSFRKYLRWMCVDHSSPWTAILSWTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  96    VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG +IP+  N +LS+ V CI+ L SWLYR  + FLVCVLFRLI
Sbjct  156   IPCFSAMSAYKIWWYASGGSRIPFLGNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLI  215

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  216   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  275

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  276   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  335

Query  1107  SSFDEFGD------ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              SFD+  +      ETP  V R           V     + DE GD +D+LDN  ++PV+
Sbjct  336   ESFDQTVESFDQTVETPTLVARNNNDNNNVHDVVTLTESDSDEYGDEEDDLDNNGIIPVY  395

Query  1263  A-HTISYHKRQAL  1298
             A  T+S+ KRQAL
Sbjct  396   AFSTMSFQKRQAL  408



>ref|NP_001031167.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32573.1| uncharacterized protein AT1G50630 [Arabidopsis thaliana]
Length=428

 Score =   357 bits (917),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 264/373 (71%), Gaps = 9/373 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+      L W+ +D S+ W A LSW++F + T+ VP +S+ + +C  CDS H RP++++
Sbjct  36    ELHSFRKYLRWMCVDHSSPWTAILSWTMFIVFTLVVPAISHFLLACADCDSYHSRPYDSV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  AT+SF+ L+ F  +YG+R+FLF D+L +E++ V++ YT Q+++SL I++ FV
Sbjct  96    VQLSLSSVATVSFLCLTRFVSKYGLRRFLFFDKLWDESETVRRNYTNQLNTSLHIVSYFV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             +P F A  AYKIWW+ +GG +IP+  N +LS+ V CI+ L SWLYR  + FLVCVLFRLI
Sbjct  156   IPCFSAMSAYKIWWYASGGSRIPFLGNAVLSDTVACIMELCSWLYRTTVIFLVCVLFRLI  215

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA++F+ +S+V +IL EHLRIRR+LR+ISHR+R FIL  LI+VT SQF S
Sbjct  216   CHLQILRLQDFAKLFQIDSDVGSILSEHLRIRRHLRIISHRYRSFILCLLILVTGSQFSS  275

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+TT++ +  +I+ A EL LCSM +VT L I LRSA+KITHKAQ+V  LAAKWH CATL
Sbjct  276   LLITTKAYTEVNIYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATL  335

Query  1107  SSFDEFGD------ETP--VDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVH  1262
              SFD+  +      ETP  V R           V     + DE GD +D+LDN +++PV+
Sbjct  336   ESFDQTVESFDQTVETPTLVARNNNDNNNVHDVVTLTESDSDEYGDEEDDLDNNDIIPVY  395

Query  1263  A-HTISYHKRQAL  1298
             A  T+S+ KRQAL
Sbjct  396   AFSTMSFQKRQAL  408



>ref|XP_009408724.1| PREDICTED: uncharacterized protein LOC103991088 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 275/411 (67%), Gaps = 22/411 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+  L S L W+  DQSN   A +SW   F+L + VP +++ + S       ++RP++ +
Sbjct  20    ELYWLRSCLRWMCQDQSNAVLAVVSWVALFVLAVAVPAMAHFMLS-------YRRPYDLV  72

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSL+V A +SF++LS    RYG+  F FL++L  ++ +V+  Y  Q+ SS ++LA F+
Sbjct  73    VQLSLTVAAALSFLTLSAATHRYGLCHFFFLNKLPGQSARVRLAYAAQLRSSFRLLALFI  132

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P   A+ AYK+WW+     +IP+  N + ++ V C L L+SW YR A  F+VCV+FR I
Sbjct  133   APCCAAEVAYKLWWYSFSAIRIPFLGNRVATSCVACALELASWTYRAASFFVVCVMFRSI  192

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA  F+ ESE  A+L EHLR+RR L+VISHRFR FIL  LI+VTASQF +
Sbjct  193   CHLQILRLQEFAVAFQAESEAVAVLNEHLRLRRQLKVISHRFRGFILWGLILVTASQFAA  252

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             +LV T   S  ++F   EL  CS+++VTG+ ICL SAAKITHKAQ++ S AAKWH CAT+
Sbjct  253   VLVITRPHSDDNLFNIGELAPCSIVLVTGMLICLHSAAKITHKAQALTSHAAKWHGCATV  312

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVda--dwenddeegdgddeldnTNMVPVHAHTISY  1280
              SF        +D      P+A   V    D ++D+EE   +DEL++T +V  H HTIS+
Sbjct  313   ESFS-------ID------PEAASEVITGGDGDSDEEEDSEEDELEDTKIVHPHVHTISF  359

Query  1281  HKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              KRQALVTY E+N AGIT++GF +DR+WL T+F +++SL LW+L KTIGIS
Sbjct  360   QKRQALVTYLENNGAGITIFGFTVDRSWLCTLFTLEISLFLWLLGKTIGIS  410



>emb|CAA16777.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79182.1| hypothetical protein [Arabidopsis thaliana]
Length=387

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 259/340 (76%), Gaps = 5/340 (1%)
 Frame = +3

Query  417   ISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAY  596
             ISF+SLS ++R++G+R+FLFLD+L + +DKV+  Y  +I  SLK L  FVLP+   +  Y
Sbjct  49    ISFVSLSIWSRKFGMRRFLFLDKLWDVSDKVRIEYEAEIQRSLKRLMIFVLPSLTLEATY  108

Query  597   KIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDG  776
             +IWW+++G  QIPY  N ILS+VV C L LSSWLYR ++  +VC+L+++ CHLQ LRLD 
Sbjct  109   RIWWYISGFNQIPYIINPILSHVVACTLQLSSWLYRNSLFIIVCILYKITCHLQTLRLDD  168

Query  777   FAQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKS  953
             FA+ F  E ++V + L EH +IRRNLR++SHRFR FIL +LI+VTA+QF++LL TT +  
Sbjct  169   FARCFASEITDVRSALGEHQKIRRNLRIVSHRFRRFILLSLILVTATQFMALLTTTRASV  228

Query  954   HAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDE  1133
               +I+   EL LCS+ +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    E
Sbjct  229   AVNIYEVGELALCSLSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGE  288

Query  1134  TPVDRTGTGTPQAIH-PVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYF  1310
             TP   TG+     +    +A   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY 
Sbjct  289   TP---TGSIIESQVSLRGNAIETSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYL  345

Query  1311  EHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             E+NKAGITVYGF++DR+WL+TIF I+L+L LW+LNKTIGI
Sbjct  346   ENNKAGITVYGFLVDRSWLNTIFGIELALLLWLLNKTIGI  385



>ref|NP_001136565.1| hypothetical protein [Zea mays]
 gb|ACF82181.1| unknown [Zea mays]
 gb|AFW87362.1| hypothetical protein ZEAMMB73_304323 [Zea mays]
Length=445

 Score =   350 bits (899),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 268/414 (65%), Gaps = 13/414 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +D S   +A LSW LF +L   VP  ++ + +  A     +RPF+A+
Sbjct  40    ELQWFRSCLRWVCMDHSGPGQAALSWLLFLVLAAIVPAAAHFLLAFRAS----RRPFSAV  95

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  +   F+ LS   RR G+R+ L LD+L  ++D+V+  YT ++  S ++LAS V
Sbjct  96    VQLSLSAASAAGFLCLSSSFRRVGLRRLLHLDKLRSKSDRVRASYTARLAFSFRLLASLV  155

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F A+ AYK WW+ T   ++P+F N +LS+V++C L ++SW+YR AI  L CVLFRLI
Sbjct  156   APCFAAEAAYKAWWYATSADRVPFFANDVLSDVLVCSLEMASWMYRSAIYLLTCVLFRLI  215

Query  747   CHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             CHLQ LRL+ FA     +V E  + V A+L EHL IR+ L+VISHRFR FI++ L++ TA
Sbjct  216   CHLQGLRLEDFAGSLLEEVEEGRAGVDAVLREHLDIRKQLKVISHRFRKFIVAALLIATA  275

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF S+L+TT   S   +    EL LCS+++++GL I L SAAKITH+AQ++     KWH
Sbjct  276   SQFASVLLTTRRDSVDDLLNTGELALCSVVLMSGLIIILSSAAKITHQAQALTGHTTKWH  335

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHT  1271
             AC T+    E G+  P     +   Q   P       D EE   +D L+NT +   HAH 
Sbjct  336   ACCTIEPVLEEGE--PGSNQNSMIDQ--EPESDSDTEDSEETGDEDLLENTKIHMPHAHV  391

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG S
Sbjct  392   ISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGFS  445



>ref|XP_002438712.1| hypothetical protein SORBIDRAFT_10g024850 [Sorghum bicolor]
 gb|EER90079.1| hypothetical protein SORBIDRAFT_10g024850 [Sorghum bicolor]
Length=445

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/415 (46%), Positives = 267/415 (64%), Gaps = 14/415 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSN-LWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNA  383
             E++   S L W+ +D S+   +A LSW LF +L I VP  ++ + +  A     +RPF+A
Sbjct  39    ELQWFRSCLRWVCMDHSSGPAQAALSWLLFLVLAIIVPAAAHFLLAFRAS----RRPFSA  94

Query  384   IVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASF  563
             +VQLSLS  +   F+ LS   RR G+R+ L LD+L  ++D+V+  YT ++  S ++LAS 
Sbjct  95    VVQLSLSAASAAGFLCLSSSFRRVGLRRLLHLDKLRGKSDRVRLNYTARLAFSFRLLASL  154

Query  564   VLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRL  743
             V P F A+ AYK WW+ T   ++P+F N +LS+V+ C L ++SW+YR A+  L CVLFRL
Sbjct  155   VAPCFAAEAAYKAWWYATSADRVPFFANDVLSDVLACSLEMASWMYRSAVYLLTCVLFRL  214

Query  744   ICHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             ICHLQ LRL+ FA     +V E  + V  +L EHL IR+ L+VISHRFR FI++ L++ T
Sbjct  215   ICHLQGLRLEDFAGSLLEEVEEGRAGVETVLREHLDIRKQLKVISHRFRKFIVAALLIAT  274

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             ASQF S+L+TT   S   +    EL LCS+++++GL I L SAAKITH+AQ++     KW
Sbjct  275   ASQFASVLLTTRRDSVDDLLNTGELALCSVVLMSGLIIILSSAAKITHQAQALTGHTTKW  334

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             HAC T+    E G+  P     +   Q   P         EE   +D L+NT +   HAH
Sbjct  335   HACCTIEPVLEDGE--PGSNQNSMIEQ--EPESDSDTEYSEETGDEDLLENTKIHMPHAH  390

Query  1269  TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG S
Sbjct  391   VISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGFS  445



>gb|KHN12540.1| hypothetical protein glysoja_035347, partial [Glycine soja]
Length=327

 Score =   338 bits (867),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 237/333 (71%), Gaps = 14/333 (4%)
 Frame = +3

Query  459   VRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPY  638
             +R+FLF D+LC+E++ V+  Y  Q + SLKIL+ FV P F+A+CAYKIWW+ +G  QIP+
Sbjct  1     LRRFLFFDKLCDESETVRTNYMAQHNRSLKILSVFVGPCFVAECAYKIWWYTSGAPQIPF  60

Query  639   FYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAI  818
               N+ +S+ V CIL L SWLYR  + FLVCVLFRLICHLQILRL  FA+ F  +S+V+++
Sbjct  61    LGNVYVSDAVACILELWSWLYRTTVIFLVCVLFRLICHLQILRLCDFARFFHVDSDVASV  120

Query  819   LIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSM  998
             + EHLRIRR+LR+ISHRFR FIL  L++VT SQF  LLVTT+     +I+   EL LCS+
Sbjct  121   MSEHLRIRRHLRIISHRFRAFILLALVLVTGSQFACLLVTTKHTKDMNIYKTGELALCSV  180

Query  999   IMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGT-PQAI  1175
              +++ L I LRSA KITHKAQ++  LAAKWH CATL  FD    E      GT T PQ+ 
Sbjct  181   TLLSALCILLRSATKITHKAQAITGLAAKWHVCATL-DFDGVLTE-----GGTPTAPQSS  234

Query  1176  HPV------dadwenddeegdgddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGIT  1334
             H               DE GD +DE+D T ++P +A+ TISY KRQALV YFE+N+AGIT
Sbjct  235   HETMFPNVGTDGESETDEAGDEEDEIDTTKLIPSYAYSTISYQKRQALVKYFENNRAGIT  294

Query  1335  VYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             VYGFMLDR+ L+TIF I+LSL LW+L KTIG S
Sbjct  295   VYGFMLDRSTLNTIFGIELSLVLWLLGKTIGFS  327



>ref|XP_004965802.1| PREDICTED: uncharacterized protein LOC101778259 [Setaria italica]
Length=446

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/415 (45%), Positives = 267/415 (64%), Gaps = 13/415 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S L W+ +D S   ++ LSW LF  L++ VP  ++ + +  A     +RP +A+
Sbjct  39    ELHWFRSCLRWVCMDHSGPCQSALSWLLFLALSVVVPAAAHFLLAFRA----SRRPISAV  94

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  +   F+ LS   RR G+R+ L+LD+L  ++D+V+  YT ++  S ++LAS V
Sbjct  95    VQLSLSAASAAGFLCLSSSFRRIGLRRLLYLDKLRTKSDRVRFHYTARLAFSFRLLASLV  154

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A+ AYK WW+ T   ++P+F N +LS+V+ C L ++SW+YR A+  L CVLFRLI
Sbjct  155   APCFVAEAAYKAWWYATSADRVPFFANDVLSDVLACSLEMASWMYRSAVYLLTCVLFRLI  214

Query  747   CHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             CHLQ LRL+ FA      V E  + V+++L EHL IRR L+VISHRFR FI++ L++ TA
Sbjct  215   CHLQGLRLEDFAGSLLEDVEEGRTGVASVLREHLDIRRQLKVISHRFRKFIVAALLITTA  274

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF S+L+TT   S  ++    EL LCS+++++GL I L SAAKITH+AQ++     KWH
Sbjct  275   SQFASVLLTTRRDSVDNLLTTGELALCSVVLMSGLIIILNSAAKITHQAQALTGHTTKWH  334

Query  1092  ACATLSSF-DEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             AC T++   DE G+  P     +   Q          ++    D D   +    +P HAH
Sbjct  335   ACCTIAPVQDEEGE--PGSNQNSMIEQDPSSDSDTESDEYTGDDEDLLENTKIHLP-HAH  391

Query  1269  TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG S
Sbjct  392   VISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGFS  446



>dbj|BAJ91857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   340 bits (871),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 186/418 (44%), Positives = 264/418 (63%), Gaps = 20/418 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +D S    A LSW LF +L + VP  ++ + +        +RPF+A+
Sbjct  44    ELQWFRSCLRWVCMDHSAPGGAALSWFLFLLLAVVVPATAHFLLAF----RPSRRPFDAV  99

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SLS  +  SF+ LS   RR G+R+ L+LD+L   +D+V+  YT ++  S ++LAS V
Sbjct  100   VQVSLSAASGASFLCLSSSFRRIGLRRLLYLDKLRTNSDRVRLNYTARLAFSFRLLASLV  159

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F A+ AYK WW+ T   ++P+F N +LS+V+ C L ++SW+YR AI  L CVLFRLI
Sbjct  160   APCFAAEAAYKAWWYATSADRVPFFANDLLSDVLACSLEMASWMYRSAIYLLTCVLFRLI  219

Query  747   CHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             CHLQ LRL+ FA     +V E    V  +L EHL IR+ L+VISHRFR FI++ L++ TA
Sbjct  220   CHLQGLRLEDFAGSLLVEVEEGRMGVERVLREHLDIRKQLKVISHRFRRFIVAALLIGTA  279

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF S+L+TT   S   +    EL LCS+++++GL I L SAAKITH+AQ++     KWH
Sbjct  280   SQFASVLLTTRHDSIDDLLHTGELALCSVVLMSGLIIILSSAAKITHQAQALTGQTTKWH  339

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQ----AIHPVdadwenddeegdgddeldnTNMVPV  1259
             AC T+       +  P D    G+ Q      +  +       E+   +D L+NT  +  
Sbjct  340   ACCTI-------EPVPDDEIDPGSNQNSMLEEYAEEESDCESSEDTGDEDMLENTRFLQP  392

Query  1260  HAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             H H IS+ KRQALVTY E+NKAGITV+GF LDR++LHTIF+++ +L LW+L KT+G S
Sbjct  393   HTHVISFQKRQALVTYLENNKAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTVGFS  450



>emb|CAB80805.1| hypothetical protein [Arabidopsis thaliana]
Length=528

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/398 (45%), Positives = 261/398 (66%), Gaps = 7/398 (2%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFF  296
             ME+    +I+   ++   I       +      RL     +L+ DQSN  +  LSWS+FF
Sbjct  134   MEESSNQQILNSETRPDPIQKPPESPATKLSFPRL-----FLWFDQSNRIKTLLSWSIFF  188

Query  297   ILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLF  476
             +L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA ISF+SLS ++++YG+R+FLF
Sbjct  189   LLAVIVPMISHFVLICADCDFKHRRPYDGLVQLSLSIFAGISFVSLSDWSKKYGIRRFLF  248

Query  477   LDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMIL  656
              D+L + +DKV+ GY  +I  S+K+LA FVLP+      Y+IWW+ +G  QIPY  N  L
Sbjct  249   FDKLKDVSDKVRIGYEAKIQRSMKLLAIFVLPSTTLQAIYRIWWYASGFNQIPYIINPTL  308

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSAILIEHL  833
             S+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD FA+ F  E  + S+IL EHL
Sbjct  309   SHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEFARCFASEIKDFSSILAEHL  368

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             +IRR L+++SHRFR FIL +L  VTA+QF++LL T  +    +I+   EL LCS  +V+G
Sbjct  369   KIRRELKIVSHRFRRFILLSLFFVTATQFMALLTTIRASVPFNIYEVGELALCSTSLVSG  428

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-ETPVDRTGTGTPQAIHPVda  1190
             LFICL+SA ++THKAQSV S+A KW+ CA+L +FD   D ETP   T T   Q +     
Sbjct  429   LFICLKSATQMTHKAQSVTSIATKWNVCASLDTFDVLYDGETPKCPTTTQHSQILSRRRN  488

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVT  1304
               ++ D++ +G+ + ++  + P+ A  IS  KRQALV 
Sbjct  489   VVQSSDDDEEGEGDDNDLEIHPIFARAISSQKRQALVN  526



>ref|XP_006287703.1| hypothetical protein CARUB_v10000912mg, partial [Capsella rubella]
 gb|EOA20601.1| hypothetical protein CARUB_v10000912mg, partial [Capsella rubella]
Length=417

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 248/355 (70%), Gaps = 2/355 (1%)
 Frame = +3

Query  240   LFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATI  419
             L+ DQSN  +  LSWS FF+L + VP++S+ V  C  CD KH+RP++ +VQLSLS+FA I
Sbjct  61    LWFDQSNRVKTLLSWSTFFLLAVIVPMISHFVLLCSDCDFKHRRPYDGLVQLSLSIFAGI  120

Query  420   SFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYK  599
             SF+SLS ++++YG+R+FLF D+L + +DKV+ GY  +I  S+K+LA FVLP+      Y+
Sbjct  121   SFVSLSDWSKKYGIRRFLFFDKLKDVSDKVKIGYESEIQRSMKLLAMFVLPSLTLQAIYR  180

Query  600   IWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGF  779
             IWW+ +G  QIPY  N +LS+V+ C L LSSWLYR ++  + C+L++ ICHLQ+LRLD F
Sbjct  181   IWWYASGFNQIPYIINPMLSHVLACTLQLSSWLYRTSLFIIACILYQNICHLQVLRLDEF  240

Query  780   AQVFEKE-SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSH  956
             A+ F  E S+ S++L EHL+IRR L+++SHRFR FI+ +L  VTA+QF++LL T  +   
Sbjct  241   ARCFASEISDFSSVLAEHLKIRRELKIVSHRFRRFIVLSLFFVTATQFMALLTTIRASVP  300

Query  957   AHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-E  1133
              +I+   EL LCS+ +V+GLFICLRSA ++THKAQSV S+A KW+ CA L +FD   D E
Sbjct  301   FNIYEVGELALCSISLVSGLFICLRSATQMTHKAQSVTSIATKWNVCAALETFDVLYDGE  360

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQAL  1298
             TP   T     Q +       ++ D++ +G+ + D+ ++ P++A  I   KRQAL
Sbjct  361   TPKCPTSIQHSQILSRRRNVIQSSDDDEEGEGDHDDLHIHPIYARAICSQKRQAL  415



>gb|EAZ37736.1| hypothetical protein OsJ_22076 [Oryza sativa Japonica Group]
Length=394

 Score =   332 bits (852),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 244/361 (68%), Gaps = 8/361 (2%)
 Frame = +3

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSL  545
             +RPF+A+VQ+SLS  +   F+ LS   RR G+R+ L+LD+L  ++D+V+  YT ++  S 
Sbjct  37    RRPFSAVVQVSLSAASAAGFLCLSSSFRRIGLRRLLYLDKLRTKSDRVRLNYTARLSFSF  96

Query  546   KILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLV  725
             ++LAS V P F A+ AYK+WW+ T G ++P+F N +LSN V C + +++W+YR AI  L 
Sbjct  97    RLLASLVAPCFAAEAAYKVWWYATSGDRVPFFGNDVLSNAVACSVEMAAWMYRSAIYLLT  156

Query  726   CVLFRLICHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILS  890
             CVLFRLICHLQ LRL+ FA     +V E  + V  +L EHL IR+ L+VISHRFR FI++
Sbjct  157   CVLFRLICHLQGLRLEDFAGTLLVEVEEGRAGVERVLREHLDIRKQLKVISHRFRKFIVA  216

Query  891   TLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVA  1070
             +L++ TASQF SLL+TT   S   +   +EL LCS+++++GL I L SAAKITH+AQ++ 
Sbjct  217   SLLIATASQFASLLLTTRHDSVDDLLNTSELALCSVVLMSGLIIILSSAAKITHQAQALT  276

Query  1071  SLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM  1250
                 KWHAC T+   +   DE     +   +   + PV        EE   +D L+NT +
Sbjct  277   GQTTKWHACCTI---EPVPDEEAEPGSNHSSMLEVEPVSDSDGESSEETGDEDLLENTKI  333

Query  1251  VPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             +   AH IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG 
Sbjct  334   MLPQAHVISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGF  393

Query  1431  S  1433
             S
Sbjct  394   S  394



>ref|NP_001058140.1| Os06g0635200 [Oryza sativa Japonica Group]
 dbj|BAD37983.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20054.1| Os06g0635200 [Oryza sativa Japonica Group]
 dbj|BAG90860.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81031.1| hypothetical protein OsI_23814 [Oryza sativa Indica Group]
Length=452

 Score =   333 bits (853),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 271/414 (65%), Gaps = 12/414 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +D S  W A LSW LF +L + VP  ++ + +  A     +RPF+A+
Sbjct  46    ELQWFRSCLRWVCMDHSGPWGAALSWLLFLLLAVAVPAAAHFLLAFRA----SRRPFSAV  101

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SLS  +   F+ LS   RR G+R+ L+LD+L  ++D+V+  YT ++  S ++LAS V
Sbjct  102   VQVSLSAASAAGFLCLSSSFRRIGLRRLLYLDKLRTKSDRVRLNYTARLSFSFRLLASLV  161

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F A+ AYK+WW+ T G ++P+F N +LSN V C + +++W+YR AI  L CVLFRLI
Sbjct  162   APCFAAEAAYKVWWYATSGDRVPFFGNDVLSNAVACSVEMAAWMYRSAIYLLTCVLFRLI  221

Query  747   CHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             CHLQ LRL+ FA     +V E  + V  +L EHL IR+ L+VISHRFR FI+++L++ TA
Sbjct  222   CHLQGLRLEDFAGTLLVEVEEGRAGVERVLREHLDIRKQLKVISHRFRKFIVASLLIATA  281

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF SLL+TT   S   +   +EL LCS+++++GL I L SAAKITH+AQ++     KWH
Sbjct  282   SQFASLLLTTRHDSVDDLLNTSELALCSVVLMSGLIIILSSAAKITHQAQALTGQTTKWH  341

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHT  1271
             AC T+   +   DE     +   +   + PV        EE   +D L+NT ++   AH 
Sbjct  342   ACCTI---EPVPDEEAEPGSNHSSMLEVEPVSDSDGESSEETGDEDLLENTKIMLPQAHV  398

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG S
Sbjct  399   ISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGFS  452



>ref|XP_003563581.1| PREDICTED: uncharacterized protein LOC100842014 [Brachypodium 
distachyon]
Length=450

 Score =   332 bits (851),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 193/419 (46%), Positives = 270/419 (64%), Gaps = 21/419 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   S L W+ +D S   RA +SW LF +L + VP V++ + +  A     +RPFNA+
Sbjct  43    ELQWFRSCLRWVCMDHSAPGRAAMSWLLFLLLGVVVPAVAHFLLAFRA----SRRPFNAV  98

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  +  SF+ LS   RR G+R+ L+LD+L  ++D+V+  YT ++  S ++LAS V
Sbjct  99    VQLSLSAASAASFLCLSSSFRRIGLRRLLYLDKLRTKSDRVRLNYTTRLSFSFRLLASLV  158

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F A+ AYK WW+ T   ++P+F N +LS+VV C L ++SW+YR AI  L CVLFRLI
Sbjct  159   APCFAAEAAYKAWWYATSADRVPFFANDVLSDVVACSLEMASWMYRSAIYLLTCVLFRLI  218

Query  747   CHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             CHLQ LRL+ FA     +V E    V  +L EHL IR+ L+VISHRFR FI++ L++ TA
Sbjct  219   CHLQGLRLEDFAGSLLVEVEEGRIGVERVLREHLDIRKQLKVISHRFRRFIVAALLIGTA  278

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF S+L+TT   S   +   +EL LCS+++++GL I L SAAKITH+AQ++     KWH
Sbjct  279   SQFASVLLTTRHDSVDDLLNTSELALCSVVLMSGLIIILSSAAKITHQAQALTGQTTKWH  338

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQ----AIHPVdadwenddeegdgddeldnTN-MVP  1256
             AC T+       +  P +    G+ Q      +P         EE   +D L+NT  M+P
Sbjct  339   ACCTI-------EPVPDEEVDPGSNQNSMLEEYPESDSDCESSEETGDEDLLENTRFMLP  391

Query  1257  VHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
                H IS+ KRQALVTY E+NKAGITV+GF LDR++LHTIF+++ +L LW+L KT+G S
Sbjct  392   HTVHVISFQKRQALVTYLENNKAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTVGFS  450



>ref|XP_003575187.1| PREDICTED: uncharacterized protein LOC100828011 [Brachypodium 
distachyon]
Length=436

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/445 (42%), Positives = 282/445 (63%), Gaps = 20/445 (4%)
 Frame = +3

Query  126   DEETEIILRLSKTALISSSYHEISN--AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             D  +  +L   K+   ++ Y   ++    E++   + L W+ +D ++  R+  SW++FF+
Sbjct  3     DTSSAPLLPRKKSPSSAAQYTRCASHAGDELRSFRACLRWMCVDHTDGLRSAGSWAVFFL  62

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
             L +  P    L     A     QRPF+  VQ SL++ A +++ SLS F R  G+R+ L +
Sbjct  63    LAVAAPSAVTLALPASA----PQRPFDGQVQASLTLAAALAYFSLSSFLR-VGLRRLLCI  117

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG-QIPYFYNMIL  656
             DRL  ++D+V+ GYT Q++ S +ILA F++P  LA+ AY+ +W+      + P++     
Sbjct  118   DRLRHDSDEVRAGYTAQLNRSFRILACFLVPCSLAEAAYEAYWYWAAAPFRSPWW-----  172

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
              N  +C L ++SW+YR AI F++CVLFR+IC+LQ+LR+ GFA+ F + +EV+ +L  H R
Sbjct  173   -NAAVCALDVASWVYRTAIFFMICVLFRVICYLQVLRMVGFAREFGRFAEVAVVLEHHRR  231

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR  LR ISHR+R FI+  L++VTASQF +LL TT   +  ++  A EL LCS+ +V GL
Sbjct  232   IREQLRRISHRYRRFIILCLVLVTASQFAALLATTRPHATINLATAGELALCSVSLVVGL  291

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFD-EFGDETPVDRTGTG--TPQAIHPVd  1187
              +CL SAAKITHK QS+ S+AA WHA AT+ +FD +  D  P     TG   P   + + 
Sbjct  292   LVCLHSAAKITHKTQSITSVAAAWHADATIHAFDNDLEDPDPALPASTGYMAPANAYRLA  351

Query  1188  adwenddeegdgddeldn---TNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
             +  E+DD++ D     D+   + +VP   + + + KRQALVTY E+N+AGITVYGF++DR
Sbjct  352   SGEESDDDDDDDARSEDSLDDSKLVPFQVNNMCFQKRQALVTYLENNRAGITVYGFVVDR  411

Query  1359  TWLHTIFVIQLSLTLWILNKTIGIS  1433
             TWLH +F+I+ SL +W+L KT+GIS
Sbjct  412   TWLHALFMIEFSLVMWLLGKTVGIS  436



>gb|KHM99523.1| hypothetical protein glysoja_006366 [Glycine soja]
Length=307

 Score =   322 bits (825),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 221/311 (71%), Gaps = 15/311 (5%)
 Frame = +3

Query  528   QIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRI  707
             Q++ S+KIL+ FV P F+A+CAYKIWW+ +G  QIP+  N+ +S+ V CIL L SWLYR 
Sbjct  3     QLNRSVKILSVFVGPCFVAECAYKIWWYASGASQIPFLGNVYVSDAVACILELWSWLYRT  62

Query  708   AISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFIL  887
              + FLVCVLFRLICHLQILRL  FA+ F  +S+V++++ EHLRIRR+LR+ISHRFR FIL
Sbjct  63    TVIFLVCVLFRLICHLQILRLRDFARFFHVDSDVASVMTEHLRIRRHLRIISHRFRAFIL  122

Query  888   STLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSV  1067
               L++VT SQ   LLVTT+     +I+   EL LCS+ +++ L I LRSA KITHKAQ++
Sbjct  123   LALLLVTGSQLACLLVTTKHTQDMNIYKTGELALCSVTLLSALCILLRSATKITHKAQAI  182

Query  1068  ASLAAKWHACATLSSFDEF--GDETPVDRTGTGTPQAIHPV------dadwenddeegdg  1223
               LAAKWH CATL SFD      ETP+       PQ+ H               DE GD 
Sbjct  183   TGLAAKWHVCATLDSFDGVLTEGETPM------APQSSHETVFPNVGTDGESETDEAGDE  236

Query  1224  ddeldnTNMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLT  1400
             +DE+D T ++P +A+ TISY KRQALV YFE+N+AGITVYGFMLDR+ LHTIF I++SL 
Sbjct  237   EDEIDTTKLIPSYAYSTISYQKRQALVNYFENNRAGITVYGFMLDRSTLHTIFGIEMSLV  296

Query  1401  LWILNKTIGIS  1433
             LW+L KTIG S
Sbjct  297   LWLLGKTIGFS  307



>ref|XP_006656279.1| PREDICTED: uncharacterized protein LOC102707685 [Oryza brachyantha]
Length=446

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 247/361 (68%), Gaps = 12/361 (3%)
 Frame = +3

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSL  545
             +RPF+A+VQ+SLS  +   F+ LS   RR G+R+ L+LD+L  ++D+V+  YT ++  S 
Sbjct  93    RRPFSAVVQVSLSAASAAGFLCLSSCFRRIGLRRLLYLDKLRGKSDRVRLNYTARLSFSF  152

Query  546   KILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLV  725
             ++LAS V P F A+ AYK+WW+ T G ++P+F N +LSNV+ C + ++SW+YR AI  L 
Sbjct  153   RLLASLVAPCFAAEAAYKVWWYATSGDRVPFFGNDVLSNVLACSVEMASWMYRSAIYLLT  212

Query  726   CVLFRLICHLQILRLDGFA-----QVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILS  890
             CVLFRLICHLQ LRL+ FA     +V E  + V  +L EHL IR+ L+VISHRFR FI++
Sbjct  213   CVLFRLICHLQGLRLEDFAGTLLVEVEEGRAGVERVLREHLDIRKQLKVISHRFRKFIVA  272

Query  891   TLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVA  1070
             +L++ TASQF SLL+TT   S       +EL LCS+++++GL I L SAAKITH+AQ++ 
Sbjct  273   SLLIATASQFASLLLTTRHDSVDDFLNTSELALCSVVLMSGLIIILSSAAKITHQAQALT  332

Query  1071  SLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM  1250
                 KWHAC T+   +E   E  +    +   +A  PV    +++ EE   +D L+NT +
Sbjct  333   GQTTKWHACCTIEPVEE---EAELGSNQSSMVEA-DPV---SDSECEETGDEDLLENTKI  385

Query  1251  VPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             +   A  IS+ KRQALVTY E+N+AGITV+GF LDR++LHTIF+++ +L LW+L KTIG 
Sbjct  386   LLPQATVISFQKRQALVTYLENNRAGITVFGFTLDRSYLHTIFMLEWTLFLWLLGKTIGF  445

Query  1431  S  1433
             S
Sbjct  446   S  446



>ref|XP_009398683.1| PREDICTED: uncharacterized protein LOC103983209 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=392

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 244/365 (67%), Gaps = 8/365 (2%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++ L S L W+  DQS+   A +SW  FF+L + +P VS+ V S        +RP++ +
Sbjct  23    ELRGLRSCLRWMCHDQSDAGLAVVSWVAFFVLAVAIPAVSHFVLSY----RPDRRPYDLV  78

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQLSLS  A +SF++LS   RRYG+R+FL LD+L  ++ +V+  YT Q+  S ++LA FV
Sbjct  79    VQLSLSAAAALSFLTLSSATRRYGLRRFLLLDKLPSQSPRVRLAYTAQLRRSFRLLALFV  138

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
              P F+A+ AYK WW+     +IP+  N + +  V C L L+SW+YR A  F+VCV+FR I
Sbjct  139   TPCFVAEVAYKSWWYAFSADRIPFLGNPVATGCVACALELASWIYRTASFFVVCVMFRSI  198

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             CHLQILRL  FA VF++ESEV  +L EHLR+RR LRVISHRFR FIL  LI+VTASQF +
Sbjct  199   CHLQILRLQEFAAVFQEESEVMVVLKEHLRVRRQLRVISHRFRGFILLGLIMVTASQFAA  258

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             + VTT   S   +F   EL +CS  +VTGL ICLR AAKITHKAQ++ S AAKWH CAT+
Sbjct  259   VFVTTRPHSDDSLFNTGELAICSFALVTGLLICLRGAAKITHKAQALTSHAAKWHVCATI  318

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVd-adwenddeegdgddeldnTNMVPVHAHTISYH  1283
              +F     ETP +     + +   PV   D ++D+EEG  +DEL+ T +V  HAHTIS+ 
Sbjct  319   ETF-AVDPETPSEAISKASSE--FPVTNGDEDSDEEEGSEEDELEGTKIVQSHAHTISFQ  375

Query  1284  KRQAL  1298
             KRQAL
Sbjct  376   KRQAL  380



>gb|KHG27190.1| hypothetical protein F383_14154 [Gossypium arboreum]
Length=299

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 217/294 (74%), Gaps = 3/294 (1%)
 Frame = +3

Query  126   DEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             + ET+ +L  ++++  S S  E     E++     L W  LDQSNLW+  LSWS FF+L 
Sbjct  2     ENETQSLLPKNRSSNPSYSTPE---GLELRSFRLGLNWFCLDQSNLWKVSLSWSFFFVLA  58

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             IGVP++S+ V  C  CD KH+RP++A+VQLSLS FA +SFISLS +AR+YG+RKFLFLD+
Sbjct  59    IGVPIISHYVLLCSNCDEKHRRPYDAVVQLSLSSFAAVSFISLSSWARKYGIRKFLFLDK  118

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             LC+ +DKV++GY  ++  S+K+L  FVLP   A+ AY+IWW+ TG  QIPY  NM +S++
Sbjct  119   LCDVSDKVRKGYAEELQKSMKLLCVFVLPCLAAESAYRIWWYATGASQIPYLGNMYVSDI  178

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
             ++C L L+SWLYR +I  L C+ ++L CHLQILRL+ FAQVF+KE+EV +IL EHLRIRR
Sbjct  179   IVCALQLASWLYRTSIFILACIFYQLTCHLQILRLEDFAQVFQKETEVRSILAEHLRIRR  238

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMV  1007
             NLR+ISHRFRLF+L +L++VTASQF +LL+TT + +  +I+   EL +   I +
Sbjct  239   NLRIISHRFRLFLLLSLVLVTASQFFALLMTTRTTTALNIYEVGELAVSRYIAI  292



>gb|KHG15893.1| hypothetical protein F383_23792 [Gossypium arboreum]
Length=362

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 180/413 (44%), Positives = 256/413 (62%), Gaps = 75/413 (18%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             IS+A+ E++   + L W+ +DQSN+W   LSW LF  L + VP VS+   +C  CD+KH 
Sbjct  20    ISHAKDELQSFRTYLKWMCVDQSNIWTTCLSWFLFIFLGLVVPSVSHFWLACSTCDAKHA  79

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             RP++++VQLSLS  + +SF+ L+ F + YG+++FLF D+L  E++ V++GYT Q++ SLK
Sbjct  80    RPYDSVVQLSLSSVSALSFVCLTRFVKTYGLKRFLFFDKLYVESEAVRKGYTGQLNRSLK  139

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             I+A FVLP F+A+ AYK+WW+ +G  QIP+   + LS+ V CI  L SWLYR  + FLVC
Sbjct  140   IVAVFVLPCFIAETAYKVWWYASGASQIPFLGIVWLSDTVACITELFSWLYRTTVFFLVC  199

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLF LIC+LQ+LRL  FAQVF+ +S+V ++L EHLRIRR+LR+ISHR+R FI+  LI++T
Sbjct  200   VLFHLICNLQVLRLRDFAQVFQIDSDVGSVLSEHLRIRRHLRIISHRYRAFIICCLILIT  259

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF SLL+TT++ S  + + A EL +                                 
Sbjct  260   GSQFTSLLITTKATSALNFYKAGELAV---------------------------------  286

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
                      ++ GDE  +D                                  M+P +A+
Sbjct  287   ---------NDLGDEDDIDN-------------------------------NKMIPSYAY  306

Query  1269  -TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
              T+S+ KRQALVTYFE+N+AGIT+YGF+LDR+ LHTIF ++LSL LW+L KTI
Sbjct  307   STLSFQKRQALVTYFENNRAGITIYGFVLDRSTLHTIFGLELSLVLWLLGKTI  359



>ref|XP_010451122.1| PREDICTED: uncharacterized protein LOC104733223 [Camelina sativa]
Length=326

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 176/327 (54%), Positives = 234/327 (72%), Gaps = 6/327 (2%)
 Frame = +3

Query  459   VRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPY  638
             ++K   +  L E N + +         S K L  FVLP+   +  Y+IWW+++G  QIPY
Sbjct  1     MKKNNKISDLPESNQRPKDLTVTDYSRSRKRLMIFVLPSLTLEAIYRIWWYISGFNQIPY  60

Query  639   FYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE-SEVSA  815
               N +LS+VV   L LSSWLYR  I  +VC+L+++ CHLQ LRL+ FA+ F  E ++V +
Sbjct  61    IINPVLSHVVAFTLQLSSWLYRNTIFIVVCILYQITCHLQTLRLEDFARCFASEIADVRS  120

Query  816   ILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCS  995
              L EH +IRRNLR++SHRFR FIL +L++VTA+QF++LL TT +    +I+   EL LCS
Sbjct  121   ALGEHQKIRRNLRIVSHRFRRFILLSLVLVTATQFMALLTTTRASIAVNIYEVGELALCS  180

Query  996   MIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAI  1175
             + +VTG+FICLRSA KITHKAQSV SLAAKW+ CAT+ SFD    E P   TG+     I
Sbjct  181   LSLVTGVFICLRSATKITHKAQSVTSLAAKWNVCATVDSFDHLDGEPP---TGSMIESQI  237

Query  1176  HP--VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFM  1349
              P  +++   +DDEEG+GDD+LDNT + P++A+TISY KRQALVTY E+NKAGITVYGF+
Sbjct  238   SPCGINSMDTSDDEEGEGDDDLDNTKIHPIYANTISYQKRQALVTYLENNKAGITVYGFL  297

Query  1350  LDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             +DR+WLHTIF I+L+L LW+LNKTIGI
Sbjct  298   VDRSWLHTIFGIELALLLWLLNKTIGI  324



>ref|XP_002987712.1| hypothetical protein SELMODRAFT_44258, partial [Selaginella moellendorffii]
 gb|EFJ11287.1| hypothetical protein SELMODRAFT_44258, partial [Selaginella moellendorffii]
Length=409

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 250/415 (60%), Gaps = 11/415 (3%)
 Frame = +3

Query  195   SNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP  374
             ++  E+++  ++L WL LDQS   R   SW LFF++T+ VPL++ L+  C  CD  H+ P
Sbjct  1     NSDEEIQQFKASLFWLGLDQSTAPRMICSWVLFFLMTLLVPLLNALLVDCRHCDEDHKHP  60

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             +  IV++S S  A +SF+ +S     YG+ K L  D +  ++ +VQ GY  ++HS+ ++L
Sbjct  61    YQGIVEISESALAMVSFLCVSHIFSVYGLHKLLLFDYIARDSTEVQVGYKKELHSAFRVL  120

Query  555   ASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVL  734
             A  + P+FL    +K+WWF      +P      L N V+C+ ++++WLY+  I   VCVL
Sbjct  121   AMILFPSFLVALVHKLWWFYYVSVNLPRVSESSLINAVMCVSVMAAWLYKTTIFLFVCVL  180

Query  735   FRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
             FRL+C LQILRL  + ++ E+  +VS IL EH+RIR  L +ISHRFR+F++S+L+ +T S
Sbjct  181   FRLLCSLQILRLQSYNKLLEETPDVSVILSEHMRIRDQLLIISHRFRVFMVSSLLTITFS  240

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             QFVSL + T S+   + F A +L +CS + +TG  +CL  AA+ITH+AQ + ++ ++WHA
Sbjct  241   QFVSLFMLTTSRGSVNFFRAGDLAVCSAVQLTGFVVCLNGAARITHRAQRIVAIVSQWHA  300

Query  1095  CATLSSFDEFGDETPVDRTGTGTPQAI----HPVdadwenddeegdgddeldnTNMVPVH  1262
              AT  ++         D+       A+    HP            +   ++ +T   P  
Sbjct  301   VATCGTYAVAMPSCDADKATEPVASAVVGPAHP-------FLARLEATIDICSTPKEPSK  353

Query  1263  AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
                 S+ KRQALVTY +H  AGI++YGF+LDR +L+ IF  +LSL L+IL  T+G
Sbjct  354   YDIDSFQKRQALVTYLQHCNAGISLYGFVLDRGFLYAIFGFELSLVLFILGNTMG  408



>ref|XP_002983177.1| hypothetical protein SELMODRAFT_44255, partial [Selaginella moellendorffii]
 gb|EFJ15519.1| hypothetical protein SELMODRAFT_44255, partial [Selaginella moellendorffii]
Length=409

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/415 (39%), Positives = 250/415 (60%), Gaps = 11/415 (3%)
 Frame = +3

Query  195   SNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP  374
             ++  E+++  ++L WL LDQS   R   SW LFF++T+ VPL++ L+  C  CD  H+ P
Sbjct  1     NSDEEIQQFKASLFWLGLDQSTAPRMICSWVLFFLMTLLVPLLNALLVYCRHCDEDHKHP  60

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             +  IV++S S  A +SF+ +S     YG+ K L  D +  ++ +VQ GY  ++HS+ ++L
Sbjct  61    YQGIVEISESALAMVSFLCVSHIFSVYGLHKLLLFDYIARDSTEVQVGYKKELHSAFRVL  120

Query  555   ASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVL  734
             A  + P+FL    +K+WWF      +P      L N V+C+ ++++WLY+  I   VCVL
Sbjct  121   AMILFPSFLVALVHKLWWFYYVSVNLPRVSESSLINAVMCVSVMAAWLYKTTIFLFVCVL  180

Query  735   FRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
             FRL+C LQILRL  + ++ E+  +VS IL EH+RIR  L +ISHRFR+F++S+L+ +T S
Sbjct  181   FRLLCSLQILRLQSYNKLLEETPDVSVILSEHMRIRDQLLIISHRFRVFMVSSLLTITFS  240

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             QFVSL + T S+   + F A +L +CS + +TG  +CL  AA+ITH+AQ + ++ ++WHA
Sbjct  241   QFVSLFMLTTSRGSVNFFRAGDLAVCSAVQLTGFVVCLNGAARITHRAQRIVAIVSQWHA  300

Query  1095  CATLSSFDEFGDETPVDRTGTGTPQAI----HPVdadwenddeegdgddeldnTNMVPVH  1262
              AT  ++         D+       A+    HP            +   ++ +T   P  
Sbjct  301   VATCGTYAVAMPSCDADKATEPVASAVVGPAHPF-------LARLEATIDICSTPKEPSK  353

Query  1263  AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
                 S+ KRQALVTY +H  AGI++YGF+LDR +L+ IF  +LSL L+IL  T+G
Sbjct  354   YDIDSFQKRQALVTYLQHCNAGISLYGFVLDRGFLYAIFGFELSLVLFILGNTMG  408



>ref|XP_003581286.1| PREDICTED: uncharacterized protein LOC100836114 [Brachypodium 
distachyon]
Length=444

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 283/450 (63%), Gaps = 32/450 (7%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             D   +  +L+L +    + S   +S+AR E++   S L  + +D S+   A  SW +F  
Sbjct  14    DPATSTPLLQLRRRGSYTRS---MSHARDELRSFRSCLRLMCVDHSDGASAAASWLVFAA  70

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
             L + VP+ + +           +R ++  VQ SL++ A +++++L+   RR G+R+ L+L
Sbjct  71    LAVAVPVSARVALP--------RRAYDTQVQASLTLSAALAYVTLTSLIRRRGLRRLLYL  122

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG-QIPYFYNMIL  656
             DRL  ++  V+ GYT+Q+  S ++LA FVLP FLAD AYK++W+       +P++++   
Sbjct  123   DRLRHDSQDVRAGYTVQLAGSFRLLACFVLPCFLADAAYKVFWYCANRPFAVPWWWS---  179

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLR  836
                  C L ++SW+YR A+ F+ CVLFR+IC+LQILR+ GFA+ F + ++V+A+L +H R
Sbjct  180   --AAACALEMASWMYRTAMFFMACVLFRIICYLQILRMTGFARDFGQCADVAAVLRQHRR  237

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR  LR ISHR+R FIL  L++VTASQF +LL  T   +  +I  A EL LCS+ +VTGL
Sbjct  238   IRDQLRRISHRYRRFILYCLLLVTASQFSALLGITRPHAKVNIATAGELALCSLSLVTGL  297

Query  1017  FICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGT-----------  1163
              ICL SAAKITHK Q++ S+AA WHA AT++S D    E P  RT +             
Sbjct  298   LICLHSAAKITHKTQAITSIAAAWHADATINSADR-DQENP--RTPSKANLLQVQQQQQG  354

Query  1164  PQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYG  1343
             P A +    + ++DDE    +D LD +    +H   ISY KRQALVTY E+N+AGITV+G
Sbjct  355   PAASNSSGDESDDDDEMSPSEDSLDTSRFTSLHVTHISYQKRQALVTYLENNRAGITVFG  414

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F++DRTWLH +F+I+ SL +W+L KTIGIS
Sbjct  415   FVVDRTWLHALFMIEFSLVMWLLGKTIGIS  444



>dbj|BAJ86582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/417 (43%), Positives = 268/417 (64%), Gaps = 19/417 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   + L W+ +D ++  R+  SW++FF+L +  P    L     A      RP +  
Sbjct  33    ELRSFRACLRWMCIDHTDGPRSAGSWAVFFLLAVAAPAAVALALPATA----PPRPLDGQ  88

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SL++ AT++F+SL C   R G+R+ L +DRL  ++D+V+ GYT Q++ S ++LA F+
Sbjct  89    VQVSLTLAATLAFLSL-CSLLRVGLRRLLCIDRLRHDSDEVRAGYTAQLNRSFRVLACFL  147

Query  567   LPTFLADCAYKIWWFVTGGG-QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRL  743
              P  LAD AYK++W+      + P++      N   C L  +SW+YR A+ F++CVLFR+
Sbjct  148   APCSLADAAYKVYWYWAAAPFRSPWW------NAAACALEAASWVYRTAVFFMICVLFRV  201

Query  744   ICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFV  923
             IC+LQ+LR+ GFA+ F + ++V+ +L  H RIR  LR ISHR+R FI+  L++VTASQF 
Sbjct  202   ICYLQVLRMVGFAREFGRFADVAVVLEHHRRIRDQLRRISHRYRRFIIFCLVLVTASQFS  261

Query  924   SLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACAT  1103
             +LL TT   +  +I  A EL LCS+ +V GL +CL SAAKITHK Q++ S+AA WHA AT
Sbjct  262   ALLATTRPHARINIATAGELALCSVSLVAGLLVCLHSAAKITHKTQAITSVAAAWHADAT  321

Query  1104  LSSFD-EFGDETPVDRTGTG--TPQAIHPVdadwendd----eegdgddeldnTNMVPVH  1262
             + +FD +  D  P     TG   P   + V    E+D     ++   +  +D++ +VP  
Sbjct  322   IHAFDNDLEDPDPALPAATGYLAPANAYRVAPGEESDSYGDDDDAMSEGSIDDSKLVPFQ  381

Query  1263  AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              + +S+ KRQALV Y E+N+AGITVYGF++DRTWLH +F+I+ SL +W+L KT+GIS
Sbjct  382   VNNMSFQKRQALVNYLENNRAGITVYGFVVDRTWLHALFMIEFSLVMWLLGKTVGIS  438



>ref|XP_004952715.1| PREDICTED: uncharacterized protein LOC101775844 [Setaria italica]
Length=456

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 181/429 (42%), Positives = 265/429 (62%), Gaps = 21/429 (5%)
 Frame = +3

Query  195   SNAR-EVKRLMSALAWLFLDQSNLWR--AGLSWSLFFILTIGVPLVSYLVFSCDACDSKH  365
             S+AR E++   + LAWL +D S+  R  A  SW++F +L +  P  + L+   D      
Sbjct  33    SHARDELRSFRACLAWLCIDHSSSPRLAAAGSWAVFLLLAVAAPAAALLLSGPDG-----  87

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYG-VRKFLFLDRLCEENDKVQQGYTLQIHSS  542
              RP++  VQ+SL++ AT++++SL    RR G +R+ L+LD L  +++ VQ GY  Q+  S
Sbjct  88    GRPYDGQVQVSLTLAATLAYVSLRALLRRSGGLRRLLYLDSLRRDSEDVQVGYAAQLARS  147

Query  543   LKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN---VVICILLLSSWLYRIAI  713
              ++LA FVLP  LA+ AYK +W+             + S       C L ++SW+YR+A+
Sbjct  148   FRVLACFVLPCALAEAAYKAYWYYCAAAPTTAAGPPLRSPWWAAAACALEVASWVYRVAL  207

Query  714   SFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILST  893
              F+VCVLFR+IC+LQILR+ GFA+ F + ++V  +L  H RIR  LR ISHR+R FI+ +
Sbjct  208   FFMVCVLFRVICYLQILRMVGFAREFGRFADVGTVLQHHRRIREQLRKISHRYRKFIVCS  267

Query  894   LIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVAS  1073
             L++V+A+QF +LL  T   S  ++  A EL L S+ +V GL +CL SAAKITHK Q++ S
Sbjct  268   LVLVSATQFAALLAATRPHSVVNLATAGELALSSISLVAGLLVCLHSAAKITHKTQAMTS  327

Query  1074  LAAKWHACATLSSFD---EFGDETP--VDRTGTGTPQAIHPVdadwenddeegdgddeld  1238
             +AA WHA AT+ +FD   E  D  P      G   P   + V A  E+  ++ D      
Sbjct  328   VAAAWHADATVQAFDNDLENPDRDPDLPPTAGYLAPANAYRVAAGEESGSDDDDDCGSET  387

Query  1239  nT----NMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLW  1406
             ++      VP  A+ I + KRQALVTY E+N+AGITVYGF++DR WLH +F+I+ SL +W
Sbjct  388   SSLDDPKYVPFQANNICFQKRQALVTYLENNRAGITVYGFVVDRAWLHALFMIEFSLVMW  447

Query  1407  ILNKTIGIS  1433
             +L KT+GIS
Sbjct  448   LLGKTVGIS  456



>ref|XP_008669337.1| PREDICTED: uncharacterized protein LOC103646384 [Zea mays]
 tpg|DAA37577.1| TPA: hypothetical protein ZEAMMB73_872872 [Zea mays]
Length=442

 Score =   301 bits (770),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 269/424 (63%), Gaps = 26/424 (6%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +S+AR E+    S L W+ +D S+     +SW +F  L + VP  ++         +  +
Sbjct  35    VSHARDELSSFRSGLRWMCVDHSDASSPAVSWLVFAALGVAVPAAAHAA-------AAPR  87

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
             R ++  VQ+SL++ A +++ +L    RR+G+R+ L+LDRL  ++  V+ GY +Q+  S +
Sbjct  88    RAYDTQVQVSLTLSAALAYTTLYSLVRRHGLRRLLYLDRLRHDSQDVRAGYIVQLAGSFR  147

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +LA FVLP FLAD AYK +W+       P +++        C L ++SW+YR A+  + C
Sbjct  148   LLACFVLPCFLADAAYKAFWYC-ANRPFPLWWS-----AAACALEMASWMYRTAMFCMAC  201

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFR IC+LQILR+ GFA+ F + ++V+A+L +H RIR  L+ ISHR+R FIL +LI+VT
Sbjct  202   VLFRTICYLQILRMTGFARDFGQCADVAAVLRQHRRIRVQLQRISHRYRSFILYSLILVT  261

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             ASQF +LL  T   +  +   A EL LCSM +VTGL +CL SAAKITHK QS+ S+AA W
Sbjct  262   ASQFTALLAATRPHARVNFATAGELALCSMSLVTGLLVCLHSAAKITHKTQSITSVAAAW  321

Query  1089  HACATLSSFDEFGDETPVDRTGTG------TPQAIHPVdadwenddeegd---gddeldn  1241
             HA AT++S D    E P  RT +       TP +  P+      ++ + D    +D +D 
Sbjct  322   HADATINSLDR-DQENP--RTPSKACLQQQTPTSPFPMAGASSGEESDDDEWRSEDGVDT  378

Query  1242  TNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKT  1421
             +   P HA  +S+ KRQALVTY E+N+AGITV+GF++DRTWLH +F+I+ SL +W+L KT
Sbjct  379   SRFTPFHATNVSFQKRQALVTYLENNRAGITVFGFVVDRTWLHALFMIEFSLVMWLLGKT  438

Query  1422  IGIS  1433
             IGIS
Sbjct  439   IGIS  442



>ref|XP_001769393.1| predicted protein [Physcomitrella patens]
 gb|EDQ65762.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 254/438 (58%), Gaps = 32/438 (7%)
 Frame = +3

Query  117   MEDDEETEIILRLSKTALISSSYHEI-SNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSL  290
             +EDD + +   +  + A + S Y  + SN + E++R  S L+WL LDQS   +   S  L
Sbjct  15    VEDDFDPD---KEEQRAKLRSKYKRVLSNPKDELRRFRSGLSWLGLDQSTTIKVVCSRIL  71

Query  291   FFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
             F +L   VP+ +Y   SC+ C+ + + PF  +VQ+S +V A +SF  LS    +YG+R+ 
Sbjct  72    FVLLAFVVPIFNYSFVSCENCEERRRHPFEKLVQMSETVLAIVSFFCLSHILHKYGLRRT  131

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             L LD++ +E+ +VQQG+  ++ SS  ILA  +LPTFL    ++ WWF      IPYF ++
Sbjct  132   LLLDKIVKESPEVQQGFQAKLDSSFSILAWMLLPTFLVALGHRAWWFYYVTVSIPYFTDI  191

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
                NV++ I  + SWLYR ++   +CVLFRL+C LQILRL G+ ++ E  SEVS IL EH
Sbjct  192   PRINVILFIASIFSWLYRTSVFLFMCVLFRLMCSLQILRLRGYYKLLEVTSEVSIILKEH  251

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVT  1010
             +++R  L  ISHRFR+F++  L  +  SQ  SL          + F A +L +CS++ +T
Sbjct  252   MKLRNQLTTISHRFRIFLILALFTIIFSQLSSLFQILLYAKTINFFRAGDLAVCSLVQLT  311

Query  1011  GLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVda  1190
             GL +CL+ AAKITHKAQ + +  +KWHA AT S        +   RT    P   HP+  
Sbjct  312   GLVLCLQGAAKITHKAQHIVTSVSKWHALATCSPGTIIESTSSSRRTSFYGPA--HPL--  367

Query  1191  dwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLH  1370
                                   +H    ++ KRQALVTY +H +AGI++YGF+LDR +L+
Sbjct  368   ----------------------LHNRR-TFQKRQALVTYLQHTRAGISLYGFVLDRGFLY  404

Query  1371  TIFVIQLSLTLWILNKTI  1424
              IF +  S TL++L KTI
Sbjct  405   MIFGVTFSSTLFVLGKTI  422



>ref|XP_006653458.1| PREDICTED: uncharacterized protein LOC102711255, partial [Oryza 
brachyantha]
Length=325

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 217/331 (66%), Gaps = 16/331 (5%)
 Frame = +3

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             L+LDRL  ++  V+ GYT+Q+  S  +LA FVLP FLAD AYK++W+       P +++ 
Sbjct  1     LYLDRLRHDSQDVRAGYTVQLAGSFNLLACFVLPCFLADAAYKVYWYC-ANRPFPLWWS-  58

Query  651   ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEH  830
                    C L ++SW+YR A+ F+ CVLFR+IC LQILR+ GFA+ F + ++V+A+L +H
Sbjct  59    ----AAACALEMASWMYRTAMFFMACVLFRIICFLQILRMTGFARDFGQCADVAAVLRQH  114

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVT  1010
              RIR  LR ISHR+R FI+S L++VTASQF +LL  T   +  +I  + EL LCSM +VT
Sbjct  115   RRIREQLRRISHRYRKFIVSCLLLVTASQFSALLAATRPHAQVNIATSGELALCSMSLVT  174

Query  1011  GLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDE--TPVDRTGT----GTPQA  1172
             GL ICL SAAKITHK Q++ S+AA+WHA AT++S D   +   TP   +       +P  
Sbjct  175   GLLICLHSAAKITHKTQAITSVAAQWHADATINSQDRDHENPRTPSKASANHFHAASPVV  234

Query  1173  IHPVdadwenddeegdgddeldn----TNMVPVHAHTISYHKRQALVTYFEHNKAGITVY  1340
             + P  A    D+ +       D+       V  HA  IS+ KRQALVTY E+N+AGITV+
Sbjct  235   VVPPGASSSGDESDDGSARSDDDALDGAKFVSFHATNISFQKRQALVTYLENNRAGITVF  294

Query  1341  GFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             GF++DRTWLH +F+I+ SL +W+L KTIGIS
Sbjct  295   GFVVDRTWLHALFMIEFSLVMWLLGKTIGIS  325



>ref|XP_002452309.1| hypothetical protein SORBIDRAFT_04g023430 [Sorghum bicolor]
 gb|EES05285.1| hypothetical protein SORBIDRAFT_04g023430 [Sorghum bicolor]
Length=455

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 181/427 (42%), Positives = 262/427 (61%), Gaps = 21/427 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGL--SWSLFFILTIGVPLVSYLVFSCDAC-DSKHQRPF  377
             E++   + LAWL +D S+  R     SW++F +L +  P    L+       D    RPF
Sbjct  32    ELRSFRACLAWLCVDHSSSPRVAAVGSWAVFLLLAVAAPAAVRLLLLLPLVADDPPPRPF  91

Query  378   NAIVQLSLSVFATISFISLSCFARRYG-VRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             +  VQ+SL++ A+++++SL     R G +R+ L+LD L  +++ VQ GY  Q+  S ++L
Sbjct  92    DGQVQVSLTLAASLAYVSLRALLHRAGGLRRLLYLDSLRRDSEDVQAGYAAQLARSFRVL  151

Query  555   ASFVLPTFLADCAYKIWWFVT----GGGQIPYFYNMILSNVVICILLLSSWLYRIAISFL  722
             A FVLP  LA+ AYK +W+      GGG     +    +   + +   +SW+YR+A+ F+
Sbjct  152   ACFVLPCALAEAAYKAYWYHAAAAYGGGSRRRRWCWAAAACAVEV---ASWVYRVALFFM  208

Query  723   VCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIV  902
             VCVLFR+IC+LQILR+ GFA+ F + ++V+A+L  H RIR  LR ISHR+R FI+ +L++
Sbjct  209   VCVLFRVICYLQILRMVGFAREFGRFADVAAVLQHHRRIREQLRKISHRYRKFIVCSLVL  268

Query  903   VTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAA  1082
             V+ASQF +LL TT   +  ++  A EL LCSM +V GL +CL SAAKITHK Q++ S+AA
Sbjct  269   VSASQFAALLATTRPHAVVNLATAGELALCSMSLVAGLLMCLYSAAKITHKTQAMTSVAA  328

Query  1083  KWHACATLSSFDEFGDETPVDRTGTG----TPQAIHPVdadwenddeegdgddeldn---  1241
              WHA AT+ +FD   +    D   T      P   + V A  E+     D DD       
Sbjct  329   AWHADATVHAFDNDQENPDPDLPPTAGYYLAPANAYRVAAGDESGSGGDDDDDSRSECSS  388

Query  1242  ---TNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWIL  1412
                   VP  A+ IS+ KRQALVTY E+N+AGITVYGF++DR WLH +F+I+ SL +W+L
Sbjct  389   LDDPKYVPFQANNISFQKRQALVTYLENNRAGITVYGFVVDRAWLHALFMIEFSLVMWLL  448

Query  1413  NKTIGIS  1433
              KT+GIS
Sbjct  449   GKTVGIS  455



>ref|XP_001771079.1| predicted protein [Physcomitrella patens]
 gb|EDQ64080.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 246/418 (59%), Gaps = 12/418 (3%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E++   + L WL LDQS   +   SW +F + T  VP V+    SC  CDS+H+ PF  +
Sbjct  31    ELRYFRNGLRWLGLDQSTKPKMLFSWIVFLLFTFVVPFVNLTSISCPDCDSQHRHPFEEL  90

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ++ +  A +SF+ LS   RRYG+R+ L LDR+  E+++V++GY  ++HSS   L   +
Sbjct  91    VQIAETAMAAVSFLCLSHIVRRYGLRRTLLLDRIARESEEVRKGYESELHSSFSSLGRIL  150

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNM----ILSNVVICILLLSSWLYRIAISFLVCVL  734
             LP  + + A+++WW+V     IP+  N     I+ NV++C   L SWLYR ++    C+L
Sbjct  151   LPAAVIEIAFRLWWYVYVSVSIPFIQNNQRLNIIFNVLLCTSGLLSWLYRTSVFLFTCIL  210

Query  735   FRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
             FRL+C LQILR  G+  + E  S VS I+ EHLR+R  L +ISHRFR F+L+ L +++ +
Sbjct  211   FRLLCSLQILRFKGYTSLLEVTSNVSVIMSEHLRLRSQLTIISHRFRSFLLAALFIISFT  270

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             QF S+ V   +    + F   +L +CS++ +TGL +CL  AAKITH+AQ +  + ++WHA
Sbjct  271   QFCSVFVLLRTYEKFNFFRCGDLVVCSVVQLTGLMLCLGGAAKITHRAQRIVGIVSQWHA  330

Query  1095  CATLS------SFDEFG-DETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV  1253
              AT +      S    G D     +  +      HP   +  +D+ +   ++    ++ V
Sbjct  331   LATCNPHAVTESLKTDGCDSNDPPQYSSAMRGPAHPRLYNDSSDEVDSSDEESPRYSSDV  390

Query  1254  PVHAHTI-SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
                 H + SY KRQALV Y +  KAGI+++G +LDR +L+ IF    SLTL++L KTI
Sbjct  391   DQTIHDMESYQKRQALVCYLQQAKAGISLFGVVLDRGFLYGIFGCTFSLTLFVLGKTI  448



>ref|XP_001779543.1| predicted protein [Physcomitrella patens]
 gb|EDQ55619.1| predicted protein [Physcomitrella patens]
Length=389

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/416 (39%), Positives = 243/416 (58%), Gaps = 37/416 (9%)
 Frame = +3

Query  195   SNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQR  371
             SN R E+ +  S LAWL LDQS ++    S  LF +L + VP+ ++   SCD CD   + 
Sbjct  3     SNPRDELVQFRSGLAWLGLDQSTIFSVIWSRILFVLLAVVVPIFNFNFVSCDTCDESRKH  62

Query  372   PFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKI  551
             PF  +VQ S +V AT+SF++LS   RR+G+R+ L LD++ +E  +VQ+G+ +++ ++  +
Sbjct  63    PFEKLVQASETVLATVSFLTLSHILRRFGLRRTLLLDKIVKEPSEVQEGFQVKLKTAFSL  122

Query  552   LASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
             LA  +LPTFL +  ++ WW+      IP+  ++   N ++    + SWLYR ++   +CV
Sbjct  123   LAWMLLPTFLVELGHRAWWYYCVTIDIPFLADVPKINAILLFASILSWLYRTSVFLFMCV  182

Query  732   LFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             LFRL+C LQILRL  + ++ E  SEVS IL EH++IR  L  ISHRFR+F++  L  +  
Sbjct  183   LFRLMCSLQILRLRAYNKLLELTSEVSIILKEHMKIRNQLTTISHRFRVFLILALFTIIF  242

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQ  SL     S      F A +L +CS++ +TGL +CL+ AAKITHKAQ + +  ++WH
Sbjct  243   SQLSSLFQILLSAKSISFFRAGDLAVCSLVQLTGLVLCLQGAAKITHKAQHIVASVSRWH  302

Query  1092  ACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHT  1271
             A AT S      + T  +R                               T+M  +   T
Sbjct  303   ALATCSP-SVIIEPTESNR------------------------------RTSMDLLFQET  331

Query  1272  IS-----YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +S     + KRQALVTY +H +AGI++YGF+LDR +L+ IFVI  + TL++L KTI
Sbjct  332   LSHDLEAFQKRQALVTYLQHTRAGISLYGFVLDRGFLYMIFVITFTSTLFVLGKTI  387



>ref|XP_002446563.1| hypothetical protein SORBIDRAFT_06g018146 [Sorghum bicolor]
 gb|EES10891.1| hypothetical protein SORBIDRAFT_06g018146 [Sorghum bicolor]
Length=411

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/412 (42%), Positives = 251/412 (61%), Gaps = 23/412 (6%)
 Frame = +3

Query  249   DQSNLWRAGLSWSLFFILTIGV-PLVSYLVFSC--------DACDSKHQRPFNAIVQLSL  401
             D+ + +R+GL W        G  P VS+LVF+             +     ++  VQ+SL
Sbjct  6     DELSSFRSGLRWMCVDPSEAGAGPAVSWLVFAALGVAVPAAAHAATTPGHAYDTQVQVSL  65

Query  402   SVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFL  581
             ++ A +++ +L    RR G+R+ L+LDRL  ++  V+ GY +Q+  S ++LA FVLP FL
Sbjct  66    TLSAALAYATLYSLVRRRGLRRLLYLDRLRHDSQDVRAGYIVQLAGSFRLLACFVLPCFL  125

Query  582   ADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQI  761
             AD  YK++W+       P++      +   C L ++SW+YR A+ F+ CVLFR IC+LQI
Sbjct  126   ADAGYKVFWYCANAPFPPWW------SAAACALEMASWMYRTAMFFMACVLFRTICYLQI  179

Query  762   LRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTT  941
             LR+ GFA+ F + ++V+A+L +H RIR  L+ ISHR+R FIL +LI+VTASQF +LL  T
Sbjct  180   LRMTGFARDFGQCADVAAVLRQHRRIRVQLQRISHRYRRFILYSLILVTASQFTALLAAT  239

Query  942   ESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDE  1121
                +  +   A EL LCS+ +VTGL +CL SAAKITHK Q++ S+AA WHA AT++S D 
Sbjct  240   RPHAQVNFATAGELALCSVSLVTGLLVCLHSAAKITHKTQAITSVAAAWHADATINSLDR  299

Query  1122  FGDETPVDRTGTGTPQAIHPVdadwenddeegd--------gddeldnTNMVPVHAHTIS  1277
               +       G    Q   P       +   G+         +D +D +     HA  IS
Sbjct  300   DQENPRTPSKGCLQQQQQAPTSPFPMGNASSGEESDDDEWRSEDSVDTSRFTSFHATNIS  359

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             + KRQALVTY E+N+AGITV+GF++DRTWLH +F+I+ SL +W+L KTIGIS
Sbjct  360   FQKRQALVTYLENNRAGITVFGFVVDRTWLHALFMIEFSLVMWLLGKTIGIS  411



>gb|EAY94307.1| hypothetical protein OsI_16076 [Oryza sativa Indica Group]
Length=442

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 196/460 (43%), Positives = 285/460 (62%), Gaps = 32/460 (7%)
 Frame = +3

Query  93    TNQGKPIAMEDDEETEIILRLSKTALI---SSSYHEISNAR-EVKRLMSALAWLFLDQSN  260
             T+   P A       E ++  + T L+    S    +S+AR E+    S L W+ ++ S+
Sbjct  2     TDTASPAAAR-----EAMIEPASTPLLRRRGSYTRSMSHARDELGSFRSCLRWMCVEHSD  56

Query  261   LWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSC  440
                A  SW +F +L + VP  +       A D +        VQ SL++ A +++++LS 
Sbjct  57    GSSAVASWLVFTLLAVAVPAAARAALPRRAYDGQ--------VQASLTLSAALAYLTLSR  108

Query  441   FARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTG  620
               RR G+R+ L+LDRL  ++  V+ GYT+++  S ++LA FVLP FLAD AYK++W+   
Sbjct  109   LVRRRGLRRLLYLDRLRHDSQDVRAGYTVELAGSFRLLACFVLPCFLADAAYKVYWYC-A  167

Query  621   GGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKE  800
                 P +++        C L ++SW+YR A+ F+ CVLFR+IC LQILR+ GFA+ F + 
Sbjct  168   NRPFPLWWS-----AAACALEMASWMYRTAMFFMACVLFRIICFLQILRMTGFARDFGQC  222

Query  801   SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAE  980
             ++V+ +L +H RIR  LR ISHR+R FI+S L++VTASQF +LL  T   +  +I  + E
Sbjct  223   ADVADVLRQHRRIREQLRRISHRYRKFIVSCLLLVTASQFSALLAATRPHAQVNIATSGE  282

Query  981   LGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSS--FDEFGDETPVDRT-  1151
             L LCS+ +VTGL ICL SAAKITHK Q++ S+AA+WHA AT++S   D     TP+  + 
Sbjct  283   LALCSLSLVTGLLICLHSAAKITHKTQAITSVAAQWHADATINSQERDHENPRTPIKASS  342

Query  1152  -----GTGTPQ-AIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
                  G   PQ A +   +  E++DE    DD LD T +V  HA  IS+ KRQALVTY E
Sbjct  343   YLHAAGPVVPQPAPNASSSGDESEDETSPSDDGLDGTKIVSFHATHISFQKRQALVTYLE  402

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             +N+AGITV+GF++DRTWLH +F+I+ SL +W+L KTIGIS
Sbjct  403   NNRAGITVFGFVVDRTWLHALFMIEFSLVMWLLGKTIGIS  442



>emb|CAD40876.2| OSJNBa0064H22.7 [Oryza sativa Japonica Group]
 emb|CAH67195.1| OSIGBa0152K17.7 [Oryza sativa Indica Group]
Length=442

 Score =   288 bits (737),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 281/445 (63%), Gaps = 27/445 (6%)
 Frame = +3

Query  138   EIILRLSKTALI---SSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             E ++  + T L+    S    +S+AR E+    S L W+ ++ S+   A  SW +F +L 
Sbjct  12    EAMIEPASTPLLRRRGSYTRSMSHARDELGSFRSCLRWMCVEHSDGSSAVASWLVFTLLA  71

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             + VP  +       A D +        VQ SL++ A +++++LS   RR G+R+ L+LDR
Sbjct  72    VAVPAAARAALPRRAYDGQ--------VQASLTLSAALAYLTLSRLVRRRGLRRLLYLDR  123

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             L  ++  V+ GYT+++  S ++LA FVLP FLAD AYK++W+       P +++      
Sbjct  124   LRHDSQDVRAGYTVELAGSFRLLACFVLPCFLADAAYKVYWYC-ANRPFPLWWS-----A  177

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
               C L ++SW+YR A+ F+ CVLFR+IC LQILR+ GFA+ F + ++V+ +L +H RIR 
Sbjct  178   AACALEMASWMYRTAMFFMACVLFRIICFLQILRMTGFARDFGQCADVADVLRQHRRIRE  237

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
              LR ISHR+R FI+S L++VTASQF +LL  T   +  +I  + EL LCS+ +VTGL IC
Sbjct  238   QLRRISHRYRKFIVSCLLLVTASQFSALLAATRPHAQVNIATSGELALCSLSLVTGLLIC  297

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSS--FDEFGDETPVDRT------GTGTPQ-AIH  1178
             L SAAKITHK Q++ S+AA+WHA AT++S   D     TP+  +      G   PQ A +
Sbjct  298   LHSAAKITHKTQAITSVAAQWHADATINSQERDHENPRTPIKASSYLHAAGPVVPQPAPN  357

Query  1179  PVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
                +  E++DE    DD LD T +V  HA  IS+ KRQALVTY E+N+AGITV+GF++DR
Sbjct  358   ASSSGDESEDETSPSDDGLDGTKIVSFHATHISFQKRQALVTYLENNRAGITVFGFVVDR  417

Query  1359  TWLHTIFVIQLSLTLWILNKTIGIS  1433
             TWLH +F+I+ SL +W+L KTIGIS
Sbjct  418   TWLHALFMIEFSLVMWLLGKTIGIS  442



>ref|XP_001752835.1| predicted protein [Physcomitrella patens]
 gb|EDQ82339.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 173/470 (37%), Positives = 260/470 (55%), Gaps = 42/470 (9%)
 Frame = +3

Query  87    QSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNAR-EVKRLMSALAWLFLDQSNL  263
             ++T Q +   ++ D+      R    AL+ +    +S+AR E++   + L  L LDQS+ 
Sbjct  17    RATAQDQERCIDIDDHN----RKDNQALVRT----LSHARDELRYFRNGLRCLGLDQSSK  68

Query  264   WRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCF  443
              +  LSW LF + T  VP V+    SC  CD +H+ PF  +VQL+ +  A +SF+ LS  
Sbjct  69    LKVTLSWILFALFTFIVPFVNLTSVSCPDCDPQHRHPFEGLVQLAETALAAVSFVCLSHI  128

Query  444   ARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGG  623
              RR+G+R+ LFLDR+  E+ +V+ GY  ++H +  +L SF+LP  L + A+++WW+    
Sbjct  129   VRRHGLRRTLFLDRIVRESHEVRAGYESELHGAFSLLGSFLLPIALIEIAFRVWWYYYVT  188

Query  624   GQIPYFYN----MILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVF  791
               IP+  +     I+ NVV+C   L SWLYR ++    C+LFRL+CHLQILRL G+ ++ 
Sbjct  189   VSIPFIESHRRLKIILNVVLCSCGLLSWLYRTSVFLFTCILFRLMCHLQILRLKGYIKLL  248

Query  792   EKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFA  971
             E  S VS IL EH+RIR  L +ISHRFR F+++    ++ SQ  S  V   S    + F 
Sbjct  249   ETTSNVSIILSEHMRIRSQLTIISHRFRAFLVAASFTISFSQVWSAFVLLSSYEKFNFFR  308

Query  972   AAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRT  1151
             A +L +CS++ +TGL +CL  AAKITH+AQ +  + ++WHA AT +        T   RT
Sbjct  309   AGDLVVCSVVQLTGLMLCLNGAAKITHRAQRIIGIVSQWHALATCNPH----AVTDSQRT  364

Query  1152  GTGTPQ-----------AIHPVdadwenddeegdgddeldnTNMVPVHAHTI--------  1274
             G G                HP          +   + + D+    P H+ +I        
Sbjct  365   GEGDSNDPALWSSTIRGPAHPC------VYNDSSDESDSDDEEQSPRHSTSIKQAFHDME  418

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +Y KR AL+ Y +  KAG+++YG +LDR +L+ IF    SL L IL KTI
Sbjct  419   NYQKRHALLCYLQQAKAGVSLYGCVLDRGFLYGIFACTFSLILVILGKTI  468



>gb|EAZ30889.1| hypothetical protein OsJ_14964 [Oryza sativa Japonica Group]
Length=442

 Score =   287 bits (735),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 280/445 (63%), Gaps = 27/445 (6%)
 Frame = +3

Query  138   EIILRLSKTALI---SSSYHEISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILT  305
             E ++  + T L+    S    +S+AR E+    S L W+ ++ S+   A  SW +F +L 
Sbjct  12    EAMIEPASTPLLRRRGSYTRSMSHARDELGSFRSCLRWMCVEHSDGSSAVASWLVFTLLA  71

Query  306   IGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDR  485
             + VP  +       A D +        VQ SL++ A ++++ LS   RR G+R+ L+LDR
Sbjct  72    VAVPAAARAALPRRAYDRQ--------VQASLTLSAALAYLKLSRLVRRRGLRRLLYLDR  123

Query  486   LCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNV  665
             L  ++  V+ GYT+++  S ++LA FVLP FLAD AYK++W+       P +++      
Sbjct  124   LRHDSQDVRAGYTVELAGSFRLLACFVLPCFLADAAYKVYWYC-ANRPFPLWWS-----A  177

Query  666   VICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRR  845
               C L ++SW+YR A+ F+ CVLFR+IC LQILR+ GFA+ F + ++V+ +L +H RIR 
Sbjct  178   AACALEMASWMYRTAMFFMACVLFRIICFLQILRMTGFARDFGQCADVADVLRQHRRIRE  237

Query  846   NLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFIC  1025
              LR ISHR+R FI+S L++VTASQF +LL  T   +  +I  + EL LCS+ +VTGL IC
Sbjct  238   QLRRISHRYRKFIVSCLLLVTASQFSALLAATRPHAQVNIATSGELALCSLSLVTGLLIC  297

Query  1026  LRSAAKITHKAQSVASLAAKWHACATLSS--FDEFGDETPVDRT------GTGTPQ-AIH  1178
             L SAAKITHK Q++ S+AA+WHA AT++S   D     TP+  +      G   PQ A +
Sbjct  298   LHSAAKITHKTQAITSVAAQWHADATINSQERDHENPRTPIKASSYLHAAGPVVPQPAPN  357

Query  1179  PVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
                +  E++DE    DD LD T +V  HA  IS+ KRQALVTY E+N+AGITV+GF++DR
Sbjct  358   ASSSGDESEDETSPSDDGLDGTKIVSFHATHISFQKRQALVTYLENNRAGITVFGFVVDR  417

Query  1359  TWLHTIFVIQLSLTLWILNKTIGIS  1433
             TWLH +F+I+ SL +W+L KTIGIS
Sbjct  418   TWLHALFMIEFSLVMWLLGKTIGIS  442



>gb|KHG22956.1| hypothetical protein F383_04880 [Gossypium arboreum]
Length=356

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 201/267 (75%), Gaps = 1/267 (0%)
 Frame = +3

Query  192  ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
            IS+A+ E+K   + L W+ +DQSN+W   LSW +F +  + VPLVS+ + +C  CD+ H 
Sbjct  18   ISHAQDELKSFRTYLRWMCVDQSNIWMGCLSWFMFIVFGLLVPLVSHFMLACSTCDATHT  77

Query  369  RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
            RP++ +VQLSLS  + +SF+ L+ F +++G+R+FLFLD+LC+E++ V++ YT+Q++ SLK
Sbjct  78   RPYDWVVQLSLSSVSALSFVCLTRFVKKHGLRRFLFLDKLCDESETVRKQYTVQLNRSLK  137

Query  549  ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
            I++ FVLP F+A+ AYK+WW+ +G  QIP+   + LS+ V C++ L SWLYR  + FLVC
Sbjct  138  IVSFFVLPCFIAETAYKVWWYASGASQIPFLGIVWLSDTVACVMELCSWLYRTTVFFLVC  197

Query  729  VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
            VLFRLIC+LQ+LRL  FA+VF  +S+V ++L EHLRIRR LR+ISHR+R FI+  LI+VT
Sbjct  198  VLFRLICNLQVLRLHDFAKVFNVDSDVGSVLREHLRIRRQLRIISHRYRAFIVWCLILVT  257

Query  909  ASQFVSLLVTTESKSHAHIFAAAELGL  989
             SQF SLL+TT+S S  +I+ A EL +
Sbjct  258  FSQFTSLLITTKSNSRLNIYKAGELAV  284


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  1245  NMVPVHAH-TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKT  1421
              ++P +A+ TISYHKRQALVTYFE N+ GITVYG  LDR+ LHTIF I+LS  LWIL KT
Sbjct  293   KLIPAYAYSTISYHKRQALVTYFEKNQGGITVYGIALDRSTLHTIFGIELSFVLWILGKT  352

Query  1422  IGIS  1433
             IGIS
Sbjct  353   IGIS  356



>gb|AFW71907.1| hypothetical protein ZEAMMB73_453015 [Zea mays]
Length=441

 Score =   282 bits (722),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 176/423 (42%), Positives = 258/423 (61%), Gaps = 25/423 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGL--SWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFN  380
             E++   + LAWL +D S+  R     SW++F +L +  P    L+       +   RPF+
Sbjct  30    ELRSFRACLAWLCVDHSSSPRVAAVGSWAVFLLLAVAAPAAVRLL------GTAPPRPFD  83

Query  381   AIVQLSLSVFATISFISLSCFARRYG-VRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
               VQ+SL++ A+++++ L     R G +R+ L LD L  +++ VQ GY  Q+  S ++LA
Sbjct  84    GQVQVSLTLAASLAYVCLRALLHRAGGLRRLLHLDSLRRDSEDVQAGYAAQLARSFRVLA  143

Query  558   SFVLPTFLADCAYKIWWFVTGGGQI--PYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
              FVLP  LA+ AYK +W+         P+++      V +     +SW+YR+A+ F+VCV
Sbjct  144   CFVLPCALAEAAYKAYWYRAAAAAYGSPWWWAAAACAVEV-----ASWVYRVALFFMVCV  198

Query  732   LFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             LFR+IC+LQILR+ GFA+ F + ++V+ +L  H RIR  LR ISHR+R FI+ +L++V+A
Sbjct  199   LFRVICYLQILRMVGFAREFGRFADVATVLQHHRRIREQLRKISHRYRKFIVCSLVLVSA  258

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF +LL TT   +  ++  A EL LCS+ +V GL +CL SAAKITHK Q++ S+AA WH
Sbjct  259   SQFAALLATTRPHAIVNLATAGELALCSVSLVAGLLMCLYSAAKITHKTQAMTSVAAAWH  318

Query  1092  ACATLSSFDEFGDETPVDRTGTG---TPQAIHPVdadwenddeegdgddeldn------T  1244
             A AT+ +FD   +    D   T     P   + V A  E+     D DD           
Sbjct  319   ADATVHAFDNDQENPDPDLPPTAGYLAPANAYRVAAGDESGSGGDDDDDSRSECSSLDDP  378

Query  1245  NMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
               VP  A+ IS+ KRQALVTY E+N+AGITVYGF++DR WLH +F+I+ SL +W+L KT+
Sbjct  379   KYVPFQANNISFQKRQALVTYLENNRAGITVYGFVVDRAWLHALFMIEFSLVMWLLGKTV  438

Query  1425  GIS  1433
             GIS
Sbjct  439   GIS  441



>ref|NP_001143249.1| hypothetical protein [Zea mays]
 gb|ACG30141.1| hypothetical protein [Zea mays]
 gb|AFW71908.1| hypothetical protein ZEAMMB73_915883 [Zea mays]
Length=441

 Score =   280 bits (716),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 175/423 (41%), Positives = 257/423 (61%), Gaps = 25/423 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGL--SWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFN  380
             E++   + LAWL +D  +  R     SW++F +L +  P    L+       +   RPF+
Sbjct  30    ELRSFRACLAWLCVDHYSSPRVAAVGSWAVFLLLAVAAPAAVRLL------GTAPPRPFD  83

Query  381   AIVQLSLSVFATISFISLSCFARRYG-VRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
               VQ+SL++ A+++++ L     R G +R+ L LD L  +++ VQ GY  Q+  S ++LA
Sbjct  84    GQVQVSLTLAASLAYVCLRALLHRAGGLRRLLHLDSLRRDSEDVQAGYAAQLARSFRVLA  143

Query  558   SFVLPTFLADCAYKIWWFVTGGGQI--PYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
              FVLP  LA+ AYK +W+         P+++      V +     +SW+YR+A+ F+VCV
Sbjct  144   CFVLPCALAEAAYKAYWYRAAAAAYGSPWWWAAAACAVEV-----ASWVYRVALFFMVCV  198

Query  732   LFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTA  911
             LFR+IC+LQILR+ GFA+ F + ++V+ +L  H RIR  LR ISHR+R FI+ +L++V+A
Sbjct  199   LFRVICYLQILRMVGFAREFGRFADVATVLQHHRRIREQLRKISHRYRKFIVCSLVLVSA  258

Query  912   SQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH  1091
             SQF +LL TT   +  ++  A EL LCS+ +V GL +CL SAAKITHK Q++ S+AA WH
Sbjct  259   SQFAALLATTRPHAIVNLATAGELALCSVSLVAGLLMCLYSAAKITHKTQAMTSVAAAWH  318

Query  1092  ACATLSSFDEFGDETPVDRTGTG---TPQAIHPVdadwenddeegdgddeldn------T  1244
             A AT+ +FD   +    D   T     P   + V A  E+     D DD           
Sbjct  319   ADATVHAFDNDQENPDPDLPPTAGYLAPANAYRVAAGDESGSGGDDDDDSRSECSSLDDP  378

Query  1245  NMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
               VP  A+ IS+ KRQALVTY E+N+AGITVYGF++DR WLH +F+I+ SL +W+L KT+
Sbjct  379   KYVPFQANNISFQKRQALVTYLENNRAGITVYGFVVDRAWLHALFMIEFSLVMWLLGKTV  438

Query  1425  GIS  1433
             GIS
Sbjct  439   GIS  441



>ref|XP_002963850.1| hypothetical protein SELMODRAFT_64232, partial [Selaginella moellendorffii]
 ref|XP_002971800.1| hypothetical protein SELMODRAFT_54154, partial [Selaginella moellendorffii]
 gb|EFJ27549.1| hypothetical protein SELMODRAFT_54154, partial [Selaginella moellendorffii]
 gb|EFJ35721.1| hypothetical protein SELMODRAFT_64232, partial [Selaginella moellendorffii]
Length=405

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 242/412 (59%), Gaps = 10/412 (2%)
 Frame = +3

Query  192   ISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQ  368
             +SN R E++R   +L W+ LDQS   R   SW +F +  I +P+++ +  SC  C  + Q
Sbjct  3     LSNPRDELQRFRLSLLWIGLDQSTPVRIAFSWIIFLLFAIVLPVINSVATSCSRCYHR-Q  61

Query  369   RPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLK  548
              PF  +V +S S  A +SF  LS   RR+G+RK L L++L  E+ +VQQ Y  +++ + +
Sbjct  62    LPFERLVYVSESALAIVSFACLSFLLRRHGLRKVLMLEKLDRESQEVQQNYRAKVNFAFR  121

Query  549   ILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +LA  +LP+ +     +IWWF      +P   +      V+C L++ SWLY+  +  L+C
Sbjct  122   LLAMIILPSMVVKLVREIWWFSRATVALPGIPHGPALRSVMCTLVMLSWLYKAGVFLLMC  181

Query  729   VLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             VLFRL+C LQILRL G++ +  K  +V  +L+EH+RIR+ L  ISHR R+FIL+++ ++T
Sbjct  182   VLFRLMCSLQILRLQGYSTLLAKSLDVPELLLEHVRIRKQLFKISHRCRIFILASMFIIT  241

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             +SQF+SL      K   H F A  L + S + ++G+  C+  A+KITH+AQ + SL ++W
Sbjct  242   SSQFISLFFILSYKESVHFFIAGSLAVSSAVQLSGILTCMNGASKITHRAQKLISLVSEW  301

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             HA  T S+     ++       T TP   +P+     +         +  +++    + +
Sbjct  302   HAVWTCSAMTSDFNKPAFK---TATPPC-YPLLRQQSDIKACDLFSAKSQDSH----YDN  353

Query  1269  TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
                + ++Q+ + Y +HN  GI+VYGF+LDR  L+T+F ++LSL LWIL KT+
Sbjct  354   ECYFRQQQSFLRYLQHNSPGISVYGFVLDRGSLYTLFALELSLVLWILGKTV  405



>ref|XP_006648760.1| PREDICTED: uncharacterized protein LOC102705507 [Oryza brachyantha]
Length=357

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 230/354 (65%), Gaps = 11/354 (3%)
 Frame = +3

Query  390   QLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVL  569
             ++SL++ ATI+++SL+ F RR G+R+ L+LDRL  ++++V+ GY  ++  S ++LA  + 
Sbjct  9     EVSLTLAATIAYLSLTAFLRRRGLRELLYLDRLRHDSEEVRVGYMAELAGSFRVLACLLF  68

Query  570   PTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLIC  749
             P  LA+ AYK +W+       P F +   S    C+L L+SW YR A+ F+VCVLFR IC
Sbjct  69    PCALAEAAYKAYWYCAA----PPFRSPWWS-AAACVLELASWAYRTAVFFIVCVLFRTIC  123

Query  750   HLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSL  929
             +LQILR+ GF + F + ++V+A+L  H  IR+ L  ISHR+R FIL  L++VTASQF +L
Sbjct  124   YLQILRMKGFVREFCRFTDVAAVLERHRVIRKQLHKISHRYRRFILWCLVLVTASQFSAL  183

Query  930   LVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLS  1109
             L TT   +  ++  A EL LCS+ +V GL +CL+SAAKITHK Q++ S+AA WHA AT++
Sbjct  184   LATTRPHAQINLATAGELALCSISLVAGLLVCLQSAAKITHKTQAITSVAAGWHADATIN  243

Query  1110  SFDEFGDETPVDRT---GTGTPQAIHPVda---dwenddeegdgddeldnTNMVPVHAHT  1271
             +F+   +    D     G   P   + + +              DDE  ++  +P   + 
Sbjct  244   AFNNDQENPNPDLPAIIGYMAPANAYWMASGEESDYESSASSSSDDESGDSKYIPFQNNN  303

Query  1272  ISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             I + KRQALVTY E+N+ GITVYGF++DRTWLH +F+I+ SL +W+L KT+GIS
Sbjct  304   ICFQKRQALVTYLENNRGGITVYGFVVDRTWLHALFMIEFSLVMWLLGKTVGIS  357



>ref|XP_009375736.1| PREDICTED: uncharacterized protein LOC103964525 [Pyrus x bretschneideri]
Length=433

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 249/450 (55%), Gaps = 31/450 (7%)
 Frame = +3

Query  87    QSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLW  266
             Q ++ G+P    ++  T  +L              + ++ E+     +L W  LD S+ +
Sbjct  14    QISSPGRPNNNSNEPNTAPLL--------------LQSSDELCSFKVSLKWWALDHSSCF  59

Query  267   RAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFA  446
                LS+  F  LT+ VP+++ L     + D      FN +VQL  S  A I FI+LS F 
Sbjct  60    GKFLSYFTFIFLTVLVPILTSLSLKLPSGDPIS---FNKLVQLPESSLAAIGFITLSGFF  116

Query  447   RRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG  626
             R+YG+R+ LFLD L E++  V++GYT ++  + K LA  +LP+F  + A+KI +F T   
Sbjct  117   RKYGLRQLLFLDGLTEDSGFVRRGYTRELDKAFKYLACILLPSFFIELAHKIIFFSTVHI  176

Query  627   QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFE-KES  803
              +P+  + +  N ++ +L+L+SW+YR  +  LVCV+FRL C LQILRL    ++FE +E 
Sbjct  177   SLPHISSSVPVNSIMFVLVLASWVYRTGVFLLVCVMFRLTCELQILRLKRLCKLFEGREY  236

Query  804   EVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAEL  983
             E S I  EH+RIR+ L+V SHR+R FI+  + ++T SQF +LL+   SK+      + +L
Sbjct  237   ESSIIFQEHVRIRKQLKVTSHRYRFFIIGCMFIITVSQFGALLLVLASKTEKTFLNSGDL  296

Query  984   GLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGT  1163
              +CS + ++GLF CL  AA+ITH+AQ V ++A +WH   T  S             G   
Sbjct  297   VVCSAVELSGLFCCLMEAARITHRAQGVVAIATRWHMLLTCPS------------AGADQ  344

Query  1164  PQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYG  1343
                   + +       E D +   D +  VP    + S+  RQALV Y  HN  GIT+YG
Sbjct  345   QWKSQQISSKANGRCGESDSEHSSDISTSVPPQEPS-SFQTRQALVAYLSHNNGGITLYG  403

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR  LHT+F  + SL LW+L+K + +S
Sbjct  404   FALDRGLLHTLFAFEFSLVLWVLSKVVVLS  433



>ref|XP_004978035.1| PREDICTED: uncharacterized protein LOC101754954 [Setaria italica]
Length=457

 Score =   275 bits (702),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 184/437 (42%), Positives = 264/437 (60%), Gaps = 37/437 (8%)
 Frame = +3

Query  189   EISNAR-EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKH  365
              +S+AR E++   S L WL +D S+     +SW +F  L + VP+ + +           
Sbjct  36    SMSHARDELRSFRSCLRWLCVDHSDDSSPAVSWLVFAALAVAVPVAARVALP--------  87

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSL  545
              R +   VQ SL++ AT+++ +L    RR G+R+ L+LDRL  ++  V+ GY +++  S 
Sbjct  88    WRAYGTQVQASLTLSATLAYATLYSLVRRRGLRRLLYLDRLRHDSQDVRAGYIVELAGSF  147

Query  546   KILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLV  725
             ++LA FVLP  LAD AYK++W+ T     P +++        C L ++SW+YR AI F+ 
Sbjct  148   RLLACFVLPCSLADAAYKVFWYCTNR-PFPLWWS-----AAACALEVASWMYRTAIFFMA  201

Query  726   CVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             CVLFR IC LQILR+ GFA+   + ++V+A+L +H RIR  LR ISHR+R FIL  LI+V
Sbjct  202   CVLFRTICFLQILRMTGFARDVGQCADVAAVLRQHRRIRAQLRRISHRYRTFILYGLIIV  261

Query  906   TASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAK  1085
             T SQF +LL  T  ++  ++  A+EL LCS+ +VTGL +CL SAAKITHK QS+ S+AA 
Sbjct  262   TISQFTALLAATRPRAQVNLATASELALCSLSLVTGLLVCLYSAAKITHKTQSITSIAAA  321

Query  1086  WHACATLSSFDEFGDETPVDRTGTGTPQ--AIHP-------------------Vdadwen  1202
             WHA AT++S D    E P   +     Q  A  P                      +  +
Sbjct  322   WHADATINSLDR-DQENPRTPSKAYLQQQHAFSPSKAYLQQHAPSSPFSAASASSGEESD  380

Query  1203  ddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFV  1382
             DD+E   +D +D +     H   ISY KRQALVTY E+N+AGITV+GF++DRTWLH +F+
Sbjct  381   DDDESRSEDSVDTSRFAYFHVTNISYQKRQALVTYLENNRAGITVFGFVVDRTWLHALFM  440

Query  1383  IQLSLTLWILNKTIGIS  1433
             I+ SL +W+L KTIGIS
Sbjct  441   IEFSLVMWLLGKTIGIS  457



>ref|XP_010263393.1| PREDICTED: uncharacterized protein LOC104601654 [Nelumbo nucifera]
Length=455

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/429 (37%), Positives = 236/429 (55%), Gaps = 35/429 (8%)
 Frame = +3

Query  174   SSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDAC  353
             SS Y E+ N R       +L W  LD S+     +S+  F +LT+ +P+ S L       
Sbjct  53    SSIYDELRNFR------ISLKWCALDHSSCTGKFVSYLAFVLLTVIIPIASSLSVRLPPT  106

Query  354   DSKHQR-PFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQ  530
              S      FN +VQ   S  A I+F +LS F RRYG+R+ LFLD + +++  V++GY  +
Sbjct  107   ASADDPISFNKLVQFPESGHAAIAFFTLSGFFRRYGLRQLLFLDAMQDDSPFVRRGYARE  166

Query  531   IHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIA  710
             +  + + LA  +LP+F  +  +KI +F T    IPY    + SN ++ I +L+SW+YR  
Sbjct  167   LDKAFRHLAFILLPSFFVEFFHKIIFFSTVTVSIPYISASVPSNSIMFIAVLASWVYRTG  226

Query  711   ISFLVCVLFRLICHLQILRLDGFAQVFE---KESEVSAILIEHLRIRRNLRVISHRFRLF  881
             +  LVCVLFRL C LQILR +GF ++ E    ES+   I  EH+RIR+ L V SHR+R F
Sbjct  227   VFLLVCVLFRLTCELQILRFEGFHKLLEGCGSESDSCVIFREHMRIRKQLSVTSHRYRSF  286

Query  882   ILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQ  1061
             I+  L+ +T SQ  +L++   SKS    F + ++ +CS + ++G F+CL  AA+ITH+AQ
Sbjct  287   IIGCLVTITVSQLGALMLALASKSEKSFFNSGDVVVCSAVQLSGFFLCLLGAARITHRAQ  346

Query  1062  SVASLAAKWHACATLSSFDEFGDET-----PVDRTGTGTPQAIHPVdadwenddeegdgd  1226
              + S+A +WH   T +S +    E      P+         + H + +            
Sbjct  347   GIVSIATRWHIVVTCASCNAAESEAWKNLLPIANADPSDDHSSHTLAS------------  394

Query  1227  deldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLW  1406
                     +P    T S+  RQALVTY +HN  GIT++GF LDR  LHT+F  + SL LW
Sbjct  395   --------IPSSQDTSSFQTRQALVTYLQHNNGGITLFGFALDRGLLHTLFAFEFSLVLW  446

Query  1407  ILNKTIGIS  1433
             IL+K + +S
Sbjct  447   ILSKAVVLS  455



>ref|XP_006382205.1| hypothetical protein POPTR_0006s29350g [Populus trichocarpa]
 gb|ERP60002.1| hypothetical protein POPTR_0006s29350g [Populus trichocarpa]
Length=457

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 164/469 (35%), Positives = 253/469 (54%), Gaps = 19/469 (4%)
 Frame = +3

Query  48    MINKTIKPRT*LKQSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNA--REVKRL  221
             MIN +      L    + G+ +   D+      LR S   L+  SY    +    E++  
Sbjct  1     MINTSTASGDTLIDIHSSGRHVTFPDENNQSNQLRASVPLLLQPSYARSKSLLFDELRNF  60

Query  222   MSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSC-DACDSKHQRPFNAIVQLS  398
               +L W  LD S      +S  +F  L I +P+VS L      +  +     +N +VQL 
Sbjct  61    RISLKWCALDHSTCIGKFVSCFIFVFLAIILPIVSSLSIRVPSSAPANDPISYNKLVQLP  120

Query  399   LSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTF  578
              SV A ISF SL  F +RYG+R+ LFLD L E++  +++GY+ ++  + + LA  +LP+F
Sbjct  121   ESVLALISFFSLFRFFKRYGLRQLLFLDDLQEDSLFIRRGYSRELDKAFRYLACILLPSF  180

Query  579   LADCAYKIWWFVTGGGQIP--YFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICH  752
               + A+KI +F T    +P   F   I  N ++ +L+L+SW+YR  +  LVCVLFRL C 
Sbjct  181   FVEVAHKIIFFSTVKIWLPCNVFPGNIPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCE  240

Query  753   LQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSL  929
             LQILR DG  ++F+  ES+   I  EH+RI++ L   SHR+R FI+S L+ +T SQF SL
Sbjct  241   LQILRFDGLHKLFDGCESDAGVIFREHVRIKKQLSFTSHRYRFFIISCLVTITVSQFGSL  300

Query  930   LVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLS  1109
             L+     +  + F + +L +CS + + G F+CL  AA+ITH+AQ + S+A +WH     +
Sbjct  301   LLVLGFNNEKNFFNSGDLVICSAVQLCGFFLCLLGAARITHRAQGIVSMATRWHMIVASA  360

Query  1110  SFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHT-ISYHK  1286
             S         +D+  +  P+A               +  +   + N + + +    S+  
Sbjct  361   S-----ASARIDQGKSHVPEA-------DGTLASNTEDSESDSSDNFIAISSQDPCSFQT  408

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALV Y +HN  GIT++GF LDR  LHT+F  + SL LWIL+K + +S
Sbjct  409   RQALVAYLQHNNGGITLFGFALDRGLLHTLFAFEFSLVLWILSKVVVLS  457



>gb|EAY86337.1| hypothetical protein OsI_07714 [Oryza sativa Indica Group]
Length=448

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 170/417 (41%), Positives = 257/417 (62%), Gaps = 16/417 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S LAW+ +D S   R   SW+ F +L +  P  + L             PF+  
Sbjct  40    ELHSFRSCLAWMCVDHSTRARGAASWAAFLLLAVAAPSAATLALPSPVGGGGS--PFDGQ  97

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SL++ A +++++L+   +  G+R+ L+LDRL +++++V+ GY  ++  S ++LA F+
Sbjct  98    VQVSLTLAAALAYLTLTALLQGRGLRRLLYLDRLRDDSEEVRSGYIEELAGSFRVLACFL  157

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP  LA+ AYK +W++      P F +   S    C + ++SW YR A+ F+VCVLFR I
Sbjct  158   LPCTLAEAAYKAYWYLAA----PPFRSPWWS-AAACAVEVASWAYRTAVFFMVCVLFRTI  212

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILR+ GFA+ F + ++V+A+L  H RIR+ L  ISHR+R FIL  L++VTASQF +
Sbjct  213   CYLQILRMKGFAREFCRFADVAAVLESHRRIRKQLHRISHRYRRFILCCLVLVTASQFAA  272

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL TT   +  ++  A EL LCS+ +V GL +CL+SAAKITHK Q++ S+AA WHA AT+
Sbjct  273   LLATTRPHAQINLATAGELALCSLSLVAGLLVCLQSAAKITHKTQAITSVAAGWHADATI  332

Query  1107  SSFDEFGDETPVDRT---GTGTP-----QAIHPVdadwenddeegdgddeldnTNMVPVH  1262
             ++FD   ++   D     G   P      A     +D  +     D D     +  +P  
Sbjct  333   NAFDNDQEDPNPDLPRIVGYLVPVNAYWMASGESSSDSSSSSSSDDDDSGHPKSKYIPFQ  392

Query  1263  AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              +   + +RQALVTY E+N+AGITVYGF++DRTWLH +F+I+ SL +W+L KT+GIS
Sbjct  393   -NNHCFQQRQALVTYLENNRAGITVYGFVVDRTWLHALFMIEFSLVMWLLGKTVGIS  448



>ref|NP_001047171.1| Os02g0566400 [Oryza sativa Japonica Group]
 dbj|BAD15834.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD17747.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09085.1| Os02g0566400 [Oryza sativa Japonica Group]
 dbj|BAG94884.1| unnamed protein product [Oryza sativa Japonica Group]
Length=449

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 170/422 (40%), Positives = 258/422 (61%), Gaps = 25/422 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAI  386
             E+    S LAW+ +D S   R   SW+ F +L +  P  + L             PF+  
Sbjct  40    ELHSFRSCLAWMCVDHSTRARGAASWAAFLLLAVAAPSAATLALPSPVGGGGS--PFDGQ  97

Query  387   VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFV  566
             VQ+SL++ A +++++L+   +  G+R+ L+LDRL +++++V+ GY  ++  S ++LA F+
Sbjct  98    VQVSLTLAAALAYLTLTALLQGRGLRRLLYLDRLRDDSEEVRSGYIEELAGSFRVLACFL  157

Query  567   LPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLI  746
             LP  LA+ AYK +W++      P F +   S    C + ++SW YR A+ F+VCVLFR I
Sbjct  158   LPCTLAEAAYKAYWYLAA----PPFRSPWWS-AAACAVEVASWAYRTAVFFMVCVLFRTI  212

Query  747   CHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
             C+LQILR+ GFA+ F + ++V+A+L  H RIR+ L  ISHR+R FIL  L++VT SQF +
Sbjct  213   CYLQILRMKGFAREFCRFADVAAVLESHRRIRKQLHRISHRYRRFILCCLVLVTTSQFAA  272

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL TT   +  ++  A EL LCS+ +V GL +CL+SAAKITHK Q++ S+AA WHA AT+
Sbjct  273   LLATTRPHAQINLATAGELALCSLSLVAGLLVCLQSAAKITHKTQAITSVAAGWHADATI  332

Query  1107  SSFDEFGDETPVDRTGTGTPQAIH---PVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
             ++FD   ++   D      P+ +    PV+A W    E         +++      H  S
Sbjct  333   NAFDNDQEDPNPD-----LPRIVGYLVPVNAYWMASGESSSDSSSSSSSSDDDDSGHPKS  387

Query  1278  ----------YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
                       + +RQALVTY E+N+AGITVYGF++DRTWLH +F+I+ SL +W+L KT+G
Sbjct  388   KYIPFQNNHCFQQRQALVTYLENNRAGITVYGFVVDRTWLHALFMIEFSLVMWLLGKTVG  447

Query  1428  IS  1433
             IS
Sbjct  448   IS  449



>ref|XP_007011510.1| Ras guanine nucleotide exchange factor K [Theobroma cacao]
 gb|EOY29129.1| Ras guanine nucleotide exchange factor K [Theobroma cacao]
Length=502

 Score =   271 bits (693),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/427 (37%), Positives = 243/427 (57%), Gaps = 18/427 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACD-SKHQRPFNA  383
             E++R   +L W  LD S+     +S+ +F  LT+ VP++S L     +   +     FN 
Sbjct  41    ELRRFRISLKWCALDHSSRLGKFISYLMFVSLTVFVPIISSLSVQVPSSSLATDTTAFNL  100

Query  384   IVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASF  563
             +VQ   S  A + F +L CF RRYG+R+ LFLD L ++   V++GYT ++  + + LA  
Sbjct  101   LVQFPESGLAFLGFFNLCCFFRRYGLRQLLFLDALQQDTTFVRRGYTRELDKAFRYLACI  160

Query  564   VLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRL  743
             +LP+F    A+KI +F T    +PY  +    N ++ +L+L SW+YR  +  LVCVLFRL
Sbjct  161   LLPSFFVQVAHKIIFFSTVKISLPYVRSGFPLNSIMFVLVLGSWVYRTGVFLLVCVLFRL  220

Query  744   ICHLQILRLDGFAQVFEKES---EVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTAS  914
              C LQILR +G  ++FE      +   I  EH+RIR+ L V SHR+R FI+++L+V+T S
Sbjct  221   TCELQILRFEGLHKMFEGSGSGCDAGEIFQEHVRIRKQLSVTSHRYRFFIIASLVVITVS  280

Query  915   QFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHA  1094
             QF +LL+   SKS    F + +L +CS +  +G F+CL  AA++TH+AQ +AS+A +WH 
Sbjct  281   QFAALLMVLASKSEKSFFNSGDLLVCSAVQQSGFFLCLLGAARMTHRAQGMASVATRWHM  340

Query  1095  CATLSSFDEFGDETPV---DRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHA  1265
                +SS    G +      +     TPQA               + D +  +  ++ + A
Sbjct  341   SIIISSLAGLGQQQQGKLHNPDTDVTPQA--------SISKCNDESDSDSSSDTLIRLSA  392

Query  1266  -HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG--IS*  1436
              H  ++  RQALV Y +HN  GIT++G+ LDR  LHT+F  + SL +WIL  ++   I  
Sbjct  393   QHPSNFQTRQALVLYLQHNNRGITLFGYALDRGLLHTLFAFEFSLVMWILRDSMAQWIRR  452

Query  1437  FSTQIKI  1457
             +ST+ +I
Sbjct  453   WSTEPEI  459



>ref|XP_004292871.1| PREDICTED: uncharacterized protein LOC101310198 [Fragaria vesca 
subsp. vesca]
Length=422

 Score =   268 bits (686),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 158/416 (38%), Positives = 238/416 (57%), Gaps = 24/416 (6%)
 Frame = +3

Query  201   AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFN  380
             + E+     +L W  LD S      +S+  F +LT+ VP+++ L        SK    FN
Sbjct  26    SDELSNFQISLKWCALDHSTSLGKFISYFTFILLTLVVPILTSLTLKLP---SKDPTSFN  82

Query  381   AIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILAS  560
              +VQL  S  A I+F +LS F R YG+ + LFLD L E+   V++GYT ++  + K LA 
Sbjct  83    KLVQLPESGLAAIAFFTLSAFFRNYGLGQLLFLDGLQEDTFSVRRGYTREVDKAFKCLAW  142

Query  561   FVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
              +LP+   + A+K+ +F T    +PY    +  N ++ +L+L+SWLYR  +  LVC+LFR
Sbjct  143   ILLPSCFLELAHKVIFFTTVKVSLPYLSPSVPLNSIVFVLVLASWLYRTGVFLLVCILFR  202

Query  741   LICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             L C LQILR +G  + FE  +S    I  EH+RIR+ L V SHR+R FI+     +T SQ
Sbjct  203   LTCELQILRFEGLHKFFEGCDSNSKVIFQEHVRIRKQLWVTSHRYRFFIIGCWFTITVSQ  262

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH--  1091
             F +LL+   SK+      + +L +CS + ++GLF+CL  AA++TH+AQ + ++A +WH  
Sbjct  263   FAALLLVLASKAEKTFLNSGDLVVCSAVELSGLFLCLMEAARMTHRAQGIVAIATRWHML  322

Query  1092  -ACATLSSFDEFGDETPVDRTGTG-TPQAIHPVdadwenddeegdgddeldnTNMVPVHA  1265
               C++ +  D        D+ G G +P+A           + E D D    +T++ P H 
Sbjct  323   LTCSSAAGLDS-------DKQGKGQSPEA-------NGGCNGESDNDSSDISTSVSP-HE  367

Query  1266  HTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
              + S+  RQALVTY  HN  GIT++GF LDR  LHTIF  + SL LW+L+K + +S
Sbjct  368   PS-SFQTRQALVTYLGHNHGGITLFGFALDRGMLHTIFAFEFSLVLWVLSKVVVLS  422



>ref|XP_008378229.1| PREDICTED: uncharacterized protein LOC103441326 [Malus domestica]
Length=526

 Score =   271 bits (692),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 161/450 (36%), Positives = 247/450 (55%), Gaps = 31/450 (7%)
 Frame = +3

Query  87    QSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLW  266
             Q ++ G+P    ++  T  +L  S   L S                 +L W  LD S+ +
Sbjct  107   QISSPGRPNNNSNEPNTAPLLLQSSDELCS--------------FKGSLKWWALDHSSCF  152

Query  267   RAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFA  446
                LS+  F  LT+ VP+++ L     + D      FN +VQL  S  A I F++LS F 
Sbjct  153   GKFLSYFTFIFLTVLVPILTSLSLKLPSGDPIS---FNKLVQLPESSLAAIGFMTLSGFF  209

Query  447   RRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG  626
             R+YG+R+ LFLD L +++  V++GYT ++  + K LA  +LP+F  + A+KI +F     
Sbjct  210   RKYGLRQLLFLDGLTDDSGFVRRGYTRELDKAFKYLACILLPSFFIELAHKIIFFSNVQI  269

Query  627   QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ES  803
              +P+  + +  N ++ +L+L+SW+YR  +  LVCV+FRL C LQILR +G  ++FE  E 
Sbjct  270   SLPHISSSVPVNSIMFVLVLASWVYRTGVFLLVCVMFRLTCELQILRFEGLYKLFEGHEY  329

Query  804   EVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAEL  983
             E S I  EH+RIR+ L+V SHR+R FI+  +  +T SQF +LL+   SK+      + +L
Sbjct  330   ESSIIFQEHVRIRKQLKVTSHRYRFFIIGCMFTITVSQFGALLLVLASKTEKTFLNSGDL  389

Query  984   GLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGT  1163
              +CS + ++GLF CL  AA+ITH+AQ V ++A +WH   T  +             G+  
Sbjct  390   VVCSAVELSGLFCCLMEAARITHRAQGVVAIATRWHMLLTCPN------------AGSDQ  437

Query  1164  PQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYG  1343
                   + ++      E D +   D +  VP    + S+  RQALV Y  HN  GIT+YG
Sbjct  438   QWKSRQISSEANGRCRESDCEHSSDISTSVPPQQPS-SFQTRQALVAYLSHNNGGITLYG  496

Query  1344  FMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             F LDR  LHT+F  + SL LW+L+K + +S
Sbjct  497   FALDRGLLHTLFAFEFSLVLWVLSKVVVLS  526



>ref|XP_009368026.1| PREDICTED: uncharacterized protein LOC103957568 [Pyrus x bretschneideri]
Length=433

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 236/420 (56%), Gaps = 27/420 (6%)
 Frame = +3

Query  192   ISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQR  371
             + ++ E++    +L W  LD S+ +   LS+  F  LT+ VP+++ L     + D     
Sbjct  35    LQSSDELRSFRVSLKWWALDHSSCFGKFLSYFTFIFLTVLVPILTSLFLKLPSGDPIS--  92

Query  372   PFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKI  551
              FN +VQL  S  A I FI+LSCF R+YG+R+ LFLD L +++  V++ YT +++   K 
Sbjct  93    -FNKLVQLPESGLAAIGFITLSCFFRKYGLRQLLFLDGLRDDSGFVRRRYTRELNKVFKY  151

Query  552   LASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
             LA  +LP+F  +  +KI +F T    +P+  + +  N ++ IL+L+SW+YR  +  LVCV
Sbjct  152   LACILLPSFFIELTHKIIFFSTIQLSLPHISSSVPVNSIMFILVLASWVYRTGVFLLVCV  211

Query  732   LFRLICHLQILRLDGFAQVFE-KESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             +F L C LQILR  G  ++FE +ESE S I  E +RIR+ L V SHR+R FI+  +  +T
Sbjct  212   MFWLTCELQILRFKGLHKLFEGRESESSIIFQEQVRIRKQLWVTSHRYRFFIIGCMFTIT  271

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF +LL+   SK+      + +L +CS + ++G F CL  AA+ITH+AQ V ++A +W
Sbjct  272   VSQFGALLLVLASKTEKTFLNSGDLVVCSAVELSGFFCCLMEAARITHRAQGVVAIATRW  331

Query  1089  H---ACATLSSFDEFGDETPVDRTGT--GTPQAIHPVdadwenddeegdgddeldnTNMV  1253
             H    C +  S  ++        T T  G   + H                   D +  V
Sbjct  332   HMLLTCPSAGSEQQWKSRQISSETNTRCGESDSEH-----------------SSDISTSV  374

Query  1254  PVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             P    + S+  RQALV Y  HN  GIT+YGF LDR  LHT+F  + SL LW+L+K + +S
Sbjct  375   PPQEPS-SFQTRQALVAYLSHNNGGITLYGFALDRGLLHTLFAFEFSLVLWVLSKVVVLS  433



>ref|XP_008365157.1| PREDICTED: uncharacterized protein LOC103428821 [Malus domestica]
Length=526

 Score =   270 bits (689),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 162/453 (36%), Positives = 246/453 (54%), Gaps = 37/453 (8%)
 Frame = +3

Query  87    QSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLW  266
             Q ++ G+P    ++  T  +L  S   L S                 +L W  LD S+ +
Sbjct  107   QISSPGRPNNNSNEPNTAPLLLQSSDELCS--------------FKGSLKWWALDHSSCF  152

Query  267   RAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFA  446
                LS+  F  LT+ VP+++ L     + D      FN +VQL  S  A I F +LS F 
Sbjct  153   GKFLSYFTFIFLTVLVPILTSLSLKLPSGDPIS---FNKLVQLPESSLAAIGFXTLSGFF  209

Query  447   RRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG  626
             R+YG+R+ LFLD L +++  V++GYT ++  + K LA  +LP+F  + A+KI +F T   
Sbjct  210   RKYGLRQLLFLDGLTDDSGFVRRGYTHELDKAFKYLACILLPSFFIELAHKIIFFSTVQI  269

Query  627   QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFE-KES  803
              +P+  + +  N ++ +L+L+SW+YR  +  LVCV+FRL C LQILR +G  ++FE +E 
Sbjct  270   SLPHISSSVPVNSIMFVLVLASWVYRTGVFLLVCVMFRLTCELQILRFEGLYKLFERREY  329

Query  804   EVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAEL  983
             E S I  EH+RIR+ L+V SHR+R FI+  +  +T SQF +LL+   SK+      + +L
Sbjct  330   ESSIIFQEHIRIRKQLKVTSHRYRFFIIGCMFTITVSQFGALLLVLASKTEKTFLNSGDL  389

Query  984   GLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH---ACATLSSFDEFGDETPVDRTG  1154
              +CS + ++GLF CL  AA+ITH+AQ V ++A +WH    C    S D+      +    
Sbjct  390   VVCSAVELSGLFCCLMEAARITHRAQGVVAIATRWHMLLTCPNAXS-DQQWKSRQISSEA  448

Query  1155  TGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGIT  1334
              G  +                D +   D +  VP    + S+  RQAL  Y  HN  GIT
Sbjct  449   NGRCRE--------------SDCEHSSDISTSVPPQQPS-SFQTRQALXAYLSHNNGGIT  493

Query  1335  VYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             +YGF LDR  LHT+F  + SL LW+L+K + +S
Sbjct  494   LYGFALDRGXLHTLFAFEFSLVLWVLSKVVVLS  526



>gb|KHN18230.1| hypothetical protein glysoja_025120 [Glycine soja]
Length=437

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 163/441 (37%), Positives = 248/441 (56%), Gaps = 31/441 (7%)
 Frame = +3

Query  105   KPIAMEDDEETEIILRLSKTALISSSY--HEISNAREVKRLMSALAWLFLDQSNLWRAGL  278
             K  +  ++   E   +L+   L+  SY  HE+ N R       +L W  LD S+L    +
Sbjct  20    KTPSFVENHPNEEKHQLNVPFLLRPSYATHELRNLRR------SLQWCALDHSSLVGQLI  73

Query  279   SWSLFFILTIGVPLVSYLVFSCDACDSKHQR-PFNAIVQLSLSVFATISFISLSCFARRY  455
             S+ +F  LTI VPL + L     +  S+     FN ++QL  S  A I+F +LS F  R+
Sbjct  74    SYVVFIFLTIAVPLFTSLFVHVPSSSSQLDPFNFNKLLQLPQSALAVIAFFTLSRFFPRH  133

Query  456   GVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIP  635
             G+R+ LFLD L +++  V++GYT ++  + + LA  +LP+F  +  +KI +F +    IP
Sbjct  134   GLRQLLFLDVLQDDSTYVRRGYTRELQKAFRYLACMILPSFFVELVHKIIFFSSVEISIP  193

Query  636   YFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVS  812
                ++   N V+ +L+L SW+YR  +  L CVLFRL C LQILR +G  ++FE   S+ +
Sbjct  194   CGTSL---NWVVFVLVLVSWVYRTGLFLLACVLFRLTCELQILRFEGLRKLFEGCGSDAN  250

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
              I  EH+RIRR L ++SHR+R FI++ L+ +T SQ  SLL+  ESKS    F + +L +C
Sbjct  251   MIFREHVRIRRQLWIMSHRYRFFIITCLVTITISQLGSLLLVLESKSDTTFFNSGDLVIC  310

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQA  1172
             S + + G F+CL  AA+ITH+AQ + S+A KWH   T +S +    +T +   G  +P A
Sbjct  311   SAVQLCGFFLCLMGAARITHRAQGIVSIATKWHMVVTNASAESEHWKTQMPE-GLPSPTA  369

Query  1173  IHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFML  1352
                               D   +   + V     S+  RQALVTY +HN  GIT++GF++
Sbjct  370   -----------------SDSDSSDIYISVTTQGPSFQTRQALVTYLQHNYGGITLFGFVV  412

Query  1353  DRTWLHTIFVIQLSLTLWILN  1415
             DR  LHT+F  + S+ LWIL+
Sbjct  413   DRGLLHTLFAFEFSMVLWILS  433



>ref|XP_001769917.1| predicted protein [Physcomitrella patens]
 gb|EDQ65277.1| predicted protein [Physcomitrella patens]
Length=439

 Score =   266 bits (680),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 160/442 (36%), Positives = 239/442 (54%), Gaps = 40/442 (9%)
 Frame = +3

Query  108   PIAMEDDEETEIILRLSKTALISSSYHE-ISNAR-EVKRLMSALAWLFLDQSNLWRAGLS  281
             P   E++ + E+I    K A +S+ Y   +SN R E+++  S LAWL LDQS+  +   S
Sbjct  33    PHDSEEELDHEVI---EKRAKLSNKYKRTLSNPRDELRQFRSGLAWLGLDQSSTIKVIWS  89

Query  282   WSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGV  461
               +F  L   VP+ ++   SC+ CD  HQ PF                            
Sbjct  90    GFVFVALAALVPIFNFTFVSCETCDESHQHPFE---------------------------  122

Query  462   RKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYF  641
              K L LD++ +E+++VQ GY  ++ +S  ILA  + PTFL   A++ WW+       PY 
Sbjct  123   -KTLLLDKIVKESEEVQLGYEEKLKNSFSILAGMLFPTFLIAIAHRGWWYSYVTVSFPYL  181

Query  642   YNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAIL  821
              ++   NV++    + SWLYR ++   +CVLFRL+C LQ+LRL G+ ++ E  SEV+ IL
Sbjct  182   ADVPRVNVILFGAAVISWLYRTSVFLFMCVLFRLMCSLQVLRLKGYNKLLETTSEVAIIL  241

Query  822   IEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMI  1001
              EH+RIR  L  ISHRFRLF++  L  +  SQ  SL     S    + F A +L +CS++
Sbjct  242   KEHMRIRAQLTTISHRFRLFLIFALFTIVFSQLSSLFEILLSAKQINFFRAGDLAVCSLV  301

Query  1002  MVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHP  1181
              +TGL +CL+ AAKITHKAQ + +  +KWHA AT          +  D          HP
Sbjct  302   QLTGLMLCLQGAAKITHKAQHIVAAVSKWHALATCCPSTIM--RSASDNLKGNVYGPAHP  359

Query  1182  VdadwenddeegdgddeldnTNMVPVHAHTI-SYHKRQALVTYFEHNKAGITVYGFMLDR  1358
             +     + ++    +       +    AH + ++ KRQALVTY + ++AGI++YGF+LDR
Sbjct  360   LLNKGSSSEDLEITNQLTFEQEL----AHDLEAFQKRQALVTYLQFSRAGISLYGFVLDR  415

Query  1359  TWLHTIFVIQLSLTLWILNKTI  1424
              +L+ IF +  S TL+IL KTI
Sbjct  416   GFLYMIFGVTFSSTLFILGKTI  437



>ref|XP_007137142.1| hypothetical protein PHAVU_009G103200g [Phaseolus vulgaris]
 gb|ESW09136.1| hypothetical protein PHAVU_009G103200g [Phaseolus vulgaris]
Length=432

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 165/446 (37%), Positives = 239/446 (54%), Gaps = 44/446 (10%)
 Frame = +3

Query  108   PIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWS  287
             P  +E  ++  + L L +    S + HE+ N R       +L    LD S+L    +S+ 
Sbjct  23    PSFLEKQQQLNVPLLLQQP---SYATHELRNLRR------SLQCCALDHSSLLTKLISYV  73

Query  288   LFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRK  467
             +F  LTI VPL + L     A        FN ++QL  S  A  +F +LS F   YG+R+
Sbjct  74    VFIFLTITVPLFTSLFVHIPA-SQLDPFSFNKLLQLPQSAIAIFAFFTLSRFFPSYGLRQ  132

Query  468   FLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYN  647
              LFLD L +++  V++GYT QI  + + LA  VLP+F+ +  +KI +F      +P    
Sbjct  133   LLFLDVLHDDSVYVRRGYTRQIQKAFRYLACMVLPSFIVELVHKIIFFSRVEISVP---C  189

Query  648   MILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVSAILI  824
               L N V+ +L+L SW+YR  +  L CVLFRL C LQILR +G  ++FE  ES+ + I  
Sbjct  190   GTLLNWVVFVLVLLSWVYRTGLFLLACVLFRLTCELQILRFEGLHKLFEGCESDANTIFR  249

Query  825   EHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIM  1004
             EH+RIRR L + SHR+R FI+S L+ +T SQ  SLL+  ESKS    F + +L +CS + 
Sbjct  250   EHVRIRRQLWITSHRYRFFIISCLVTITVSQLTSLLLVLESKSDTTFFNSGDLVICSAVQ  309

Query  1005  VTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFD------EFGDETPVDRTGTGTP  1166
             + G  +CL  AA+ITH+AQ + S+AAKWH   T +S +      +  +  P         
Sbjct  310   LCGFVLCLTGAARITHRAQGIVSIAAKWHMVVTNASAESEQWKGQMPEVLPGPSASDSDS  369

Query  1167  QAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGF  1346
               IH                        + V      +H RQALVTY +HN  GIT++GF
Sbjct  370   SEIH------------------------ISVTPRPCFFHTRQALVTYLQHNCGGITLFGF  405

Query  1347  MLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +LDR  LHT+F  +LS+ LWIL+  +
Sbjct  406   VLDRGLLHTLFAFELSMVLWILSMVV  431



>ref|XP_007227319.1| hypothetical protein PRUPE_ppa016430mg [Prunus persica]
 gb|EMJ28518.1| hypothetical protein PRUPE_ppa016430mg [Prunus persica]
Length=434

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 249/447 (56%), Gaps = 39/447 (9%)
 Frame = +3

Query  105   KPIAMEDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSW  284
             +P+A ++   T ++             H+  +  E++    +L W  LD S+     +S+
Sbjct  23    RPLANQNQPNTPLL-------------HQCCD--ELRSFRVSLKWWTLDHSSCLGKFISY  67

Query  285   SLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVR  464
               F  LTI VP+++   FS  +  S+    FN +VQL  S  A I FI+LS F R+YG+R
Sbjct  68    FTFIFLTILVPILA--AFSLKS-PSEDPISFNKLVQLPQSGLAAIGFITLSGFFRKYGLR  124

Query  465   KFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFY  644
             + LFLD L ++   V++GYT Q+  + K LA  +LP+F  + A+KI +F T    + +  
Sbjct  125   QLLFLDGLGDDTCFVRRGYTRQLDKAFKCLAYILLPSFFIELAHKIIFFCTVKISLLHIS  184

Query  645   NMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFE-KESEVSAIL  821
             + +  N ++ +L+L+SW+YR  +  LVCVLFRL C LQILR  G  ++FE +ESE S I 
Sbjct  185   SSVPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCELQILRFQGLHKLFEGRESESSVIF  244

Query  822   IEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMI  1001
              EH+RIR+ L V SHR+R FI+  + VVT SQF +LL+   SK+      + +L +CS++
Sbjct  245   QEHIRIRKQLWVTSHRYRFFIIGCMFVVTVSQFGALLLVLASKTEKTFLNSGDLVVCSVV  304

Query  1002  MVTGLFICLRSAAKITHKAQSVASLAAKWH---ACATLSSFDEFGDETPVDRTGTGTPQA  1172
              ++GLF+CL  AA+ITH+AQ ++++A +WH    C + +   +   +   +  G      
Sbjct  305   ELSGLFLCLMEAARITHRAQGISAIATRWHMLLTCPSAALDQQCKKQQSSEADGC-----  359

Query  1173  IHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFML  1352
                         +          T++ P      S+  RQALV Y  HN  GIT++GF L
Sbjct  360   ----------CGDTDSEFSSNVLTSVSPQEPS--SFQTRQALVAYLGHNSGGITLFGFPL  407

Query  1353  DRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             DR  LHT+F  + SL LW+L+K + +S
Sbjct  408   DRGLLHTLFAFEFSLVLWVLSKVVVLS  434



>ref|XP_003527815.1| PREDICTED: uncharacterized protein LOC100804399 [Glycine max]
Length=437

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 163/441 (37%), Positives = 247/441 (56%), Gaps = 31/441 (7%)
 Frame = +3

Query  105   KPIAMEDDEETEIILRLSKTALISSSY--HEISNAREVKRLMSALAWLFLDQSNLWRAGL  278
             K  +  ++   E   +L+   L+  SY  HE+ N R       +L W  LD S+L    +
Sbjct  20    KTPSFVENHPNEEKHQLNVPFLLRPSYATHELRNLRR------SLQWCALDHSSLVGQLI  73

Query  279   SWSLFFILTIGVPLVSYLVFSCDACDSK-HQRPFNAIVQLSLSVFATISFISLSCFARRY  455
             S+ +F  LTI VPL + L     +  S+     FN ++QL  S  A I+F +LS F  R+
Sbjct  74    SYVVFIFLTIAVPLFTSLFVHVPSSSSQLDPFNFNKLLQLPQSALAVIAFFTLSRFFPRH  133

Query  456   GVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIP  635
             G+R+ LFLD L +++  V++GYT ++  + + LA  +LP+F  +  +KI +F +    IP
Sbjct  134   GLRQLLFLDVLQDDSTYVRRGYTRELQKAFRYLACMILPSFFVELVHKIIFFSSVEISIP  193

Query  636   YFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVS  812
                ++   N V+ +L+L SW+YR  +  L CVLFRL C LQILR +G  ++FE   S+ +
Sbjct  194   CGTSL---NWVVFVLVLVSWVYRTGLFLLACVLFRLTCELQILRFEGLRKLFEGCGSDAN  250

Query  813   AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLC  992
              I  EH+RIRR L + SHR+R FI++ L+ +T SQ  SLL+  ESKS    F + +L +C
Sbjct  251   MIFREHVRIRRQLWITSHRYRFFIITCLVTITISQLGSLLLVLESKSATTFFNSGDLVIC  310

Query  993   SMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQA  1172
             S + + G F+CL  AA+ITH+AQ + S+A KWH   T +S +    +T +   G  +P A
Sbjct  311   SAVQLCGFFLCLMGAARITHRAQGIVSIATKWHMVVTNASAESEHWKTQMPE-GLPSPTA  369

Query  1173  IHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFML  1352
                               D   +   + V     S+  RQALVTY +HN  GIT++GF++
Sbjct  370   -----------------SDSDSSDIYISVTTQGPSFQTRQALVTYLQHNYGGITLFGFVV  412

Query  1353  DRTWLHTIFVIQLSLTLWILN  1415
             DR  LHT+F  + S+ LWIL+
Sbjct  413   DRGLLHTLFAFEFSMVLWILS  433



>ref|XP_010532188.1| PREDICTED: uncharacterized protein LOC104808241 [Tarenaya hassleriana]
 ref|XP_010532189.1| PREDICTED: uncharacterized protein LOC104808241 [Tarenaya hassleriana]
Length=434

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/415 (37%), Positives = 240/415 (58%), Gaps = 18/415 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYL-VFSCDACDSKHQRP--F  377
             +++    +L W  LD S+ W   LS+  F + TI VPLVS L + + ++  S  + P  F
Sbjct  32    DLRNFRVSLKWCALDHSSPWGKILSYFTFVVFTILVPLVSCLSIETPNSLSSPVEDPISF  91

Query  378   NAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
             NA+VQ   S  AT+ F +L CF R+YG+R+ LFLD L +++  V++GY+ ++  + + +A
Sbjct  92    NALVQFPESGLATVGFFTLICFFRKYGLRQLLFLDGLGDDSVFVRRGYSRELDKAFRYVA  151

Query  558   SFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILS-NVVICILLLSSWLYRIAISFLVCVL  734
             + +LP+F  +  +K  +F +     P+  +  L  N V+  L+L SW+YR  +  LVC+L
Sbjct  152   AILLPSFFVELVHKSIFFSSTKVSFPFMKSSCLPLNSVMFFLVLVSWVYRTGVFLLVCIL  211

Query  735   FRLICHLQILRLDGFAQVFEK--ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             FRL C LQILR  G  ++F+      +  I  EH RI++ L   SHR+R FI+++ +V++
Sbjct  212   FRLTCELQILRFVGLHKMFDGCGSDTIEDIYKEHTRIKKQLSATSHRYRFFIIASSVVIS  271

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
             ASQFV+LL+   SKS      + +L +CS + ++G F+CL  A +ITH+AQ V S+A +W
Sbjct  272   ASQFVALLLVLASKSEKSFLNSGDLVVCSAVQLSGFFLCLLGAVRITHRAQGVVSIATRW  331

Query  1089  HACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAH  1268
             H   TL+S      +    + G    QA        E+D +  D      ++++ P    
Sbjct  332   HMTLTLASSASLDSDGRKIQDGMPESQA--------ESDTDSSDNICITVSSSLDP----  379

Query  1269  TISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             T  +  RQALV Y  HN  GIT+YG+ LDR  LHT+F  + SL +WIL+K + +S
Sbjct  380   TSFFQARQALVEYLRHNNKGITLYGYTLDRGLLHTLFAFEFSLVMWILSKVVVLS  434



>ref|XP_006483640.1| PREDICTED: uncharacterized protein LOC102622682 isoform X1 [Citrus 
sinensis]
 gb|KDO67160.1| hypothetical protein CISIN_1g013040mg [Citrus sinensis]
Length=451

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 162/469 (35%), Positives = 248/469 (53%), Gaps = 36/469 (8%)
 Frame = +3

Query  81    LKQSTNQGKPIAME-----DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLF  245
             +K   N G    ++       E   ++L+ S     S  + E+ N R       +L W  
Sbjct  1     MKSPKNSGDETRVDIQFNLQQENVPLLLQPSYARSKSLLFDELRNFR------ISLKWCA  54

Query  246   LDQSNLWRAGLSWSLFFILTIGVPLVSYLVF----SCDACDSKHQRPFNAIVQLSLSVFA  413
             LD S+     +S+  F  L I VPL+S L      S   C       FN +VQ   S  A
Sbjct  55    LDHSSCIGKFISYFAFIFLAIIVPLISSLCIKVPSSTQDCAQDGPVSFNKLVQFPESGLA  114

Query  414   TISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCA  593
              + F  LS F  +YG+R  LFLD L E++  V++GYT ++  + + LA  +LP+F  + A
Sbjct  115   LVGFFILSRFFSKYGLRHLLFLDGLQEDSLFVRRGYTRELDKAFRYLACILLPSFFVELA  174

Query  594   YKIWWFVT------GGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHL  755
             +KI +F T      GGG  P+     ++++V+ +L+L+SW+YR  +  LVCV+FRL C L
Sbjct  175   HKIIYFSTVRVSFPGGGGDPW-----INSIVMFVLVLASWVYRTGLYLLVCVMFRLTCEL  229

Query  756   QILRLDGFAQVFEKE---SEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVS  926
              ILR +G   +FE     S+   I  EHLRIR+ L   SHR+R FI+++L+V++ SQ  +
Sbjct  230   HILRFEGLHNMFEGRRSGSDAGFIFREHLRIRKQLSATSHRYRFFIIASLVVISISQMGA  289

Query  927   LLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
             LL+   + +    F++ EL +CS + ++G F+C+  AA+ITH+AQ + S+A +WH  AT 
Sbjct  290   LLLILGTHADKSFFSSGELVVCSAVELSGFFLCVLGAARITHRAQGITSVATRWHMTATC  349

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             +S    G ++     G               +D +     +    ++  P      S+  
Sbjct  350   ASVG--GSDSGKGNAGEAADHDQCRDSTSSSSDSDSSSDINIKVLSSQEPP-----SFQI  402

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALV Y +HN  GIT++GF LDR  LHTIF  + SL LWIL+K + +S
Sbjct  403   RQALVAYLQHNNGGITLFGFALDRGLLHTIFAFEFSLVLWILSKVVVLS  451



>ref|XP_008220009.1| PREDICTED: uncharacterized protein LOC103320155 [Prunus mume]
Length=431

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 238/420 (57%), Gaps = 26/420 (6%)
 Frame = +3

Query  186   HEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKH  365
             H+ S+  E++    +L W  LD S+     +S+  F  LTI VP+++   FS  +  S+ 
Sbjct  34    HQCSD--ELRNFRVSLKWWTLDHSSCLGKFISYFTFIFLTILVPILA--AFSLKS-PSED  88

Query  366   QRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSL  545
                FN +VQL  S  A I FI+LS F R+YG+R+ LFLD L ++   V++GYT ++  + 
Sbjct  89    PISFNKLVQLPQSGLAAIGFITLSSFFRKYGLRQLLFLDGLGDDTCFVRRGYTRELDKAF  148

Query  546   KILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLV  725
             K LA  +LP+F  + A+KI +F T    + +  + +  N ++ +L+L+SW+YR  +  LV
Sbjct  149   KCLAYILLPSFFIELAHKIIFFCTVKISLLHISSSVPLNSIMFVLVLASWVYRTGVFLLV  208

Query  726   CVLFRLICHLQILRLDGFAQVFE-KESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIV  902
             CVLFRL C LQILR  G  ++FE +ES+ S I  EH+RIR+ L V SHR+R FI+    V
Sbjct  209   CVLFRLTCELQILRFQGLHKLFEGRESKSSFIFQEHIRIRKQLWVTSHRYRFFIIGCTFV  268

Query  903   VTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAA  1082
             VT SQF +LL+   SK+      + +L +CS + ++G F+CL  AA+ITH+AQ ++++A 
Sbjct  269   VTVSQFGALLLVLASKTKKTFLNSGDLVVCSAVELSGFFLCLMEAARITHRAQGISAIAT  328

Query  1083  KWH---ACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMV  1253
             +WH    C + +   +   +   +  G                  E          T++ 
Sbjct  329   RWHMLLTCPSAALDQQCKKQQSSEADGC---------------CGETDSEFSSNVLTSVS  373

Query  1254  PVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             P      S+  RQALV Y  HN  GIT++GF LDR  LHT+F  + SL LW+L+K + +S
Sbjct  374   PQEPS--SFQTRQALVAYLGHNSGGITLFGFPLDRGLLHTLFAFEFSLVLWVLSKVVVLS  431



>ref|XP_003545561.1| PREDICTED: uncharacterized protein LOC100783743 [Glycine max]
 gb|KHN47917.1| hypothetical protein glysoja_047349 [Glycine soja]
Length=455

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/411 (37%), Positives = 227/411 (55%), Gaps = 18/411 (4%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQR-PFNA  383
             E++    +L W  LD S+     +S+  F   TI VPL + +     A   +     FN 
Sbjct  61    ELRNFRISLKWCALDHSSFIGRLISYVTFIFFTIVVPLFTSIFVEVPASAPEDDPISFNK  120

Query  384   IVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASF  563
             +VQL  S  A ++F +LS F +RYG+R+ LFLD L E+   V++GYT ++  + + L   
Sbjct  121   LVQLPESGLAIVAFFTLSSFFKRYGLRQLLFLDALQEDTTYVRRGYTRELEKAFRYLTYI  180

Query  564   VLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRL  743
             +LP+F  + A+KI +F       P+       N ++ +L+L SW+YR  +  LVCVLFRL
Sbjct  181   ILPSFFMELAHKIIFFSAVKISAPHISPGFPLNSIVFVLVLVSWVYRTGVFLLVCVLFRL  240

Query  744   ICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQF  920
              C LQ LR +G  ++FE   SE   I  EH+RIRR L V SHR+R FI+  ++ +T SQ 
Sbjct  241   TCELQKLRFEGVHKLFEGCGSEAGVIFKEHVRIRRQLWVTSHRYRFFIIGCVVTITVSQL  300

Query  921   VSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
              +LL+   SKS    F + +L +CS + ++G F+C+  AA+ITH+AQ + ++A +WH   
Sbjct  301   GALLLVLASKSDKTFFNSGDLVICSAVQLSGFFLCILGAARITHRAQGIVAIATRWHMLV  360

Query  1101  TLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISY  1280
             T +S +    E  V                   +DD+    D    + +++P      S+
Sbjct  361   TTASAESEHCEAQVSEG--------------LASDDDSDSDDSSNIHVSVIP--PQLSSF  404

Query  1281  HKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
               RQ LVTY +HN  GITVYG+ LDR  LHT+F  + SL LWIL+K + +S
Sbjct  405   QTRQTLVTYLQHNHGGITVYGYSLDRGLLHTLFAFEFSLVLWILSKVVVLS  455



>ref|XP_006450085.1| hypothetical protein CICLE_v10008275mg [Citrus clementina]
 gb|ESR63325.1| hypothetical protein CICLE_v10008275mg [Citrus clementina]
Length=449

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 234/422 (55%), Gaps = 25/422 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVF----SCDACDSKHQRP  374
             E++    +L W  LD S+ +   +S+  F  L I VPL+S L      S   C       
Sbjct  40    ELRNFRISLKWCALDHSSCFGKFISYFAFIFLAIIVPLISSLCIKVPSSTQDCAQDGPVS  99

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             FN +VQ   S  A + F  LS F  +YG+R  LFLD L E++  V++GYT ++  + + L
Sbjct  100   FNKLVQFPESGLALVGFFILSRFFSKYGLRHLLFLDGLQEDSLFVRRGYTRELDKAFRYL  159

Query  555   ASFVLPTFLADCAYKIWWFVT------GGGQIPYFYNMILSNVVICILLLSSWLYRIAIS  716
             A  +LP+F  + A+KI +F T      GGG  P+     ++++V+ +L+L+SW+YR  + 
Sbjct  160   ACILLPSFFVELAHKIIYFSTVRVSFPGGGGDPW-----INSIVMFVLVLASWVYRTGLY  214

Query  717   FLVCVLFRLICHLQILRLDGFAQVFEKE---SEVSAILIEHLRIRRNLRVISHRFRLFIL  887
              LVCV+FRL C L ILR +G   +FE     S+   I  EHLRIR+ L   SHR+R FI+
Sbjct  215   LLVCVMFRLTCELHILRFEGLHNMFEGRRSGSDAGFIFREHLRIRKQLSGTSHRYRFFII  274

Query  888   STLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSV  1067
             ++L+V++ SQ  +LL+   + +    F++ EL +CS + ++G F+C+  AA+ITH+AQ +
Sbjct  275   ASLVVISISQMGALLLILGTHADKSFFSSGELVVCSAVELSGFFLCVLGAARITHRAQGI  334

Query  1068  ASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTN  1247
              S+A +WH  AT +S    G ++     G               +D +     +    ++
Sbjct  335   TSVATRWHMTATCASVG--GSDSGKGNAGEAADHDQCRDSTSSSSDSDSSSDINIKVLSS  392

Query  1248  MVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
               P      S+  RQALV Y +HN  GIT++GF LDR  LHTIF  + SL LWIL+K + 
Sbjct  393   QEPP-----SFQIRQALVAYLQHNNGGITLFGFALDRGLLHTIFAFEFSLVLWILSKVVV  447

Query  1428  IS  1433
             +S
Sbjct  448   LS  449



>ref|XP_010029421.1| PREDICTED: uncharacterized protein LOC104419453 isoform X1 [Eucalyptus 
grandis]
Length=447

 Score =   259 bits (661),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 238/421 (57%), Gaps = 37/421 (9%)
 Frame = +3

Query  201   AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDS-KHQRPF  377
             + +++    +L W  LDQS+ +   +S   F + T  +P+VS L     +    ++   F
Sbjct  54    SDDLRHFRISLRWCALDQSSCFGMFISIFTFVLFTFVIPIVSSLAVKVPSTAPVENPISF  113

Query  378   NAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILA  557
             N +VQ   S  A I F +L  F  +YG+R+ LFLD L  ++  V++ Y  ++  S + L+
Sbjct  114   NLLVQFPESGLAAIGFFTLCRFFNKYGLRQLLFLDVLEYDSAPVRRNYARELDKSFRYLS  173

Query  558   SFVLPTFLADCAYKIWWF--VTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCV  731
               +LP+FL + A+K+ +F  V+    +P+ +    SN V+ +L+L+SW+YR  I  LVCV
Sbjct  174   YILLPSFLVELAHKVVFFSTVSMSFSLPFPFP---SNAVLFVLVLASWIYRTGIFLLVCV  230

Query  732   LFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVT  908
             LFRL C LQILRL G   + E   S+ SAI  EH+RIR+ L   SHR+R FI+S L+ +T
Sbjct  231   LFRLTCELQILRLGGLHGMLEGCGSDPSAIFDEHVRIRKQLSATSHRYRFFIISCLLTMT  290

Query  909   ASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKW  1088
              SQF +LL+   SK+  + F + +L +CS++ ++GLF+CL  AA+ITH+AQ +ASLA +W
Sbjct  291   VSQFAALLIVLASKTEKNFFNSGDLVVCSVVELSGLFLCLLGAARITHRAQGIASLATRW  350

Query  1089  HACATLSSFDEFGDETP--VDRTG--TGTPQAIHPVdadwenddeegdgddeldnTNMVP  1256
             +   T +S        P  V+  G  + T   +                        ++P
Sbjct  351   NMLVTSASASGSNRPKPETVEHNGWHSDTDSDL------------------------LIP  386

Query  1257  VH--AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGI  1430
             V   + + S+  RQALV Y E N  GIT+YGF LDR  LHTIF  + SL LWIL+K + +
Sbjct  387   VSTFSDSSSFQIRQALVAYLERNNGGITLYGFALDRGLLHTIFAFEFSLVLWILSKVVVL  446

Query  1431  S  1433
             S
Sbjct  447   S  447



>gb|KCW56336.1| hypothetical protein EUGRSUZ_I02070 [Eucalyptus grandis]
Length=444

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 158/419 (38%), Positives = 237/419 (57%), Gaps = 39/419 (9%)
 Frame = +3

Query  201   AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--  374
             + +++    +L W  LDQS+ +   +S   F + T  +P+VS L     +  +  + P  
Sbjct  54    SDDLRHFRISLRWCALDQSSCFGMFISIFTFVLFTFVIPIVSSLAVKVPST-APVENPIS  112

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             FN +VQ   S  A I F +L  F  +YG+R+ LFLD L  ++  V++ Y  ++  S + L
Sbjct  113   FNLLVQFPESGLAAIGFFTLCRFFNKYGLRQLLFLDVLEYDSAPVRRNYARELDKSFRYL  172

Query  555   ASFVLPTFLADCAYKIWWF--VTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +  +LP+FL + A+K+ +F  V+    +P+ +    SN V+ +L+L+SW+YR  I  LVC
Sbjct  173   SYILLPSFLVELAHKVVFFSTVSMSFSLPFPFP---SNAVLFVLVLASWIYRTGIFLLVC  229

Query  729   VLFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             VLFRL C LQILRL G   + E   S+ SAI  EH+RIR+ L   SHR+R FI+S L+ +
Sbjct  230   VLFRLTCELQILRLGGLHGMLEGCGSDPSAIFDEHVRIRKQLSATSHRYRFFIISCLLTM  289

Query  906   TASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAK  1085
             T SQF +LL+   SK+  + F + +L +CS++ ++GLF+CL  AA+ITH+AQ +ASLA +
Sbjct  290   TVSQFAALLIVLASKTEKNFFNSGDLVVCSVVELSGLFLCLLGAARITHRAQGIASLATR  349

Query  1086  WHACATLSSFDEFGDETP--VDRTG--TGTPQAIHPVdadwenddeegdgddeldnTNMV  1253
             W+   T +S        P  V+  G  + T   +                        ++
Sbjct  350   WNMLVTSASASGSNRPKPETVEHNGWHSDTDSDL------------------------LI  385

Query  1254  PVH--AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             PV   + + S+  RQALV Y E N  GIT+YGF LDR  LHTIF  + SL LWIL+K I
Sbjct  386   PVSTFSDSSSFQIRQALVAYLERNNGGITLYGFALDRGLLHTIFAFEFSLVLWILSKVI  444



>ref|XP_009367974.1| PREDICTED: uncharacterized protein LOC103957521 [Pyrus x bretschneideri]
Length=438

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 153/404 (38%), Positives = 232/404 (57%), Gaps = 27/404 (7%)
 Frame = +3

Query  228   ALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSV  407
             +L W  LD S+     +S+  F  LTI VP+++ L  +     S     FN +VQL  S 
Sbjct  54    SLKWWALDHSSCLGKFISYFTFIFLTILVPILTSLSLN----TSSDPISFNKLVQLPESG  109

Query  408   FATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLAD  587
              A I FI+LS F R+YG+R+ LFLD L +++  V++ YT +++ + K LA  +LP+F  +
Sbjct  110   LAAIGFITLSGFFRKYGLRQLLFLDGLGDDSGFVRREYTRELNKAFKSLACILLPSFFIE  169

Query  588   CAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILR  767
              A+KI +F T    +P+  + +  N ++ +++L+SW+YR  +  LVCVLFRL C LQILR
Sbjct  170   LAHKIIFFCTVKISLPHISSSVPLNSIMFVIVLASWVYRTGVFLLVCVLFRLTCELQILR  229

Query  768   LDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTE  944
                  ++FE  ESE S I  EH+RIR+ L V SHR+R FI+  L ++T SQF +LL+   
Sbjct  230   FQELHKLFEGCESESSIIFKEHVRIRKQLWVTSHRYRFFIIGCLFIITVSQFGALLLVLA  289

Query  945   SKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH---ACATLSSF  1115
             SK+      + +L +CS + ++GLF+CL  AA+ITH+AQ + ++A +WH    C +  S 
Sbjct  290   SKTEKTFLNSGDLVVCSAVELSGLFLCLMEAARITHRAQGIVAIATRWHMFLTCPSTLSD  349

Query  1116  DEFGDETPVDRTGT-GTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQ  1292
              +  +    + +G  G   + H                   D  + VP    + S+  RQ
Sbjct  350   QQCKNWLRSEASGQHGESDSEH-----------------LSDVFSSVPQEEPS-SFQTRQ  391

Query  1293  ALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             ALV Y  HN  GIT++GFMLDR  L T+F  + SL LWIL++ +
Sbjct  392   ALVAYLRHNNGGITLFGFMLDRGSLRTLFAFEFSLVLWILSRVV  435



>ref|XP_010029422.1| PREDICTED: uncharacterized protein LOC104419453 isoform X2 [Eucalyptus 
grandis]
Length=443

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 157/417 (38%), Positives = 236/417 (57%), Gaps = 39/417 (9%)
 Frame = +3

Query  201   AREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--  374
             + +++    +L W  LDQS+ +   +S   F + T  +P+VS L     +  +  + P  
Sbjct  54    SDDLRHFRISLRWCALDQSSCFGMFISIFTFVLFTFVIPIVSSLAVKVPST-APVENPIS  112

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             FN +VQ   S  A I F +L  F  +YG+R+ LFLD L  ++  V++ Y  ++  S + L
Sbjct  113   FNLLVQFPESGLAAIGFFTLCRFFNKYGLRQLLFLDVLEYDSAPVRRNYARELDKSFRYL  172

Query  555   ASFVLPTFLADCAYKIWWF--VTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +  +LP+FL + A+K+ +F  V+    +P+ +    SN V+ +L+L+SW+YR  I  LVC
Sbjct  173   SYILLPSFLVELAHKVVFFSTVSMSFSLPFPFP---SNAVLFVLVLASWIYRTGIFLLVC  229

Query  729   VLFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             VLFRL C LQILRL G   + E   S+ SAI  EH+RIR+ L   SHR+R FI+S L+ +
Sbjct  230   VLFRLTCELQILRLGGLHGMLEGCGSDPSAIFDEHVRIRKQLSATSHRYRFFIISCLLTM  289

Query  906   TASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAK  1085
             T SQF +LL+   SK+  + F + +L +CS++ ++GLF+CL  AA+ITH+AQ +ASLA +
Sbjct  290   TVSQFAALLIVLASKTEKNFFNSGDLVVCSVVELSGLFLCLLGAARITHRAQGIASLATR  349

Query  1086  WHACATLSSFDEFGDETP--VDRTG--TGTPQAIHPVdadwenddeegdgddeldnTNMV  1253
             W+   T +S        P  V+  G  + T   +                        ++
Sbjct  350   WNMLVTSASASGSNRPKPETVEHNGWHSDTDSDL------------------------LI  385

Query  1254  PVH--AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNK  1418
             PV   + + S+  RQALV Y E N  GIT+YGF LDR  LHTIF  + SL LWIL+K
Sbjct  386   PVSTFSDSSSFQIRQALVAYLERNNGGITLYGFALDRGLLHTIFAFEFSLVLWILSK  442



>ref|XP_008393923.1| PREDICTED: uncharacterized protein LOC103456071 [Malus domestica]
Length=438

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 162/440 (37%), Positives = 241/440 (55%), Gaps = 40/440 (9%)
 Frame = +3

Query  120   EDDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFI  299
             +D  + +I L      L+ SSY       E+     +L W  LD S+     +S+  F  
Sbjct  31    DDSNQPDIPL------LLQSSY-------ELCSFRVSLKWWALDHSSCLGKFVSYFTFIF  77

Query  300   LTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
             LTI VP+V+ L  +     S     FN +VQL  S  A I FI+LS F R+YG+R+ LFL
Sbjct  78    LTILVPIVTSLSLN----TSSDPISFNKLVQLPESGLAAIGFITLSGFFRKYGLRQLLFL  133

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILS  659
             D L +++  V++ YT +++ + K LA  +LP+F  + A+KI +F T    +P+  + +  
Sbjct  134   DGLGDDSGFVRREYTRELNKAFKSLACILLPSFFIELAHKIIFFCTVKISLPHISSSVPL  193

Query  660   NVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHLR  836
             N ++ + +L+SW+YR  +  LVCVLFRL C LQILR     ++FE  E + S I  EH+R
Sbjct  194   NSIMFVFVLASWVYRTGVFLLVCVLFRLTCELQILRFQELHKLFEGCEXDSSIIFKEHVR  253

Query  837   IRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGL  1016
             IR+ L V SHR+R FI+  L  +T SQF +LL+   SK+      + +L +CS + ++GL
Sbjct  254   IRKQLWVTSHRYRFFIIGCLFTITVSQFGALLLVLASKTEKTFLNSGDLVVCSAVELSGL  313

Query  1017  FICLRSAAKITHKAQSVASLAAKWH---ACATLSSFDEFGDETPVDRTG-TGTPQAIHPV  1184
             F+CL  AA+ITH+AQ + ++A +WH    C +  S  +       + +G  G   + H  
Sbjct  314   FLCLMEAARITHRAQGIVAIATRWHMFLTCPSALSDQQCKKWLRSEASGHHGESDSEH--  371

Query  1185  dadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTW  1364
                              D  + VP    + S+  RQALV Y  HN  GIT+YGFMLDR  
Sbjct  372   ---------------LSDVFSSVPQEEPS-SFQTRQALVVYLRHNNGGITLYGFMLDRGS  415

Query  1365  LHTIFVIQLSLTLWILNKTI  1424
             L T+F  Q SL LWIL++ +
Sbjct  416   LRTLFAFQFSLVLWILSRVV  435



>ref|XP_004498558.1| PREDICTED: uncharacterized protein LOC101507189 [Cicer arietinum]
Length=441

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 164/460 (36%), Positives = 248/460 (54%), Gaps = 37/460 (8%)
 Frame = +3

Query  105   KPIAMEDDEETEIILRLS--KTALISSSYH-----EISNAR-------EVKRLMSALAWL  242
             KP ++E + ET I +  S  K A IS+ ++     + S AR       E++     L W 
Sbjct  2     KP-SIEPNNETTIDIENSNSKRASISNQHNVPLLLQPSYARSKSIIYDELRNFRICLKWC  60

Query  243   FLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--FNAIVQLSLSVFAT  416
              LD S+     +S+  F  LT+ VPL + L     A  S    P   N +VQ+  S  A 
Sbjct  61    ALDHSSCVGKLISYVSFIFLTLIVPLFTTLFVQVSA-SSPENDPISLNKLVQIPESALAI  119

Query  417   ISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAY  596
             ISF +LS F RRYG+R+ LFLD L ++   V++GY  ++  + + L   +LP+F  +  +
Sbjct  120   ISFFTLSRFFRRYGLRQLLFLDALQDDATFVRRGYARELEKAFRYLGYIILPSFFVELGH  179

Query  597   KIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDG  776
             KI +        P+       N ++ +L+L SW+YR  +  LVCV+FRL C LQILR +G
Sbjct  180   KIIFLSAVKISAPHISAGFPLNSIVFVLVLVSWVYRTGVYLLVCVIFRLTCQLQILRFEG  239

Query  777   FAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKS  953
               ++FE   SE   I  EH+RIRR L VISHR+R FI+  ++ ++ SQ  +LL+   SKS
Sbjct  240   VHKLFEGCGSEAGFIFKEHVRIRRQLWVISHRYRFFIICCVVTMSVSQLGALLLVLASKS  299

Query  954   HAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDE  1133
                 F + +L +CS + ++G  +C+  AAKITH+AQ + S+A +WH   T ++F E   E
Sbjct  300   KKTFFNSGDLVICSAVQLSGFLLCILGAAKITHRAQGIVSIATRWHMLVT-NAFAE--SE  356

Query  1134  TPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFE  1313
                D+                         D +  + ++  +     S+H RQ+LVTY +
Sbjct  357   QCKDQMSEALASD---------------SSDSDSSDIHITIIPQRLSSFHTRQSLVTYLQ  401

Query  1314  HNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             HN  GIT+YGF LDR +LHT+F  + S+ LWIL+K + +S
Sbjct  402   HNHGGITLYGFTLDRGFLHTLFAFEFSIVLWILSKVVVLS  441



>ref|XP_011006658.1| PREDICTED: uncharacterized protein LOC105112614 isoform X1 [Populus 
euphratica]
Length=456

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 161/469 (34%), Positives = 254/469 (54%), Gaps = 20/469 (4%)
 Frame = +3

Query  48    MINKTIKPRT*LKQSTNQGKPIAMEDDEETEIILRLSKTALISSSYHEISNA--REVKRL  221
             MI  +      L    + G+ +   D+      LR S   L+  SY    +    E++  
Sbjct  1     MIKTSTASGDTLTDIHSSGRHVTFPDENNQSSQLRASVPLLLQPSYAGSKSLLFDELRNF  60

Query  222   MSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSC-DACDSKHQRPFNAIVQLS  398
               +L W  LD S      +S  +F  L I +P+VS L      +  +     +N +VQL 
Sbjct  61    RISLKWCALDHSTCIGKFVSCFIFVFLAIILPIVSSLSIRVPSSVPANDPVSYNKLVQLP  120

Query  399   LSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTF  578
              SV A ISF +L    +RYG+R+ LFLD L E++  +++GY+ ++  + + LA  + P+F
Sbjct  121   ESVLALISFFTLFRSFKRYGLRQLLFLDDLQEDSLFIRRGYSRELDKAFRYLACILFPSF  180

Query  579   LADCAYKIWWFVTGGGQIP--YFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICH  752
               + A+KI +F T    +P   F   I  N ++ +L+L+SW+YR  +  LVCVLFRL C 
Sbjct  181   FVEVAHKIIFFSTVKIWLPCNVFPGNIPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCE  240

Query  753   LQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSL  929
             LQILR +G  ++F+  ES+   I  EH+RI++ L   SHR+R FI+S L+ +T SQF SL
Sbjct  241   LQILRFEGLHKLFDGCESDAGVIFREHIRIKKQLSFTSHRYRFFIISCLVTITVSQFGSL  300

Query  930   -LVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATL  1106
              LV   +    + F + +L +CS + + G F+CL  AA+ITH+AQ + S+A +WH     
Sbjct  301   WLVLGFNNIEKNFFNSGDLVICSAVQLCGFFLCLLGAARITHRAQGIVSIATRWHMIVAS  360

Query  1107  SSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHK  1286
             +S       T +D+  +  P+A   ++++ E+ + +        ++          S+  
Sbjct  361   AS-------TRIDQGKSHVPEADGTLESNAEDSESDSSDILIAISSQ------DPCSFQT  407

Query  1287  RQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             RQALV Y +HN  GIT++GF LDR  LHT+F  + SL LWIL+K + +S
Sbjct  408   RQALVAYLQHNNGGITLFGFALDRGLLHTLFAFEFSLVLWILSKVVVLS  456



>gb|EMS51983.1| hypothetical protein TRIUR3_23467 [Triticum urartu]
Length=379

 Score =   254 bits (648),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 196/312 (63%), Gaps = 16/312 (5%)
 Frame = +3

Query  504   KVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILL  683
              V+ GYT+Q+  S  +LA FVLP FLAD AYK++W+       P +++        C + 
Sbjct  82    DVRAGYTVQLAGSFHLLACFVLPCFLADAAYKVFWYC-AHRPFPAWWS-----AAACAME  135

Query  684   LSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEKESEVSAILIEHLRIRRNLRVIS  863
             ++SW+YR A+ F+ CVLFR+IC+LQILR+ GFA+ F + ++V+A+L +        R  S
Sbjct  136   MASWMYRTAMFFMACVLFRIICYLQILRMTGFARDFGQCADVAAVLGQ--------RRTS  187

Query  864   HRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAK  1043
             HR+R FI+  L++VTASQF +LL  T   +  +I  A EL LCS+ +V GL ICL SAAK
Sbjct  188   HRYRKFIMYCLLLVTASQFTALLGATRPHAQVNIATAGELALCSLSLVAGLLICLHSAAK  247

Query  1044  ITHKAQSVASLAAKWHACATLSSF--DEFGDETPVDRTGTGTPQAIHPVdadwenddeeg  1217
             ITHK Q++ S+AA WHA AT+ +   D+    TP             P     ++D+   
Sbjct  248   ITHKTQAITSIAAAWHADATIDTVERDQENPRTPSRSCLQQQQVPPSPDSDQSDDDEMSP  307

Query  1218  dgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSL  1397
               D    ++     HA  ISY KRQALVTY E+N+AGITV+GF++DRTWLH +F+++ SL
Sbjct  308   SEDSLDTSSKFTSFHATHISYQKRQALVTYLENNRAGITVFGFVVDRTWLHALFMLEFSL  367

Query  1398  TLWILNKTIGIS  1433
              +W+L KTIGIS
Sbjct  368   VMWLLGKTIGIS  379



>ref|XP_007140992.1| hypothetical protein PHAVU_008G158000g [Phaseolus vulgaris]
 gb|ESW12986.1| hypothetical protein PHAVU_008G158000g [Phaseolus vulgaris]
Length=453

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/413 (37%), Positives = 226/413 (55%), Gaps = 25/413 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPF--N  380
             E++    +L W  LD S+     +S+  F   TI VPL++  +F      +    PF  N
Sbjct  61    ELRNFRISLKWCALDHSSCVGKLISYVTFIFFTIIVPLLTS-IFVEVPSSAPEDDPFSFN  119

Query  381   AIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILAS  560
              +VQL  S  A ISF ++S F RRYG+R+ LFLD L E+   V++GYT ++  + + L  
Sbjct  120   KLVQLPESGLAIISFFTISSFFRRYGLRQLLFLDALQEDTVYVRRGYTRELEKAFRYLTY  179

Query  561   FVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
              +LP+FL +  +KI +F       P        N ++ +L+L  W+YR  +  L+CVLFR
Sbjct  180   IILPSFLVELVHKIIFFSAVKISTPGITPGFPLNSIVFVLVLVCWVYRTGVFLLLCVLFR  239

Query  741   LICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             L C LQ LR +G  ++FE   SE   I  EH+RIRR L V SHR+R FI+ +L+ +T S 
Sbjct  240   LTCELQKLRFEGVHKLFEGCGSEAGVIFKEHVRIRRQLWVTSHRYRFFIIGSLVTITVSH  299

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               +LL+   SKS    F + +L +CS + ++G F+C+  AA+ITH+AQ + ++A +WH  
Sbjct  300   LGALLLVLASKSDKTFFNSGDLVICSAVQLSGFFLCILGAARITHRAQGIVAIATRWHML  359

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNM-VPVHAHTI  1274
              T +S +    +T V                            D  D++N+ V V     
Sbjct  360   VTTASAESEHCKTQVSEG--------------------LASDSDSDDSSNIHVSVIPQLS  399

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             S+  RQ L+TY +HN  GITVYG+ LDR  LHT+F  + SL LWIL+K I +S
Sbjct  400   SFQTRQTLITYLQHNHGGITVYGYSLDRGLLHTLFAFEFSLVLWILSKVIVLS  452



>gb|KGN62851.1| hypothetical protein Csa_2G377870 [Cucumis sativus]
Length=429

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 163/445 (37%), Positives = 249/445 (56%), Gaps = 30/445 (7%)
 Frame = +3

Query  123   DDEETEIILRLSKTALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             D  E+ + L L  +   S S      + +++    +L W  LD S+      S+ +F +L
Sbjct  2     DSSESNLPLLLQHSYCRSKSI----TSDDLRNYRISLKWCALDHSSAAGKFFSYLVFTLL  57

Query  303   TIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLD  482
             TI VP V+ L    D  D      FN +VQ+  S  A + F+SL  F RRYG+R+ LFL+
Sbjct  58    TIVVPAVTILAVQ-DPGDDPIS--FNKLVQVPESGLAAVGFLSLCRFFRRYGLRQLLFLE  114

Query  483   RLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSN  662
              L E++  VQ+GY  ++    + +A  + P+F  + A+KI +F T     P  + +   N
Sbjct  115   GLQEDSVYVQKGYARELEKWFRSVAYILFPSFFVELAHKIIFFSTVKIYFPVGFPV---N  171

Query  663   VVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFE--KESEVSAILI--EH  830
              ++ IL+L SW+YR  +  LVCVLFRL C LQILRL G  ++FE    SE  ++LI  EH
Sbjct  172   SILFILVLGSWVYRTGVFLLVCVLFRLTCELQILRLQGVHKLFETSNGSESDSVLIFNEH  231

Query  831   LRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVT  1010
             LRIR+ L + SHR+R FI+  L+V+T SQFV+LL+   SK+  + F + ++ +CS + + 
Sbjct  232   LRIRKQLSITSHRYRFFIIVCLLVITVSQFVALLLVLASKTDKNFFNSGDVVVCSTVQLC  291

Query  1011  GLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVda  1190
             G F+CL  AA+ITH+AQ +AS+A +WH   T                 T  P  + P+  
Sbjct  292   GFFLCLFGAARITHRAQGIASVATRWHMLVT---------SAASGSNSTKPPPLLQPLVN  342

Query  1191  dwenddeegdgddeldnTN------MVPVHA-HTISYHKRQALVTYFEHNKAGITVYGFM  1349
               +N++    G+DE D  +      ++ V    + S+  RQALV+Y +HN  GIT++G+ 
Sbjct  343   HKKNNNSSSSGEDEDDTDSDSSSDVLISVRPRESSSFQTRQALVSYLQHNNGGITLFGYA  402

Query  1350  LDRTWLHTIFVIQLSLTLWILNKTI  1424
             LDR  LHT+F  + SL + IL+K +
Sbjct  403   LDRGLLHTLFAFEFSLVMSILSKVV  427



>ref|XP_011002963.1| PREDICTED: uncharacterized protein LOC105109832 [Populus euphratica]
Length=456

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 250/444 (56%), Gaps = 21/444 (5%)
 Frame = +3

Query  120   EDDEETEIILRLSKTALISSSYHEISNA--REVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             E+D+  +  L+ +   L+  SY    +    E++    +L W  LD S+     +S+ +F
Sbjct  28    ENDQSDQ--LQANVPLLLQPSYARSKSLLFDELRNFRMSLRWCALDHSSCIGKTVSYFVF  85

Query  294   FILTIGVPLVSYLVFSC-DACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
               L I VP++S L      +  +     +N +VQ+  S  A I+F +L  F +RYG+R+ 
Sbjct  86    IFLAIIVPILSSLSIRVPSSAPADDPISYNKLVQVPESALAFIAFFTLFRFFKRYGLRQL  145

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYN-  647
             LFLD L +++  V++GY+ ++  + + LA  +LP+F  + A+KI +F T    +PY  + 
Sbjct  146   LFLDGLQDDSLFVRRGYSRELDKAFRYLACILLPSFFVELAHKIIFFSTVKIWLPYNISP  205

Query  648   -MILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVSAIL  821
               I  N ++ +L+L+SW+YR  +  LVCVLFRL C LQILR +GF ++FE   S    I 
Sbjct  206   HSIPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCELQILRFEGFHKLFEGCGSGADVIF  265

Query  822   IEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMI  1001
              EH+RI++ L + SHR+R FI+S L+ +T SQF +LL+     +    F + +L +CS +
Sbjct  266   REHVRIKKQLSLTSHRYRFFIISCLVTITVSQFGALLLVLGFSTQKSFFNSGDLVICSAV  325

Query  1002  MVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHP  1181
              ++G F+CL  AA+ITH+AQ + S+A +WH   T S+F        VD+     P+A   
Sbjct  326   QLSGFFLCLLGAARITHRAQGIVSIATRWHMNVT-SAFAR------VDQGKNHVPEADGS  378

Query  1182  VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRT  1361
             +  +  + + +        ++          S+  RQALV Y +HN  GIT++GF LDR 
Sbjct  379   LAFNAGDSESDSSDFFIAISSQ------DPCSFQTRQALVAYLQHNNGGITLFGFALDRG  432

Query  1362  WLHTIFVIQLSLTLWILNKTIGIS  1433
              LHT+F  + SL +WI++K + +S
Sbjct  433   LLHTLFAFEFSLGMWIMSKVVVLS  456



>ref|XP_003551145.1| PREDICTED: uncharacterized protein LOC100775945 [Glycine max]
Length=454

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/412 (36%), Positives = 228/412 (55%), Gaps = 22/412 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--FN  380
             E++    +L W  LD S+     +S++ F   TI VPL++ +     A  +    P  FN
Sbjct  62    ELRNFRISLRWCALDHSSCAGKIISYATFIFFTIIVPLLASIFVEIPA-SAPEDDPISFN  120

Query  381   AIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILAS  560
              +VQL  S  A I+F +LS F +RYG+R+ LFLD L E+   V++GYT ++  + + L  
Sbjct  121   KLVQLPKSGLAIIAFFTLSGFFKRYGLRQLLFLDALQEDTTYVRRGYTRELEKAFRYLTC  180

Query  561   FVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
              +LP    + A+KI +F       P+    +  N ++ +L+L SWLYR  +  LVCVLFR
Sbjct  181   IILPCLFVELAHKIIFFSAVKFSAPHISPGLPLNSIVFVLVLLSWLYRTGVFLLVCVLFR  240

Query  741   LICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             L C LQ LR +G  ++FE   SE   I  EH+RIRR L   SHR+R FI+  ++ +T SQ
Sbjct  241   LTCELQKLRFEGVHKLFEGCGSEAGVIFKEHVRIRRQLWDTSHRYRFFIIGCVVTITISQ  300

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               +LL+   SKS    F + +L +CS + ++G F+C+  A +ITH+AQ + ++A +WH  
Sbjct  301   LGALLLVLASKSDKTFFNSGDLVICSAVQLSGFFLCILGATRITHRAQGIVAIATRWHML  360

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
              T +S +    +    R   G                +    D    + +++P  +   S
Sbjct  361   VTEASSE---SKQCKARVSEG-------------LASDSDSDDSSNIHVSVIP--SQLSS  402

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             +  RQ LVTY +HN+ GITVYG+ LDR +LHT+F  + SL LWIL++ + +S
Sbjct  403   FQTRQTLVTYLQHNQRGITVYGYSLDRRFLHTLFAFEFSLVLWILSRVVVLS  454



>gb|KHN19617.1| hypothetical protein glysoja_048834 [Glycine soja]
Length=454

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/412 (36%), Positives = 228/412 (55%), Gaps = 22/412 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--FN  380
             E++    +L W  LD S+     +S++ F   TI VPL++ +     A  +    P  FN
Sbjct  62    ELRNFRISLRWCALDHSSCAGKIISYATFIFFTIIVPLLASIFVEIPA-SAPEDDPISFN  120

Query  381   AIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILAS  560
              +VQL  S  A I+F +LS F +RYG+R+ LFLD L E+   V++GYT ++  + + L  
Sbjct  121   KLVQLPKSGLAIIAFFTLSGFFKRYGLRQLLFLDALQEDTTYVRRGYTRELEKAFRYLTC  180

Query  561   FVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
              +LP    + A+KI +F       P+    +  N ++ +L+L SWLYR  +  LVCVLFR
Sbjct  181   IILPCLFVELAHKIIFFSAVKFSAPHISPGLPLNSIVFVLVLLSWLYRTGVFLLVCVLFR  240

Query  741   LICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             L C LQ LR +G  ++FE   SE   I  EH+RIRR L   SHR+R FI+  ++ +T SQ
Sbjct  241   LTCELQKLRFEGVHKLFEGCGSEAGVIFKEHVRIRRQLWDTSHRYRFFIIGCVVTITISQ  300

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               +LL+   SKS    F + +L +CS + ++G F+C+  A +ITH+AQ + ++A +WH  
Sbjct  301   LGALLLVLASKSDKTFFNSGDLVICSAVQLSGFFLCILGATRITHRAQGIVAIATRWHML  360

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
              T +S +    +    R   G                +    D    + +++P  +   S
Sbjct  361   VTEASSE---SKQCKARVSEG-------------LASDSDSDDSSNIHVSVIP--SQLSS  402

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             +  RQ LVTY +HN+ GITVYG+ LDR +LHT+F  + SL LWIL++ + +S
Sbjct  403   FQTRQTLVTYLQHNQRGITVYGYSLDRRFLHTLFAFEFSLVLWILSRVVVLS  454



>ref|XP_010029424.1| PREDICTED: uncharacterized protein LOC104419453 isoform X3 [Eucalyptus 
grandis]
Length=373

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 144/362 (40%), Positives = 211/362 (58%), Gaps = 36/362 (10%)
 Frame = +3

Query  375   FNAIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKIL  554
             FN +VQ   S  A I F +L  F  +YG+R+ LFLD L  ++  V++ Y  ++  S + L
Sbjct  39    FNLLVQFPESGLAAIGFFTLCRFFNKYGLRQLLFLDVLEYDSAPVRRNYARELDKSFRYL  98

Query  555   ASFVLPTFLADCAYKIWWF--VTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVC  728
             +  +LP+FL + A+K+ +F  V+    +P+ +    SN V+ +L+L+SW+YR  I  LVC
Sbjct  99    SYILLPSFLVELAHKVVFFSTVSMSFSLPFPFP---SNAVLFVLVLASWIYRTGIFLLVC  155

Query  729   VLFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVV  905
             VLFRL C LQILRL G   + E   S+ SAI  EH+RIR+ L   SHR+R FI+S L+ +
Sbjct  156   VLFRLTCELQILRLGGLHGMLEGCGSDPSAIFDEHVRIRKQLSATSHRYRFFIISCLLTM  215

Query  906   TASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAK  1085
             T SQF +LL+   SK+  + F + +L +CS++ ++GLF+CL  AA+ITH+AQ +ASLA +
Sbjct  216   TVSQFAALLIVLASKTEKNFFNSGDLVVCSVVELSGLFLCLLGAARITHRAQGIASLATR  275

Query  1086  WHACATLSSFDEFGDETP--VDRTG--TGTPQAIHPVdadwenddeegdgddeldnTNMV  1253
             W+   T +S        P  V+  G  + T   +                        ++
Sbjct  276   WNMLVTSASASGSNRPKPETVEHNGWHSDTDSDL------------------------LI  311

Query  1254  PVH--AHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIG  1427
             PV   + + S+  RQALV Y E N  GIT+YGF LDR  LHTIF  + SL LWIL+K + 
Sbjct  312   PVSTFSDSSSFQIRQALVAYLERNNGGITLYGFALDRGLLHTIFAFEFSLVLWILSKVVV  371

Query  1428  IS  1433
             +S
Sbjct  372   LS  373



>ref|XP_002527998.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34410.1| conserved hypothetical protein [Ricinus communis]
Length=436

 Score =   250 bits (639),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 146/413 (35%), Positives = 227/413 (55%), Gaps = 26/413 (6%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDS-KHQRPFNA  383
             E++     L W  LD S+     +S+S F    I +P++S L        + +    FN 
Sbjct  46    ELRHFRICLKWCALDHSSCLGKFISYSTFIFFAIILPILSSLSVKLPPSAALRDPISFNT  105

Query  384   IVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASF  563
             +VQL  S  A I+F +LS F   YG+R+ LFLD L +++  V++GY+ ++  + + LA  
Sbjct  106   LVQLPESGLALIAFFTLSRFFSTYGLRQLLFLDGLQDDSLFVRRGYSRELDKAFRYLACI  165

Query  564   VLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRL  743
             +LP+F  + A+KI +F T    +PY    +  N V+ +L+L+SW+YR  +  LVCVLFRL
Sbjct  166   LLPSFFVELAHKIIFFSTVEITLPYISLGVPLNSVMFLLVLASWVYRTGVFLLVCVLFRL  225

Query  744   ICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQF  920
              C LQILR +G  ++FE  ES+  AI  EH RI++ L   SHR+R FI++  + +T +Q 
Sbjct  226   TCELQILRFEGLHKLFEGCESDAGAIFKEHFRIKKQLSGTSHRYRFFIIACSVTITITQL  285

Query  921   VSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACA  1100
              +LL+    KS  + F + ++ +CS++ ++G F+CL  AA+ITH+AQ + S+A +WH   
Sbjct  286   GALLLVLAFKSEKNFFNSGDIVICSVVQLSGFFLCLLGAARITHRAQGIVSIATRWHMMV  345

Query  1101  TLSSFDEFGDETPVDRTGTG--TPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTI  1274
             T +S      +  V  T     T  A  P                       + +     
Sbjct  346   TSASSRSEQGKCLVRETDDSIQTDDADPP----------------------DIFITQDAS  383

Query  1275  SYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             S+  RQA + Y +HN  GIT++GF LDR  LHT+F  + SL LWIL+K + +S
Sbjct  384   SFQTRQAFIAYLQHNHGGITLFGFALDRGLLHTLFAFEFSLVLWILSKVVVLS  436



>ref|XP_006850979.1| hypothetical protein AMTR_s00025p00209050 [Amborella trichopoda]
 gb|ERN12560.1| hypothetical protein AMTR_s00025p00209050 [Amborella trichopoda]
Length=482

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 160/429 (37%), Positives = 236/429 (55%), Gaps = 34/429 (8%)
 Frame = +3

Query  174   SSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDAC  353
             S S+H+     E+     +L W  LDQS+     +SW  F + T+ VP+ S ++      
Sbjct  79    SQSFHD----DELYNFRMSLRWWALDQSSKPTKLISWLTFCVFTLVVPITSLVLV-----  129

Query  354   DSKHQRPFNAI-----VQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQG  518
                 + P  AI     VQL  S  A I+F SLS   R++G+RK LFLD+L E+  ++++ 
Sbjct  130   ----RAPSRAIAIEKWVQLPESGLAAIAFFSLSRSVRKHGLRKILFLDQLAEDTHEIRRN  185

Query  519   YTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWL  698
             Y+ ++  + K LA  +LP+F  + A+K+ +F      +        +  V+   +L+SW+
Sbjct  186   YSSELERAFKGLAFMLLPSFSVELAHKVVFFSCT--DVGILKGGFAAKWVVFGFVLASWI  243

Query  699   YRIAISFLVCVLFRLICHLQILRLDGFAQVFEK---ESEVSAILIEHLRIRRNLRVISHR  869
             YR  +  LVCVLF L C LQILRL G  +  E    ESEV  I  EH+RIRR L V+SHR
Sbjct  244   YRTGVYLLVCVLFSLTCELQILRLQGLRKKLEDGGSESEVGVIFREHVRIRRQLSVMSHR  303

Query  870   FRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKIT  1049
              R FIL +L  +T SQ  +L++   SK     F + +L +CS + + G+F+CL  AAKIT
Sbjct  304   CRGFILGSLGTITVSQLGALIMVFSSKFQKDFFNSGDLLVCSAVQLCGVFLCLLGAAKIT  363

Query  1050  HKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgdd  1229
             H+AQ + S+A +WHA  TL        +T    + +G P A  P++ +           +
Sbjct  364   HRAQGIVSIATRWHASMTLEP------KTKRSYSNSGEPSA-PPINGENFLATNNSSDPE  416

Query  1230  eldnTNMVP-VHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLW  1406
               D   + P +H+   S+  RQA V+Y +HN  GIT++GF LDR  LHTIF  + SL LW
Sbjct  417   SPDALFISPSLHS---SFEVRQAFVSYLQHNSGGITLFGFTLDRGLLHTIFAFEFSLVLW  473

Query  1407  ILNKTIGIS  1433
             IL+K + IS
Sbjct  474   ILSKVVVIS  482



>ref|XP_002280927.1| PREDICTED: uncharacterized protein LOC100262807 [Vitis vinifera]
Length=460

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 163/453 (36%), Positives = 253/453 (56%), Gaps = 19/453 (4%)
 Frame = +3

Query  102   GKPIAMED--DEETEIILRLSKTALISSSYHEISNA--REVKRLMSALAWLFLDQSNLWR  269
             G+  ++ D  DE  +I + L    L+  SY    ++   E++    +L W  LD S+   
Sbjct  18    GRHASVPDQVDEPIQINVPL----LLQPSYARSKSSIFDELRHFRMSLKWCALDHSSWAG  73

Query  270   AGLSWSLFFILTIGVPLVSYLVFSCDACDS-KHQRPFNAIVQLSLSVFATISFISLSCFA  446
               +S   F +L I VP++S L     +  S K    FN +VQL  S  A I+F +LS F 
Sbjct  74    KSISCLTFIVLAIIVPILSSLFIEPPSSSSTKDPISFNKLVQLPESGLAAIAFFTLSRFF  133

Query  447   RRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGG  626
             ++YG+R  LFLD L +++  V++GYT ++  + + LA  +LP+   + A+KI +F T   
Sbjct  134   QQYGLRHLLFLDDLMDDSLYVRRGYTRELDKAFRFLAFILLPSLFVELAHKILFFSTVRI  193

Query  627   QIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ES  803
              IP+  + +  N +  +L+L+SW+YR  +  LVCVLFRL C LQILR +GF ++ E   S
Sbjct  194   SIPHIPSGVPLNSIAFVLVLASWIYRTGLFLLVCVLFRLTCELQILRFEGFQKLLEGCGS  253

Query  804   EVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAEL  983
             +   I  EH+RIR+ L V SHR+R FI+  LI +T SQ  +LL+   SKS+   F + +L
Sbjct  254   DAGVIFREHMRIRKQLSVTSHRYRFFIIGCLITITVSQLGALLIVLASKSNKTFFNSGDL  313

Query  984   GLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTG-TG  1160
              +CS + ++G  +CL  AA+ITH+AQ + S+A +WH   T ++ +   D +     G   
Sbjct  314   VVCSAVQLSGFLLCLLGAARITHRAQRMVSVATRWHMLVTCATINLHPDASSDQWRGIIQ  373

Query  1161  TPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYHKR--QALVTYFEHNKAGIT  1334
              P   H +         + D      +  ++ V +  +S  +   QALVTY +HN  GIT
Sbjct  374   GPDPDHTL------LPSKFDDTVSDLSQTLITVSSQDLSSFQTSWQALVTYLQHNSGGIT  427

Query  1335  VYGFMLDRTWLHTIFVIQLSLTLWILNKTIGIS  1433
             ++GF LDR  LHTIF  + SL +WIL+K + +S
Sbjct  428   LFGFTLDRGLLHTIFAFEFSLVMWILSKVVVLS  460



>gb|AES58871.2| extracellular ligand-gated ion channel protein [Medicago truncatula]
Length=446

 Score =   248 bits (634),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 223/409 (55%), Gaps = 22/409 (5%)
 Frame = +3

Query  207   EVKRLMSALAWLFLDQSNLWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRP--FN  380
             E++     L W  LD S+     +S+  F  LT  VPL + L     A  S    P   N
Sbjct  54    ELRNFRICLKWCALDHSSCVGKLISYVSFIFLTFVVPLFTTLFVQVSA-SSPEVDPISLN  112

Query  381   AIVQLSLSVFATISFISLSCFARRYGVRKFLFLDRLCEENDKVQQGYTLQIHSSLKILAS  560
              +VQ+  S  A ISF +L  F RRYG+R+ LFLD L ++   V++GY  ++  + + LA 
Sbjct  113   KLVQIPESALAIISFFTLYRFFRRYGLRQLLFLDALQDDTTYVRRGYARELEKAFRYLAY  172

Query  561   FVLPTFLADCAYKIWWFVTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFR  740
              +LP+F  + A+KI +F       P        + ++ + +L SWLYR  +  LVCV+F+
Sbjct  173   IILPSFFVELAHKIIFFSAVKISAPNLSAGFPLHSIVFVFMLLSWLYRTGVYLLVCVIFK  232

Query  741   LICHLQILRLDGFAQVFEK-ESEVSAILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQ  917
             L C LQILR +G  ++FE   SE   I  EH+RIRR L +ISHR+R FI+  ++ ++ SQ
Sbjct  233   LTCQLQILRFEGVHKLFEGCGSEAGVIFKEHVRIRRQLWIISHRYRFFIICCVVTMSVSQ  292

Query  918   FVSLLVTTESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWHAC  1097
               SLL+   SKS    F + +L +CS + ++G F+C+  AAKITH+AQ + S+A +WH  
Sbjct  293   LGSLLLVLASKSEKTFFNSGDLVICSAVQLSGFFLCILGAAKITHRAQGIVSIATRWHML  352

Query  1098  ATLSSFDEFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTIS  1277
              T    + F +    ++      +A+                D +  + ++  +     S
Sbjct  353   VT----NAFAES---EQCKDNMSEAL-----------ASDSSDSDSSDIHISIIPQRLSS  394

Query  1278  YHKRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
             +  RQ+LVTY +HN  GIT+YGF LDR  LHT+F  + S+ LWIL+K +
Sbjct  395   FQTRQSLVTYLQHNHGGITLYGFALDRGMLHTLFAFEFSIVLWILSKVV  443



>ref|XP_006371829.1| hypothetical protein POPTR_0018s04020g [Populus trichocarpa]
 gb|ERP49626.1| hypothetical protein POPTR_0018s04020g [Populus trichocarpa]
Length=440

 Score =   248 bits (632),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 246/444 (55%), Gaps = 37/444 (8%)
 Frame = +3

Query  120   EDDEETEIILRLSKTALISSSYHEISNA--REVKRLMSALAWLFLDQSNLWRAGLSWSLF  293
             E+D+  +  L+ +   L+  SY    +    E++    +L W  LD S+     +S+ +F
Sbjct  28    ENDQSDQ--LQANVPLLLQPSYARSKSLLFDELRNFRMSLRWCALDHSSCIGKTVSYFVF  85

Query  294   FILTIGVPLVSYLVFSC-DACDSKHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKF  470
               L I VP+VS L      +  +     +N +VQ+  S  A I+F +L  F +RYG+R+ 
Sbjct  86    IFLAIIVPIVSSLSIRVPSSAPADDPISYNKLVQVPESALAFIAFFTLFRFFKRYGLRQL  145

Query  471   LFLDRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYFYNM  650
             LFLD L +++  V+QGY+ ++  + + LA  +LP+F  + A+KI +F T    +PY  + 
Sbjct  146   LFLDGLQDDSLFVRQGYSRELDKAFRYLACILLPSFFVELAHKIIFFSTVKIWLPYNISP  205

Query  651   --ILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVSAIL  821
               I  N ++ +L+L+SW+YR  +  LVCVLFRL C LQILR +G  ++FE   S    I 
Sbjct  206   HGIPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCELQILRFEGLHKLFEGCGSGAGVIF  265

Query  822   IEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMI  1001
              EH+RI++ L + SHR+R FI+S L+ +T SQF +LL+     +    F + +L +CS +
Sbjct  266   REHVRIKKQLSLTSHRYRFFIISCLVTITVSQFGALLLVLGFNTQKSFFNSGDLVICSAV  325

Query  1002  MVTGLFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGDETPVDRTGTGTPQAIHP  1181
              ++G F+CL  AA+ITH+AQ + S+A +WH   T S+F        VD+    +  +   
Sbjct  326   QLSGFFLCLLGAARITHRAQGIVSIATRWHMNVT-SAFAR------VDQGKNHSDSS---  375

Query  1182  VdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDRT  1361
                           D  +  ++  P      ++  RQALV Y +HN  GIT++GF LDR 
Sbjct  376   --------------DFFIAISSQDPC-----TFQTRQALVAYLQHNNGGITLFGFALDRG  416

Query  1362  WLHTIFVIQLSLTLWILNKTIGIS  1433
              LHT+F  + SL +WI++K + +S
Sbjct  417   LLHTLFAFEFSLGMWIMSKVVVLS  440



>ref|XP_010669538.1| PREDICTED: uncharacterized protein LOC104886749 [Beta vulgaris 
subsp. vulgaris]
Length=460

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 167/445 (38%), Positives = 244/445 (55%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   DEETEIILRLSKT-ALISSSYHEISNAREVKRLMSALAWLFLDQSNLWRAGLSWSLFFIL  302
             DE++ I L L K  A   SS H+     E++    +L W  LD +      +S+  FFIL
Sbjct  30    DEQSHIPLLLQKPCARSKSSIHD-----ELRHFRRSLKWCALDHTTSLGKTISYLTFFIL  84

Query  303   TIGVPLVSYLVFSCDACDS-KHQRPFNAIVQLSLSVFATISFISLSCFARRYGVRKFLFL  479
              I +P+++ +     +    K+   FN +VQL  S  A I F +L  F + YG+RK LFL
Sbjct  85    AIIIPIITSISIKIPSSSHSKNPLSFNKLVQLPESSLAFIGFFTLCQFFKEYGLRKLLFL  144

Query  480   DRLCEENDKVQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWFVTGGGQIPYF-YNMIL  656
             D L +++  VQ GY  ++  + K LA  +LP+F+ + A+KI++F T     P    +++ 
Sbjct  145   DGLNDDSLDVQLGYKCELDKAFKNLAYILLPSFIVEFAHKIFFFSTIVVSFPVVGVSIVP  204

Query  657   SNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVFEK-ESEVSAILIEHL  833
              N ++ I  + SW+YR  +  LVCVLF+L C LQILRL+    +FE   SE SA   EH 
Sbjct  205   MNSIMFISGMISWVYRTGVFLLVCVLFQLTCELQILRLEAVRHMFEGFGSEPSAFFREHR  264

Query  834   RIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVTTESKSHAHIFAAAELGLCSMIMVTG  1013
             RIR  L V SHRFR FI   L+ +T SQ  +LL+   SKS  + F + ++ +CS + ++G
Sbjct  265   RIRDQLYVTSHRFRFFIAGCLVTITVSQLGALLLVLASKSDKNFFNSGDIVVCSAVQLSG  324

Query  1014  LFICLRSAAKITHKAQSVASLAAKWHACATLSSFDEFGD-----ETPVDRTGTGTPQAIH  1178
              F+CL  AA+ITH+AQ + S+A +WH   T S  D+  D     ETP     +  P +  
Sbjct  325   FFLCLTGAARITHRAQQIVSVATRWHMHMT-SCCDDGLDHRSKGETPAIDASSPAPDSAG  383

Query  1179  PVdadwenddeegdgddeldnTNMVPVHAHTISYHKRQALVTYFEHNKAGITVYGFMLDR  1358
              +       D+            ++    H  ++  RQALVTY +HN  GITV+GF LDR
Sbjct  384   DM------ADDYDQSSSPDVAVKILQQEPH--AFQTRQALVTYLQHNNGGITVFGFALDR  435

Query  1359  TWLHTIFVIQLSLTLWILNKTIGIS  1433
               L T+F  +LSL LWIL+K I +S
Sbjct  436   GLLQTLFAFELSLVLWILSKVIVLS  460



>ref|XP_010927168.1| PREDICTED: uncharacterized protein LOC105049268 [Elaeis guineensis]
Length=458

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 243/467 (52%), Gaps = 42/467 (9%)
 Frame = +3

Query  87    QSTNQGKPIAMEDDEETEIILRLSKTAL--ISSSYHEISNAREVKRLMSALAWLFLDQSN  260
              + N   P AME +  +  +  L   A     S  H+     E++     L W  LD S+
Sbjct  10    DARNGSDPAAMEANSASVAVPLLLNPAYARTKSIVHD-----ELRNFRICLKWCALDHSS  64

Query  261   LWRAGLSWSLFFILTIGVPLVSYLVFSCDACDSKHQRPFNAIVQLSLSVFATISFISLSC  440
                   S++ F  L + +P  + L  S     S    P   +VQL  S  A ISF++L+ 
Sbjct  65    CGGRAASYATFVALAVVLPAATSL--SVRPPPSAAAMPLYQLVQLPESGLAAISFLTLAA  122

Query  441   FARRYGVRKFLFLDRLCEENDK-VQQGYTLQIHSSLKILASFVLPTFLADCAYKIWWF--  611
             F RR+G+R+ LFLD    ++   V++GY  ++  + + LA+ +LP+F  + A+KI +F  
Sbjct  123   FFRRHGLRQLLFLDGALRDDSAFVRRGYNRELDRAFRHLAAILLPSFSVELAHKILFFSS  182

Query  612   VTGGGQIPYFYNMILSNVVICILLLSSWLYRIAISFLVCVLFRLICHLQILRLDGFAQVF  791
             V    ++P F   I  N V  +  L+SW+YR  +  LVCVLFRL C LQILR +GF ++F
Sbjct  183   VPVSARLP-FRAPIPWNSVAFVATLASWVYRTGVFLLVCVLFRLTCELQILRFEGFYRMF  241

Query  792   EKESEVS-----------AILIEHLRIRRNLRVISHRFRLFILSTLIVVTASQFVSLLVT  938
             ++                AI  EHLRI+R L   SHR+R+FI+  L++++ SQ  +L++ 
Sbjct  242   DEGEGAGVEHRRSGNYAWAIFKEHLRIKRQLLETSHRYRIFIIGCLVIISVSQLGALMLV  301

Query  939   TESKSHAHIFAAAELGLCSMIMVTGLFICLRSAAKITHKAQSVASLAAKWH---ACATLS  1109
               SKS  +   + +L +CS + ++G F+CL  AA+ITH+AQ V S+A++WH   +CA   
Sbjct  302   LASKSQKNFCNSGDLVVCSAVQISGFFMCLLGAARITHRAQRVVSVASRWHTITSCAPRC  361

Query  1110  SFD--EFGDETPVDRTGTGTPQAIHPVdadwenddeegdgddeldnTNMVPVHAHTISYH  1283
               D  +   +TP             P   +    D      +      M   H    S+ 
Sbjct  362   PSDASQLQKQTPA------------PPINEHHASDAGDCERNLSKEPIMSSSHPGA-SFE  408

Query  1284  KRQALVTYFEHNKAGITVYGFMLDRTWLHTIFVIQLSLTLWILNKTI  1424
              RQALVTY +HN  GIT++GF LDR  LHT+F  +++L LWIL+K +
Sbjct  409   SRQALVTYLQHNGGGITLFGFALDRGLLHTLFAFEMTLVLWILSKVV  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600