BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22411_g1_i3 len=1490 path=[7219:0-293 8248:294-374 2366:375-402
2394:403-427 2419:428-464 2456:465-479 2471:480-532 2524:533-1489]

Length=1490
                                                                      Score     E

gb|ADG22608.1|  diacylglycerol acyltransferase type 2                   444   4e-150   
ref|XP_009804388.1|  PREDICTED: diacylglycerol O-acyltransferase 2      433   1e-145   
ref|XP_009597603.1|  PREDICTED: diacylglycerol O-acyltransferase 2      431   5e-145   
gb|AGL46984.1|  acyl-CoA:diacylglycerol acyltransferase 2               431   5e-145   
ref|XP_006365015.1|  PREDICTED: diacylglycerol O-acyltransferase ...    426   4e-143   
emb|CDP01742.1|  unnamed protein product                                434   6e-143   
ref|XP_011098009.1|  PREDICTED: diacylglycerol O-acyltransferase 2      419   3e-140   
ref|XP_004233286.1|  PREDICTED: diacylglycerol O-acyltransferase ...    418   1e-139   
ref|XP_004509475.1|  PREDICTED: diacylglycerol O-acyltransferase ...    411   5e-137   
gb|EYU38933.1|  hypothetical protein MIMGU_mgv1a009887mg                409   3e-136   
gb|AGO32049.1|  diacylglycerol acyltransferase 2                        405   6e-135   
gb|EPS73366.1|  diacylglycerol acyltransferase type 2                   405   6e-135   
ref|NP_566952.1|  diacylglycerol O-acyltransferase 2                    402   5e-134   Arabidopsis thaliana [mouse-ear cress]
gb|ADT91688.1|  diacylglycerol acyltransferase 2                        400   8e-133   
ref|XP_003517113.1|  PREDICTED: diacylglycerol O-acyltransferase ...    400   1e-132   
emb|CBI37486.3|  unnamed protein product                                400   1e-132   
ref|XP_002263626.1|  PREDICTED: diacylglycerol O-acyltransferase 2      400   1e-132   Vitis vinifera
ref|XP_010029543.1|  PREDICTED: diacylglycerol O-acyltransferase ...    399   2e-132   
gb|KHN28301.1|  Diacylglycerol O-acyltransferase 2                      395   2e-131   
ref|XP_009369766.1|  PREDICTED: diacylglycerol O-acyltransferase ...    396   3e-131   
ref|XP_008392180.1|  PREDICTED: diacylglycerol O-acyltransferase ...    394   1e-130   
ref|XP_006403907.1|  hypothetical protein EUTSA_v10010550mg             394   1e-130   
ref|XP_002876092.1|  diacylglycerol acyltransferase family              394   2e-130   
gb|ABU50328.1|  diacylglycerol acyltransferase                          394   2e-130   
emb|CAB63016.1|  putative protein                                       394   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003612436.1|  Diacylglycerol O-acyltransferase                   394   2e-130   
ref|XP_010515570.1|  PREDICTED: diacylglycerol O-acyltransferase ...    393   3e-130   
ref|XP_009359645.1|  PREDICTED: diacylglycerol O-acyltransferase ...    393   3e-130   
gb|KFK34394.1|  hypothetical protein AALP_AA5G139600                    392   5e-130   
ref|XP_010503848.1|  PREDICTED: diacylglycerol O-acyltransferase ...    392   6e-130   
ref|XP_006420603.1|  hypothetical protein CICLE_v10005396mg             392   9e-130   
ref|XP_008365454.1|  PREDICTED: diacylglycerol O-acyltransferase ...    392   1e-129   
ref|XP_008242123.1|  PREDICTED: diacylglycerol O-acyltransferase 2      391   2e-129   
ref|XP_007202234.1|  hypothetical protein PRUPE_ppa008682mg             391   2e-129   
ref|XP_004287691.1|  PREDICTED: diacylglycerol O-acyltransferase ...    391   3e-129   
ref|XP_009148943.1|  PREDICTED: diacylglycerol O-acyltransferase 2      390   4e-129   
ref|XP_010033619.1|  PREDICTED: diacylglycerol O-acyltransferase ...    390   4e-129   
ref|XP_003534223.1|  PREDICTED: diacylglycerol O-acyltransferase ...    390   6e-129   
ref|XP_006489798.1|  PREDICTED: diacylglycerol O-acyltransferase ...    389   1e-128   
gb|KHN38842.1|  Diacylglycerol O-acyltransferase 2                      389   2e-128   
gb|ACJ84867.1|  unknown                                                 387   5e-128   Medicago truncatula
ref|XP_006290290.1|  hypothetical protein CARUB_v10018454mg             387   6e-128   
emb|CDY16300.1|  BnaC01g23350D                                          387   6e-128   
ref|XP_010426724.1|  PREDICTED: diacylglycerol O-acyltransferase 2      387   6e-128   
ref|XP_010270589.1|  PREDICTED: diacylglycerol O-acyltransferase 2      387   1e-127   
gb|AET03523.2|  type 2 acyl-CoA diacylglycerol acyltransferase          387   2e-127   
ref|XP_010681114.1|  PREDICTED: diacylglycerol O-acyltransferase ...    386   3e-127   
gb|AEO11794.1|  diacylglycerol acyltransferase type 2                   384   2e-126   
gb|AEO11793.1|  diacylglycerol acyltransferase type 2                   382   7e-126   
ref|XP_007156272.1|  hypothetical protein PHAVU_003G272500g             382   8e-126   
gb|KCW53318.1|  hypothetical protein EUGRSUZ_J02570                     379   8e-126   
gb|AEO11792.1|  diacylglycerol acyltransferase type 2                   381   2e-125   
gb|AEO11788.1|  diacylglycerol acyltransferase type 2                   381   2e-125   
gb|KDO43608.1|  hypothetical protein CISIN_1g025152mg                   378   3e-125   
ref|XP_002317635.2|  hypothetical protein POPTR_0011s14890g             380   3e-125   Populus trichocarpa [western balsam poplar]
emb|CDP01743.1|  unnamed protein product                                379   3e-125   
gb|KHN39764.1|  Diacylglycerol O-acyltransferase 2                      381   3e-125   
ref|XP_003548798.1|  PREDICTED: diacylglycerol O-acyltransferase ...    380   4e-125   
ref|XP_010103230.1|  Diacylglycerol O-acyltransferase 2                 379   7e-125   
gb|ADT91714.1|  diacylglycerol acyltransferase 2                        379   8e-125   
gb|AEO11795.1|  diacylglycerol acyltransferase type 2                   380   8e-125   
gb|AEO11791.1|  diacylglycerol acyltransferase type 2                   380   8e-125   
gb|AEO11790.1|  diacylglycerol acyltransferase type 2                   379   1e-124   
gb|AEO11789.1|  diacylglycerol acyltransferase type 2                   378   4e-124   
gb|KHG09832.1|  Diacylglycerol O-acyltransferase 2 -like protein        377   6e-124   
ref|XP_004512296.1|  PREDICTED: diacylglycerol O-acyltransferase ...    377   6e-124   
gb|ADF57328.1|  1,2-diacyl-sn-glycerol:acyl-CoA acyltransferase 2       377   1e-123   
ref|XP_011004405.1|  PREDICTED: diacylglycerol O-acyltransferase ...    376   1e-123   
gb|KHG14545.1|  Diacylglycerol O-acyltransferase 2 -like protein        377   1e-123   
ref|XP_006599272.1|  PREDICTED: diacylglycerol O-acyltransferase ...    375   6e-123   
gb|ACO90187.1|  putative type-2 acyl-CoA:diacylglycerol acyltrans...    372   4e-122   Brassica napus [oilseed rape]
gb|KGN55585.1|  hypothetical protein Csa_3G00090                        372   7e-122   
ref|XP_007202235.1|  hypothetical protein PRUPE_ppa008685mg             372   8e-122   
ref|XP_008242122.1|  PREDICTED: diacylglycerol O-acyltransferase ...    371   1e-121   
ref|XP_007046427.1|  Diacylglycerol acyltransferase family isoform 3    368   2e-121   
ref|XP_008448438.1|  PREDICTED: diacylglycerol O-acyltransferase 2      371   2e-121   
ref|XP_004146185.1|  PREDICTED: diacylglycerol O-acyltransferase ...    370   2e-121   
ref|XP_010681115.1|  PREDICTED: diacylglycerol O-acyltransferase ...    369   4e-121   
ref|XP_007158045.1|  hypothetical protein PHAVU_002G119500g             370   4e-121   
ref|XP_002528531.1|  type 2 diacylglycerol acyltransferase              370   5e-121   Ricinus communis
ref|XP_009136618.1|  PREDICTED: diacylglycerol O-acyltransferase ...    369   6e-121   
ref|XP_007046425.1|  Diacylglycerol acyltransferase family isoform 1    369   1e-120   
ref|XP_003629047.1|  2-acylglycerol O-acyltransferase                   372   1e-120   
emb|CDX90646.1|  BnaA03g41350D                                          368   1e-120   
gb|ACO90188.1|  putative type-2 acyl-CoA:diacylglycerol acyltrans...    368   2e-120   Brassica napus [oilseed rape]
gb|ABK26256.1|  unknown                                                 367   6e-120   Picea sitchensis
gb|ABI83668.1|  type 2 acyl-CoA diacylglycerol acyltransferase          367   7e-120   Ricinus communis
emb|CDY29021.1|  BnaC07g32270D                                          366   1e-119   
ref|XP_006599271.1|  PREDICTED: diacylglycerol O-acyltransferase ...    367   2e-119   
ref|XP_006656043.1|  PREDICTED: diacylglycerol O-acyltransferase ...    365   2e-119   
gb|KCW56459.1|  hypothetical protein EUGRSUZ_I02195                     364   3e-119   
gb|AHA57446.1|  acyl CoA:diacylglycerol acyltransferases 2-3            366   3e-119   
gb|AHA57445.1|  acyl CoA:diacylglycerol acyltransferases 2-1            365   6e-119   
ref|XP_007046426.1|  Diacylglycerol acyltransferase family isoform 2    364   6e-119   
ref|XP_010317058.1|  PREDICTED: diacylglycerol O-acyltransferase ...    362   2e-118   
gb|EEC80511.1|  hypothetical protein OsI_22778                          363   3e-118   Oryza sativa Indica Group [Indian rice]
ref|NP_001057530.1|  Os06g0326700                                       362   7e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953677.1|  PREDICTED: diacylglycerol O-acyltransferase ...    360   3e-117   
gb|KDP24913.1|  hypothetical protein JCGZ_24291                         360   5e-117   
ref|XP_009401347.1|  PREDICTED: diacylglycerol O-acyltransferase ...    359   8e-117   
gb|AEZ56254.1|  acyl-CoA:diacylglycerol acyltransferase 2               360   9e-117   
ref|XP_009369767.1|  PREDICTED: diacylglycerol O-acyltransferase ...    357   3e-116   
ref|XP_003570227.1|  PREDICTED: diacylglycerol O-acyltransferase ...    357   5e-116   
gb|KHG14544.1|  Diacylglycerol O-acyltransferase 2 -like protein        356   8e-116   
gb|AEQ94266.1|  diglyceride acyltransferase 2                           355   2e-115   
gb|ABC94473.1|  type 2 diacylglycerol acyltransferase                   355   2e-115   Vernicia fordii [tung oil tree]
ref|XP_009387694.1|  PREDICTED: diacylglycerol O-acyltransferase ...    355   2e-115   
gb|KHG28933.1|  Diacylglycerol O-acyltransferase 2 -like protein        355   2e-115   
ref|XP_010932136.1|  PREDICTED: diacylglycerol O-acyltransferase 2      355   9e-115   
ref|XP_003563898.2|  PREDICTED: diacylglycerol O-acyltransferase ...    354   1e-114   
ref|XP_008802155.1|  PREDICTED: diacylglycerol O-acyltransferase 2      353   4e-114   
ref|XP_010270587.1|  PREDICTED: diacylglycerol O-acyltransferase ...    352   4e-114   
gb|ACO35365.1|  diacylglycerol acyltransferase                          352   6e-114   Elaeis oleifera
ref|NP_001150174.1|  diacylglycerol O-acyltransferase 1                 352   8e-114   Zea mays [maize]
ref|XP_010550516.1|  PREDICTED: LOW QUALITY PROTEIN: diacylglycer...    350   1e-113   
gb|AFW63609.1|  diacylglycerol O-acyltransferase 1                      353   4e-113   
gb|ACG40288.1|  diacylglycerol O-acyltransferase 1                      349   6e-113   Zea mays [maize]
ref|XP_002452652.1|  hypothetical protein SORBIDRAFT_04g030010          349   8e-113   Sorghum bicolor [broomcorn]
dbj|BAJ85730.1|  predicted protein                                      347   6e-112   
dbj|BAJ98415.1|  predicted protein                                      345   2e-111   
ref|XP_004965355.1|  PREDICTED: diacylglycerol O-acyltransferase ...    344   6e-111   
gb|EMT13438.1|  2-acylglycerol O-acyltransferase 1                      344   6e-111   
gb|EAY87275.1|  hypothetical protein OsI_08677                          344   7e-111   Oryza sativa Indica Group [Indian rice]
ref|NP_001047917.1|  Os02g0714100                                       344   9e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45964.1|  Diacylglycerol O-acyltransferase 2                      343   2e-110   
ref|XP_006849935.1|  hypothetical protein AMTR_s00022p00123300          343   2e-110   
ref|XP_006648987.1|  PREDICTED: diacylglycerol O-acyltransferase ...    339   3e-109   
ref|XP_010919928.1|  PREDICTED: diacylglycerol O-acyltransferase ...    339   4e-109   
gb|ACU20344.1|  unknown                                                 337   3e-108   Glycine max [soybeans]
ref|XP_003547891.1|  PREDICTED: diacylglycerol O-acyltransferase ...    336   3e-108   
ref|XP_010270586.1|  PREDICTED: diacylglycerol O-acyltransferase ...    336   1e-107   
ref|XP_007156273.1|  hypothetical protein PHAVU_003G272600g             332   2e-106   
ref|NP_001241731.1|  diacylglycerol O-acyltransferase 1                 332   4e-106   
ref|XP_004509476.1|  PREDICTED: diacylglycerol O-acyltransferase ...    331   4e-106   
gb|ACL54036.1|  unknown                                                 332   5e-106   Zea mays [maize]
ref|XP_006837415.1|  hypothetical protein AMTR_s00111p00149430          330   8e-106   
ref|XP_002972054.1|  hypothetical protein SELMODRAFT_96204              327   3e-104   
ref|XP_008344179.1|  PREDICTED: diacylglycerol O-acyltransferase ...    321   5e-103   
dbj|BAG95286.1|  unnamed protein product                                318   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004406.1|  PREDICTED: diacylglycerol O-acyltransferase ...    315   3e-100   
ref|XP_008392825.1|  PREDICTED: diacylglycerol O-acyltransferase ...    313   7e-100   
ref|XP_006599273.1|  PREDICTED: diacylglycerol O-acyltransferase ...    314   8e-100   
gb|AET03522.2|  type 2 acyl-CoA diacylglycerol acyltransferase          312   8e-99    
gb|EMS48367.1|  Diacylglycerol O-acyltransferase 2                      312   3e-98    
gb|ACN32157.1|  unknown                                                 311   3e-98    Zea mays [maize]
ref|XP_006599274.1|  PREDICTED: diacylglycerol O-acyltransferase ...    308   2e-97    
ref|XP_008796323.1|  PREDICTED: diacylglycerol O-acyltransferase ...    307   7e-97    
gb|AFW86522.1|  hypothetical protein ZEAMMB73_897295                    302   6e-95    
gb|AAQ89590.1|  mono- or diacylglycerol acyltransferase                 300   3e-94    Spirodela polyrhiza
gb|KEH40833.1|  diacylglycerol acyltransferase type 2                   296   1e-92    
ref|XP_001777726.1|  predicted protein                                  295   4e-92    
ref|XP_003629046.1|  2-acylglycerol O-acyltransferase                   291   3e-90    
gb|ACV40232.1|  type 2 acyl-CoA diacylglycerol acyltransferase          277   5e-85    
gb|AFW86523.1|  hypothetical protein ZEAMMB73_897295                    272   6e-84    
ref|XP_001758758.1|  predicted protein                                  269   3e-82    
gb|KCW53319.1|  hypothetical protein EUGRSUZ_J02571                     260   1e-80    
dbj|BAK03129.1|  predicted protein                                      244   5e-73    
gb|EAZ36838.1|  hypothetical protein OsJ_21181                          232   6e-68    Oryza sativa Japonica Group [Japonica rice]
emb|CBI37485.3|  unnamed protein product                                234   1e-66    
ref|XP_010270588.1|  PREDICTED: diacylglycerol O-acyltransferase ...    218   4e-63    
gb|KHN41793.1|  Diacylglycerol O-acyltransferase 2                      210   1e-61    
ref|XP_005647498.1|  DAGAT-domain-containing protein                    209   4e-59    
ref|XP_004172576.1|  PREDICTED: diacylglycerol O-acyltransferase ...    195   9e-56    
ref|XP_002503155.1|  predicted protein                                  199   3e-55    Micromonas commoda
ref|XP_007046428.1|  Diacylglycerol acyltransferase family isoform 4    193   2e-54    
ref|XP_003083539.1|  putative mono-or diacylglycerol acyltransfe ...    196   3e-54    
ref|XP_003061169.1|  predicted protein                                  196   7e-54    
ref|XP_001421576.1|  predicted protein                                  193   3e-53    Ostreococcus lucimarinus CCE9901
gb|KFM22531.1|  Diacylglycerol O-acyltransferase 2                      187   1e-50    
ref|XP_006402203.1|  hypothetical protein EUTSA_v10015808mg             179   3e-50    
ref|XP_002957707.1|  hypothetical protein VOLCADRAFT_77655              184   1e-49    
ref|XP_001693189.1|  diacylglycerol acyl transferase                    182   4e-49    Chlamydomonas reinhardtii
ref|XP_005843408.1|  hypothetical protein CHLNCDRAFT_10860              179   4e-49    
ref|XP_006397051.1|  hypothetical protein EUTSA_v10029434mg             175   1e-48    
gb|AID16200.1|  diacylglycerol acyltransferase type 2                   178   2e-47    
gb|KDD73230.1|  diacylglycerol acyltransferase                          177   4e-47    
emb|CAN72688.1|  hypothetical protein VITISV_037521                     177   1e-45    Vitis vinifera
gb|AFW60565.1|  hypothetical protein ZEAMMB73_440876                    177   4e-45    
gb|AFW69147.1|  hypothetical protein ZEAMMB73_149235                    169   1e-44    
gb|AFW86527.1|  hypothetical protein ZEAMMB73_897295                    163   2e-44    
ref|XP_008646663.1|  PREDICTED: uncharacterized protein LOC103628190    171   4e-44    
ref|XP_002294483.1|  hypothetical protein THAPSDRAFT_37867              166   2e-43    Thalassiosira pseudonana CCMP1335
ref|XP_004169998.1|  PREDICTED: diacylglycerol O-acyltransferase ...    157   2e-42    
ref|XP_011030707.1|  PREDICTED: diacylglycerol O-acyltransferase ...    155   1e-41    
ref|XP_006402180.1|  hypothetical protein EUTSA_v10015985mg             155   2e-41    
gb|EWM23187.1|  diacylglycerol acyltransferase type 2                   159   2e-40    
emb|CDX85154.1|  BnaC07g07520D                                          150   2e-39    
ref|XP_007512274.1|  predicted protein                                  154   7e-39    
gb|ETI37899.1|  hypothetical protein F443_16242                         143   2e-34    
gb|ETK78105.1|  hypothetical protein L915_15796                         141   5e-34    
ref|XP_003745579.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    141   6e-34    
gb|ETO66656.1|  hypothetical protein F444_16239                         141   6e-34    
ref|XP_008911342.1|  hypothetical protein PPTG_16282                    141   7e-34    
ref|XP_006403242.1|  hypothetical protein EUTSA_v10003409mg             135   2e-33    
ref|XP_006942072.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      139   2e-33    
ref|XP_008870786.1|  hypothetical protein H310_07219                    139   3e-33    
ref|XP_009826313.1|  hypothetical protein H257_03774                    139   6e-33    
ref|XP_007073968.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      136   2e-32    
ref|XP_005690058.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      137   2e-32    
emb|CBJ27686.1|  mono-or diacylglycerol acyltransferase type 2          136   4e-32    
gb|KDO23510.1|  hypothetical protein SPRG_11432                         135   4e-32    
ref|XP_005954165.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    135   5e-32    
gb|ELT87803.1|  hypothetical protein CAPTEDRAFT_131195                  134   8e-32    
ref|XP_006074155.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    134   1e-31    
ref|XP_002500702.1|  predicted protein                                  134   1e-31    Micromonas commoda
ref|XP_008603917.1|  hypothetical protein SDRG_00227                    134   2e-31    
ref|XP_002895811.1|  2-acylglycerol O-acyltransferase, putative         133   2e-31    
ref|XP_004016381.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    133   2e-31    
ref|XP_004761644.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      133   3e-31    
ref|XP_009520152.1|  hypothetical protein PHYSODRAFT_486821             132   5e-31    
ref|XP_008603915.1|  hypothetical protein SDRG_00225                    132   5e-31    
ref|XP_006414977.1|  hypothetical protein EUTSA_v10026593mg             125   9e-31    
gb|KDO23508.1|  hypothetical protein SPRG_11430                         131   1e-30    
ref|XP_008671628.1|  PREDICTED: diacylglycerol O-acyltransferase ...    129   1e-30    
ref|XP_007558068.1|  PREDICTED: diacylglycerol O-acyltransferase 2      131   2e-30    
ref|XP_001632983.1|  predicted protein                                  130   3e-30    Nematostella vectensis
ref|XP_005844537.1|  hypothetical protein CHLNCDRAFT_138958             129   3e-30    
ref|XP_005806752.1|  PREDICTED: diacylglycerol O-acyltransferase ...    130   3e-30    
ref|XP_004347733.1|  Diacylglycerol acyltransferase, putative           130   3e-30    
ref|XP_010868998.1|  PREDICTED: diacylglycerol O-acyltransferase 2      130   3e-30    
ref|XP_004992811.1|  hypothetical protein PTSG_05918                    129   7e-30    
ref|XP_003738944.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    129   7e-30    
ref|XP_008426466.1|  PREDICTED: diacylglycerol O-acyltransferase 2      129   7e-30    
ref|XP_007639883.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      129   8e-30    
ref|XP_003923532.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      128   1e-29    
ref|XP_001253431.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    128   1e-29    Bos taurus [bovine]
ref|XP_002108095.1|  hypothetical protein TRIADDRAFT_63184              128   1e-29    Trichoplax adhaerens
gb|ELW56463.1|  2-acylglycerol O-acyltransferase 3                      129   2e-29    
emb|CBN77027.1|  mono-or diacylglycerol acyltransferase type 2          128   3e-29    
ref|NP_872180.1|  Protein K07B1.4, isoform b                            127   3e-29    Caenorhabditis elegans [roundworm]
ref|NP_505413.1|  Protein K07B1.4, isoform a                            127   3e-29    Caenorhabditis elegans [roundworm]
ref|XP_006971459.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      127   3e-29    
gb|EEZ98242.1|  hypothetical protein TcasGA2_TC000681                   127   3e-29    
ref|XP_002683800.2|  PREDICTED: 2-acylglycerol O-acyltransferase ...    126   4e-29    
ref|XP_001730209.1|  hypothetical protein MGL_2591                      125   4e-29    Malassezia globosa CBS 7966
ref|XP_006155804.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      129   4e-29    
ref|XP_003745429.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    127   4e-29    
tpg|DAA21905.1|  TPA: monoacylglycerol O-acyltransferase 2-like         125   4e-29    
ref|XP_004587242.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    126   5e-29    
ref|XP_001630435.1|  predicted protein                                  126   5e-29    Nematostella vectensis
ref|XP_004354544.1|  Monoacylglycerol Oacyltransferase 2, putative      125   6e-29    
ref|XP_001633322.1|  predicted protein                                  126   6e-29    Nematostella vectensis
ref|XP_003780937.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      126   7e-29    
emb|CCG82856.1|  Diacylglycerol O-acyltransferase 1                     125   7e-29    
ref|XP_006733819.1|  PREDICTED: LOW QUALITY PROTEIN: 2-acylglycer...    130   7e-29    
ref|XP_004347514.1|  2-acylglycerol O-acyltransferase 2-A               126   7e-29    
ref|XP_003970760.1|  PREDICTED: diacylglycerol O-acyltransferase ...    126   8e-29    
ref|XP_008900467.1|  hypothetical protein PPTG_07846                    126   8e-29    
gb|ETI53835.1|  hypothetical protein, variant 1                         125   8e-29    
ref|XP_005080529.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      125   8e-29    
ref|XP_006788764.1|  PREDICTED: diacylglycerol O-acyltransferase ...    126   8e-29    
gb|ETI53834.1|  hypothetical protein F443_03265                         126   8e-29    
ref|XP_008900464.1|  hypothetical protein, variant 1                    126   9e-29    
gb|ETM53389.1|  hypothetical protein L914_03118                         126   9e-29    
ref|XP_008587700.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      125   1e-28    
ref|XP_004339931.1|  diacylglycerol oacyltransferase                    125   1e-28    
ref|XP_004348705.1|  diacylglycerol oacyltransferase                    125   1e-28    
ref|XP_004587016.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    125   1e-28    
ref|XP_008056011.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      125   1e-28    
ref|XP_003794278.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      125   1e-28    
ref|XP_003412732.2|  PREDICTED: diacylglycerol O-acyltransferase ...    125   1e-28    
gb|KDE09727.1|  hypothetical protein MVLG_00129                         125   2e-28    
tpg|DAA39556.1|  TPA: hypothetical protein ZEAMMB73_155634              127   2e-28    
gb|EGT47092.1|  hypothetical protein CAEBREN_16074                      125   2e-28    
gb|ETO82560.1|  hypothetical protein, variant                           123   2e-28    
ref|XP_004610886.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      125   2e-28    
ref|XP_005701341.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    125   2e-28    
ref|XP_003459020.1|  PREDICTED: diacylglycerol O-acyltransferase ...    125   2e-28    
gb|EGW01864.1|  2-acylglycerol O-acyltransferase 3                      125   2e-28    
ref|XP_008900463.1|  hypothetical protein PPTG_07845                    125   2e-28    
dbj|BAC87534.1|  unnamed protein product                                122   2e-28    Homo sapiens [man]
ref|XP_008900469.1|  hypothetical protein, variant                      123   2e-28    
ref|XP_005740434.1|  PREDICTED: diacylglycerol O-acyltransferase ...    125   2e-28    
gb|AAI03878.1|  Monoacylglycerol O-acyltransferase 2                    124   2e-28    Homo sapiens [man]
ref|XP_010365091.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      124   2e-28    
ref|XP_002754829.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   2e-28    Callithrix jacchus [common marmoset]
ref|NP_079374.2|  2-acylglycerol O-acyltransferase 2                    124   2e-28    Homo sapiens [man]
ref|XP_001086603.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      124   3e-28    Macaca mulatta [rhesus macaque]
ref|XP_008965719.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    122   3e-28    
ref|XP_004561683.1|  PREDICTED: diacylglycerol O-acyltransferase ...    124   3e-28    
ref|XP_003910482.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      124   3e-28    
ref|XP_006890341.1|  PREDICTED: 2-acylglycerol O-acyltransferase 1      124   3e-28    
ref|XP_005956036.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   3e-28    
ref|XP_010765633.1|  PREDICTED: diacylglycerol O-acyltransferase 2      124   3e-28    
tpg|DAA39555.1|  TPA: hypothetical protein ZEAMMB73_155634              127   3e-28    
ref|XP_780610.3|  PREDICTED: 2-acylglycerol O-acyltransferase 2-like    124   3e-28    
ref|XP_005579169.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   3e-28    
ref|XP_008285514.1|  PREDICTED: diacylglycerol O-acyltransferase 2      124   4e-28    
ref|XP_006957543.1|  diacylglycerol acyltransferase                     124   4e-28    
gb|ACO15207.1|  2-acylglycerol O-acyltransferase 1                      124   4e-28    
ref|XP_850305.2|  PREDICTED: 2-acylglycerol O-acyltransferase 3         124   4e-28    
ref|XP_007906824.1|  PREDICTED: diacylglycerol O-acyltransferase 2      124   4e-28    
ref|XP_002187643.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      124   4e-28    
ref|XP_003461530.2|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   4e-28    
ref|XP_008696742.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    123   5e-28    
ref|XP_005549348.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      124   5e-28    
ref|XP_004021045.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   5e-28    
gb|EHH52051.1|  hypothetical protein EGM_12419                          123   5e-28    
ref|XP_001713160.1|  diacylglycerol O-acyltransferase Dga1              124   5e-28    
emb|CAG02909.1|  unnamed protein product                                123   5e-28    
ref|XP_005379935.1|  PREDICTED: diacylglycerol O-acyltransferase ...    124   5e-28    
gb|EHH17215.1|  hypothetical protein EGK_13557                          123   5e-28    
ref|XP_004587244.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    124   5e-28    
emb|CEI88725.1|  Putative Diacylglycerol O-acyltransferase 2B           122   6e-28    
ref|XP_010891755.1|  PREDICTED: diacylglycerol O-acyltransferase ...    123   6e-28    
ref|XP_003971280.1|  PREDICTED: diacylglycerol O-acyltransferase ...    123   7e-28    
ref|XP_008018375.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      123   7e-28    
ref|XP_004587241.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    125   7e-28    
ref|XP_001683920.1|  putative diacylglycerol acyltransferase            126   7e-28    
gb|ETO82559.1|  hypothetical protein F444_03333                         123   8e-28    
ref|XP_005379934.1|  PREDICTED: diacylglycerol O-acyltransferase ...    124   8e-28    
ref|XP_007520292.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      123   8e-28    
gb|AIC32617.1|  MOGAT3-like protein variant                             123   8e-28    
ref|XP_008900468.1|  hypothetical protein PPTG_07847                    123   8e-28    
ref|XP_010845888.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    123   8e-28    
gb|ETI53863.1|  hypothetical protein F443_03260                         123   8e-28    
ref|XP_005379936.1|  PREDICTED: diacylglycerol O-acyltransferase ...    123   8e-28    
gb|ELT95074.1|  hypothetical protein CAPTEDRAFT_226963                  123   9e-28    
ref|XP_005700763.1|  PREDICTED: diacylglycerol O-acyltransferase ...    123   9e-28    
gb|ETP23686.1|  hypothetical protein F441_03245                         122   9e-28    
ref|XP_001746050.1|  hypothetical protein                               123   9e-28    
gb|ETM53411.1|  hypothetical protein L914_03113                         122   9e-28    
ref|XP_004022202.1|  PREDICTED: diacylglycerol O-acyltransferase ...    122   1e-27    
ref|NP_835470.1|  2-acylglycerol O-acyltransferase 3 isoform a          122   1e-27    
ref|XP_002637529.1|  Hypothetical protein CBG19252                      123   1e-27    
gb|EGT36474.1|  hypothetical protein CAEBREN_15003                      122   1e-27    
emb|CAP36537.2|  Protein CBG19252                                       122   1e-27    
ref|XP_006141071.1|  PREDICTED: diacylglycerol O-acyltransferase 2      123   1e-27    
ref|XP_006070171.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    122   1e-27    
gb|ETM00218.1|  hypothetical protein L917_03041                         122   1e-27    
emb|CEG77579.1|  Putative Diacylglycerol O-acyltransferase 2B           121   1e-27    
ref|XP_005003242.1|  PREDICTED: diacylglycerol O-acyltransferase ...    122   1e-27    
gb|EFN85928.1|  2-acylglycerol O-acyltransferase 1                      122   1e-27    
gb|ETK93722.1|  hypothetical protein L915_03143                         122   1e-27    
gb|AAI00954.1|  Monoacylglycerol O-acyltransferase 3                    122   1e-27    
ref|XP_002822302.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      122   1e-27    
ref|XP_007080981.1|  PREDICTED: diacylglycerol O-acyltransferase 2      122   1e-27    
ref|XP_003468600.1|  PREDICTED: diacylglycerol O-acyltransferase ...    123   1e-27    
emb|CDW58459.1|  2 acylglycerol O acyltransferase 2                     122   1e-27    
ref|XP_005357582.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      122   1e-27    
ref|XP_006106273.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      122   1e-27    
ref|XP_009029562.1|  hypothetical protein HELRODRAFT_186146             122   1e-27    
ref|XP_005024158.1|  PREDICTED: diacylglycerol O-acyltransferase 2      122   1e-27    
ref|XP_008606374.1|  hypothetical protein SDRG_02556                    121   2e-27    
emb|CDQ66407.1|  unnamed protein product                                122   2e-27    
ref|XP_004076687.1|  PREDICTED: diacylglycerol O-acyltransferase ...    122   2e-27    
ref|XP_004021046.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    122   2e-27    
ref|NP_001104193.1|  acyl-CoA wax alcohol acyltransferase 1             121   2e-27    
ref|XP_006926694.1|  PREDICTED: diacylglycerol O-acyltransferase 2      122   2e-27    
ref|XP_009520151.1|  hypothetical protein PHYSODRAFT_256907             122   2e-27    
gb|EPT31895.1|  diacylglycerol acyltransferase                          124   2e-27    
ref|XP_005954882.1|  PREDICTED: diacylglycerol O-acyltransferase ...    122   2e-27    
ref|XP_005534894.1|  similar to diacylglycerol acyltransferase ty...    121   2e-27    
ref|XP_003105885.1|  hypothetical protein CRE_19675                     122   2e-27    
ref|XP_002641060.1|  Hypothetical protein CBG22471                      122   2e-27    
gb|EPR59229.1|  diacylglycerol acyltransferase                          124   2e-27    
ref|NP_001025367.1|  diacylglycerol O-acyltransferase 2                 122   2e-27    
gb|KFH06361.1|  diacylglycerol acyltransferase                          124   2e-27    
ref|XP_003515320.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      121   3e-27    
ref|XP_008016659.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      121   3e-27    
gb|KFH72739.1|  hypothetical protein MVEG_03028                         121   3e-27    
ref|XP_001602288.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    122   3e-27    
gb|ELR45823.1|  hypothetical protein M91_16293                          120   3e-27    
gb|EWM27175.1|  mono- or diacylglycerol acyltransferase                 122   3e-27    
ref|XP_006908581.1|  PREDICTED: diacylglycerol O-acyltransferase ...    121   3e-27    
ref|NP_001106446.1|  acyl-CoA wax alcohol acyltransferase 1             121   3e-27    
ref|XP_006074149.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    121   3e-27    
ref|XP_010614245.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      121   3e-27    
ref|XP_003112375.1|  hypothetical protein CRE_30885                     122   3e-27    
ref|XP_001635548.1|  predicted protein                                  120   3e-27    
emb|CEG63726.1|  Putative Diacylglycerol O-acyltransferase 2B           121   3e-27    
ref|XP_010845890.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    121   3e-27    
ref|XP_007055343.1|  PREDICTED: diacylglycerol O-acyltransferase ...    121   4e-27    
ref|XP_009005662.1|  PREDICTED: LOW QUALITY PROTEIN: diacylglycer...    122   4e-27    
ref|XP_005903302.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    121   4e-27    
emb|CEI99677.1|  Putative Diacylglycerol O-acyltransferase 2B           121   4e-27    
ref|XP_002429597.1|  Diacylglycerol O-acyltransferase, putative         121   4e-27    
ref|XP_005910163.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   4e-27    
ref|XP_007259505.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
ref|XP_001518899.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      119   4e-27    
ref|NP_989372.1|  diacylglycerol O-acyltransferase 2                    121   4e-27    
ref|XP_003764696.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
ref|XP_007518045.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      120   4e-27    
ref|XP_007491014.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
ref|XP_003923533.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
ref|XP_006937035.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
gb|ELR50951.1|  2-acylglycerol O-acyltransferase 2                      120   4e-27    
ref|XP_010610326.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   4e-27    
ref|XP_527842.3|  PREDICTED: 2-acylglycerol O-acyltransferase 3 i...    120   4e-27    
gb|EPQ15716.1|  2-acylglycerol O-acyltransferase 3                      120   5e-27    
ref|XP_005579171.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   5e-27    
ref|XP_005879226.1|  PREDICTED: LOW QUALITY PROTEIN: 2-acylglycer...    121   5e-27    
gb|KDQ11945.1|  hypothetical protein BOTBODRAFT_432646                  119   5e-27    
ref|XP_009539666.1|  hypothetical protein PHYSODRAFT_356224             117   5e-27    
ref|XP_006005287.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   5e-27    
gb|KHJ45052.1|  diacylglycerol acyltransferase                          120   5e-27    
ref|XP_004683759.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      120   5e-27    
ref|XP_003934201.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      120   6e-27    
ref|XP_009185215.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   6e-27    
emb|CDH54370.1|  diacylglycerol acyltransferase                         120   6e-27    
gb|ERG81224.1|  2-acylglycerol o-acyltransferase 2-a                    120   6e-27    
ref|XP_975146.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2         120   6e-27    
ref|XP_005982607.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   6e-27    
ref|XP_005644081.1|  hypothetical protein COCSUDRAFT_54539              119   6e-27    
ref|XP_005633540.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   6e-27    
ref|XP_006743443.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   6e-27    
gb|EFB28719.1|  hypothetical protein PANDA_003320                       120   7e-27    
ref|XP_002895954.1|  diacylglycerol O-acyltransferase, putative         120   7e-27    
ref|XP_004708892.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      120   7e-27    
ref|XP_002822303.1|  PREDICTED: diacylglycerol O-acyltransferase 2      121   7e-27    
ref|XP_002915342.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   7e-27    
ref|XP_009185214.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   7e-27    
emb|CDQ73885.1|  unnamed protein product                                120   7e-27    
ref|XP_004016767.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   7e-27    
gb|KFO13973.1|  Diacylglycerol O-acyltransferase 2                      120   7e-27    
ref|XP_003807246.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   8e-27    
ref|XP_008980395.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   8e-27    
ref|NP_001106365.1|  uncharacterized protein LOC100127341               119   8e-27    
ref|XP_004589935.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   8e-27    
ref|XP_009422059.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   9e-27    
ref|XP_006627833.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   9e-27    
ref|XP_003910483.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   9e-27    
ref|XP_004023002.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   9e-27    
ref|XP_005579176.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   9e-27    
emb|CEF62560.1|  Diacylglycerol acyltransferase family-containing...    120   9e-27    
gb|EKG02616.1|  diacylglycerol acyltransferase, putative                122   9e-27    
gb|KHN74604.1|  2-acylglycerol O-acyltransferase 1                      120   9e-27    
ref|XP_004879692.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_005579177.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_008047622.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      120   1e-26    
ref|XP_005323271.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_004016382.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
ref|XP_005954164.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_819169.1|  diacylglycerol acyltransferase                        122   1e-26    
ref|XP_004638293.1|  PREDICTED: 2-acylglycerol O-acyltransferase 1      120   1e-26    
ref|XP_010845887.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_008965721.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_006627832.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_009097156.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
tpg|DAA15129.1|  TPA: monoacylglycerol O-acyltransferase 3-like         120   1e-26    
ref|XP_008056012.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
ref|XP_004789196.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
ref|XP_005690059.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_005395549.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_005323272.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_005690060.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_005910164.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_004688316.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      119   1e-26    
gb|ELR45825.1|  2-acylglycerol O-acyltransferase 2                      119   1e-26    
ref|XP_006627834.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   1e-26    
ref|XP_008842455.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
ref|XP_008148275.1|  PREDICTED: diacylglycerol O-acyltransferase 2      120   1e-26    
ref|XP_002947215.1|  hypothetical protein VOLCADRAFT_103301             119   1e-26    
ref|XP_010817933.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_002808396.1|  PREDICTED: LOW QUALITY PROTEIN: 2-acylglycer...    122   1e-26    
ref|XP_003254746.1|  PREDICTED: diacylglycerol O-acyltransferase 2      118   1e-26    
ref|NP_001240820.1|  diacylglycerol O-acyltransferase 2 isoform 2       119   1e-26    
ref|XP_006203382.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_003732220.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    119   1e-26    
ref|XP_010745176.1|  PREDICTED: diacylglycerol O-acyltransferase 2      119   1e-26    
ref|XP_006127339.1|  PREDICTED: 2-acylglycerol O-acyltransferase 3      118   1e-26    
ref|NP_115953.2|  diacylglycerol O-acyltransferase 2 isoform 1          120   1e-26    
ref|XP_002593388.1|  hypothetical protein BRAFLDRAFT_206726             119   1e-26    
ref|XP_005633539.1|  PREDICTED: diacylglycerol O-acyltransferase ...    120   2e-26    
dbj|BAH85840.1|  diacylglycerol acyltransferase                         119   2e-26    
ref|XP_006203383.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   2e-26    
emb|CDS13959.1|  hypothetical protein LRAMOSA06132                      119   2e-26    
ref|XP_003746869.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   2e-26    
ref|XP_004434071.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   2e-26    
ref|XP_004434070.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   2e-26    
emb|CDQ94355.1|  unnamed protein product                                119   2e-26    
gb|AIC32620.1|  MOGAT3-like protein variant                             118   2e-26    
ref|XP_010704571.1|  PREDICTED: diacylglycerol O-acyltransferase 2      119   2e-26    
gb|AIC32618.1|  MOGAT3-like protein variant                             118   2e-26    
ref|XP_005487215.1|  PREDICTED: diacylglycerol O-acyltransferase 2      119   2e-26    
gb|ADU25258.1|  diacylglycerol acytransferase 2                         119   2e-26    
gb|AGZ95151.1|  diacylglycerol O-acyltransferase 2                      119   2e-26    
ref|XP_005282594.1|  PREDICTED: 2-acylglycerol O-acyltransferase 1      119   2e-26    
ref|XP_005284567.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   2e-26    
ref|XP_004683270.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   2e-26    
gb|KFQ45425.1|  Diacylglycerol O-acyltransferase 2                      119   2e-26    
ref|XP_010845886.1|  PREDICTED: LOW QUALITY PROTEIN: 2-acylglycer...    119   2e-26    
emb|CAH18230.1|  hypothetical protein                                   117   2e-26    
ref|XP_635762.1|  diacylglycerol O-acyltransferase 2                    119   2e-26    
ref|NP_001153552.1|  diacylglycerol O-acyltransferase 2                 119   2e-26    
ref|XP_005193073.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    120   2e-26    
gb|KFP73186.1|  Diacylglycerol O-acyltransferase 2                      119   2e-26    
ref|XP_006875499.1|  PREDICTED: LOW QUALITY PROTEIN: diacylglycer...    120   2e-26    
gb|ESL11749.1|  hypothetical protein TRSC58_00493                       117   2e-26    
ref|XP_004656320.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      118   2e-26    
ref|XP_010022613.1|  PREDICTED: diacylglycerol O-acyltransferase 2      119   2e-26    
gb|KFP14576.1|  Diacylglycerol O-acyltransferase 2                      119   2e-26    
ref|XP_004879694.1|  PREDICTED: 2-acylglycerol O-acyltransferase 2      118   2e-26    
ref|XP_004484356.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    118   3e-26    
ref|XP_004468826.1|  PREDICTED: 2-acylglycerol O-acyltransferase ...    117   3e-26    
gb|AAD45832.1|AC004876_5  similar to predicted proteins AAB54240 ...    117   3e-26    
ref|XP_004879693.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   3e-26    
ref|XP_004656318.1|  PREDICTED: diacylglycerol O-acyltransferase ...    119   3e-26    
ref|NP_080660.1|  diacylglycerol O-acyltransferase 2                    119   3e-26    
ref|XP_001512404.2|  PREDICTED: diacylglycerol O-acyltransferase 2      116   3e-26    



>gb|ADG22608.1| diacylglycerol acyltransferase type 2 [Olea europaea]
Length=335

 Score =   444 bits (1143),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 266/334 (80%), Gaps = 4/334 (1%)
 Frame = -3

Query  1191  EKGGNVQHRSP-SNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASII  1018
             E  G+++ R    +E+A  PTPAEF GT    S+  T++ L  WLG     ++VVLAS +
Sbjct  4     EGNGDMRRRQLLVSESAQQPTPAEFKGTQ--GSIFHTILALVLWLGSVHFNIIVVLASFV  61

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FL FTKA+MVIGLL +LM  PID  +KWG + ARY+CK A GYFP++LYVEDIKAF+PN 
Sbjct  62    FLSFTKALMVIGLLVILMVAPIDDRNKWGRKLARYICKHAVGYFPVNLYVEDIKAFDPNE  121

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             +YVFGYEPHS+WPIG+V+L+  TGFMPL KIK L STAVFYTP +RHIW+WLG++PA ++
Sbjct  122   SYVFGYEPHSVWPIGVVSLADLTGFMPLQKIKVLASTAVFYTPFLRHIWSWLGLTPATRK  181

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             +F SLL+SGYSCI+VPGGV+EA YMEH  E  +LK+R+GFV+IAM+MG PLVPVFCFGQ+
Sbjct  182   NFTSLLASGYSCIIVPGGVKEALYMEHGSEIAYLKTRRGFVRIAMEMGKPLVPVFCFGQT  241

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             NVY WWKPS KLYL+FSRA+KF PI FWG +GS +P + P+HVVVG+PI   +N QPT E
Sbjct  242   NVYKWWKPSGKLYLEFSRAIKFAPIFFWGVLGSPLPLRHPMHVVVGRPIVPKRNPQPTVE  301

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             ++A +H +F+EAL ELFE+HK R+GY D+QLKI+
Sbjct  302   EVAEVHGQFVEALQELFERHKARVGYTDMQLKIL  335



>ref|XP_009804388.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Nicotiana sylvestris]
Length=332

 Score =   433 bits (1113),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/334 (64%), Positives = 267/334 (80%), Gaps = 4/334 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             MEE G  V  + P+  A  PPTP EF GT S + L   + ++ WLG      ++VLAS +
Sbjct  3     MEEDG--VIDQKPA--APSPPTPVEFKGTDSGSLLHTVVALVLWLGSIHFNFIIVLASFV  58

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FLPF+KA+ VIG+L +LM IPID+ +K G R +RY+CK   GYFP+HLYVEDIKAF+PN 
Sbjct  59    FLPFSKALAVIGILLILMLIPIDEKNKRGRRLSRYICKHVCGYFPVHLYVEDIKAFDPNE  118

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             AYVFGYEPHS+WPIG+V L+  TGFMPLP+IK L STAVFYTP MRHIWTWLG++PA ++
Sbjct  119   AYVFGYEPHSVWPIGVVALADLTGFMPLPRIKVLASTAVFYTPFMRHIWTWLGLAPATRK  178

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             SFKSLL+SG+SCI+VPGGVQEA+YME   E  +L+ RKGFV+IAM+MG PLVPVFCFGQS
Sbjct  179   SFKSLLASGHSCIIVPGGVQEAFYMERGSEIAYLQRRKGFVRIAMEMGKPLVPVFCFGQS  238

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             +VY WWKPS KLYL+FSR +KFTPILFWG + S +PFQRP+HVVVG+PI + KN  PT E
Sbjct  239   DVYKWWKPSGKLYLEFSRLIKFTPILFWGVLCSPIPFQRPMHVVVGRPIVLKKNPDPTAE  298

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             ++A +HSRFIEAL +LFE+HKKR+GY DL L+++
Sbjct  299   EVAEVHSRFIEALEQLFERHKKRVGYDDLPLRVL  332



>ref|XP_009597603.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Nicotiana tomentosiformis]
Length=332

 Score =   431 bits (1109),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/334 (64%), Positives = 265/334 (79%), Gaps = 4/334 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             +EE G  V  + P+  A  PPTP EF GT S + L   + ++ WLG      +++LAS +
Sbjct  3     IEEDG--VIDQKPA--APSPPTPLEFKGTDSGSLLHTVVALVLWLGSIHINFIIILASFV  58

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FLPF+KA+ VIG+L +LM IPID+ +KWG R +RY+CK   GYFP+HLYVEDIKAF+ N 
Sbjct  59    FLPFSKALAVIGILLILMLIPIDEKNKWGRRLSRYICKHVCGYFPVHLYVEDIKAFDSNE  118

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             AYVFGYEPHS+WPIG+V L+  TGFMPLP+IK L STAVFYTP MRHIWTWLG++PA ++
Sbjct  119   AYVFGYEPHSVWPIGVVALADLTGFMPLPRIKVLASTAVFYTPFMRHIWTWLGLAPATRK  178

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             SFKSLL SG+SCI+VPGGVQEA+YME   E  +L+ RKGFV+IAM+MG PLVPVFCFGQS
Sbjct  179   SFKSLLDSGHSCIIVPGGVQEAFYMERGSEIAYLQRRKGFVRIAMEMGKPLVPVFCFGQS  238

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             +VY WWKPS KLYL+FSR +KFTPILFWG +GS +PFQRP+ VVVG+PI + KN  PT E
Sbjct  239   DVYKWWKPSGKLYLEFSRLIKFTPILFWGVLGSPIPFQRPMKVVVGRPILLKKNPDPTAE  298

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             ++  +HSRFIEAL +LFE+HKKR+GY DL L+I+
Sbjct  299   EVTEVHSRFIEALEQLFERHKKRVGYEDLPLRIL  332



>gb|AGL46984.1| acyl-CoA:diacylglycerol acyltransferase 2 [Nicotiana tabacum]
Length=332

 Score =   431 bits (1109),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/334 (64%), Positives = 266/334 (80%), Gaps = 4/334 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             +EE G  V  + P+  A  PPTP EF GT S + L   + ++ WLG      +++LAS +
Sbjct  3     IEEDG--VIDQKPA--APSPPTPLEFKGTDSGSLLHTVVALVLWLGSIHINFIIILASFV  58

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FLPF+KA+ VIG+L +LM IPID+ +KWG R +RY+CK   GYFP+HLYVEDIKAF+ N 
Sbjct  59    FLPFSKALAVIGILLILMLIPIDEKNKWGRRLSRYICKHVCGYFPVHLYVEDIKAFDSNE  118

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             AYVFGYEPHS+WPIG+V L+  TGFMPLP+IK L STAVFYTP MRHIWTWLG++PA ++
Sbjct  119   AYVFGYEPHSVWPIGVVALADLTGFMPLPRIKVLASTAVFYTPFMRHIWTWLGLAPATRK  178

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             SFKSLL+SG+SCI+VPGGVQEA+YME   E  +L+ RKGFV+IAM+MG PLVPVFCFGQS
Sbjct  179   SFKSLLASGHSCIIVPGGVQEAFYMERGSEIAYLQRRKGFVRIAMEMGKPLVPVFCFGQS  238

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             +VY WWKPS KLYL+FSR +KFTPILFWG +GS +PFQRP+ VVVG+PI + KN  PT E
Sbjct  239   DVYKWWKPSGKLYLEFSRLIKFTPILFWGVLGSPIPFQRPMKVVVGRPILLKKNPDPTAE  298

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             ++  +HSRFIEAL +LFE+HKKR+GY DL L+I+
Sbjct  299   EVTEVHSRFIEALEQLFERHKKRVGYEDLPLRIL  332



>ref|XP_006365015.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Solanum tuberosum]
Length=333

 Score =   426 bits (1096),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 266/334 (80%), Gaps = 6/334 (2%)
 Frame = -3

Query  1191  EKGGNVQHRSPSNEAAPP--PTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
                 +V H+ P    APP  PTP EF GT S +     L ++ WLG      ++++AS +
Sbjct  4     RDDDSVIHQKP----APPSTPTPVEFKGTNSGSLFYTVLALVLWLGSVHFNFLILIASFV  59

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FLPF+KA++VIG+L +L+ IPID+ +  G R ARY+CK A GYFP+HLYVEDIKAF+PN 
Sbjct  60    FLPFSKALIVIGILLILILIPIDEKNNLGRRLARYICKHACGYFPVHLYVEDIKAFDPNE  119

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             AYVFGYEPHS+WPIG V+L+  TGFMPLPKIK L STAVFYTP +RHIWTWLG++P  ++
Sbjct  120   AYVFGYEPHSVWPIGAVSLADLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLAPVTRK  179

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             +FKSLL+SGYSCI+VPGGVQEA+YMEH  E  +L+ RKGFV+IA++ G PLVPVFCFGQ+
Sbjct  180   NFKSLLASGYSCIIVPGGVQEAFYMEHGSEIAYLQRRKGFVRIAIETGKPLVPVFCFGQT  239

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             +VY WWKPS KLYL+FSR +KFTPILFWG +GS VPFQRP+HVVVG+PI + KN +PT E
Sbjct  240   DVYKWWKPSGKLYLEFSRLIKFTPILFWGVLGSPVPFQRPMHVVVGRPIVLKKNPEPTVE  299

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +++ +HSRFIEA+ ELFE+HKKR+GY DL L+++
Sbjct  300   EVSEVHSRFIEAMQELFERHKKRVGYEDLPLRVL  333



>emb|CDP01742.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   434 bits (1115),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 253/314 (81%), Gaps = 3/314 (1%)
 Frame = -3

Query  1134  TPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFI  958
             T  EF GT    SL  T++ L  WLG      ++V AS IFLPF+KA+ VIGLL + M +
Sbjct  232   TALEFKGTR--GSLFHTVLALIFWLGSVHFNALIVFASFIFLPFSKALAVIGLLVIFMVL  289

Query  957   PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLS  778
             PID+ S WG + ARY+CK A GYFP+ LYVED KAF+PN+AYVFGYEPHS+WP+G+V L+
Sbjct  290   PIDERSNWGRKLARYICKHACGYFPVCLYVEDYKAFDPNQAYVFGYEPHSVWPVGVVALA  349

Query  777   AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQ  598
               TGFMPLPKIK L STAVFYTP +RHIWTWLG++PA +++F SLL+SGYSCI+VPGGVQ
Sbjct  350   DLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLAPATRRNFLSLLASGYSCIIVPGGVQ  409

Query  597   EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAV  418
             EA+ MEH  E  F+KSR+GFV+IAM+ G PLVPVFCFGQ+ VY W KPS KL+L+FSRA+
Sbjct  410   EAFRMEHGSEIAFIKSRRGFVRIAMESGKPLVPVFCFGQTEVYRWLKPSGKLFLEFSRAI  469

Query  417   KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             KFTPI+FWG +GS +P + P+HVVVGKPIEV KN QPT E++AA+H +F+EAL +LFE+H
Sbjct  470   KFTPIVFWGVLGSPMPLRHPLHVVVGKPIEVKKNPQPTAEEVAAVHGQFVEALRDLFERH  529

Query  237   KKRLGYVDLQLKIM  196
             K+R+GY DLQL+I+
Sbjct  530   KERVGYADLQLQIL  543



>ref|XP_011098009.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Sesamum indicum]
Length=335

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/335 (63%), Positives = 266/335 (79%), Gaps = 3/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             +E  G   Q +SPS EAA P TPAEF G  S   +L T++ L  WLG     VVVVL S 
Sbjct  3     LEADGDVGQRKSPSAEAAAPSTPAEFRG--SQGPVLHTILALVLWLGSVHFNVVVVLVSF  60

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             IFLPF KA+ VIGLL +LM IPID+ SK G + +RY+CK A GYFP++LYVEDIKAF+PN
Sbjct  61    IFLPFQKALGVIGLLLILMVIPIDERSKLGRKLSRYICKHAVGYFPVNLYVEDIKAFDPN  120

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
              AYVFGYEPHS+WPIG+V L+  TGFMPLPK+K L STAVFYTP++RH+W+WLG++PA +
Sbjct  121   EAYVFGYEPHSVWPIGVVALADHTGFMPLPKMKVLASTAVFYTPLLRHVWSWLGLAPATR  180

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL SGYSCI+VPGGVQEA+YME   E  FL+ RKGFV+IA++ G PLVPVFCFGQ
Sbjct  181   KNFTSLLLSGYSCIIVPGGVQEAFYMERGSEIAFLQKRKGFVRIAIETGKPLVPVFCFGQ  240

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S+VY WWKPS KLY +F+RA+KF PI+FWG +GS +PF+RP+HVVVG+PI + KN QPTE
Sbjct  241   SDVYKWWKPSWKLYREFARAIKFAPIVFWGVLGSPLPFRRPLHVVVGRPILLKKNPQPTE  300

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+E L  LFE+HK R+G  D+QL+I+
Sbjct  301   EEVAEVHSQFVEGLEGLFERHKTRVGCTDVQLRIL  335



>ref|XP_004233286.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Solanum 
lycopersicum]
Length=333

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 263/332 (79%), Gaps = 2/332 (1%)
 Frame = -3

Query  1191  EKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFL  1012
             ++  ++ H+ P+  +AP  TP EF G  S + L   L ++ WLG      ++++AS IFL
Sbjct  4     QEDNSIIHQQPAPPSAP--TPVEFKGANSGSLLHTVLALVLWLGSVHFNFLILIASFIFL  61

Query  1011  PFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAY  832
             PF+K ++VIG+L +L+ IPID+ + +G R ARY+CK A GYFP+HLYVEDIKAF+PN AY
Sbjct  62    PFSKTVIVIGILLILILIPIDEKNNFGRRLARYICKHACGYFPVHLYVEDIKAFDPNEAY  121

Query  831   VFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSF  652
             VFGYEPHS+WPIG V L+  TGFMPLPKIK L STAVFYTP +RHIWTWLG++P  +++F
Sbjct  122   VFGYEPHSVWPIGAVALADLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLAPITRKNF  181

Query  651   KSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNV  472
             KSLL+SGYSCI+VPGGVQE +YMEH  E  +L+ RKGFV+IA++ G PLVPVFCFGQ+ +
Sbjct  182   KSLLASGYSCIIVPGGVQETFYMEHGSEIAYLQKRKGFVRIAIETGKPLVPVFCFGQTAI  241

Query  471   YNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQL  292
             Y WWKP  KLYL+FSR +KFTPILFWG +GS VPF+RP+HVVVG+PI + KN +PT E++
Sbjct  242   YKWWKPRGKLYLEFSRLIKFTPILFWGVLGSPVPFRRPMHVVVGRPIMLEKNPEPTVEEV  301

Query  291   AALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             + +HSRF EA+ ELFE+HKKR+GY DL L+++
Sbjct  302   SEVHSRFTEAMQELFERHKKRVGYEDLPLRVV  333



>ref|XP_004509475.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Cicer arietinum]
Length=336

 Score =   411 bits (1056),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 257/336 (76%), Gaps = 6/336 (2%)
 Frame = -3

Query  1188  KGGNVQHRSPSNEAAPPPTPAEFIGT-----ASANSLLMTLMMLAWLGVPPSIVVVVLAS  1024
             K G+++  +P + +  P     FIG+     +S+N L   L +  WLG       V+  +
Sbjct  2     KRGSMESPAPEDFSGEPEEKV-FIGSDKFSDSSSNGLKTVLALALWLGGIHFNGAVIFFA  60

Query  1023  IIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEP  844
             I FLP +KA+ V GLLF+LM IPID+NS +G + ARY+CK+A  YFP+ L+VEDIKAF P
Sbjct  61    IFFLPLSKALFVFGLLFVLMVIPIDENSLFGRKLARYICKRACSYFPVTLHVEDIKAFHP  120

Query  843   NRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAG  664
             NRAYVFGYEPHS+ PIG+V L+  TGFMPLPKIK L S+A+FYTP +RHIWTWLG++PA 
Sbjct  121   NRAYVFGYEPHSVLPIGVVALANNTGFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPAT  180

Query  663   KQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
             K++F SLL +GYSCI+VPGGVQE + MEH CE  FLK+R+GFV+IAM+ G PLVPVFCFG
Sbjct  181   KKNFTSLLDAGYSCILVPGGVQETFIMEHGCEIAFLKARRGFVRIAMEKGKPLVPVFCFG  240

Query  483   QSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPT  304
             QS+VY WWKP  KL L F+RA+KFTP+ FWG  GS +PF+ P++VVVG+PIE+ KN + T
Sbjct  241   QSDVYKWWKPGGKLILNFARAIKFTPLYFWGIFGSPIPFKHPMYVVVGRPIEIEKNPKAT  300

Query  303   EEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              E++A +HS+F+EAL +LFE++K R+GYV+LQLKI+
Sbjct  301   PEEVAKVHSQFVEALQDLFERNKARVGYVNLQLKIV  336



>gb|EYU38933.1| hypothetical protein MIMGU_mgv1a009887mg [Erythranthe guttata]
Length=328

 Score =   409 bits (1050),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 250/321 (78%), Gaps = 3/321 (1%)
 Frame = -3

Query  1155  NEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGL  979
             ++   PPTPAEF G  S  S+L TL+ L  WLG      VVVL S I LP  KA+ VIGL
Sbjct  10    SDRRSPPTPAEFKG--SPGSILHTLLALVLWLGSVHFNFVVVLLSFILLPLQKALGVIGL  67

Query  978   LFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWP  799
             L + M IPID  SKWG + +RY+CK A GYFP+ LYVEDIKAF+PN AYVFGYEPHS+WP
Sbjct  68    LLIFMVIPIDDRSKWGRKLSRYICKHAVGYFPVSLYVEDIKAFDPNEAYVFGYEPHSVWP  127

Query  798   IGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCI  619
             IG+V L+  TGFMPLPKIK L STAVFYTP MRH+W+WLG+SPA + +F SLLSSG SCI
Sbjct  128   IGVVALADLTGFMPLPKIKVLASTAVFYTPFMRHVWSWLGLSPATRNNFSSLLSSGCSCI  187

Query  618   VVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
             +VPGGVQEA+YMEH  E  F++ RKGFV+IAM+ G PLVPVFCFGQS+VY WWKPS KLY
Sbjct  188   IVPGGVQEAFYMEHGSEIAFIQKRKGFVRIAMQKGNPLVPVFCFGQSDVYKWWKPSWKLY  247

Query  438   LKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
               FSRA+KF PI+FWG +GS +PF+ P+HVVVG+P  V KN QPT E++  +H++F+EAL
Sbjct  248   RDFSRAIKFAPIIFWGVLGSPLPFRNPLHVVVGRPFVVNKNPQPTVEEVDEVHAQFVEAL  307

Query  258   LELFEKHKKRLGYVDLQLKIM  196
              +LFE+HK R+G  +L+L+I+
Sbjct  308   KDLFERHKARVGCAELKLRIL  328



>gb|AGO32049.1| diacylglycerol acyltransferase 2 [Xanthoceras sorbifolium]
Length=333

 Score =   405 bits (1042),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 248/303 (82%), Gaps = 1/303 (0%)
 Frame = -3

Query  1101  NSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             ++++ T++ LA WLG+    V++VL +I F+P +K+++V GLL+  M +PID +SKWG  
Sbjct  31    SNVVHTMLALALWLGIIHFNVLLVLFTIFFMPLSKSLLVFGLLWFFMLLPIDNHSKWGRS  90

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              ARY+CK A  YFP+ L+VEDI AF  +R+Y+FGYEPHS+ PIG+V L+  TGFMPLPK+
Sbjct  91    LARYICKHACSYFPVTLHVEDINAFHSDRSYIFGYEPHSVLPIGVVALADLTGFMPLPKV  150

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+A+FYTP +RHIW+WLG++PA K++F SLL++GYSCI+VPGGVQE + MEH  E 
Sbjct  151   KVLASSAIFYTPFLRHIWSWLGLTPASKKNFTSLLAAGYSCIIVPGGVQETFLMEHGSEI  210

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM+MG PLVPVFCFGQS+VY WWKP  +LYLKFSRA+KFTPI FWG +
Sbjct  211   AFLKSRRGFVRIAMEMGRPLVPVFCFGQSDVYKWWKPGGQLYLKFSRALKFTPIYFWGLL  270

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             G+ +P++ P+HVVVG+PIE+ KN QPT E++  +HS+F+EAL +LFE+HK+R+GY +LQL
Sbjct  271   GTPLPYKHPMHVVVGRPIELKKNPQPTMEEVNEVHSQFVEALQDLFERHKERVGYPNLQL  330

Query  204   KIM  196
             KI+
Sbjct  331   KIL  333



>gb|EPS73366.1| diacylglycerol acyltransferase type 2, partial [Genlisea aurea]
Length=312

 Score =   405 bits (1040),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 247/314 (79%), Gaps = 3/314 (1%)
 Frame = -3

Query  1134  TPAEFIGTASANSLLMTLM-MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFI  958
             TPAEF   AS  SL  +++ +L WLG      +V L S +FLP  KA+ VIG L +L  I
Sbjct  1     TPAEF--KASPGSLFTSILALLLWLGSVHFNFLVALLSFVFLPLPKALCVIGFLLILAVI  58

Query  957   PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLS  778
             P+D++S WG + +RY+C++++GYFP+ L+VEDI+AF+PN AYVFGYEPHS+WPIG+V+L+
Sbjct  59    PVDESSVWGRKLSRYICRRSAGYFPITLHVEDIEAFDPNEAYVFGYEPHSVWPIGVVSLA  118

Query  777   AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQ  598
               TG MPL KIK L S+AVFYTP MRH+W+W G++PA +++F SLLSSGYSCIVVPGGVQ
Sbjct  119   DLTGLMPLSKIKFLASSAVFYTPFMRHLWSWCGVTPASRKNFASLLSSGYSCIVVPGGVQ  178

Query  597   EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAV  418
             EA YMEH  ET FLK+R+GF++IAM+ G PLVPVFCFGQS+ Y WWKP  KL++ FSRA+
Sbjct  179   EAVYMEHGSETAFLKNRRGFIRIAMETGKPLVPVFCFGQSDAYKWWKPGGKLFMDFSRAI  238

Query  417   KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             KF PI+FWG +GS VPF+RP++V VG+PI +  N++PT E++  +H RF+  L +LFE+H
Sbjct  239   KFAPIVFWGVLGSPVPFRRPMYVAVGRPIVLKTNAKPTAEEIGEVHGRFVHELKQLFERH  298

Query  237   KKRLGYVDLQLKIM  196
             KKR GY +L+L+I+
Sbjct  299   KKRAGYPNLELRIL  312



>ref|NP_566952.1| diacylglycerol O-acyltransferase 2 [Arabidopsis thaliana]
 sp|Q9ASU1.1|DGAT2_ARATH RecName: Full=Diacylglycerol O-acyltransferase 2 [Arabidopsis 
thaliana]
 gb|AAK32844.1|AF361832_1 AT3g51520/F26O13_160 [Arabidopsis thaliana]
 gb|AAL77746.1| AT3g51520/F26O13_160 [Arabidopsis thaliana]
 gb|AAM65113.1| unknown [Arabidopsis thaliana]
 gb|AEE78802.1| diacylglycerol O-acyltransferase 2 [Arabidopsis thaliana]
Length=314

 Score =   402 bits (1034),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 238/310 (77%), Gaps = 1/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF     +N     + M  WLG     V +VL S+IFLP + ++MV+GLL L +FIPID 
Sbjct  6     EFRAEEHSNQFHSIIAMAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ LYVED +AF+PNRAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    RSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMP+P IK L S+A+FYTP +RHIWTWLG++ A +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPIPNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD E +FL  R+GFV+IAM+ G+PLVPVFCFGQ+ VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I FWG  GS +P ++P+HVVVGKPIEV K  +PT+E++A  H +++EAL +LFE+HK R+
Sbjct  246   ICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRV  305

Query  225   GYVDLQLKIM  196
             GY DL+LKI+
Sbjct  306   GY-DLELKIL  314



>gb|ADT91688.1| diacylglycerol acyltransferase 2 [Helianthus annuus]
Length=336

 Score =   400 bits (1028),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 243/315 (77%), Gaps = 3/315 (1%)
 Frame = -3

Query  1137  PTPAEFIGTASANSLLMT-LMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMF  961
             PTP EF G      L+ T L M+AWLG     V +VLAS   LP  K  +VIG+L +L+ 
Sbjct  24    PTPVEFTG--KPQPLIHTALAMIAWLGSIHLNVFIVLASFFLLPIHKFFVVIGMLVILIV  81

Query  960   IPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL  781
             IPI++ S+WG    RY+CK A G+FP+ LYVED KAF P++AYVFGYEPHS+WPIG+V L
Sbjct  82    IPINERSRWGRGLGRYICKHAVGFFPVTLYVEDYKAFVPDQAYVFGYEPHSVWPIGVVAL  141

Query  780   SAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGV  601
             +  TGFMPLPKIK L STAVFYTP +RHIWTWLG++ A +++F SLL +GYSCIV+PGGV
Sbjct  142   ADLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLTAATRKNFSSLLKAGYSCIVIPGGV  201

Query  600   QEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRA  421
             QE +YM+HD E  FL++RKGFV++AM+  +PLVPVF FGQS VY WWKP  KL+LK SRA
Sbjct  202   QETFYMDHDSEIAFLRTRKGFVRLAMETNSPLVPVFGFGQSYVYKWWKPRGKLFLKLSRA  261

Query  420   VKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
             ++FTP+ FWG +GS +PF++P+HVVVG+PI   KN+ PT E+++ +H +F++A+ +LFE+
Sbjct  262   IRFTPVFFWGILGSPIPFRQPMHVVVGRPIHFKKNTTPTMEEVSEVHRQFVDAVEDLFER  321

Query  240   HKKRLGYVDLQLKIM  196
             HK R GY +LQL+IM
Sbjct  322   HKARAGYPNLQLRIM  336



>ref|XP_003517113.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Glycine max]
Length=329

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 241/304 (79%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N     L M+ WLG     + ++L ++ FLP +K+++V G LF  M +PI++ S++G 
Sbjct  26    SSNLFSAILAMVLWLGAIHFNIALILLAVFFLPLSKSLLVFGFLFGFMVLPINEKSRFGR  85

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             R +R++CK A  YFP+ L+VED+KAF+PNRAYVFGYEPHS+ PIG+V L+  TGFMPLPK
Sbjct  86    RLSRFICKHACNYFPITLHVEDMKAFDPNRAYVFGYEPHSVLPIGIVALADHTGFMPLPK  145

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             +K L S+ VFYTP +RH+WTWLG++PA K++F SLL+SG+SCI++PGGVQEA++M+H  E
Sbjct  146   VKVLASSTVFYTPFLRHLWTWLGLTPATKKNFISLLASGHSCILIPGGVQEAFHMQHGTE  205

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLK+R+GFV++AM  G PLVPVFCFGQSNVY WWKP  KL+LKF+RA+KFTPI FWG 
Sbjct  206   IAFLKARRGFVRVAMVKGKPLVPVFCFGQSNVYKWWKPGGKLFLKFARAIKFTPICFWGI  265

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              GS +PF+ P+HVVVG+PIEV KN +PT E++A +H  F+EAL +LFE+HK R GY +L+
Sbjct  266   FGSPLPFRHPMHVVVGRPIEVDKNREPTTEEVAKIHGLFVEALQDLFERHKARAGYPNLE  325

Query  207   LKIM  196
             L+I+
Sbjct  326   LRIV  329



>emb|CBI37486.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 241/303 (80%), Gaps = 1/303 (0%)
 Frame = -3

Query  1101  NSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +SL+ ++  L  WLG    +V +VL +++FLP + A+ V GLL + M IPID+ SK+G +
Sbjct  31    DSLIHSIAALTIWLGAIHFVVALVLTALLFLPLSLALTVFGLLLVFMVIPIDERSKYGRK  90

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A GYFP+ LYVEDIKAF+PNRAYVFGYEPHS+ PIG+V L+  TGF+PL KI
Sbjct  91    LSRYICKHACGYFPVTLYVEDIKAFDPNRAYVFGYEPHSVLPIGVVALADLTGFLPLSKI  150

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFY P +RHIWTWLG++PA K++F SLL+SGYSCI+VPGGVQE   MEH CE 
Sbjct  151   KVLASSAVFYVPFLRHIWTWLGLTPATKKNFTSLLASGYSCIIVPGGVQEPCLMEHGCEV  210

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSRKGFV+IAM+MG PLVPVFCFGQS VY WWKP   LYL+FSRA+KFTPI FWG  
Sbjct  211   AFLKSRKGFVRIAMEMGRPLVPVFCFGQSRVYKWWKPGGNLYLQFSRAIKFTPIFFWGIF  270

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS +P++ P+ VVVG+PIEV KN QPT E++  +H +F+EAL +LFEKHK R+G+ DLQL
Sbjct  271   GSPLPYRHPMDVVVGRPIEVKKNVQPTVEEVIEVHGQFVEALNDLFEKHKARVGHADLQL  330

Query  204   KIM  196
             KI+
Sbjct  331   KIL  333



>ref|XP_002263626.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Vitis vinifera]
Length=337

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 241/303 (80%), Gaps = 1/303 (0%)
 Frame = -3

Query  1101  NSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +SL+ ++  L  WLG    +V +VL +++FLP + A+ V GLL + M IPID+ SK+G +
Sbjct  35    DSLIHSIAALTIWLGAIHFVVALVLTALLFLPLSLALTVFGLLLVFMVIPIDERSKYGRK  94

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A GYFP+ LYVEDIKAF+PNRAYVFGYEPHS+ PIG+V L+  TGF+PL KI
Sbjct  95    LSRYICKHACGYFPVTLYVEDIKAFDPNRAYVFGYEPHSVLPIGVVALADLTGFLPLSKI  154

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFY P +RHIWTWLG++PA K++F SLL+SGYSCI+VPGGVQE   MEH CE 
Sbjct  155   KVLASSAVFYVPFLRHIWTWLGLTPATKKNFTSLLASGYSCIIVPGGVQEPCLMEHGCEV  214

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSRKGFV+IAM+MG PLVPVFCFGQS VY WWKP   LYL+FSRA+KFTPI FWG  
Sbjct  215   AFLKSRKGFVRIAMEMGRPLVPVFCFGQSRVYKWWKPGGNLYLQFSRAIKFTPIFFWGIF  274

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS +P++ P+ VVVG+PIEV KN QPT E++  +H +F+EAL +LFEKHK R+G+ DLQL
Sbjct  275   GSPLPYRHPMDVVVGRPIEVKKNVQPTVEEVIEVHGQFVEALNDLFEKHKARVGHADLQL  334

Query  204   KIM  196
             KI+
Sbjct  335   KIL  337



>ref|XP_010029543.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Eucalyptus 
grandis]
Length=331

 Score =   399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 242/304 (80%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N+L M   ML WLG      ++VL S++FLP +KA++V+G L   + IPID  SK G 
Sbjct  28    SSNALHMVTAMLIWLGAIHFDAILVLLSLLFLPHSKALLVVGSLVACVVIPIDDQSKVGR  87

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             + +RY+CK A  YFP+ L+VED+ AF+PN+AYVFGYEPHS+ PIG++ L+ FTGFMPLPK
Sbjct  88    KLSRYICKHAYRYFPLTLHVEDMTAFDPNQAYVFGYEPHSVLPIGVIVLTDFTGFMPLPK  147

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             IK L STAVFYTP++RHIWTWLG++PA +++F SLL +GYSCI+VPGGVQE + MEHD E
Sbjct  148   IKVLASTAVFYTPILRHIWTWLGVTPATRKNFSSLLEAGYSCIIVPGGVQETFLMEHDFE  207

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLK+RKGFV+IAM+   PLVPV CFGQS+VY WWKPS +++L+ SRA+KF PILFWG 
Sbjct  208   IAFLKARKGFVRIAMETSRPLVPVICFGQSHVYKWWKPSGRIFLRISRAIKFAPILFWGI  267

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             +G+ +PFQRP+HVV+GKPIE  +N  PT E++  +H RF+EA+ +LFE+HK RLGY DLQ
Sbjct  268   LGTPLPFQRPMHVVIGKPIEFKRNPNPTVEEVNEVHGRFVEAMRDLFERHKARLGYPDLQ  327

Query  207   LKIM  196
             LK++
Sbjct  328   LKLI  331



>gb|KHN28301.1| Diacylglycerol O-acyltransferase 2 [Glycine soja]
Length=294

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 237/294 (81%), Gaps = 0/294 (0%)
 Frame = -3

Query  1077  MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQA  898
             M+ WLG     + ++L ++ FLP +K+++V G LF  M +PI++ S++G R +R++CK A
Sbjct  1     MVLWLGAIHFNIALILLAVFFLPLSKSLLVFGFLFGFMVLPINEKSRFGRRLSRFICKHA  60

Query  897   SGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVF  718
               YFP+ L+VED+KAF+PNRAYVFGYEPHS+ PIG+V L+  TGFMPLPK+K L S+ VF
Sbjct  61    CNYFPITLHVEDMKAFDPNRAYVFGYEPHSVLPIGIVALADHTGFMPLPKVKVLASSTVF  120

Query  717   YTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGF  538
             YTP +RH+WTWLG++PA K++F SLL+SG+SCI++PGGVQEA++M+H  E  FLK+R+GF
Sbjct  121   YTPFLRHLWTWLGLTPATKKNFISLLASGHSCILIPGGVQEAFHMQHGTEIAFLKARRGF  180

Query  537   VQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRP  358
             V++AM  G PLVPVFCFGQSNVY WWKP  KL+LKF+RA+KFTPI FWG  GS +PF+ P
Sbjct  181   VRVAMVKGKPLVPVFCFGQSNVYKWWKPGGKLFLKFARAIKFTPICFWGIFGSPLPFRHP  240

Query  357   IHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +HVVVG+PIEV KN +PT E++A +H  F+EAL +LFE+HK R GY +L+L+I+
Sbjct  241   MHVVVGRPIEVDKNREPTTEEVAKIHGLFVEALQDLFERHKARAGYPNLELRIV  294



>ref|XP_009369766.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Pyrus x bretschneideri]
Length=325

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 240/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L M + +  WLG     V ++L +I FLPF+KA++V GLL L M IP+D+ SK G  
Sbjct  23    SNVLHMFVALGIWLGTIHFNVGLILFTIFFLPFSKALLVFGLLVLFMIIPVDEKSKIGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNRAYVFGYEPHS+ PIG+V L+  TGF+PLPKI
Sbjct  83    LSRYICKHACAYFPVTLYAEDINAFDPNRAYVFGYEPHSVLPIGVVALADLTGFLPLPKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP++RHIWTWLG++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  143   KALASSAVFYTPLLRHIWTWLGLAPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGTEI  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM++G PLVPVFCFGQSNVY WWKPS +L LKF+RA+KFTPI FWG  
Sbjct  203   AFLKSRRGFVRIAMELGHPLVPVFCFGQSNVYKWWKPSGELILKFARAIKFTPIFFWGVF  262

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             G+ VP++ P+HVVVGKPIE+ K SQPT E++  +H +F+ AL +LFE+HK R+G+ DL+L
Sbjct  263   GTPVPYRLPMHVVVGKPIELKKTSQPTMEEVNEVHGQFVAALEDLFERHKARVGHADLRL  322

Query  204   KIM  196
             KI+
Sbjct  323   KIL  325



>ref|XP_008392180.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Malus domestica]
Length=325

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 239/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L M + +  WLG     V ++L +I FLPF+KA++V GLL L M IP+D+ SK G  
Sbjct  23    SNVLHMFVALGIWLGTIHFNVGLILFTIFFLPFSKALLVFGLLVLFMIIPVDEKSKIGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNRAYVFGYEPHS+ PIG+V L+  TGF+PLPKI
Sbjct  83    LSRYICKHACAYFPVTLYAEDINAFDPNRAYVFGYEPHSVLPIGVVALADLTGFLPLPKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTWLG++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  143   KALASSAVFYTPFLRHIWTWLGLAPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGTEI  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM++G PLVPVFCFGQSNVY WWKPS +L+LKF+RA+KFTPI FWG  
Sbjct  203   AFLKSRRGFVRIAMELGHPLVPVFCFGQSNVYKWWKPSGELFLKFARAIKFTPIFFWGVF  262

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             G+ VP++ P+HVVVGKPIE+ K SQPT E++  +H +F+ AL +LFE+HK R+G+  L+L
Sbjct  263   GTPVPYRHPMHVVVGKPIELKKTSQPTMEEVNEVHGQFVAALEDLFERHKARVGHAHLRL  322

Query  204   KIM  196
             KI+
Sbjct  323   KIL  325



>ref|XP_006403907.1| hypothetical protein EUTSA_v10010550mg [Eutrema salsugineum]
 gb|ESQ45360.1| hypothetical protein EUTSA_v10010550mg [Eutrema salsugineum]
Length=317

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 240/291 (82%), Gaps = 0/291 (0%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGY  889
             WLG     V ++L S+IFLP + +++V+GLLFLL+FIPID  SK+G   ARY+CK A  Y
Sbjct  27    WLGAIHLNVALLLFSLIFLPPSLSLLVLGLLFLLIFIPIDDRSKYGRMLARYICKHACSY  86

Query  888   FPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTP  709
             FP+ L+VED +AF+PNRAYVFGYEPHS+WPIG++ L+  TGFMPLPKIK L STAVFYTP
Sbjct  87    FPVTLHVEDYEAFQPNRAYVFGYEPHSVWPIGVIALADLTGFMPLPKIKVLASTAVFYTP  146

Query  708   VMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQI  529
              +RHIWTWLG++PA +++F SLL SGYSCI+VPGGVQE ++M+HD E +FL SR+GFV+I
Sbjct  147   FLRHIWTWLGLAPASRKNFSSLLKSGYSCILVPGGVQETFHMQHDIENVFLSSRRGFVRI  206

Query  528   AMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHV  349
             AM+ GTPLVPVFCFGQS+VY WWKP  KLYLK SRA++FTPI FWG  GS +P+++P+HV
Sbjct  207   AMEHGTPLVPVFCFGQSHVYKWWKPDWKLYLKLSRAIRFTPICFWGVFGSPLPYRQPMHV  266

Query  348   VVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             VVGKPIEV K  QP+ E++A LH +F+EAL +LFEKHK R+GY DLQL I+
Sbjct  267   VVGKPIEVTKTLQPSNEEIAKLHGQFVEALKDLFEKHKARVGYSDLQLNIL  317



>ref|XP_002876092.1| diacylglycerol acyltransferase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52351.1| diacylglycerol acyltransferase family [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 238/310 (77%), Gaps = 1/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF    ++N     + +  WLG     V +VL S+IFLP + ++MV+GLL L +FIPID 
Sbjct  6     EFRAEQTSNQFHSIIAIAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ LYVE+ +AF+PNRAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    RSKYGRKLARYICKHACSYFPVSLYVEEYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPL  IK L S+A+FYTP +RHIWTWLG++ A +++F SLL+SGYSC++VPGGVQE ++
Sbjct  126   FMPLTNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLNSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD ET+FL  R+GFV+IAM+ G+PLVPVFCFGQ+ VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDAETVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDWDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I FWG  GS +P ++P+HVVVGKPIEV K  +PT+E++   H +++EAL +LFE+HK R+
Sbjct  246   ICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIDKFHGQYVEALRDLFERHKSRV  305

Query  225   GYVDLQLKIM  196
             GY DL+L I+
Sbjct  306   GY-DLELHIL  314



>gb|ABU50328.1| diacylglycerol acyltransferase [Helianthus annuus]
Length=336

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 234/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1083  LMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCK  904
             L M+AWLG     V +VLAS   LP  K  +VIG+L +L+ IPI++ S+WG    RY+CK
Sbjct  41    LAMIAWLGSIHLNVFIVLASFFLLPIHKFFVVIGMLVILIVIPINERSRWGRGLGRYICK  100

Query  903   QASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTA  724
              A G+FP+ LYVED KAF P++AYVFGYEPHS+WPIG+V L+  TGFMPLPKIK L STA
Sbjct  101   HAVGFFPVTLYVEDYKAFVPDQAYVFGYEPHSVWPIGVVALADLTGFMPLPKIKVLASTA  160

Query  723   VFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRK  544
             VFYTP +RHIWTWLG++ A +++F SLL +GYSCIV+PGGVQE +YM+HD E  FL++RK
Sbjct  161   VFYTPFLRHIWTWLGLTAATRKNFSSLLKAGYSCIVIPGGVQETFYMDHDSEIAFLRTRK  220

Query  543   GFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ  364
             GFV++AM+  +PLVPVF FGQS VY WWKP  KL+LK SRA++FTP+ FWG +GS +PF+
Sbjct  221   GFVRLAMETNSPLVPVFGFGQSYVYKWWKPRGKLFLKLSRAIRFTPVFFWGILGSPIPFR  280

Query  363   RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +P+HVVVG+PI   KN+ PT E+++ +H +F++A+ +LFE+HK R GY +LQL+IM
Sbjct  281   QPMHVVVGRPIHFKKNTTPTMEEVSEVHRQFVDAVEDLFERHKARAGYPNLQLRIM  336



>emb|CAB63016.1| putative protein [Arabidopsis thaliana]
Length=327

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 239/323 (74%), Gaps = 14/323 (4%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF     +N     + M  WLG     V +VL S+IFLP + ++MV+GLL L +FIPID 
Sbjct  6     EFRAEEHSNQFHSIIAMAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ LYVED +AF+PNRAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    RSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMP+P IK L S+A+FYTP +RHIWTWLG++ A +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPIPNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCET-------------MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSK  445
             M+HD E+             +FL  R+GFV+IAM+ G+PLVPVFCFGQ+ VY WWKP   
Sbjct  186   MQHDAESDDFLIELYLTLQNVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCD  245

Query  444   LYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIE  265
             LYLK SRA++FTPI FWG  GS +P ++P+HVVVGKPIEV K  +PT+E++A  H +++E
Sbjct  246   LYLKLSRAIRFTPICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVE  305

Query  264   ALLELFEKHKKRLGYVDLQLKIM  196
             AL +LFE+HK R+GY DL+LKI+
Sbjct  306   ALRDLFERHKSRVGY-DLELKIL  327



>ref|XP_003612436.1| Diacylglycerol O-acyltransferase [Medicago truncatula]
 gb|AES95394.1| type 2 acyl-CoA diacylglycerol acyltransferase [Medicago truncatula]
Length=321

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 240/306 (78%), Gaps = 0/306 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S+N+    L +  WLG     + ++L +++FLP +K ++V+G L + M IP+D  SK+
Sbjct  16    SDSSNTFRSILALSLWLGSIHFNIAIILFALLFLPLSKYLLVLGFLLICMVIPVDAKSKF  75

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G R +RY+CK A  YFP+ L+VEDIKAF+PNRAYVFGYEPHS+ PIG++ L+  TGFMP+
Sbjct  76    GRRLSRYICKHACSYFPITLHVEDIKAFDPNRAYVFGYEPHSVLPIGVIALADNTGFMPI  135

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             PK+K L S+AVFYTP +RHIWTWLG++PA +++F SLL++GYSCI++PGGVQE + M+  
Sbjct  136   PKVKVLASSAVFYTPFLRHIWTWLGLTPATRKNFISLLAAGYSCILIPGGVQETFLMQRG  195

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E  +LK+R+GFV+IA++ G PLVPVFCFGQS++Y WWKP  KL+L FSRA+KFTPI FW
Sbjct  196   SEIAYLKARRGFVRIALEKGHPLVPVFCFGQSDIYKWWKPDGKLFLNFSRAIKFTPICFW  255

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS VPF+ P+HVVVG+PI + KN +PT E++A +HS+F+EAL +LFE+HK R GY  
Sbjct  256   GIFGSPVPFRHPMHVVVGRPIVLEKNPEPTTEEIAKIHSQFVEALQDLFERHKARAGYPK  315

Query  213   LQLKIM  196
             L+LKI+
Sbjct  316   LELKIV  321



>ref|XP_010515570.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Camelina 
sativa]
Length=315

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 240/310 (77%), Gaps = 0/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF    S++    T+ M  WLG     +V+VL S+IFLP   +++V+ LL L +FIPID 
Sbjct  6     EFRADKSSDQFHSTIAMAIWLGAIHFNIVLVLFSLIFLPPYLSLLVLSLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ +YVED +AF+PNRAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    RSKYGRKLARYICKHACNYFPVSMYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPL KIK L S+A+FYTP +RHIWTWLG++PA +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPLTKIKVLASSAIFYTPFLRHIWTWLGLTPASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD E +FL SR+GFV+IAM+ GTPLVPVFCFGQS+VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDVENVFLSSRRGFVRIAMEQGTPLVPVFCFGQSHVYRWWKPDWDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I F G  GS +P+++P+HV+VGKPIEV K  QPT+E++A  H +++EAL +LFE HK R+
Sbjct  246   ICFGGVFGSPLPYRQPMHVIVGKPIEVTKTLQPTDEEIAKFHGQYVEALRDLFESHKARV  305

Query  225   GYVDLQLKIM  196
             GY DLQL I+
Sbjct  306   GYPDLQLNIL  315



>ref|XP_009359645.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Pyrus x bretschneideri]
Length=325

 Score =   393 bits (1010),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 236/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L M L +  WLG       +VL +I FLPF+KA++V+GLL L M IP+D  SK G  
Sbjct  23    SNVLHMVLALGIWLGTIHFNAALVLFTIFFLPFSKALLVLGLLVLFMIIPVDDKSKLGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNR+YVFGYEPHS+ PIG+V L+  TGF+PLPKI
Sbjct  83    LSRYICKHACAYFPVTLYAEDINAFDPNRSYVFGYEPHSVLPIGVVALADLTGFLPLPKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RH+WTWLG++PA + +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  143   KVLASSAVFYTPFLRHVWTWLGLTPATRSNFISHLSAGYSCIIVPGGVQETFYMEHGSEI  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM++G PLVPVFCFGQSNVY WWKPS +L LKF+RA+KFTP+ FWG  
Sbjct  203   AFLKSRRGFVRIAMELGNPLVPVFCFGQSNVYKWWKPSGELILKFARAIKFTPVFFWGLF  262

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS VP+  P+HVVVGKPI+V K  QP+ E++  +H +F+ AL +LFE+HK R+G+ DLQL
Sbjct  263   GSPVPYSHPMHVVVGKPIDVKKTPQPSMEEVNEVHGQFVAALQDLFERHKARVGHADLQL  322

Query  204   KIM  196
             KI+
Sbjct  323   KIL  325



>gb|KFK34394.1| hypothetical protein AALP_AA5G139600 [Arabis alpina]
Length=317

 Score =   392 bits (1008),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 239/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N     + +  WLG    I+ +VL S+IFLP + +++V GLLFLL+FIPID  SK+G  
Sbjct  15    SNQFHTIIAITIWLGSIHLIIAIVLFSLIFLPPSLSLLVFGLLFLLIFIPIDDRSKYGRM  74

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              ARY+CK A  YFP+ L+VED +AF+PNR+YV GYEPHS+WPIG V L+  TGFMPLP I
Sbjct  75    LARYICKHACSYFPLTLHVEDYEAFQPNRSYVIGYEPHSVWPIGAVALADLTGFMPLPNI  134

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L STAVFYTP +RHIWTWLG++PA +++F SLL+SGYSCIVVPGGVQE  +M+HD E 
Sbjct  135   KVLASTAVFYTPFLRHIWTWLGLAPASRKNFSSLLASGYSCIVVPGGVQETCHMQHDVEN  194

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
             +FL +RKGFV+IAM+ G+PLVPVF FGQS+VY WWKP+  LYLK SRA+KFTPI FWG  
Sbjct  195   VFLSTRKGFVRIAMEQGSPLVPVFGFGQSHVYKWWKPNWNLYLKLSRAIKFTPICFWGIF  254

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS +P++ PIHVVVGKPIEV K   PT+E++A LH +F+EAL +LFEKHK R+GY DLQL
Sbjct  255   GSPLPYRHPIHVVVGKPIEVTKTLHPTDEEVAKLHGQFVEALKDLFEKHKARVGYSDLQL  314

Query  204   KIM  196
              I+
Sbjct  315   NIL  317



>ref|XP_010503848.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Camelina 
sativa]
Length=315

 Score =   392 bits (1007),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 240/310 (77%), Gaps = 0/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF    S++    T+ M  WLG     +V+VL S+IFLP   +++V+ LL L +FIPID 
Sbjct  6     EFRADKSSDQFHSTIAMAIWLGAIHFNIVLVLFSLIFLPPYLSLLVLSLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ LYVED +AF+PNRAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    CSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPL KIK L S+A+FYTP +RHIWTWLG++PA +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPLTKIKVLASSAIFYTPFLRHIWTWLGLTPASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD E +FL SR+GFV+IAM+ GTP+VPVFCFGQS+VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDVENVFLSSRRGFVRIAMEQGTPIVPVFCFGQSHVYKWWKPDWDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I F G  GS +P+++P+HV+VGKPIEV K  QPT+E++A  H +++EAL +LFE HK R+
Sbjct  246   ICFGGVFGSPLPYRQPMHVIVGKPIEVTKTLQPTDEEIAKFHGQYVEALRDLFESHKARV  305

Query  225   GYVDLQLKIM  196
             GY DLQL I+
Sbjct  306   GYPDLQLNIL  315



>ref|XP_006420603.1| hypothetical protein CICLE_v10005396mg [Citrus clementina]
 gb|ESR33843.1| hypothetical protein CICLE_v10005396mg [Citrus clementina]
Length=332

 Score =   392 bits (1007),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 244/303 (81%), Gaps = 1/303 (0%)
 Frame = -3

Query  1101  NSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +++L T++ L  WLG     V+++L S  F P + +I+V+GLL L MFIPID++SK G  
Sbjct  30    SNMLHTMVALGIWLGSIHFNVLLILVSFTFFPLSISILVLGLLLLFMFIPIDEHSKLGRS  89

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ L+VEDI AF P+RAYVFGYEPHS+ PIG+V L+  TGFMPLPKI
Sbjct  90    LSRYICKHACSYFPITLHVEDINAFHPDRAYVFGYEPHSVLPIGVVALADLTGFMPLPKI  149

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K LGS+AVFYTP +RHIWTWLG +PA K++F SLL++GYSCI+VPGGVQE ++MEH  E 
Sbjct  150   KVLGSSAVFYTPFLRHIWTWLGTTPATKKNFISLLAAGYSCILVPGGVQETFHMEHGSEV  209

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLK+R+GFV+IAM+MG PLVPVFC+GQSNVY WWKP  KLYL+FSRA+KFTPI FWG  
Sbjct  210   AFLKTRRGFVRIAMEMGRPLVPVFCYGQSNVYKWWKPGGKLYLQFSRAIKFTPIYFWGLF  269

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS +P + P+HVVVGKPIE+ K+ QPT E++  +H++F+EAL +LFE+HK ++GY DL+L
Sbjct  270   GSPLPSRHPMHVVVGKPIELKKSPQPTNEEVTEVHNQFVEALRDLFERHKAQVGYPDLEL  329

Query  204   KIM  196
             KI+
Sbjct  330   KIL  332



>ref|XP_008365454.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Malus domestica]
Length=325

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 235/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L M L +  WLG       +VL +I FLPF+KA++V+GLL L M IP+D  SK G  
Sbjct  23    SNFLHMVLALGIWLGTIHFNAALVLFTIFFLPFSKALLVLGLLVLFMIIPVDDKSKLGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNR+YVFGYEPHS+ PIG+V L+  TGF+PLPKI
Sbjct  83    LSRYICKHACAYFPVTLYAEDINAFDPNRSYVFGYEPHSVLPIGVVALADLTGFLPLPKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTWLG++PA + +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  143   KVLASSAVFYTPFLRHIWTWLGLTPATRSNFISHLSAGYSCIIVPGGVQETFYMEHGTEI  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM++G PLVPVFCFGQSNVY WWKPS +L LKF+R +KFTP+ FWG  
Sbjct  203   AFLKSRRGFVRIAMELGNPLVPVFCFGQSNVYKWWKPSGELILKFARVIKFTPVFFWGLF  262

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS VP+  P+HVVVGKPI+V K  QP+ E++  +H +F+ AL +LFE+HK R+G+ DLQL
Sbjct  263   GSPVPYSHPMHVVVGKPIDVKKTPQPSMEEVNEVHGQFVAALQDLFERHKARVGHADLQL  322

Query  204   KIM  196
             KI+
Sbjct  323   KIL  325



>ref|XP_008242123.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Prunus mume]
Length=322

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 238/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N+L   + +  WLG     V+++  +I+FLP +KA++VIGLL L M IP+D  SK G  
Sbjct  20    SNALHTVVALGIWLGTIHFNVILIFFAILFLPLSKALLVIGLLLLFMIIPVDDKSKIGRS  79

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNR+YVFGYEPHS+ PIG+V L+  TGF+PL KI
Sbjct  80    LSRYICKHACAYFPVTLYAEDIHAFDPNRSYVFGYEPHSVLPIGVVALADLTGFLPLTKI  139

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTWLG++PA K +F S LSSGYSCI+VPGGVQE +YMEH  E 
Sbjct  140   KVLASSAVFYTPFLRHIWTWLGLTPATKSNFISHLSSGYSCIIVPGGVQETFYMEHGTEI  199

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM+MG PLVPVFCFGQS+VY WWKPS +L+ KF+RA+KFTPI FWG  
Sbjct  200   AFLKSRRGFVRIAMEMGHPLVPVFCFGQSDVYKWWKPSGELFSKFARAIKFTPIFFWGIF  259

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS VP++ P+HVVVG+PIE+ K  QPT E++  +HS+F+ AL +LFE+HK R+G+ DLQL
Sbjct  260   GSPVPYRHPMHVVVGRPIELKKTPQPTMEEVNEVHSQFVAALQDLFERHKARVGHADLQL  319

Query  204   KIM  196
             KI+
Sbjct  320   KIL  322



>ref|XP_007202234.1| hypothetical protein PRUPE_ppa008682mg [Prunus persica]
 gb|EMJ03433.1| hypothetical protein PRUPE_ppa008682mg [Prunus persica]
Length=322

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N+L   + +  WLG     V++V  +I+FLP +KA++VIGLL L M IP+D  SK G  
Sbjct  20    SNALHTVVALGIWLGTIHFNVILVFFAILFLPVSKALLVIGLLLLFMIIPVDDKSKIGRS  79

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNR+YVFGYEPHS+ PIG+V L+  TGF+PL KI
Sbjct  80    LSRYICKHACAYFPVTLYAEDIHAFDPNRSYVFGYEPHSVLPIGVVALADLTGFLPLTKI  139

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTWLG++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  140   KVLASSAVFYTPFLRHIWTWLGLTPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGTEI  199

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM MG PLVPVFCFGQS+VY WWKPS +L+ KF+RA+KFTPI FWG  
Sbjct  200   AFLKSRRGFVRIAMAMGHPLVPVFCFGQSDVYKWWKPSGELFSKFARAIKFTPIFFWGIF  259

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS VP++ P+HVVVG+PIE+ K  QPT E++  +HS+F+ AL +LFE+HK R+GY DLQL
Sbjct  260   GSPVPYRHPMHVVVGRPIELKKTPQPTMEEVNEVHSQFVAALQDLFERHKARVGYADLQL  319

Query  204   KIM  196
             KI+
Sbjct  320   KIL  322



>ref|XP_004287691.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=326

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 238/310 (77%), Gaps = 3/310 (1%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             E IG    N   M + M  WLG     V +++ ++ FLP +KAI+V GLL L M +P+D 
Sbjct  20    EAIGLRIVN---MFVAMALWLGAIHFNVALIVLTVCFLPISKAILVFGLLVLFMIVPVDD  76

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK G R ARY+CK A GYFP+ LYVE+   F+PN AYVFGYEPHS+ PIG+V L+  TG
Sbjct  77    KSKIGRRVARYICKYACGYFPVTLYVEEKHVFDPNCAYVFGYEPHSVLPIGVVALADMTG  136

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             F+ LPK+K L STAVFYTP +RHIWTWLG++PA K +F S L++GYSC++VPGGVQE + 
Sbjct  137   FLGLPKMKVLASTAVFYTPFLRHIWTWLGLTPATKSNFVSNLAAGYSCVIVPGGVQETFL  196

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             MEH  E +FLKSR+GFV+IA++ G PLVPVFCFGQSNVY WWKPS +L+LKF+RA+KFTP
Sbjct  197   MEHGKEKVFLKSRRGFVRIALENGYPLVPVFCFGQSNVYKWWKPSGELFLKFARAIKFTP  256

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I+FWG  GS +PF+ P+HVVVGKPIE+ KN +PT E++  +H +++EAL ELFEKHK R 
Sbjct  257   IVFWGMFGSPLPFRHPMHVVVGKPIELKKNPEPTMEEVMEVHGQYVEALKELFEKHKARA  316

Query  225   GYVDLQLKIM  196
             G+ DL+L+I+
Sbjct  317   GFPDLELEIL  326



>ref|XP_009148943.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Brassica rapa]
 emb|CDY33272.1| BnaA01g19390D [Brassica napus]
Length=318

 Score =   390 bits (1002),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 240/306 (78%), Gaps = 0/306 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             ++S+N       ++ WLG     V +VL+S+IFLP + +++V+GLLFLL+FIPID  SK+
Sbjct  13    SSSSNIFHSITAIVIWLGSVHLNVAIVLSSLIFLPPSLSLLVLGLLFLLIFIPIDDRSKY  72

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G   ARY+CK A  YFP+ L+VED +AF+P RAYVFGYEPHS+WPIG V L+  TGFMPL
Sbjct  73    GRMLARYICKHACSYFPVTLHVEDYEAFQPTRAYVFGYEPHSVWPIGAVALADLTGFMPL  132

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             P IK L STAVFYTP +R IWTWLG++PA +++F S L SGYSCI+VPGGVQE ++M+HD
Sbjct  133   PNIKVLASTAVFYTPFLRQIWTWLGLAPASRKNFASYLDSGYSCILVPGGVQETFHMKHD  192

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E +FL SR+GFV+IAM+ GTPLVPVFCFGQS VY WWKP   LYLK SRA+KFTPI FW
Sbjct  193   VENLFLSSRRGFVRIAMEHGTPLVPVFCFGQSRVYKWWKPDWNLYLKLSRAIKFTPICFW  252

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS +PF+ P+HVVVGKPIEV K  QPT+E++A +H +F+EAL +LFE+HK R G+ D
Sbjct  253   GVFGSPIPFRHPLHVVVGKPIEVRKTLQPTDEEIAKVHGQFVEALKDLFERHKARAGFSD  312

Query  213   LQLKIM  196
             LQL I+
Sbjct  313   LQLNIL  318



>ref|XP_010033619.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW53317.1| hypothetical protein EUGRSUZ_J02570 [Eucalyptus grandis]
Length=329

 Score =   390 bits (1003),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 241/304 (79%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N    T+ +  WLG    + V+VL S++FL  + A++V GLL + MF+PI+   + G 
Sbjct  26    SSNIWHTTVALGIWLGGIHFVAVLVLFSLLFLSPSNALLVFGLLVVFMFLPINDRRRLGR  85

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             + +RY+CK A  YFP+ L+VEDI+ F+PNRAYVFGYEPHS+ PIG+V L+  TGFMPLPK
Sbjct  86    KLSRYICKHACSYFPVTLHVEDIEDFDPNRAYVFGYEPHSVLPIGVVALADLTGFMPLPK  145

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             IK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPGGVQE   MEHD E
Sbjct  146   IKVLASSAVFYTPFLRHIWTWLGLTPATKRNFISLLGAGYSCIIVPGGVQETSLMEHDSE  205

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               F+KSRKGFV+IAM+MG PLVPVFC+GQSNVY WWKP  KLYL+FSRA+KFTP+LFWG 
Sbjct  206   IAFIKSRKGFVRIAMEMGCPLVPVFCYGQSNVYKWWKPGGKLYLQFSRAIKFTPVLFWGI  265

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              GS +PFQ P+HVVVG+PIE+ K S+PT E++  +H +F+EAL +LFE+HK R+G+ DL+
Sbjct  266   FGSPLPFQNPMHVVVGRPIELEKTSKPTMEEVNEVHGKFVEALRDLFERHKARVGHADLE  325

Query  207   LKIM  196
             LKI+
Sbjct  326   LKIL  329



>ref|XP_003534223.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Glycine max]
Length=337

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/326 (58%), Positives = 244/326 (75%), Gaps = 0/326 (0%)
 Frame = -3

Query  1173  QHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAI  994
             + RS   E       +E  G  S N L   L +  WLG     V +VL +I FL   KA+
Sbjct  12    RRRSGDAEGEKVFKGSEVFGDTSPNYLKTILALALWLGTIHFNVALVLFAIFFLSLHKAL  71

Query  993   MVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEP  814
             ++ GLLF+LM IP+D+ SK+G + +RY+CK    YFP+ L+VED+KAF PNRAYVFGYEP
Sbjct  72    LLFGLLFVLMVIPVDEKSKFGRKLSRYICKHVCAYFPITLHVEDMKAFHPNRAYVFGYEP  131

Query  813   HSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS  634
             HS+ PIG+V L+  TGFMPLPKIK L S+A+FYTP +RHIWTWLG++P  ++ F SLL +
Sbjct  132   HSVLPIGVVALADNTGFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTRKRFTSLLDA  191

Query  633   GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKP  454
             GYSCI++PGGVQEA+ MEH  E  +LK+R+GFV+IAM+ G PLVPVFCFGQSNVY WWKP
Sbjct  192   GYSCILIPGGVQEAFLMEHGSEIAYLKARRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKP  251

Query  453   SSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSR  274
               KL L F+RAVKF+PI FWG  GS +PF+ P+HVVVG+PIE+ KN +PT E++A +HS+
Sbjct  252   GGKLILNFARAVKFSPIYFWGIFGSPIPFKHPMHVVVGRPIELEKNHEPTPEEVARIHSQ  311

Query  273   FIEALLELFEKHKKRLGYVDLQLKIM  196
             F+EAL +LFE+HK R GY +L+L+I+
Sbjct  312   FVEALQDLFERHKARAGYPNLELRIV  337



>ref|XP_006489798.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Citrus sinensis]
Length=330

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 244/303 (81%), Gaps = 1/303 (0%)
 Frame = -3

Query  1101  NSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +++L T++ L  WLG     V+++L S  F P + +++V+GLL L MFIPID++SK G  
Sbjct  28    SNMLHTMVALGIWLGSIHLNVLLILVSFTFFPLSISLLVLGLLLLFMFIPIDEHSKLGRS  87

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ L+VEDI AF P+RAYVFGYEPHS+ PIG+V L+  TGFMPLPKI
Sbjct  88    LSRYICKHACSYFPITLHVEDINAFHPDRAYVFGYEPHSVLPIGVVALADLTGFMPLPKI  147

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K LGS+AVFYTP +RHIWTWLG +PA K++F SLL++GYSCI+VPGGVQE ++MEH  E 
Sbjct  148   KVLGSSAVFYTPFLRHIWTWLGTTPATKKNFISLLAAGYSCILVPGGVQETFHMEHGSEV  207

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLK+R+GFV+IAM+MG PLVPVFC+GQSNVY WWKP  KLYL+FSRA+KFTPI FWG  
Sbjct  208   AFLKTRRGFVRIAMEMGRPLVPVFCYGQSNVYKWWKPGGKLYLQFSRAIKFTPIYFWGLF  267

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS +P + P+HVVVGKPIE+ K+ QPT E++  +H++F+EAL +LFE+HK ++GY DL+L
Sbjct  268   GSPLPSRHPMHVVVGKPIELKKSPQPTNEEVTEVHNQFVEALRDLFERHKAQVGYPDLEL  327

Query  204   KIM  196
             KI+
Sbjct  328   KIL  330



>gb|KHN38842.1| Diacylglycerol O-acyltransferase 2 [Glycine soja]
Length=331

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 240/311 (77%), Gaps = 0/311 (0%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             +E  G  S N L   L +  WLG     V +VL +I FL   KA+++ GLLF+LM IP+D
Sbjct  21    SEVFGDTSPNYLKTILALALWLGTIHFNVALVLFAIFFLSLHKALLLFGLLFVLMVIPVD  80

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
             + SK+G + +RY+CK    YFP+ L+VED+KAF PNRAYVFGYEPHS+ PIG+V L+  T
Sbjct  81    EKSKFGRKLSRYICKHVCAYFPITLHVEDMKAFHPNRAYVFGYEPHSVLPIGVVALADNT  140

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
             GFMPLPKIK L S+A+FYTP +RHIWTWLG++P  ++ F SLL +GYSCI++PGGVQEA+
Sbjct  141   GFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTRKRFTSLLDAGYSCILIPGGVQEAF  200

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
              MEH  E  +LK+R+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL L F+RAVKF+
Sbjct  201   LMEHGSEIAYLKARRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLILNFARAVKFS  260

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             PI FWG  GS +PF+ P+HVVVG+PIE+ KN +PT E++A +HS+F+EAL +LFE+HK R
Sbjct  261   PIYFWGIFGSPIPFKHPMHVVVGRPIELEKNHEPTPEEVARIHSQFVEALQDLFERHKAR  320

Query  228   LGYVDLQLKIM  196
              GY +L+L+I+
Sbjct  321   AGYPNLELRIV  331



>gb|ACJ84867.1| unknown [Medicago truncatula]
 gb|AFK48189.1| unknown [Medicago truncatula]
Length=321

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 237/306 (77%), Gaps = 0/306 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S+N+    L +  WLG     + ++L ++ FLP +K ++V+G L + M IP+D  SK+
Sbjct  16    SDSSNTFRSILALSLWLGSIHFNIAIILFALPFLPLSKYLLVLGFLLICMVIPVDAKSKF  75

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G R +RY+CK A  YFP+ L+VEDIKAF+PNRAYVF YEPHS+ PIG++ L+  TGFMP+
Sbjct  76    GRRLSRYICKHACSYFPITLHVEDIKAFDPNRAYVFSYEPHSVLPIGVIALADNTGFMPI  135

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             PK+K L S+AVFYTP +RHIWTWLG++PA +++F SLL++GYSCI++PGGVQE + M+  
Sbjct  136   PKVKVLASSAVFYTPFLRHIWTWLGLTPATRKNFISLLAAGYSCILIPGGVQETFLMQRG  195

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E  +LK+R+GFV+IA++ G PLVPVFCFGQS++Y WWKP  KL+L FSRA+KFTPI FW
Sbjct  196   SEIAYLKARRGFVRIALEKGHPLVPVFCFGQSDIYKWWKPDGKLFLNFSRAIKFTPICFW  255

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS VPF+ P+HVVVG+PI + KN +P  E++A +HS+F+EAL +LFE+HK R GY  
Sbjct  256   GIFGSPVPFRHPMHVVVGRPIVLEKNPEPATEEIAKIHSQFVEALQDLFERHKARAGYPK  315

Query  213   LQLKIM  196
             L+LKI+
Sbjct  316   LELKIV  321



>ref|XP_006290290.1| hypothetical protein CARUB_v10018454mg [Capsella rubella]
 gb|EOA23188.1| hypothetical protein CARUB_v10018454mg [Capsella rubella]
Length=315

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 237/310 (76%), Gaps = 0/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF    S+N     + M  WLG     V +VL S+IFLP + +++V+GLL + +FIPID 
Sbjct  6     EFRADKSSNQFHSIVAMAIWLGAIHLNVALVLFSLIFLPASLSLLVLGLLSVFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
               K+G + ARY+CK A  YFP+ LYVED +AF+PNRAYVFGYEPHS+ PIG+V L   +G
Sbjct  66    RGKYGRQLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLSG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPL KIK L S+A+FYTP +RHIWTWLG++PA +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPLTKIKVLASSAIFYTPFLRHIWTWLGLTPASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD E +FL SRKGFV+IAM+ GTPLVPVFCFGQS+VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDVENIFLSSRKGFVRIAMEQGTPLVPVFCFGQSHVYKWWKPDWDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I F G  GS +P+++P+HV+VGKPIEV K   PT E++A  H +++EAL  LFE+HK R+
Sbjct  246   ICFGGVFGSPLPYRQPMHVIVGKPIEVTKTLHPTNEEIAKFHGQYVEALRGLFERHKARV  305

Query  225   GYVDLQLKIM  196
             GY DLQL I+
Sbjct  306   GYPDLQLNIL  315



>emb|CDY16300.1| BnaC01g23350D [Brassica napus]
Length=319

 Score =   387 bits (994),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -3

Query  1077  MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQA  898
             ++ WLG     V +VL+S+IFLP + +++V+GLLFLL+FIPID  SK+G   ARY+CK A
Sbjct  26    IVIWLGSVHLNVAIVLSSLIFLPPSLSLLVLGLLFLLIFIPIDDRSKYGRMLARYICKHA  85

Query  897   SGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVF  718
               YFP+ L+VED +AF+P RAYVFGYEPHS+WPIG V L+  TGFMPLP IK L STAVF
Sbjct  86    CSYFPVTLHVEDYEAFQPTRAYVFGYEPHSVWPIGAVALADLTGFMPLPNIKVLASTAVF  145

Query  717   YTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGF  538
             YTP +R IWTWLG++PA +++F S L SGYSCI+VPGGVQE ++M+HD E +FL SR+GF
Sbjct  146   YTPFLRQIWTWLGLAPASRKNFASYLDSGYSCILVPGGVQETFHMKHDVENLFLSSRRGF  205

Query  537   VQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRP  358
             V+IAM+ GTPLVPVFCFGQS VY WWKP   LYLK SRA+KFTPI FWG  GS +PF+ P
Sbjct  206   VRIAMEHGTPLVPVFCFGQSRVYKWWKPDWNLYLKLSRAIKFTPICFWGVFGSPIPFRHP  265

Query  357   IHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +HVVVGKPIEV K  QPT+E++A +H +F+EAL +LFE+HK R G+ DLQL I+
Sbjct  266   LHVVVGKPIEVRKTLQPTDEEIAKVHGQFVEALKDLFERHKARAGFSDLQLNIL  319



>ref|XP_010426724.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Camelina sativa]
Length=315

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 238/310 (77%), Gaps = 0/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             EF    S++    T+ M  WLG     +V+VL S+IFLP   +++V+ LL L +FIPID 
Sbjct  6     EFRADKSSDQFHSTIAMAIWLGAIHFNIVLVLFSLIFLPPYLSLLVLSLLSLFIFIPIDH  65

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              SK+G + ARY+CK A  YFP+ LYVED +AF+P RAYVFGYEPHS+ PIG+V L   TG
Sbjct  66    RSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPTRAYVFGYEPHSVLPIGVVALCDLTG  125

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPL KIK L S+A+FYTP +RHIWTWLG++ A +++F SLL SGYSC++VPGGVQE ++
Sbjct  126   FMPLTKIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYSCVLVPGGVQETFH  185

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             M+HD E +FL SR+GFV+IAM+ GTP+VPVFCFGQS+VY WWKP   LYLK SRA++FTP
Sbjct  186   MQHDVENVFLSSRRGFVRIAMEQGTPIVPVFCFGQSHVYKWWKPDWDLYLKLSRAIRFTP  245

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I F G  GS +P+++P+HV+VGKPIEV K  QPT+E++A  H +++EAL +LFE HK R+
Sbjct  246   ICFGGVFGSPLPYRQPMHVIVGKPIEVTKTLQPTDEEIAKFHGQYVEALRDLFEGHKARV  305

Query  225   GYVDLQLKIM  196
             GY DLQL I+
Sbjct  306   GYPDLQLNIL  315



>ref|XP_010270589.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Nelumbo nucifera]
Length=327

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/335 (59%), Positives = 247/335 (74%), Gaps = 9/335 (3%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             MEE  G    R  S  A   PT    +  A  +SLL  +  LA WLG       +V+ + 
Sbjct  1     MEETNGI---RGNSVNAGEEPT----VFRAKESSLLQAVTALAIWLGSIHFTAALVITAF  53

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
              FLP   A ++ GLL  LM +PID  SK G R ARY+C +  GYFP+ LYVED+KAF+PN
Sbjct  54    -FLPTHLAFLIFGLLLFLMVLPIDDRSKVGRRLARYICNRCCGYFPVTLYVEDMKAFDPN  112

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             +AYVFGYEPHS+ PIG+V L+  TGFM L KIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  113   QAYVFGYEPHSVLPIGVVALADLTGFMCLSKIKVLASSAVFYTPFLRHIWTWLGLTPATK  172

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             +SF SLL +GYSCIVVPGGVQE + M+H  E  F+KSRKGF++IAM+ G PLVPVFCFGQ
Sbjct  173   RSFTSLLEAGYSCIVVPGGVQETFLMKHGSEIAFIKSRKGFIRIAMEAGRPLVPVFCFGQ  232

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             ++VYNWWKPS +LYL+ SRA+KFTPI+FWG  GS +P++RP+HVVVG+PIE+ +  QPT 
Sbjct  233   TDVYNWWKPSGELYLRLSRAIKFTPIIFWGVFGSPLPYRRPMHVVVGRPIELKRIPQPTM  292

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++  +HSRF+ AL ELFEKHK R+G+ DLQL+I+
Sbjct  293   EEVNEVHSRFVTALEELFEKHKARVGHADLQLRIL  327



>gb|AET03523.2| type 2 acyl-CoA diacylglycerol acyltransferase [Medicago truncatula]
Length=335

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 239/324 (74%), Gaps = 17/324 (5%)
 Frame = -3

Query  1116  GTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSK  937
               +S NS    L +L WLG      VV++ ++ FLPF+KA++V G LF+LM IPID+ S 
Sbjct  12    AESSCNSFNTVLALLLWLGAIHFNGVVMVFALFFLPFSKALLVFGFLFVLMVIPIDEKSL  71

Query  936   WGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMP  757
             +G + ARY+CK A  YFP+ L+VEDIKAF PNRAYVFGYEPHS+ PIG+V L+  TGFMP
Sbjct  72    FGRKLARYICKHACSYFPVTLHVEDIKAFHPNRAYVFGYEPHSVLPIGVVALADSTGFMP  131

Query  756   LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEH  577
             LPKIK L S+A+FYTP +RHIWTWLG++PA K++F SLL + YSCI+VPGGVQE ++MEH
Sbjct  132   LPKIKVLASSAIFYTPFLRHIWTWLGLTPATKKNFTSLLDADYSCILVPGGVQETFFMEH  191

Query  576   DCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILF  397
              CE  FLK+R+GFV+IAM+ G PLVPVFCFGQS+VY WWKP  KL L  +RA+KF PI F
Sbjct  192   GCEIAFLKARRGFVRIAMEKGKPLVPVFCFGQSDVYKWWKPGGKLILNIARAIKFIPIYF  251

Query  396   WGYMGSFV-----------------PFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFI  268
             WG  GS +                  F+ P+HVVVG+PIE+ KN +PT E++A +HS+F+
Sbjct  252   WGIFGSSMVWWLYQCSSLRGSDLQYHFKHPMHVVVGRPIELEKNPKPTPEEVAKVHSQFV  311

Query  267   EALLELFEKHKKRLGYVDLQLKIM  196
             EAL +LFE +K R GY +L+L+I+
Sbjct  312   EALQDLFECNKTRAGYPNLELRIV  335



>ref|XP_010681114.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=329

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 241/328 (73%), Gaps = 3/328 (1%)
 Frame = -3

Query  1176  VQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTK  1000
             V  R      +P P    F G     S+L T++ +A WLG     V +V+AS  FL    
Sbjct  4     VSERREKPVTSPAPEITTFTG--KQESVLHTILAVAIWLGAIHFNVAIVIASFFFLSLPN  61

Query  999   AIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
                V  +L + + IPID+  K+G + A Y+CK A GYFP+ L VED KAF+PNRAYVFGY
Sbjct  62    FFAVCCVLLIFILIPIDEKDKFGRKLASYICKHACGYFPITLDVEDYKAFDPNRAYVFGY  121

Query  819   EPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
             EPHS+ PIG+V L+  TGFMPL K+K L STAVFYTP +RHIW+WLG+SPA + +FKS L
Sbjct  122   EPHSVLPIGVVALADLTGFMPLSKVKVLASTAVFYTPFLRHIWSWLGLSPATRNNFKSRL  181

Query  639   SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
             SSGYSCI+VPGGVQE ++MEH  E +FL++R+GFV++A++ G PLVPVF FGQS VY WW
Sbjct  182   SSGYSCIIVPGGVQETFHMEHGSEVIFLRNRRGFVRLALEKGCPLVPVFSFGQSEVYKWW  241

Query  459   KPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALH  280
             KPS KL+L+ +RA++FTP+ FWG  GS +P++ P+HVVVG+PI+V KN +PT E+++  H
Sbjct  242   KPSGKLFLQIARALRFTPVFFWGVFGSPLPYRVPMHVVVGRPIDVKKNPEPTMEEVSEAH  301

Query  279   SRFIEALLELFEKHKKRLGYVDLQLKIM  196
             SR++EAL +LFE+HK R+G+ +LQLKI+
Sbjct  302   SRYVEALEDLFERHKARVGHANLQLKIL  329



>gb|AEO11794.1| diacylglycerol acyltransferase type 2 [Arachis glabrata]
Length=334

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 253/335 (76%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G NV    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-NVTAAPPAEEKVFRSTEVFAAESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF PN
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNPN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|AEO11793.1| diacylglycerol acyltransferase type 2 [Arachis glabrata]
Length=334

 Score =   382 bits (982),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 253/335 (76%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G +V    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-DVTAAPPAEEKVFRSTEVFAAESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF PN
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNPN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>ref|XP_007156272.1| hypothetical protein PHAVU_003G272500g [Phaseolus vulgaris]
 gb|ESW28266.1| hypothetical protein PHAVU_003G272500g [Phaseolus vulgaris]
Length=340

 Score =   382 bits (982),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 246/310 (79%), Gaps = 0/310 (0%)
 Frame = -3

Query  1125  EFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQ  946
             +F  T+S+N L   L +  WLG       ++L +++FL   +A+++IGLLF+LM IPID+
Sbjct  31    KFGHTSSSNYLKKILALALWLGTFHLNAGLILLALLFLSLPQALLLIGLLFVLMLIPIDE  90

Query  945   NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG  766
              S++G + +RY+CK    YFP+ L+VED+KAF PNRAYVFGYEPHS++PIG+V L+  TG
Sbjct  91    ESEFGRKLSRYICKHVCSYFPVVLHVEDMKAFHPNRAYVFGYEPHSVFPIGVVALADNTG  150

Query  765   FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
             FMPLPKIK L S+AVFYTP +RHIWTWLG++PA K+ F SLL +GYSCI++PGGVQE + 
Sbjct  151   FMPLPKIKVLASSAVFYTPFLRHIWTWLGLAPATKKRFTSLLDAGYSCILIPGGVQETFL  210

Query  585   MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTP  406
             MEH  E  FLK+R+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL+LKF+RAVKFTP
Sbjct  211   MEHGSEIAFLKARRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLFLKFARAVKFTP  270

Query  405   ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             I FWG  GS +PF+ P+HVVVG+PIE+ KN +PT E++A +HS+F+EAL +LFE+HK R 
Sbjct  271   IYFWGIFGSPIPFKHPMHVVVGRPIELEKNPEPTPEEVAKIHSKFVEALQDLFERHKARA  330

Query  225   GYVDLQLKIM  196
             GY DL+L+I+
Sbjct  331   GYPDLELRIV  340



>gb|KCW53318.1| hypothetical protein EUGRSUZ_J02570 [Eucalyptus grandis]
Length=257

 Score =   379 bits (974),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 213/257 (83%), Gaps = 0/257 (0%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            MF+PI+   + G + +RY+CK A  YFP+ L+VEDI+ F+PNRAYVFGYEPHS+ PIG+V
Sbjct  1    MFLPINDRRRLGRKLSRYICKHACSYFPVTLHVEDIEDFDPNRAYVFGYEPHSVLPIGVV  60

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPG
Sbjct  61   ALADLTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKRNFISLLGAGYSCIIVPG  120

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            GVQE   MEHD E  F+KSRKGFV+IAM+MG PLVPVFC+GQSNVY WWKP  KLYL+FS
Sbjct  121  GVQETSLMEHDSEIAFIKSRKGFVRIAMEMGCPLVPVFCYGQSNVYKWWKPGGKLYLQFS  180

Query  426  RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            RA+KFTP+LFWG  GS +PFQ P+HVVVG+PIE+ K S+PT E++  +H +F+EAL +LF
Sbjct  181  RAIKFTPVLFWGIFGSPLPFQNPMHVVVGRPIELEKTSKPTMEEVNEVHGKFVEALRDLF  240

Query  246  EKHKKRLGYVDLQLKIM  196
            E+HK R+G+ DL+LKI+
Sbjct  241  ERHKARVGHADLELKIL  257



>gb|AEO11792.1| diacylglycerol acyltransferase type 2 [Arachis glabrata]
Length=334

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 253/336 (75%), Gaps = 4/336 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANS--LLMTLMMLAWLGVPPSIVVVVLAS  1024
             ME++G NV    P+ E     T   F   +S+ S    MTL +  WLG       ++L +
Sbjct  1     MEDRG-NVTAAPPAEEKVFRSTEV-FAPESSSKSKGFKMTLALALWLGAIHFNGALMLFA  58

Query  1023  IIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEP  844
             ++FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  
Sbjct  59    LLFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNS  118

Query  843   NRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAG  664
             NRAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA 
Sbjct  119   NRAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPAT  178

Query  663   KQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
             K++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFG
Sbjct  179   KKNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFG  238

Query  483   QSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPT  304
             QS++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT
Sbjct  239   QSDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPT  298

Query  303   EEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  299   TEEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|AEO11788.1| diacylglycerol acyltransferase type 2 [Arachis hypogaea]
Length=334

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 252/335 (75%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G NV    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-NVTAAPPAEEKVFRSTEVFAAESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  N
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNSN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|KDO43608.1| hypothetical protein CISIN_1g025152mg [Citrus sinensis]
Length=257

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/257 (67%), Positives = 215/257 (84%), Gaps = 0/257 (0%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            MFIPID++SK G   +RY+CK A  YFP+ L+VEDI AF P+RAYVFGYEPHS+ PIG+V
Sbjct  1    MFIPIDEHSKLGRSLSRYICKHACSYFPITLHVEDINAFHPDRAYVFGYEPHSVLPIGVV  60

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPLPKIK LGS+AVFYTP +RHIWTWLG +PA K++F SLL++GYSCI+VPG
Sbjct  61   ALADLTGFMPLPKIKVLGSSAVFYTPFLRHIWTWLGTTPATKKNFISLLAAGYSCILVPG  120

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            GVQE ++MEH  E  FLK+R+GFV+IAM+MG PLVPVFC+GQSNVY WWKP  KLYL+FS
Sbjct  121  GVQETFHMEHGSEVAFLKTRRGFVRIAMEMGRPLVPVFCYGQSNVYKWWKPGGKLYLQFS  180

Query  426  RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            RA+KFTPI FWG  GS +P + P+HVVVGKPIE+ K+ QPT E++  +H++F+EAL +LF
Sbjct  181  RAIKFTPIYFWGLFGSPLPSRHPMHVVVGKPIELKKSPQPTNEEVTEVHNQFVEALRDLF  240

Query  246  EKHKKRLGYVDLQLKIM  196
            E+HK ++GY DL+LKI+
Sbjct  241  ERHKAQVGYPDLELKIL  257



>ref|XP_002317635.2| hypothetical protein POPTR_0011s14890g [Populus trichocarpa]
 gb|EEE98247.2| hypothetical protein POPTR_0011s14890g [Populus trichocarpa]
Length=327

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 242/304 (80%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N +L  + +  WLG    +V++V+ S++FL F+K ++V GLL LL+F+PID ++K G 
Sbjct  24    SSNIILSLIAVAIWLGSIHFVVLLVIFSLLFLSFSKCLLVFGLLLLLVFVPIDDDNKLGR  83

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             R   Y+C+ A  YFP+ L+VEDI AF P+RAYVFGYEPHS+WPIG+V L+  TGFMPLPK
Sbjct  84    RLCGYICRYACCYFPVTLHVEDINAFHPDRAYVFGYEPHSVWPIGVVALADHTGFMPLPK  143

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             +K L S+AVF  P +RHIWTW G++ A K++F SLLS+GYSCIV PGGVQE +YMEHD E
Sbjct  144   VKVLASSAVFLMPFLRHIWTWCGLTSATKKNFTSLLSAGYSCIVNPGGVQETFYMEHDNE  203

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLKSR+GF++IAM+ G PLVPVFCFGQS VY WWKPS KL+LK SRA+KFTP++F G 
Sbjct  204   IAFLKSRRGFIKIAMENGAPLVPVFCFGQSKVYKWWKPSGKLFLKISRAIKFTPVVFGGI  263

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              G+ +PFQRP+H+VVG+PIE+ +N QPT E+LA +HS+F+ AL +LF++H+ R+G+ DL+
Sbjct  264   FGTPLPFQRPMHIVVGRPIELKQNLQPTVEELAEVHSQFVAALEDLFKRHRARVGFADLE  323

Query  207   LKIM  196
             LK++
Sbjct  324   LKVL  327



>emb|CDP01743.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/289 (61%), Positives = 224/289 (78%), Gaps = 0/289 (0%)
 Frame = -3

Query  1065  LGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYF  886
             LG    I ++VLAS I LP +KA++VI LL L   +P  + SKWG   +RY+CK A GYF
Sbjct  4     LGCAHLIGLIVLASFIILPPSKALVVIALLILFTVLPTCEGSKWGRNLSRYICKHACGYF  63

Query  885   PMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPV  706
             P++LYVED KAF+P +AYVFGYEPHS+ PIG + LS  TGFMPLPK K LG++AVFY P 
Sbjct  64    PVNLYVEDYKAFDPKQAYVFGYEPHSLVPIGEIALSNLTGFMPLPKTKILGTSAVFYAPF  123

Query  705   MRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIA  526
             +RHI TWLGI PA K++F +LL SGYSCI+VPGG QE YYME   E +FLK RKGFV++A
Sbjct  124   LRHIATWLGIKPATKKNFLTLLESGYSCIIVPGGTQETYYMEPGSENVFLKKRKGFVRVA  183

Query  525   MKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVV  346
             M+ G PLVPVFCFGQS  Y WWKP  K +L+FSRA+KF P++FWG +GS +PF+RP+HVV
Sbjct  184   METGKPLVPVFCFGQSEAYKWWKPKGKWFLQFSRAIKFMPVIFWGTLGSPIPFRRPMHVV  243

Query  345   VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
             VGKPI + +N QPT +++  +H +F+ AL +LFE+HK+R+GY DLQL+I
Sbjct  244   VGKPIVLQQNPQPTVKEVDEVHGQFVAALQDLFERHKERVGYADLQLRI  292



>gb|KHN39764.1| Diacylglycerol O-acyltransferase 2 [Glycine soja]
Length=341

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 236/311 (76%), Gaps = 0/311 (0%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             +E  G  S N L   L +  WLG       +VL +I FL   KA ++ GLLF+LM IP+D
Sbjct  31    SEVFGDTSPNYLKTILALALWLGTIHFNAALVLFAIFFLSLHKAFLLFGLLFVLMVIPVD  90

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
             + SK+G + +RY+CK    YFP+ L+VED+KAF P+RAYVFGYEPHS+ PIG+V L+  T
Sbjct  91    EKSKFGRKLSRYICKHVCAYFPITLHVEDMKAFHPSRAYVFGYEPHSVLPIGVVALADNT  150

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
              FMPLPKIK L S+A+FYTP +RHIWTWLG++P  K+ F SLL +GYSCI++PGGVQEA+
Sbjct  151   CFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTKKRFTSLLDAGYSCILIPGGVQEAF  210

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
              +EH  E  FLKSR+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL L F+RAVKF+
Sbjct  211   LIEHGSEIAFLKSRRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLVLNFARAVKFS  270

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             P+ FWG  GS +PF+ P+HVVVG+PIE+ K  +PT E++A +HS+F+EAL +LFE+HK R
Sbjct  271   PVYFWGIFGSPIPFKHPMHVVVGRPIELEKTPEPTPEEVAKIHSQFVEALQDLFERHKAR  330

Query  228   LGYVDLQLKIM  196
              GY +L+L+I+
Sbjct  331   AGYPNLELRIV  341



>ref|XP_003548798.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X1 
[Glycine max]
Length=340

 Score =   380 bits (977),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 236/311 (76%), Gaps = 0/311 (0%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             +E  G  S N L   L +  WLG       +VL +I FL   KA ++ GLLF+LM IP+D
Sbjct  30    SEVFGDTSPNYLKTILALALWLGTIHFNAALVLFAIFFLSLHKAFLLFGLLFVLMVIPVD  89

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
             + SK+G + +RY+CK    YFP+ L+VED+KAF P+RAYVFGYEPHS+ PIG+V L+  T
Sbjct  90    EKSKFGRKLSRYICKHVCAYFPITLHVEDMKAFHPSRAYVFGYEPHSVLPIGVVALADNT  149

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
              FMPLPKIK L S+A+FYTP +RHIWTWLG++P  K+ F SLL +GYSCI++PGGVQEA+
Sbjct  150   CFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTKKRFTSLLDAGYSCILIPGGVQEAF  209

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
              +EH  E  FLKSR+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL L F+RAVKF+
Sbjct  210   LIEHGSEIAFLKSRRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLVLNFARAVKFS  269

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             P+ FWG  GS +PF+ P+HVVVG+PIE+ K  +PT E++A +HS+F+EAL +LFE+HK R
Sbjct  270   PVYFWGIFGSPIPFKHPMHVVVGRPIELEKTPEPTPEEVAKIHSQFVEALQDLFERHKAR  329

Query  228   LGYVDLQLKIM  196
              GY +L+L+I+
Sbjct  330   AGYPNLELRIV  340



>ref|XP_010103230.1| Diacylglycerol O-acyltransferase 2 [Morus notabilis]
 gb|EXB95101.1| Diacylglycerol O-acyltransferase 2 [Morus notabilis]
Length=315

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 209/255 (82%), Gaps = 0/255 (0%)
 Frame = -3

Query  960  IPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL  781
            IPID+ SK G R +R++C+ A  YFP+ L+VEDI AF P+RAYVFGYEPHS+ PIG+V L
Sbjct  61   IPIDEQSKVGQRISRFICRNACSYFPLTLHVEDIDAFLPDRAYVFGYEPHSVLPIGVVAL  120

Query  780  SAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGV  601
            +  TGFMPLPKIK L STAVFY P +RHIWTWLG++PA K +F SLL SGYSCIVVPGGV
Sbjct  121  ADLTGFMPLPKIKVLASTAVFYAPFLRHIWTWLGLTPATKANFVSLLRSGYSCIVVPGGV  180

Query  600  QEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRA  421
            QE + MEH  E  FL SR+GFV++AM++G PLVPVFCFGQSNVYNWWKP  KL+LKFSRA
Sbjct  181  QETFLMEHGSEVAFLNSRRGFVRVAMELGLPLVPVFCFGQSNVYNWWKPRGKLFLKFSRA  240

Query  420  VKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
            +KFTPI FWG  GS  P++RP+HVVVGKPI + KN QPT E+++ +H++F+E L +LFEK
Sbjct  241  IKFTPIFFWGIFGSPFPYRRPMHVVVGKPIPLTKNPQPTTEEVSQVHAQFVEQLQQLFEK  300

Query  240  HKKRLGYVDLQLKIM  196
            HK RLGY DLQLK++
Sbjct  301  HKTRLGYADLQLKVL  315



>gb|ADT91714.1| diacylglycerol acyltransferase 2 [Helianthus annuus]
Length=330

 Score =   379 bits (974),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLM-MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLF  973
             ++  P+PA F  T+   S + T   M+ WLG    I ++++AS + LPF + ++V+G+L 
Sbjct  14    SSDEPSPAIF--TSKLVSPIHTFFAMIIWLGSVHLIFLLIVASFLLLPFYQYLLVLGMLV  71

Query  972   LLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIG  793
             +LMFIPID+NSKWGL  ARY+ K   GYFP  LYVEDIKAF P++AYVFGYEPHS+WPIG
Sbjct  72    VLMFIPIDENSKWGLAIARYIYKYGRGYFPATLYVEDIKAFNPDQAYVFGYEPHSVWPIG  131

Query  792   MVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
                LS  TGFMP  K+K L STAVFYTP +RH+WTW+G+S A ++ F SLL +G SCIV+
Sbjct  132   AGILSELTGFMPTGKVKILASTAVFYTPFLRHLWTWMGLSLATREKFSSLLKTGCSCIVI  191

Query  612   PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLK  433
             PGGVQEA+YMEHD E  FLK+RKGF+++AM+  +PLVPVF FGQS VYNWWKP    +LK
Sbjct  192   PGGVQEAFYMEHDSEVAFLKARKGFIKLAMETNSPLVPVFAFGQSYVYNWWKPRGDFFLK  251

Query  432   FSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLE  253
              SRA+KFTPI+FWG + S +PF+RPI VVVGKPI   KNS PT E+++ +H +F+EAL  
Sbjct  252   LSRAIKFTPIVFWGTLWSPIPFRRPILVVVGKPIHFKKNSTPTMEEVSEVHGQFVEALQS  311

Query  252   LFEKHKKRLGYVDLQLKIM  196
             LFE+HK R GY DL+L+IM
Sbjct  312   LFERHKARAGYPDLELRIM  330



>gb|AEO11795.1| diacylglycerol acyltransferase type 2 [Arachis diogoi]
Length=334

 Score =   380 bits (975),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 252/335 (75%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G +V    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-DVTAAPPAEEKVFRSTEVFAAESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  N
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNSN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|AEO11791.1| diacylglycerol acyltransferase type 2 [Arachis hypogaea]
Length=334

 Score =   380 bits (975),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 252/335 (75%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G NV    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-NVTAAPPAEEKVFRSTEVFAPESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  N
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNSN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|AEO11790.1| diacylglycerol acyltransferase type 2 [Arachis hypogaea]
Length=334

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 252/335 (75%), Gaps = 2/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             ME++G NV    P+ E     T      ++S +    T + LA WLG       ++L ++
Sbjct  1     MEDRG-NVTVAPPAEEKVFRSTEVFAPESSSKSKGFKTTLALALWLGAIHFNGALMLFAL  59

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
             +FLP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  N
Sbjct  60    LFLPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNSN  119

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K
Sbjct  120   RAYVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATK  179

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQ
Sbjct  180   KNFLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQ  239

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S++Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT 
Sbjct  240   SDIYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTT  299

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  300   EEVATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|AEO11789.1| diacylglycerol acyltransferase type 2 [Arachis hypogaea]
Length=334

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 249/333 (75%), Gaps = 1/333 (0%)
 Frame = -3

Query  1191  EKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIF  1015
             E  GNV    P+ E     T      ++S +    T + LA WLG       ++L +++F
Sbjct  2     EVRGNVTVAPPAEEKVFRSTEVFAPESSSKSKGFKTTLALALWLGAIHFNGALMLFALLF  61

Query  1014  LPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRA  835
             LP +KA++V  LLF+ M IPID+ SK+G + +RY+CK A  YFP+ L+VEDIKAF  NRA
Sbjct  62    LPLSKALLVFALLFVFMVIPIDEKSKFGRKLSRYICKNACSYFPITLHVEDIKAFNSNRA  121

Query  834   YVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQS  655
             YVFG+EPHS+ PIG+V L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++
Sbjct  122   YVFGFEPHSVLPIGVVALADNTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKKN  181

Query  654   FKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSN  475
             F SLL +GYSCI++PGGVQE + MEH  ET +LK+RKGF++IAM+ G PLVPVFCFGQS+
Sbjct  182   FLSLLDNGYSCILIPGGVQETFLMEHGTETAYLKARKGFIRIAMQKGQPLVPVFCFGQSD  241

Query  474   VYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQ  295
             +Y WWKP  KL L F+RA+KFTPI FWG  GS +PF+ P++VVVG+PIE+ KN +PT E+
Sbjct  242   IYKWWKPGGKLILNFARAIKFTPIYFWGIFGSPIPFKHPMYVVVGRPIELDKNPEPTTEE  301

Query  294   LAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +A +HS+F+ +L +LFE++K R GY +L+L+I+
Sbjct  302   VATVHSQFVASLQDLFERYKARAGYPNLELRIV  334



>gb|KHG09832.1| Diacylglycerol O-acyltransferase 2 -like protein [Gossypium arboreum]
 gb|KHG11897.1| Diacylglycerol O-acyltransferase 2 -like protein [Gossypium arboreum]
Length=328

 Score =   377 bits (968),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 191/321 (60%), Positives = 236/321 (74%), Gaps = 3/321 (1%)
 Frame = -3

Query  1149  AAPPPTP-AEFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGL  979
             AAPP T   EF G     +N +   L +  WLG       ++L S +FLPF K IMV+GL
Sbjct  8     AAPPGTGYREFNGRTEFPSNMVHGVLAIAMWLGAIHFNFFLLLFSFLFLPFPKLIMVLGL  67

Query  978   LFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWP  799
             L    F+PID +SK G R ARY+CK    YFP+ LYVEDI  F P+RAYVFGYEPHS+ P
Sbjct  68    LSFFTFLPIDPHSKIGRRLARYICKHLCSYFPITLYVEDIHVFHPDRAYVFGYEPHSVLP  127

Query  798   IGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCI  619
             IG+ TL+   GFMPLPK+K L S+AVFYTP +RHIWTWLG+SPA K  F SLL +GYSCI
Sbjct  128   IGVATLADLAGFMPLPKMKVLASSAVFYTPFLRHIWTWLGVSPATKTMFSSLLEAGYSCI  187

Query  618   VVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
             +VPGG+QE ++MEH  E  FLK+RKGFV+IAM+ G PLVPVFCFGQS+VY WWKPS K Y
Sbjct  188   IVPGGLQETFFMEHGSEVAFLKARKGFVRIAMEKGCPLVPVFCFGQSHVYKWWKPSGKFY  247

Query  438   LKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
             L+FSRA+KF P+LFWG  GS +P+Q  +HVVVGKPI + KN QPT E++   H ++++AL
Sbjct  248   LQFSRAIKFIPLLFWGIFGSPLPYQHSMHVVVGKPIYLKKNPQPTVEEVLETHDQYVKAL  307

Query  258   LELFEKHKKRLGYVDLQLKIM  196
              +LFE+HK R+GY DL LKI+
Sbjct  308   QDLFERHKARVGYADLPLKIL  328



>ref|XP_004512296.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Cicer arietinum]
Length=319

 Score =   377 bits (967),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 241/306 (79%), Gaps = 0/306 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             T S+N+    L +  WLG    I+ +VL +  FLP +K++ V+G L LLM +P++  SK+
Sbjct  14    TDSSNTFHSILALSLWLGAIHFIIGLVLFATFFLPLSKSLSVLGFLLLLMVLPVEAKSKF  73

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G R +RY+CK A  YFP+ L+VEDIKAF+PNRAYVFGYEPHS+ PIG++ L+  TGFMP+
Sbjct  74    GRRLSRYICKHACSYFPITLHVEDIKAFDPNRAYVFGYEPHSVLPIGVIALADNTGFMPI  133

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             PK+K L S+AVFYTP +RHIWTWLG++PA +++F SLL+ GYSCI++PGGVQE ++M+  
Sbjct  134   PKVKVLASSAVFYTPFLRHIWTWLGLTPATRKNFISLLADGYSCILIPGGVQETFFMQRG  193

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E  +LK+R+GFV+IAM+ G PLVPVFCFGQS++Y WWKPS KL+L  +RA+KFTPI FW
Sbjct  194   LEIAYLKARRGFVRIAMEKGRPLVPVFCFGQSDIYKWWKPSGKLFLNIARAIKFTPIYFW  253

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS +P + P+HVVVG+PIE+ KN +PT E+++ +HS+F+EAL +LFE+HK R GY +
Sbjct  254   GIFGSPLPLRHPMHVVVGRPIELEKNPEPTMEEVSKIHSQFVEALQDLFERHKARAGYPN  313

Query  213   LQLKIM  196
             L+LKI+
Sbjct  314   LELKIV  319



>gb|ADF57328.1| 1,2-diacyl-sn-glycerol:acyl-CoA acyltransferase 2 [Euonymus alatus]
Length=331

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/311 (56%), Positives = 231/311 (74%), Gaps = 2/311 (1%)
 Frame = -3

Query  1122  FIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             F GT    +  +   + ML WLG     V +VL S++FLP +K+IMV  +L   MF+PID
Sbjct  21    FRGTEQFPSKKMRTVVAMLIWLGAIHFNVALVLLSLVFLPLSKSIMVFAVLLFFMFVPID  80

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
             + SK+     R +C  A  YFP+ L+VEDI AF PNRAYVFGYEPHS+ PIG++ L+  T
Sbjct  81    ELSKYRRTLCRCICMHAFSYFPITLHVEDIDAFNPNRAYVFGYEPHSVLPIGVIALTDLT  140

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
             GFMPLPK+K L S+AVFY P +RHIWTW+G++PA +++F S L +GYSCI+VPGGVQE +
Sbjct  141   GFMPLPKMKVLASSAVFYIPFLRHIWTWMGLTPATRKNFTSCLDAGYSCIIVPGGVQETF  200

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
             +ME   E  FLKSR+GFV+IAM+MGTPLVPVFCFGQS VY WWKP   L+ K +RAVKFT
Sbjct  201   HMEPGSEIAFLKSRRGFVRIAMEMGTPLVPVFCFGQSRVYKWWKPGGNLFFKLARAVKFT  260

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             PI+FWG  GS +P++ P+ VVVG+PIE+ KN +P  E++A +H +F++AL +LFE+HK R
Sbjct  261   PIIFWGIFGSPLPYRHPMQVVVGRPIELEKNPRPAMEEVAEVHDQFVKALGDLFERHKAR  320

Query  228   LGYVDLQLKIM  196
             +G  DL L+I+
Sbjct  321   VGCGDLHLEIL  331



>ref|XP_011004405.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Populus 
euphratica]
Length=326

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 240/304 (79%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N +L  + +  WLG    +V++V+ S++FL F+K ++V GLL LL+F+PID ++K G 
Sbjct  23    SSNIILSLIAVAIWLGSIHFVVLLVIFSLLFLSFSKCLLVFGLLLLLVFVPIDDDNKLGR  82

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             R   Y+C+ A  YFP+ L+VEDI AF P+RAYVFGYEPHS+WPIG+V L+  TGFMPL K
Sbjct  83    RLCWYICRHACCYFPVTLHVEDINAFHPDRAYVFGYEPHSVWPIGVVALADHTGFMPLRK  142

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             +K L S+AVF  P +RHIWTW G++ A K++F SLLS+GY+CIV PGGVQE +YMEHD E
Sbjct  143   VKVLASSAVFLVPFLRHIWTWCGLTSATKKNFTSLLSAGYTCIVNPGGVQETFYMEHDNE  202

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLKSR+GF++IAM+ G PLVPVFCFGQS VY WWKPS KL+LK SRA+KFTP++F G 
Sbjct  203   IAFLKSRRGFIKIAMENGAPLVPVFCFGQSKVYKWWKPSGKLFLKISRAIKFTPVVFGGI  262

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              G+ +PFQRP+H+VVG+PIE+ +N QPT E+LA +H +F+ AL +LF++H+ R+G+ DL+
Sbjct  263   FGTPLPFQRPMHIVVGRPIELKQNLQPTVEELAEVHGQFVAALEDLFKRHRARVGFADLE  322

Query  207   LKIM  196
             LKI+
Sbjct  323   LKIL  326



>gb|KHG14545.1| Diacylglycerol O-acyltransferase 2 -like protein [Gossypium arboreum]
Length=348

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 245/342 (72%), Gaps = 10/342 (3%)
 Frame = -3

Query  1191  EKGGN--------VQHRSPSNEAAPPPTPAEFIGTA--SANSLLMTLMMLAWLGVPPSIV  1042
             E GG+        V+ R      A      +F G    S+N L   L    W+G      
Sbjct  7     ESGGDCVRSWRTMVEEREEKETYAAGSGYRQFNGRNEFSSNVLHGILACAMWIGALHFDF  66

Query  1041  VVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVED  862
              +++ S++FLPF+K ++V+GLL +   +PID NSK+GLR ARY+C+  S YFP  L+VED
Sbjct  67    YLIVFSLLFLPFSKCLLVVGLLLVFAVVPIDHNSKFGLRLARYICRNMSNYFPTTLHVED  126

Query  861   IKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWL  682
             I  F+P+RAYVFGYEPHS+ PIG+VTL+  TGFMPLPK+K L ++ VFYTP +RHIWTWL
Sbjct  127   INDFQPDRAYVFGYEPHSVLPIGVVTLAERTGFMPLPKLKCLTTSPVFYTPFLRHIWTWL  186

Query  681   GISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLV  502
             G SPA +++F SLL +GYSCIVVPGGVQE + M+HD E  FLKSR+GFV+IAM+MG PLV
Sbjct  187   GASPATRKNFCSLLEAGYSCIVVPGGVQETFLMQHDSEVAFLKSRRGFVRIAMEMGCPLV  246

Query  501   PVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVG  322
             PVF FGQS+ Y WWKP  KL L+ SRA+KF P+LFWG  G+ +P+Q P+HVVVGKPI + 
Sbjct  247   PVFAFGQSHAYKWWKPGGKLILQLSRAIKFVPMLFWGAFGTPIPYQHPMHVVVGKPIYLK  306

Query  321   KNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             KN QPT E++  +H +F++AL +LFE+HK R+GY DL LKI+
Sbjct  307   KNPQPTAEEVLEVHDQFVKALEDLFERHKARVGYDDLHLKII  348



>ref|XP_006599272.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X3 
[Glycine max]
Length=343

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 232/307 (76%), Gaps = 0/307 (0%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             +E  G  S N L   L +  WLG       +VL +I FL   KA ++ GLLF+LM IP+D
Sbjct  30    SEVFGDTSPNYLKTILALALWLGTIHFNAALVLFAIFFLSLHKAFLLFGLLFVLMVIPVD  89

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
             + SK+G + +RY+CK    YFP+ L+VED+KAF P+RAYVFGYEPHS+ PIG+V L+  T
Sbjct  90    EKSKFGRKLSRYICKHVCAYFPITLHVEDMKAFHPSRAYVFGYEPHSVLPIGVVALADNT  149

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
              FMPLPKIK L S+A+FYTP +RHIWTWLG++P  K+ F SLL +GYSCI++PGGVQEA+
Sbjct  150   CFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTKKRFTSLLDAGYSCILIPGGVQEAF  209

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
              +EH  E  FLKSR+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL L F+RAVKF+
Sbjct  210   LIEHGSEIAFLKSRRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLVLNFARAVKFS  269

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             P+ FWG  GS +PF+ P+HVVVG+PIE+ K  +PT E++A +HS+F+EAL +LFE+HK R
Sbjct  270   PVYFWGIFGSPIPFKHPMHVVVGRPIELEKTPEPTPEEVAKIHSQFVEALQDLFERHKAR  329

Query  228   LGYVDLQ  208
              GY +L+
Sbjct  330   AGYPNLE  336



>gb|ACO90187.1| putative type-2 acyl-CoA:diacylglycerol acyltransferase a [Brassica 
napus]
Length=317

 Score =   372 bits (955),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 222/283 (78%), Gaps = 0/283 (0%)
 Frame = -3

Query  1044  VVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVE  865
             + +VL S+ FLP + +++V+GLL L + IPID  SK+GL+ ARY+CK A+ YFP+ L+VE
Sbjct  35    LALVLISLFFLPTSLSLLVLGLLSLFIIIPIDDRSKYGLKLARYICKHAASYFPVTLHVE  94

Query  864   DIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
             D +AF+P+R+YVFGYEPHS+WPIG V L    GFMPLP IK L S A+FYTP +RH+W W
Sbjct  95    DYEAFKPDRSYVFGYEPHSVWPIGAVALVDLAGFMPLPNIKLLASNAIFYTPFLRHMWAW  154

Query  684   LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPL  505
             LG++ A ++SF SLL SGYSCI+VPGGVQE ++++HD E +FL SR+GFV+IAM+ G PL
Sbjct  155   LGLASASRKSFSSLLESGYSCILVPGGVQETFHLQHDVENVFLSSRRGFVRIAMEQGAPL  214

Query  504   VPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEV  325
             VPVFCFGQS  Y WWKP   LY K +RA++FTPI FWG  GS +P++ PIHVVVGKPI+V
Sbjct  215   VPVFCFGQSRAYKWWKPDCDLYFKLARAIRFTPICFWGVFGSPIPYRHPIHVVVGKPIQV  274

Query  324   GKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              K+ QPT+E++  LH +F+EAL +LFE+HK   GY DLQL I+
Sbjct  275   AKSLQPTDEEIDELHGQFVEALKDLFERHKAGAGYSDLQLNIL  317



>gb|KGN55585.1| hypothetical protein Csa_3G00090 [Cucumis sativus]
Length=337

 Score =   372 bits (955),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 245/327 (75%), Gaps = 3/327 (1%)
 Frame = -3

Query  1167  RSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA---WLGVPPSIVVVVLASIIFLPFTKA  997
             R   ++ + P       G  SA    M  +++A   WLG       + L S+ +L  +KA
Sbjct  11    RDEIDKISEPSVTVFKGGGGSATKWRMMHIIVALGIWLGGIHLNFALGLISLFYLSLSKA  70

Query  996   IMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYE  817
             ++V  LL +L+ IP+D  SK+G   ARY+C+ A  YFP+ L+VEDI AF+ NRAYVFGYE
Sbjct  71    LLVFALLLILVLIPVDHKSKYGRVLARYICQNACSYFPVTLHVEDIHAFDTNRAYVFGYE  130

Query  816   PHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS  637
             PHS+ PIG+V L+  TGFMPL K+K L S+AVFYTP +RHIWTW+G++PA +++F SLL+
Sbjct  131   PHSVLPIGVVALADLTGFMPLKKLKVLASSAVFYTPFLRHIWTWMGLTPATRKNFISLLA  190

Query  636   SGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK  457
             +GYSCI+VPGGVQE ++MEH+ ET+FLK+R+GFV+IAM+MGTPLVPVFCFGQS+VY WWK
Sbjct  191   AGYSCIIVPGGVQETFHMEHNSETVFLKTRRGFVRIAMEMGTPLVPVFCFGQSSVYQWWK  250

Query  456   PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHS  277
             P  K +L+FSRA+KFTPI+FWG  GS +P++R +HVVVG+PIEV KN  PT +++  LH 
Sbjct  251   PGGKFFLQFSRAIKFTPIVFWGVFGSPLPYRRQMHVVVGRPIEVKKNPNPTSDEVLDLHG  310

Query  276   RFIEALLELFEKHKKRLGYVDLQLKIM  196
             RF+EAL  +FE++K +LGY DLQL ++
Sbjct  311   RFVEALESMFERYKGQLGYDDLQLNVL  337



>ref|XP_007202235.1| hypothetical protein PRUPE_ppa008685mg [Prunus persica]
 gb|EMJ03434.1| hypothetical protein PRUPE_ppa008685mg [Prunus persica]
Length=322

 Score =   372 bits (954),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 233/303 (77%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L   L +  WLG     V++VL +I FLP +KA++V GLL L M IP+D  SK G  
Sbjct  20    SNVLHTVLALGLWLGTIHFNVILVLFAIFFLPLSKALLVFGLLLLFMIIPVDDKSKIGQS  79

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              + Y+ K A  YFP+++Y EDI AF+PNR+YVFGYEPHS+ P+G+V  +  TGF+PL K+
Sbjct  80    VSGYIFKHACAYFPVNVYAEDIHAFDPNRSYVFGYEPHSVLPLGVVAFAELTGFLPLTKV  139

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTW+G++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  140   KVLASSAVFYTPFLRHIWTWMGLTPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGIEI  199

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM+MG PLVPVFCFGQS+V+ WWKPS + +LKFSRA+KF P+ FWG  
Sbjct  200   AFLKSRRGFVRIAMEMGHPLVPVFCFGQSDVFKWWKPSGEFFLKFSRAIKFIPLFFWGIF  259

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             GS VP+++P+HVVVG+PI++ K  QPT E++  +H +F+ AL +LFE+HK R+G+ DLQL
Sbjct  260   GSPVPYRQPMHVVVGRPIDLKKTPQPTMEEVNEVHGQFVAALQDLFERHKVRVGHADLQL  319

Query  204   KIM  196
             KI+
Sbjct  320   KIL  322



>ref|XP_008242122.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Prunus mume]
Length=322

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 233/304 (77%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
              +N L   L +  WLG     V++VL +I FLP +KA++V GLL L M IP+D  SK G 
Sbjct  19    GSNVLHTVLALGLWLGTIHFNVILVLFAIFFLPLSKALLVFGLLLLFMIIPVDDKSKIGQ  78

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
               + Y+ K A  YFP+++Y EDI AF+PNR+YVFGYEPHS+ P+G+V  +  TGF+PL K
Sbjct  79    SVSGYIFKHACAYFPVNVYAEDIHAFDPNRSYVFGYEPHSVLPLGVVAFAELTGFLPLTK  138

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             +K L S+AVFYTP +RHIWTW+G++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E
Sbjct  139   VKVLASSAVFYTPFLRHIWTWMGLTPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGTE  198

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLKSR+GFV+IAM+MG PLVPVFCFGQS+V+ WWKPS + +L+FSRA+KF P+ FWG 
Sbjct  199   IAFLKSRRGFVRIAMEMGHPLVPVFCFGQSDVFKWWKPSGEFFLRFSRAIKFIPLFFWGI  258

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              GS VP+++P+HVVVG+PI++ K  QPT E++  +H +F+ AL +LFE+HK R+G+ DLQ
Sbjct  259   FGSPVPYRQPMHVVVGRPIDLKKTPQPTMEEVNEVHGQFVAALQDLFERHKVRVGHADLQ  318

Query  207   LKIM  196
             LKI+
Sbjct  319   LKIL  322



>ref|XP_007046427.1| Diacylglycerol acyltransferase family isoform 3 [Theobroma cacao]
 gb|EOX90584.1| Diacylglycerol acyltransferase family isoform 3 [Theobroma cacao]
Length=257

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 210/257 (82%), Gaps = 0/257 (0%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            M +PID  SK+G R +RY+CK A  YFP+ L+VEDI AF P+RAYVFG+EPHS+ PIG+V
Sbjct  1    MILPIDPYSKFGRRLSRYICKHACSYFPITLHVEDIHAFHPDRAYVFGFEPHSVLPIGVV  60

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPG
Sbjct  61   ALADLTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKKNFSSLLDAGYSCILVPG  120

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            GVQE ++ME   E  FL++R+GFV+IAM+MG+PLVPVFCFGQS+VY WWKP  K YL+FS
Sbjct  121  GVQETFHMEPGSEIAFLRARRGFVRIAMEMGSPLVPVFCFGQSHVYKWWKPGGKFYLQFS  180

Query  426  RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            RA+KFTPI FWG  GS +P+Q P+HVVVGKPI+V KN QP  E++  +H RF+EAL +LF
Sbjct  181  RAIKFTPIFFWGIFGSPLPYQHPMHVVVGKPIDVKKNPQPIVEEVIEVHDRFVEALQDLF  240

Query  246  EKHKKRLGYVDLQLKIM  196
            E+HK ++G+ DL LKI+
Sbjct  241  ERHKAQVGFADLPLKIL  257



>ref|XP_008448438.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Cucumis melo]
Length=335

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 245/327 (75%), Gaps = 3/327 (1%)
 Frame = -3

Query  1167  RSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA---WLGVPPSIVVVVLASIIFLPFTKA  997
             R   ++ + P       G  SA    M  +++A   WLG       + L S+ +L  +KA
Sbjct  9     RDEMDKISEPSVTVFKGGGGSATKWRMMHIIVALGIWLGGIHLNFALGLISLFYLSLSKA  68

Query  996   IMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYE  817
             ++V  LL +L+ IP+D  SK+G   ARY+C+ A  YFP+ L+VEDI AF+ NRAYVFGYE
Sbjct  69    LLVFALLLILVLIPVDDKSKYGRVLARYICQNACSYFPVTLHVEDIHAFDTNRAYVFGYE  128

Query  816   PHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS  637
             PHS+ PIG+V L+  TGFMPL K+K L S+AVFYTP +RHIWTW+G++PA +++F SLL+
Sbjct  129   PHSVLPIGVVALADLTGFMPLKKLKVLASSAVFYTPFLRHIWTWMGLTPATRKNFISLLA  188

Query  636   SGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK  457
             +GYSCI+VPGGVQE ++MEH+ ET+FLK+R+GFV+IAM+MGTPLVPVFCFGQS+VY WWK
Sbjct  189   AGYSCIIVPGGVQETFHMEHNSETVFLKTRRGFVRIAMEMGTPLVPVFCFGQSSVYQWWK  248

Query  456   PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHS  277
             P  K +L+FSRA+KFTPI+FWG  GS +P++R +HVVVG+PIEV KN  PT +++  LH 
Sbjct  249   PGGKFFLQFSRAIKFTPIVFWGVFGSPLPYRRQMHVVVGRPIEVKKNPNPTSDEVLDLHG  308

Query  276   RFIEALLELFEKHKKRLGYVDLQLKIM  196
             RF+EAL  +FE++K +LGY +LQL ++
Sbjct  309   RFVEALENIFERYKGQLGYDNLQLNVL  335



>ref|XP_004146185.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Cucumis sativus]
Length=301

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/291 (60%), Positives = 232/291 (80%), Gaps = 0/291 (0%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGY  889
             WLG       + L S+ +L  +KA++V  LL +L+ IP+D  SK+G   ARY+C+ A  Y
Sbjct  11    WLGGIHLNFALGLISLFYLSLSKALLVFALLLILVLIPVDHKSKYGRVLARYICQNACSY  70

Query  888   FPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTP  709
             FP+ L+VEDI AF+ NRAYVFGYEPHS+ PIG+V L+  TGFMPL K+K L S+AVFYTP
Sbjct  71    FPVTLHVEDIHAFDTNRAYVFGYEPHSVLPIGVVALADLTGFMPLKKLKVLASSAVFYTP  130

Query  708   VMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQI  529
              +RHIWTW+G++PA +++F SLL++GYSCI+VPGGVQE ++MEH+ ET+FLK+R+GFV+I
Sbjct  131   FLRHIWTWMGLTPATRKNFISLLAAGYSCIIVPGGVQETFHMEHNSETVFLKTRRGFVRI  190

Query  528   AMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHV  349
             AM+MGTPLVPVFCFGQS+VY WWKP  K +L+FSRA+KFTPI+FWG  GS +P++R +HV
Sbjct  191   AMEMGTPLVPVFCFGQSSVYQWWKPGGKFFLQFSRAIKFTPIVFWGVFGSPLPYRRQMHV  250

Query  348   VVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             VVG+PIEV KN  PT +++  LH RF+EAL  +FE++K +LGY DLQL ++
Sbjct  251   VVGRPIEVKKNPNPTSDEVLDLHGRFVEALESMFERYKGQLGYDDLQLNVL  301



>ref|XP_010681115.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=292

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 164/271 (61%), Positives = 217/271 (80%), Gaps = 0/271 (0%)
 Frame = -3

Query  1008  FTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYV  829
             FT    V  +L + + IPID+  K+G + A Y+CK A GYFP+ L VED KAF+PNRAYV
Sbjct  22    FTGKQEVCCVLLIFILIPIDEKDKFGRKLASYICKHACGYFPITLDVEDYKAFDPNRAYV  81

Query  828   FGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFK  649
             FGYEPHS+ PIG+V L+  TGFMPL K+K L STAVFYTP +RHIW+WLG+SPA + +FK
Sbjct  82    FGYEPHSVLPIGVVALADLTGFMPLSKVKVLASTAVFYTPFLRHIWSWLGLSPATRNNFK  141

Query  648   SLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY  469
             S LSSGYSCI+VPGGVQE ++MEH  E +FL++R+GFV++A++ G PLVPVF FGQS VY
Sbjct  142   SRLSSGYSCIIVPGGVQETFHMEHGSEVIFLRNRRGFVRLALEKGCPLVPVFSFGQSEVY  201

Query  468   NWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLA  289
              WWKPS KL+L+ +RA++FTP+ FWG  GS +P++ P+HVVVG+PI+V KN +PT E+++
Sbjct  202   KWWKPSGKLFLQIARALRFTPVFFWGVFGSPLPYRVPMHVVVGRPIDVKKNPEPTMEEVS  261

Query  288   ALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
               HSR++EAL +LFE+HK R+G+ +LQLKI+
Sbjct  262   EAHSRYVEALEDLFERHKARVGHANLQLKIL  292



>ref|XP_007158045.1| hypothetical protein PHAVU_002G119500g [Phaseolus vulgaris]
 gb|ESW30039.1| hypothetical protein PHAVU_002G119500g [Phaseolus vulgaris]
Length=326

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 230/304 (76%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N+    L M  WLG     + ++L ++ FLP  K + V G LF+   +PID+ S++G 
Sbjct  23    SSNTFSAILAMALWLGAIHFNIAIILFALFFLPLPKLLSVFGFLFVFSVLPIDEKSRFGR  82

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             + +RY+CK A  YFP+ L+VED+KAF PNRAYVFGYEPHS+ PIG+V L+  TGFMPL K
Sbjct  83    KLSRYICKHACNYFPITLHVEDMKAFHPNRAYVFGYEPHSVLPIGIVALADHTGFMPLQK  142

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             ++ L S+ VFYTP +RHIWTWLG++PA K++F SLL+SG+SCI+ PGGVQE + M+H  E
Sbjct  143   VRVLASSTVFYTPFLRHIWTWLGLTPATKKNFISLLASGHSCILTPGGVQETFLMQHGIE  202

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLK+R+GFV+IAM  G PLVPVFCFGQSNVY WWKP  K +LK +RA+KFTPI FWG 
Sbjct  203   IAFLKARRGFVRIAMVKGLPLVPVFCFGQSNVYKWWKPGGKFFLKVARAIKFTPICFWGI  262

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              GS +PF+ P+HVVVG+PIE+ KN  PT E++A +H +F+EAL +LFE+HK   GY +L+
Sbjct  263   FGSPLPFRYPMHVVVGRPIELTKNPDPTTEEVAMIHGKFVEALQDLFERHKALAGYPNLE  322

Query  207   LKIM  196
             L+I+
Sbjct  323   LRIV  326



>ref|XP_002528531.1| type 2 diacylglycerol acyltransferase [Ricinus communis]
 gb|AAY16324.1| diacylglycerol acyltransferase [Ricinus communis]
 gb|ACB30544.1| diacylglycerol acyltransferase type-2 [Ricinus communis]
 gb|EEF33843.1| type 2 diacylglycerol acyltransferase [Ricinus communis]
 emb|CDG23428.1| type 2 diacylglycerol acyltransferase [synthetic construct]
Length=340

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 227/296 (77%), Gaps = 0/296 (0%)
 Frame = -3

Query  1083  LMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCK  904
             L +  W+G     + ++  S +FL F   ++++G   +LMFIPID++SK G R  RY+C+
Sbjct  45    LALSIWIGSIHFNLFLLFISYLFLSFPTFLLIVGFFVVLMFIPIDEHSKLGRRLCRYVCR  104

Query  903   QASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTA  724
              A  +FP+ L+VED+ AF  +RAYVFGYEPHS++P+G+  LS     +PLPK+K L S A
Sbjct  105   HACSHFPVTLHVEDMNAFHSDRAYVFGYEPHSVFPLGVSVLSDHFAVLPLPKMKVLASNA  164

Query  723   VFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRK  544
             VF TPV+RHIWTW G++ A K++F +LL+SGYSCIV+PGGVQE +YM+H  E  FLK+R+
Sbjct  165   VFRTPVLRHIWTWCGLTSATKKNFTALLASGYSCIVIPGGVQETFYMKHGSEIAFLKARR  224

Query  543   GFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ  364
             GFV++AM+MG PLVPVFCFGQSNVY WWKP  +L++K +RA+KF+PI+FWG +GS +P Q
Sbjct  225   GFVRVAMEMGKPLVPVFCFGQSNVYKWWKPDGELFMKIARAIKFSPIVFWGVLGSHLPLQ  284

Query  363   RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             RP+HVVVGKPIEV +N QPT E+++ +  +F+ AL +LFE+HK R+GY DL L+I+
Sbjct  285   RPMHVVVGKPIEVKQNPQPTVEEVSEVQGQFVAALKDLFERHKARVGYADLTLEIL  340



>ref|XP_009136618.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Brassica 
rapa]
Length=317

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 237/318 (75%), Gaps = 8/318 (3%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
              A    P+  +   +A S+ ++ + L         + +VL S+ FLP + +++V+GLL L
Sbjct  8     GAEDHIPSNILHAVTAISICISAIYLN--------LALVLFSLFFLPPSLSLLVLGLLSL  59

Query  969   LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
              + IPID  SK+GL+ ARY+CK A+ YFP+ L+VED +AF+P+R+YVFGYEPHS+WPIG 
Sbjct  60    FIIIPIDDRSKYGLKLARYICKHAASYFPVTLHVEDYEAFKPDRSYVFGYEPHSVWPIGA  119

Query  789   VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
             V L   TGFMPLP IK L S A+FYTP +RH+W WLG++ A ++SF SLL SGYSCI+VP
Sbjct  120   VALVDLTGFMPLPNIKLLASNAIFYTPFLRHMWAWLGLASASRKSFSSLLESGYSCILVP  179

Query  609   GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
             GGVQE ++++HD E +FL SR+GFV+IAM+ G PLVPVFCFGQS  Y WWKP+  LY K 
Sbjct  180   GGVQETFHLKHDVENVFLSSRRGFVRIAMEQGAPLVPVFCFGQSRAYKWWKPNCDLYFKL  239

Query  429   SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
             +RA++FTPI FWG +GS +P++ PIHVVVGKPI+V K+ QPT+E++  LH +F+EAL +L
Sbjct  240   ARAIRFTPICFWGVLGSPIPYRHPIHVVVGKPIQVTKSLQPTDEEIDELHGQFVEALKDL  299

Query  249   FEKHKKRLGYVDLQLKIM  196
             FE+HK   GY DLQL I+
Sbjct  300   FERHKAGAGYSDLQLNIL  317



>ref|XP_007046425.1| Diacylglycerol acyltransferase family isoform 1 [Theobroma cacao]
 gb|EOX90582.1| Diacylglycerol acyltransferase family isoform 1 [Theobroma cacao]
Length=327

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 241/312 (77%), Gaps = 2/312 (1%)
 Frame = -3

Query  1125  EFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPI  952
             EF G     +N++   L M  WLG      +++L S +FLPF+K ++V GLL L M +PI
Sbjct  16    EFSGRHEFPSNTMHALLAMGIWLGAIHFNALLLLFSFLFLPFSKFLVVFGLLLLFMILPI  75

Query  951   DQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAF  772
             D  SK+G R +RY+CK A  YFP+ L+VEDI AF P+RAYVFG+EPHS+ PIG+V L+  
Sbjct  76    DPYSKFGRRLSRYICKHACSYFPITLHVEDIHAFHPDRAYVFGFEPHSVLPIGVVALADL  135

Query  771   TGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEA  592
             TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPGGVQE 
Sbjct  136   TGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKKNFSSLLDAGYSCILVPGGVQET  195

Query  591   YYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKF  412
             ++ME   E  FL++R+GFV+IAM+MG+PLVPVFCFGQS+VY WWKP  K YL+FSRA+KF
Sbjct  196   FHMEPGSEIAFLRARRGFVRIAMEMGSPLVPVFCFGQSHVYKWWKPGGKFYLQFSRAIKF  255

Query  411   TPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKK  232
             TPI FWG  GS +P+Q P+HVVVGKPI+V KN QP  E++  +H RF+EAL +LFE+HK 
Sbjct  256   TPIFFWGIFGSPLPYQHPMHVVVGKPIDVKKNPQPIVEEVIEVHDRFVEALQDLFERHKA  315

Query  231   RLGYVDLQLKIM  196
             ++G+ DL LKI+
Sbjct  316   QVGFADLPLKIL  327



>ref|XP_003629047.1| 2-acylglycerol O-acyltransferase [Medicago truncatula]
Length=416

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 239/349 (68%), Gaps = 44/349 (13%)
 Frame = -3

Query  1110  ASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWG  931
             +S NS    L +L WLG      VV++ ++ FLPF+KA++V G LF+LM IPID+ S +G
Sbjct  68    SSCNSFNTVLALLLWLGAIHFNGVVMVFALFFLPFSKALLVFGFLFVLMVIPIDEKSLFG  127

Query  930   LRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLP  751
              + ARY+CK A  YFP+ L+VEDIKAF PNRAYVFGYEPHS+ PIG+V L+  TGFMPLP
Sbjct  128   RKLARYICKHACSYFPVTLHVEDIKAFHPNRAYVFGYEPHSVLPIGVVALADSTGFMPLP  187

Query  750   KIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDC  571
             KIK L S+A+FYTP +RHIWTWLG++PA K++F SLL + YSCI+VPGGVQE ++MEH C
Sbjct  188   KIKVLASSAIFYTPFLRHIWTWLGLTPATKKNFTSLLDADYSCILVPGGVQETFFMEHGC  247

Query  570   ET---------------------------MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNV  472
             E                             FLK+R+GFV+IAM+ G PLVPVFCFGQS+V
Sbjct  248   EVGHIKRGEDFGGWDCNERPGSHIVTLMIAFLKARRGFVRIAMEKGKPLVPVFCFGQSDV  307

Query  471   YNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFV-----------------PFQRPIHVVV  343
             Y WWKP  KL L  +RA+KF PI FWG  GS +                  F+ P+HVVV
Sbjct  308   YKWWKPGGKLILNIARAIKFIPIYFWGIFGSSMVWWLYQCSSLRGSDLQYHFKHPMHVVV  367

Query  342   GKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             G+PIE+ KN +PT E++A +HS+F+EAL +LFE +K R GY +L+L+I+
Sbjct  368   GRPIELEKNPKPTPEEVAKVHSQFVEALQDLFECNKTRAGYPNLELRIV  416



>emb|CDX90646.1| BnaA03g41350D [Brassica napus]
Length=317

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 236/318 (74%), Gaps = 8/318 (3%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
              A    P+  +   +A S+ ++ + L         + +VL S+ FLP + +++V+GLL L
Sbjct  8     GAEDHIPSNILHAVTAISICLSAIYLN--------LALVLFSLFFLPPSLSLLVLGLLSL  59

Query  969   LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
              + IPID  SK+GL+ ARY+CK A+ YFP+ L+VED +AF+P+R+YVFGYEPHS+WPIG 
Sbjct  60    FIIIPIDDRSKYGLKLARYICKHAASYFPVTLHVEDYEAFKPDRSYVFGYEPHSVWPIGA  119

Query  789   VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
             V L   TGFMPLP IK L S A+FYTP +RH+W WLG++ A ++SF SLL SGYSCI+VP
Sbjct  120   VALVDLTGFMPLPNIKLLASNAIFYTPFLRHMWAWLGLASASRKSFSSLLESGYSCILVP  179

Query  609   GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
             GGVQE ++++HD E +FL SR+GFV+IA++ G PLVPVFCFGQS  Y WWKP   LY K 
Sbjct  180   GGVQETFHLKHDVENVFLSSRRGFVRIAIEQGAPLVPVFCFGQSRAYKWWKPDCDLYFKL  239

Query  429   SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
             +RA++FTPI FWG +GS +P++ PIHVVVGKPI+V K+ QPT+E++  LH +F+EAL +L
Sbjct  240   ARAIRFTPICFWGVLGSPIPYRHPIHVVVGKPIQVTKSLQPTDEEIDELHGQFVEALKDL  299

Query  249   FEKHKKRLGYVDLQLKIM  196
             FE+HK   GY DLQL I+
Sbjct  300   FERHKAGAGYSDLQLNIL  317



>gb|ACO90188.1| putative type-2 acyl-CoA:diacylglycerol acyltransferase b [Brassica 
napus]
Length=317

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 236/318 (74%), Gaps = 8/318 (3%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
              A    P+  +   +A S+ ++ + L         + +VL S+ FLP + +++V+GLL L
Sbjct  8     GAEDHIPSNILHAVTAISICLSAIYLN--------LALVLFSLFFLPPSLSLLVLGLLSL  59

Query  969   LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
              + IPID  SK+GL+ ARY+CK A+ YFP+ L+VED +AF+P+R+YVFGYEPHS+WPIG 
Sbjct  60    FIIIPIDDRSKYGLKLARYICKHAASYFPVTLHVEDYEAFKPDRSYVFGYEPHSVWPIGA  119

Query  789   VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
             V L   TGFMPLP IK L S A+FYTP +RH+W WLG++ A ++SF SLL SGYSCI+VP
Sbjct  120   VALVDLTGFMPLPNIKLLASNAIFYTPFLRHMWAWLGLASASRKSFSSLLESGYSCILVP  179

Query  609   GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
             GGVQE ++++HD E +FL SR+GFV+IA++ G PLVPVFCFGQS  Y WWKP   LY K 
Sbjct  180   GGVQETFHLKHDVEDVFLSSRRGFVRIAIEQGAPLVPVFCFGQSRAYKWWKPDCDLYFKL  239

Query  429   SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
             +RA++FTPI FWG +GS +P++ PIHVVVGKPI+V K+ QPT+E++  LH +F+EAL +L
Sbjct  240   ARAIRFTPICFWGVLGSPIPYRHPIHVVVGKPIQVTKSLQPTDEEIDELHGQFVEALKDL  299

Query  249   FEKHKKRLGYVDLQLKIM  196
             FE+HK   GY DLQL I+
Sbjct  300   FERHKAGAGYSDLQLNIL  317



>gb|ABK26256.1| unknown [Picea sitchensis]
Length=328

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 237/330 (72%), Gaps = 5/330 (2%)
 Frame = -3

Query  1182  GNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLM-MLAWLGVPPSIVVVVLASIIFLPF  1006
             G ++H    +     P P   + ++ +     +L+ ++ WLG      ++VL S+IFLP 
Sbjct  3     GEIRHEQILDR----PEPTRIVSSSQSRYGFRSLVALIMWLGTIHFDAILVLLSLIFLPS  58

Query  1005  TKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVF  826
             T A +V+G L +LM IP+D+NSKWG R AR++C  A+ YFP+ L VED+KAF+ NR+YVF
Sbjct  59    TWAFLVLGSLVILMVIPVDENSKWGNRLARFICYHATSYFPVTLIVEDMKAFDSNRSYVF  118

Query  825   GYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKS  646
               EPHS+ PIG+V L   TG+MPLP+IK L S+A+FYTP++RHIW+WLG+  A +++F  
Sbjct  119   AVEPHSVLPIGIVALCNHTGYMPLPRIKALASSAIFYTPILRHIWSWLGLVAASRKNFVK  178

Query  645   LLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYN  466
              L+SG+SCIV+PGGV+E +YME+  E  FL+ R GFV++A++ G PLVPVFCFGQ+  Y 
Sbjct  179   YLNSGFSCIVIPGGVREIFYMEYGTEVAFLRRRHGFVRVAIETGCPLVPVFCFGQTEAYR  238

Query  465   WWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAA  286
             WW+P  +LY   +RA++FTP++FWG  GS +P++RP+ VVVGKPIEV +N QP+ E++  
Sbjct  239   WWRPRGELYNHLARAIRFTPLVFWGKFGSPIPYRRPLQVVVGKPIEVKRNPQPSNEEVVE  298

Query  285   LHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +H++F+ AL +LFE+HK   GY D  L+++
Sbjct  299   IHTKFVSALQDLFERHKVPAGYEDTHLRVL  328



>gb|ABI83668.1| type 2 acyl-CoA diacylglycerol acyltransferase [Ricinus communis]
Length=340

 Score =   367 bits (942),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 226/296 (76%), Gaps = 0/296 (0%)
 Frame = -3

Query  1083  LMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCK  904
             L +  W+G     + ++  S +FL F   ++++G   +LMFIPID++SK G R  RY+C+
Sbjct  45    LALSIWIGSIHFNLFLLFISYLFLSFPTFLLIVGFFVVLMFIPIDEHSKLGRRLCRYVCR  104

Query  903   QASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTA  724
              A  +FP+ L+VED+ AF  +RAYVFGYEPHS++P+G+  LS     +PLPK+K L S A
Sbjct  105   HACSHFPVTLHVEDMNAFHSDRAYVFGYEPHSVFPLGVSVLSDHFAVLPLPKMKVLASNA  164

Query  723   VFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRK  544
             VF TPV+RHIWTW G++ A K++F +LL+SGYSCIV+PGGVQE +YM+H  E  FLK+R+
Sbjct  165   VFRTPVLRHIWTWCGLTSATKKNFTALLASGYSCIVIPGGVQETFYMKHGSEIAFLKARR  224

Query  543   GFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ  364
             GFV++AM+M  PLVPVFCFGQSNVY WWKP  +L++K +RA+KF+PI+FWG +GS +P Q
Sbjct  225   GFVRVAMEMVKPLVPVFCFGQSNVYKWWKPDGELFMKIARAIKFSPIVFWGVLGSHLPLQ  284

Query  363   RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             RP+HVVVGKPIEV +N QPT E+++ +  +F+ AL +LFE+HK R+GY DL L+I+
Sbjct  285   RPMHVVVGKPIEVKQNPQPTVEEVSEVQGQFVAALKDLFERHKARVGYADLTLEIL  340



>emb|CDY29021.1| BnaC07g32270D [Brassica napus]
Length=317

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 232/318 (73%), Gaps = 8/318 (3%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
              A    P+      +A S+ ++ + L         + +VL S+ FLP + +++V+GLL L
Sbjct  8     GAEDHIPSNIFHAVTAISICLSAIYLN--------LALVLISLFFLPPSLSLLVLGLLSL  59

Query  969   LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
              + IPID  SK+GL+ ARY+CK A+ YFP+ L+VED +AF+P+R+YVFGYEPHS+WP G 
Sbjct  60    FIIIPIDDRSKYGLKLARYICKHAASYFPVTLHVEDYEAFKPDRSYVFGYEPHSVWPFGA  119

Query  789   VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
             V L    GFMPLP IK L S A+FYTP +RH+W WLG++ A ++SF SLL SGYSCI+VP
Sbjct  120   VALVDLAGFMPLPNIKLLASNAIFYTPFLRHMWAWLGLASASRKSFSSLLESGYSCILVP  179

Query  609   GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
             GGVQE ++++HD E +FL SR+GFV+IAM+ G PLVPVFCFGQS  Y WWKP   LY K 
Sbjct  180   GGVQETFHLQHDVENVFLSSRRGFVRIAMEQGAPLVPVFCFGQSRAYKWWKPDCDLYFKL  239

Query  429   SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
             +RA++FTPI FWG  GS +P++ PIHVVVGKPI+V K+ QPT+E++  LH +F+EAL +L
Sbjct  240   ARAIRFTPICFWGVFGSPIPYRHPIHVVVGKPIQVAKSLQPTDEEIDELHGQFVEALKDL  299

Query  249   FEKHKKRLGYVDLQLKIM  196
             FE+HK   GY DLQL I+
Sbjct  300   FERHKAGAGYSDLQLNIL  317



>ref|XP_006599271.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X2 
[Glycine max]
Length=353

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 232/317 (73%), Gaps = 10/317 (3%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             +E  G  S N L   L +  WLG       +VL +I FL   KA ++ GLLF+LM IP+D
Sbjct  30    SEVFGDTSPNYLKTILALALWLGTIHFNAALVLFAIFFLSLHKAFLLFGLLFVLMVIPVD  89

Query  948   QNSKWGLRFAR----------YLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWP  799
             + SK+G + +R          Y+CK    YFP+ L+VED+KAF P+RAYVFGYEPHS+ P
Sbjct  90    EKSKFGRKLSRRKKKIWVCFRYICKHVCAYFPITLHVEDMKAFHPSRAYVFGYEPHSVLP  149

Query  798   IGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCI  619
             IG+V L+  T FMPLPKIK L S+A+FYTP +RHIWTWLG++P  K+ F SLL +GYSCI
Sbjct  150   IGVVALADNTCFMPLPKIKVLASSAIFYTPFLRHIWTWLGLTPVTKKRFTSLLDAGYSCI  209

Query  618   VVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
             ++PGGVQEA+ +EH  E  FLKSR+GFV+IAM+ G PLVPVFCFGQSNVY WWKP  KL 
Sbjct  210   LIPGGVQEAFLIEHGSEIAFLKSRRGFVRIAMEKGKPLVPVFCFGQSNVYKWWKPGGKLV  269

Query  438   LKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
             L F+RAVKF+P+ FWG  GS +PF+ P+HVVVG+PIE+ K  +PT E++A +HS+F+EAL
Sbjct  270   LNFARAVKFSPVYFWGIFGSPIPFKHPMHVVVGRPIELEKTPEPTPEEVAKIHSQFVEAL  329

Query  258   LELFEKHKKRLGYVDLQ  208
              +LFE+HK R GY +L+
Sbjct  330   QDLFERHKARAGYPNLE  346



>ref|XP_006656043.1| PREDICTED: diacylglycerol O-acyltransferase 2-like, partial [Oryza 
brachyantha]
Length=310

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/297 (57%), Positives = 220/297 (74%), Gaps = 0/297 (0%)
 Frame = -3

Query  1086  TLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLC  907
             T+ +  WLG     V++VLAS+   P   A +V+    L M  P++   +WG + AR++C
Sbjct  14    TVALALWLGGIHFNVLLVLASLFLFPLRVAALVVAFQLLFMLTPLNDKDEWGRKIARFIC  73

Query  906   KQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGST  727
             + A GYFP+ L+VED K F+PNRAYVFGYEPHS+ PIG+  L+   GFMPLPKIK L S+
Sbjct  74    RYAMGYFPISLHVEDYKCFDPNRAYVFGYEPHSVLPIGVAALADLVGFMPLPKIKVLASS  133

Query  726   AVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSR  547
             AVFYTP +R IWTWLG+ PA +++F+S L +GYSCI+VPGGVQE  +M+HD E  F+KSR
Sbjct  134   AVFYTPFLRQIWTWLGLIPATRKNFQSYLGAGYSCIIVPGGVQEILHMDHDSEVAFVKSR  193

Query  546   KGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPF  367
             KGFV+IAM+ G PLVPVFCFGQS  Y WW+PS KL++K +RAVKFTPI+FWG  G+ +PF
Sbjct  194   KGFVKIAMQSGCPLVPVFCFGQSYAYKWWRPSGKLFVKIARAVKFTPIIFWGRYGTPIPF  253

Query  366   QRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
               P+HVVVG PIEV KN QPT +++  +H +FI AL +LFEK+K R GY  L L+++
Sbjct  254   PTPMHVVVGIPIEVEKNPQPTIDEINEVHEQFIVALQDLFEKYKTRTGYPGLHLRVL  310



>gb|KCW56459.1| hypothetical protein EUGRSUZ_I02195 [Eucalyptus grandis]
Length=299

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 227/304 (75%), Gaps = 25/304 (8%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N+L M   ML WLG      ++VL S++FLP +KA++                     
Sbjct  21    SSNALHMVTAMLIWLGAIHFDAILVLLSLLFLPHSKALL---------------------  59

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
                 Y+CK A  YFP+ L+VED+ AF+PN+AYVFGYEPHS+ PIG++ L+ FTGFMPLPK
Sbjct  60    ----YICKHAYRYFPLTLHVEDMTAFDPNQAYVFGYEPHSVLPIGVIVLTDFTGFMPLPK  115

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             IK L STAVFYTP++RHIWTWLG++PA +++F SLL +GYSCI+VPGGVQE + MEHD E
Sbjct  116   IKVLASTAVFYTPILRHIWTWLGVTPATRKNFSSLLEAGYSCIIVPGGVQETFLMEHDFE  175

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FLK+RKGFV+IAM+   PLVPV CFGQS+VY WWKPS +++L+ SRA+KF PILFWG 
Sbjct  176   IAFLKARKGFVRIAMETSRPLVPVICFGQSHVYKWWKPSGRIFLRISRAIKFAPILFWGI  235

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             +G+ +PFQRP+HVV+GKPIE  +N  PT E++  +H RF+EA+ +LFE+HK RLGY DLQ
Sbjct  236   LGTPLPFQRPMHVVIGKPIEFKRNPNPTVEEVNEVHGRFVEAMRDLFERHKARLGYPDLQ  295

Query  207   LKIM  196
             LK++
Sbjct  296   LKLI  299



>gb|AHA57446.1| acyl CoA:diacylglycerol acyltransferases 2-3 [Linum usitatissimum]
Length=349

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 236/304 (78%), Gaps = 1/304 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             + S L +L+ L  WLG     V + + S +FLPF+  +M++G L +LMF+PI+ +S  G 
Sbjct  46    SGSKLKSLLSLGIWLGAIHFNVALGVVSFVFLPFSYFLMLLGFLLMLMFVPINDSSYLGR  105

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             RF RY+C+ A  YFP+ L+VED+ AF  +R+YVFGYEPHS+ PIG+V LS   GF+PLPK
Sbjct  106   RFCRYVCRHACSYFPITLHVEDMNAFRSDRSYVFGYEPHSVLPIGVVALSDHVGFLPLPK  165

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             IK L STAVFYTP +RHIWTW G++PA K++F SLL+SGYSCIVVPGGVQEA++MEH  E
Sbjct  166   IKVLASTAVFYTPFLRHIWTWCGLAPATKKNFTSLLASGYSCIVVPGGVQEAFHMEHGAE  225

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FL  RKGFV++A++MG+PLVPVF FGQS+VY WWKP  K +L F+RA++FTPI+FWG 
Sbjct  226   VAFLNKRKGFVRLAIEMGSPLVPVFSFGQSDVYKWWKPRGKWFLAFARAIRFTPIIFWGI  285

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             +G+ +PFQ+P+HVV+G+PIE  KN+QP+ E++A +H +F+ AL +LF++HK   G  DLQ
Sbjct  286   LGTPLPFQQPMHVVIGRPIEFKKNAQPSMEEVAEVHGKFVAALKDLFDRHKVEAGCADLQ  345

Query  207   LKIM  196
             LKI+
Sbjct  346   LKIL  349



>gb|AHA57445.1| acyl CoA:diacylglycerol acyltransferases 2-1 [Linum usitatissimum]
Length=354

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 235/304 (77%), Gaps = 1/304 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             + S L +L+ L  WLG     V +V+ S +FLPF+  +M++G L +L+FIPI+ +S  G 
Sbjct  51    SRSKLKSLLSLGIWLGAIHFNVALVVVSFVFLPFSYFLMLLGFLLMLVFIPINDSSYLGR  110

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             RF RY+C+ A  YFP+ L+VEDI AF  +R+YVFGYEPHS+ PIG+V LS   GF+PLPK
Sbjct  111   RFCRYVCRHACSYFPITLHVEDINAFRSDRSYVFGYEPHSVLPIGVVVLSDHVGFLPLPK  170

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             IK L STAVFYTP +RHIWTW G++PA K++F SLL+SGYS IVVPGGVQEA++MEH  E
Sbjct  171   IKVLASTAVFYTPFLRHIWTWCGLAPATKKNFTSLLASGYSRIVVPGGVQEAFHMEHGVE  230

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
               FL  RKGFV++A+++G+PLVPVF FGQS+VY WWKP  K +L F+R ++FTPI+FWG 
Sbjct  231   VAFLNKRKGFVRLAIEIGSPLVPVFSFGQSDVYKWWKPRGKWFLAFARVIRFTPIIFWGV  290

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             +G+ +PF++P+HVV+G+PIE  KN+QPT E++A +H +F+ AL +LF++HK   G  DLQ
Sbjct  291   LGTPLPFRQPMHVVIGRPIEFKKNAQPTMEEVAEVHGQFVAALKDLFDRHKVEAGCADLQ  350

Query  207   LKIM  196
             LKI+
Sbjct  351   LKIL  354



>ref|XP_007046426.1| Diacylglycerol acyltransferase family isoform 2 [Theobroma cacao]
 gb|EOX90583.1| Diacylglycerol acyltransferase family isoform 2 [Theobroma cacao]
Length=328

 Score =   364 bits (935),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 241/313 (77%), Gaps = 3/313 (1%)
 Frame = -3

Query  1125  EFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPI  952
             EF G     +N++   L M  WLG      +++L S +FLPF+K ++V GLL L M +PI
Sbjct  16    EFSGRHEFPSNTMHALLAMGIWLGAIHFNALLLLFSFLFLPFSKFLVVFGLLLLFMILPI  75

Query  951   DQNSKWGLRFA-RYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSA  775
             D  SK+G R + RY+CK A  YFP+ L+VEDI AF P+RAYVFG+EPHS+ PIG+V L+ 
Sbjct  76    DPYSKFGRRLSSRYICKHACSYFPITLHVEDIHAFHPDRAYVFGFEPHSVLPIGVVALAD  135

Query  774   FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQE  595
              TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPGGVQE
Sbjct  136   LTGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKKNFSSLLDAGYSCILVPGGVQE  195

Query  594   AYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVK  415
              ++ME   E  FL++R+GFV+IAM+MG+PLVPVFCFGQS+VY WWKP  K YL+FSRA+K
Sbjct  196   TFHMEPGSEIAFLRARRGFVRIAMEMGSPLVPVFCFGQSHVYKWWKPGGKFYLQFSRAIK  255

Query  414   FTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
             FTPI FWG  GS +P+Q P+HVVVGKPI+V KN QP  E++  +H RF+EAL +LFE+HK
Sbjct  256   FTPIFFWGIFGSPLPYQHPMHVVVGKPIDVKKNPQPIVEEVIEVHDRFVEALQDLFERHK  315

Query  234   KRLGYVDLQLKIM  196
              ++G+ DL LKI+
Sbjct  316   AQVGFADLPLKIL  328



>ref|XP_010317058.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X2 [Solanum 
lycopersicum]
Length=304

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 239/332 (72%), Gaps = 31/332 (9%)
 Frame = -3

Query  1191  EKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFL  1012
             ++  ++ H+ P+  +AP  TP EF G  S + L   L ++ WLG      ++++AS IFL
Sbjct  4     QEDNSIIHQQPAPPSAP--TPVEFKGANSGSLLHTVLALVLWLGSVHFNFLILIASFIFL  61

Query  1011  PFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAY  832
             PF+K ++VIG+L +L+ IPID+ + +G R ARY+CK A GYFP+HLYVEDIKAF+PN AY
Sbjct  62    PFSKTVIVIGILLILILIPIDEKNNFGRRLARYICKHACGYFPVHLYVEDIKAFDPNEAY  121

Query  831   VFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSF  652
             VFGYEPHS+WPIG V L+  TGFMPLPKIK L STAVFYTP +RHIWTWLG++P  +++F
Sbjct  122   VFGYEPHSVWPIGAVALADLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLAPITRKNF  181

Query  651   KSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNV  472
             KSLL+SGYSCI+VPGGVQE +YMEH  ET                              +
Sbjct  182   KSLLASGYSCIIVPGGVQETFYMEHGSETA-----------------------------I  212

Query  471   YNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQL  292
             Y WWKP  KLYL+FSR +KFTPILFWG +GS VPF+RP+HVVVG+PI + KN +PT E++
Sbjct  213   YKWWKPRGKLYLEFSRLIKFTPILFWGVLGSPVPFRRPMHVVVGRPIMLEKNPEPTVEEV  272

Query  291   AALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             + +HSRF EA+ ELFE+HKKR+GY DL L+++
Sbjct  273   SEVHSRFTEAMQELFERHKKRVGYEDLPLRVV  304



>gb|EEC80511.1| hypothetical protein OsI_22778 [Oryza sativa Indica Group]
Length=340

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 234/342 (68%), Gaps = 10/342 (3%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASAN-------SLLMTLMMLA-WLGVPPSIV  1042
             M   G +V   + + E+  P   A  +    A        SL  T + LA WLG     V
Sbjct  1     MGANGNDVVAAAAAGES--PMGAARVVAEGGATVFRGADYSLPRTTVALALWLGGIHFNV  58

Query  1041  VVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVED  862
             ++VLAS+   P   A MV+    L M IP++   K G + AR++C+ A GYFP+ L+VED
Sbjct  59    LLVLASLFLFPLRVAAMVVAFQLLFMLIPLNDKDKLGRKIARFICRYAMGYFPISLHVED  118

Query  861   IKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWL  682
              K F+PNRAYVFG+EPHS+ PIG+  L+   GFMPLPKIK L S+AVFYTP +R IWTWL
Sbjct  119   YKCFDPNRAYVFGFEPHSVLPIGVAALADLVGFMPLPKIKVLASSAVFYTPFLRQIWTWL  178

Query  681   GISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLV  502
             G+ PA +++F+S L +GYSCI+VPGGVQE  +M+HD E  FLKSRKGFV+IAM+ G PLV
Sbjct  179   GLIPATRKNFQSYLRAGYSCIIVPGGVQEILHMDHDSEIAFLKSRKGFVKIAMQSGCPLV  238

Query  501   PVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVG  322
             PVFCFGQS  Y WW+P  KL++K +RA+KFTPI+FWG  G+ +PF  P+HVVVG+PIEV 
Sbjct  239   PVFCFGQSYAYKWWRPKGKLFVKIARAIKFTPIVFWGRYGTPIPFPTPMHVVVGRPIEVE  298

Query  321   KNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             KNSQPT +++  +H +F  AL +LF+K+K   GY  L L+++
Sbjct  299   KNSQPTIDEINEVHEQFTVALQDLFDKYKTETGYPGLHLRVL  340



>ref|NP_001057530.1| Os06g0326700 [Oryza sativa Japonica Group]
 dbj|BAD33251.1| putative mono- or diacylglycerol acyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAD33505.1| putative mono- or diacylglycerol acyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF19444.1| Os06g0326700 [Oryza sativa Japonica Group]
Length=340

 Score =   362 bits (929),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 233/342 (68%), Gaps = 10/342 (3%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASAN-------SLLMTLMMLA-WLGVPPSIV  1042
             M   G +V   + + E+  P   A  +    A        SL  T + LA WLG     V
Sbjct  1     MGANGNDVVAAAAAGES--PMGAARVVAEGGATVFRGADYSLPRTTVALALWLGGIHFNV  58

Query  1041  VVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVED  862
              +VLAS+   P   A MV+    L M IP++   K G + AR++C+ A GYFP+ L+VED
Sbjct  59    FLVLASLFLFPLRVAAMVVAFQLLFMLIPLNDKDKLGRKIARFICRYAMGYFPISLHVED  118

Query  861   IKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWL  682
              K F+PNRAYVFG+EPHS+ PIG+  L+   GFMPLPKIK L S+AVFYTP +R IWTWL
Sbjct  119   YKCFDPNRAYVFGFEPHSVLPIGVAALADLVGFMPLPKIKVLASSAVFYTPFLRQIWTWL  178

Query  681   GISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLV  502
             G+ PA +++F+S L +GYSCI+VPGGVQE  +M+HD E  FLKSRKGFV+IAM+ G PLV
Sbjct  179   GLIPATRKNFQSYLGAGYSCIIVPGGVQEILHMDHDSEIAFLKSRKGFVKIAMQSGCPLV  238

Query  501   PVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVG  322
             PVFCFGQS  Y WW+P  KL++K +RA+KFTPI+FWG  G+ +PF  P+HVVVG+PIEV 
Sbjct  239   PVFCFGQSYAYKWWRPKGKLFVKIARAIKFTPIVFWGRYGTPIPFPTPMHVVVGRPIEVE  298

Query  321   KNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             KNSQPT +++  +H +F  AL +LF+K+K   GY  L L+++
Sbjct  299   KNSQPTIDEINEVHEQFTVALQDLFDKYKTETGYPGLHLRVL  340



>ref|XP_004953677.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Setaria italica]
Length=335

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 1/311 (0%)
 Frame = -3

Query  1128  AEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             A F GTA A  L  T+ +  WLG     V +VLAS+   P   A +V+      MF+P++
Sbjct  26    AVFRGTAYA-PLRTTVALALWLGAIHFNVFLVLASLFLFPRRVAALVLATQLFFMFVPVN  84

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
               S+ G + AR++ +   GYFP+ L++ED  AF+P+RAYVFGYEPHS+ PI +  L    
Sbjct  85    DKSRLGRKIARFISRYVIGYFPVTLHLEDYDAFDPSRAYVFGYEPHSVLPIAVGILGDLV  144

Query  768   GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
             GFMPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF S L +GYSCI+VPGGVQE  
Sbjct  145   GFMPLPKMKILASSAVFYTPFLRQIWTWLGLAPASRKSFYSCLGAGYSCIIVPGGVQEIL  204

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
             +M+HD E  FLKSRKGFV+IA++MG P+VPVF FGQS VY WW+PS KL +K +RA+KF+
Sbjct  205   HMDHDSEVAFLKSRKGFVKIAIEMGCPVVPVFAFGQSYVYKWWRPSGKLIVKIARAIKFS  264

Query  408   PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
             PI+FWG +G+ +PF  P+HVVVG+PIEV KN QPT +++  +H +F+ A+ ELFEK+K R
Sbjct  265   PIIFWGKLGTPIPFATPMHVVVGRPIEVVKNPQPTTDEINEVHKQFVAAMQELFEKYKAR  324

Query  228   LGYVDLQLKIM  196
              GY DLQL+++
Sbjct  325   TGYPDLQLRVL  335



>gb|KDP24913.1| hypothetical protein JCGZ_24291 [Jatropha curcas]
Length=335

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 208/258 (81%), Gaps = 0/258 (0%)
 Frame = -3

Query  969  LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
             M IPI+  S+ G R  RY+C+ A  +FP+ L+VEDI AF  +RAYVFGYEPHS++P+G+
Sbjct  78   FMIIPINDGSRLGRRLCRYICRHACSHFPITLHVEDINAFRSDRAYVFGYEPHSVFPLGV  137

Query  789  VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
            V L+   GF+PLPKIK L S+AVFYTP +RHIW+W G++PA K++F SLL +GYSCIVVP
Sbjct  138  VVLADHVGFLPLPKIKVLASSAVFYTPFLRHIWSWCGLTPATKKNFTSLLDAGYSCIVVP  197

Query  609  GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
            GGVQE +YM+H  E  FL  R+GF++IAM+MG PLVPVFC+GQS+ Y WWKP  KL+++F
Sbjct  198  GGVQETFYMKHGTEIAFLNKRRGFIRIAMEMGKPLVPVFCYGQSHAYKWWKPDGKLFMQF  257

Query  429  SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
            +RA+KFTPI+FWG +GS +PFQ P+HVVVGKPIE+ KN QPT E++A +H +F+ +L +L
Sbjct  258  ARAIKFTPIVFWGILGSPLPFQHPMHVVVGKPIELKKNPQPTMEEVAEVHRQFVASLKDL  317

Query  249  FEKHKKRLGYVDLQLKIM  196
            FE+HK R+GY DL+L+I+
Sbjct  318  FERHKARVGYSDLKLEIL  335



>ref|XP_009401347.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=325

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 239/334 (72%), Gaps = 9/334 (3%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             M+E  GN +HR          TP  F GT   +    T+ +  WLG       +VLA+++
Sbjct  1     MDE--GNGEHRKGGE------TPVVFQGT-EYSPFRTTVALALWLGGIHFNAALVLATLL  51

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
              LP   A  V G L  LM IP+D  SK G R +RY+CK ASGYFP+ L+VEDIKAF P++
Sbjct  52    LLPLRLAAAVFGFLLFLMLIPVDHKSKLGSRLSRYICKYASGYFPVTLHVEDIKAFNPDQ  111

Query  837   AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
             AYVFGYEPHS+ PIG+  L+  TGFMPLPK+K L S+AVFYTP +RHIWTWLG+ PA ++
Sbjct  112   AYVFGYEPHSVLPIGVCALANHTGFMPLPKVKVLASSAVFYTPFLRHIWTWLGLVPASRK  171

Query  657   SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             +F + L +GYSCI+VPGGVQE  +M H  E  FLKSRKGFV+IAM+ G P+VPVFCFGQS
Sbjct  172   NFYAYLEAGYSCIIVPGGVQEMLHMNHFSEVAFLKSRKGFVRIAMETGRPIVPVFCFGQS  231

Query  477   NVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEE  298
             +VY WWKP  K ++  +RA+KFTPI+FWG  G+ +PF+ P+HVVVG+PIE+ KN +PT +
Sbjct  232   HVYRWWKPGGKFFVPIARALKFTPIVFWGRFGTPIPFRHPMHVVVGRPIELMKNPKPTTD  291

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             ++  +H++F+ A  ELFEK+K ++GY DLQ+ I+
Sbjct  292   EINEVHAQFVHAFQELFEKYKYKVGYPDLQVSIL  325



>gb|AEZ56254.1| acyl-CoA:diacylglycerol acyltransferase 2 [Jatropha curcas]
 gb|AFV61670.1| acyl-CoA: diacylglycerol acyltransferase 2 [Jatropha curcas]
Length=352

 Score =   360 bits (923),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 208/258 (81%), Gaps = 0/258 (0%)
 Frame = -3

Query  969  LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
             M IPI+  S+ G R  RY+C+ A  +FP+ L+VEDI AF  +RAYVFGYEPHS++P+G+
Sbjct  95   FMIIPINDGSRLGRRLCRYICRHACSHFPITLHVEDINAFRSDRAYVFGYEPHSVFPLGV  154

Query  789  VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
            V L+   GF+PLPKIK L S+AVFYTP +RHIW+W G++PA K++F SLL +GYSCIVVP
Sbjct  155  VVLADHVGFLPLPKIKVLASSAVFYTPFLRHIWSWCGLTPATKKNFTSLLDAGYSCIVVP  214

Query  609  GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
            GGVQE +YM+H  E  FL  R+GF++IAM+MG PLVPVFC+GQS+ Y WWKP  KL+++F
Sbjct  215  GGVQETFYMKHGTEIAFLNKRRGFIRIAMEMGKPLVPVFCYGQSHAYKWWKPDGKLFMQF  274

Query  429  SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
            +RA+KFTPI+FWG +GS +PFQ P+HVVVGKPIE+ KN QPT E++A +H +F+ +L +L
Sbjct  275  ARAIKFTPIVFWGILGSPLPFQHPMHVVVGKPIELKKNPQPTMEEVAEVHRQFVASLKDL  334

Query  249  FEKHKKRLGYVDLQLKIM  196
            FE+HK R+GY DL+L+I+
Sbjct  335  FERHKARVGYSDLKLEIL  352



>ref|XP_009369767.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Pyrus x bretschneideri]
Length=325

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 225/303 (74%), Gaps = 0/303 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N+L   + +  WLG     + +VL +I FLPF+KA++   LL L + IPID  SK G  
Sbjct  23    SNALHSFVALGIWLGTIHFNMALVLFTIFFLPFSKALLAFALLVLFVIIPIDDKSKIGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ L+ EDI AF+PN +YVFGYEPHS+  IG+V L+  TGF+PL KI
Sbjct  83    LSRYICKHACAYFPVTLHAEDINAFDPNHSYVFGYEPHSVLAIGVVALADLTGFLPLTKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP MRHIWTWLG SPA + +F S LS+GYSCI+VPGGV+E +YME   E 
Sbjct  143   KTLASSAVFYTPFMRHIWTWLGFSPATRSNFISHLSAGYSCIIVPGGVRETFYMEPGTEV  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              +LKSR+GFV+IAM++G P+VPVFCFGQSNVY WW+PS  L  K +RA+KF P+ FWG  
Sbjct  203   AYLKSRRGFVRIAMELGHPVVPVFCFGQSNVYKWWRPSGDLVWKIARALKFPPVFFWGIF  262

Query  384   GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQL  205
             G+ VP+  P+HVVVGKPI++ K  QPT E++  +H +F+ AL +LFE+HK R+G+ +LQL
Sbjct  263   GTPVPYSHPMHVVVGKPIDLKKTPQPTMEEVNEVHGQFVAALQDLFERHKARVGHANLQL  322

Query  204   KIM  196
             KI+
Sbjct  323   KII  325



>ref|XP_003570227.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Brachypodium 
distachyon]
Length=331

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 222/306 (73%), Gaps = 1/306 (0%)
 Frame = -3

Query  1110  ASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             A+A S L T + LA WLG     VV+VLAS+  LP   A MV+G     M +P+   S+ 
Sbjct  26    ATAYSPLRTTVALALWLGGIHLNVVLVLASLFLLPRRIAAMVLGTQLFFMLVPVSDKSRL  85

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + AR++ K   GYFP+ L+VED  AF+P RAYVFGYEPHS+ PIG+  L    GFMPL
Sbjct  86    GRKIARFISKYVIGYFPVTLHVEDYNAFDPKRAYVFGYEPHSVLPIGLGALLDLVGFMPL  145

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             PKIK L S+AVFYTP +R IWTWLG+ PA ++SF S L +GY+CI+VPGGVQE  +M+HD
Sbjct  146   PKIKVLASSAVFYTPFLRQIWTWLGLVPASRKSFYSYLGAGYTCIIVPGGVQEMLHMDHD  205

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E  FLKSRKGFV+IAM+ G+PLVPVFCFGQS V+ WW+P  KL +K +RA+KFTPI+FW
Sbjct  206   SEVAFLKSRKGFVKIAMETGSPLVPVFCFGQSFVFKWWRPGGKLIVKIARAIKFTPIVFW  265

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  G+ +PF  P+H+VVG+PIEV KN QP  +++  +H +F+ AL ELFEK+K + GY  
Sbjct  266   GKFGTPIPFATPLHLVVGRPIEVKKNPQPNYDEINEVHEQFVVALQELFEKYKTKAGYDK  325

Query  213   LQLKIM  196
             L L+++
Sbjct  326   LHLRVL  331



>gb|KHG14544.1| Diacylglycerol O-acyltransferase 2 -like protein [Gossypium arboreum]
Length=330

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 236/328 (72%), Gaps = 2/328 (1%)
 Frame = -3

Query  1173  QHRSPSNEAAPPPTPAEFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTK  1000
             + ++ +    P P   +F G     +N L  TL    W+G     V ++L S +FLPF+K
Sbjct  3     EDKAETQAFTPGPGYRQFKGRDEFPSNILHGTLACAIWIGSMHFNVSLLLFSFLFLPFSK  62

Query  999   AIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
              ++V+G+L + + +PID NSK+GLR ARY+C+  S YFP  L+VEDI  F P+RAYV GY
Sbjct  63    FLLVVGVLLIFVVLPIDHNSKFGLRLARYICQHMSSYFPATLHVEDINDFHPDRAYVLGY  122

Query  819   EPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
              PHS+ PIG+VTL+  TGFMPLPK+K L S+ VFYTP +RH+WTWLG SPA +++F SLL
Sbjct  123   APHSVLPIGVVTLAERTGFMPLPKLKCLTSSPVFYTPFLRHLWTWLGASPATRKNFCSLL  182

Query  639   SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
              +GY+CIVVPGGVQE + M HD E  FLKSR+GFV+IA++ G PLVPVF FGQS  + WW
Sbjct  183   EAGYTCIVVPGGVQETFLMRHDSEVAFLKSRRGFVRIAIEKGCPLVPVFAFGQSYAFKWW  242

Query  459   KPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALH  280
             KP SK  L+ SRA+KF P+LFWG  G+ +P+Q PI+VVVGKPI V +N QPT E++  +H
Sbjct  243   KPRSKFLLQLSRAIKFVPMLFWGSFGTPIPYQHPINVVVGKPIYVKRNPQPTTEEVLEVH  302

Query  279   SRFIEALLELFEKHKKRLGYVDLQLKIM  196
              +F++AL +LFE+HK R+G+ D  L I+
Sbjct  303   GQFVKALQDLFERHKGRVGHADQSLTIL  330



>gb|AEQ94266.1| diglyceride acyltransferase 2 [Vernicia montana]
Length=322

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 230/307 (75%), Gaps = 4/307 (1%)
 Frame = -3

Query  1116  GTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNS  940
             G     +++ +++ LA WLG    I+ +V +S IFLPF+K ++VIGLL   M IPI+  S
Sbjct  18    GEIYPTNIIQSVLALAIWLGSFHFILFLV-SSSIFLPFSKFLLVIGLLLFFMVIPINDRS  76

Query  939   KWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFM  760
             K G     Y+ +    YFP+ L+VEDI AF  +RAYVFGYEPHS++PIG++ LS   GF+
Sbjct  77    KLGQCLFSYISRHVCSYFPITLHVEDINAFRSDRAYVFGYEPHSVFPIGVMILS--LGFI  134

Query  759   PLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYME  580
             PLP IK L S+AVFYTP +RHIW+W G++PA +++F SLLSSG+SCI+VPGGVQE +Y++
Sbjct  135   PLPNIKFLASSAVFYTPFLRHIWSWCGLTPATRKNFVSLLSSGFSCILVPGGVQETFYLK  194

Query  579   HDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPIL  400
              D E  FLK+R+GF++IAM+ GT LVPVFCFGQ++ + WWKP  +L++K +RA+KFTP +
Sbjct  195   QDSEIAFLKARRGFIRIAMQRGTSLVPVFCFGQTHTFKWWKPDGELFMKIARAIKFTPTI  254

Query  399   FWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
             FWG +G+ +PFQ P+HVVVG+PIEV  N QPT E++A +   FI +L  LFE+HK RLGY
Sbjct  255   FWGVLGTPLPFQNPMHVVVGRPIEVKPNPQPTAEEVAEVQREFIASLKNLFERHKARLGY  314

Query  219   VDLQLKI  199
              DL+L+I
Sbjct  315   SDLKLEI  321



>gb|ABC94473.1| type 2 diacylglycerol acyltransferase [Vernicia fordii]
 gb|ABC94474.1| type 2 diacylglycerol acyltransferase [Vernicia fordii]
Length=322

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 229/307 (75%), Gaps = 4/307 (1%)
 Frame = -3

Query  1116  GTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNS  940
             G     ++  +++ LA WLG    I+ +V +S IFLPF+K ++VIGLL   M IPI+  S
Sbjct  18    GEIYPTNIFQSVLALAIWLGSFHFILFLV-SSSIFLPFSKFLLVIGLLLFFMVIPINDRS  76

Query  939   KWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFM  760
             K G     Y+ +    YFP+ L+VEDI AF  +RAYVFGYEPHS++PIG++ LS   G +
Sbjct  77    KLGQCLFSYISRHVCSYFPITLHVEDINAFRSDRAYVFGYEPHSVFPIGVMILS--LGLI  134

Query  759   PLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYME  580
             PLP IK L S+AVFYTP +RHIW+W G++PA +++F SLLSSGYSCI+VPGGVQE +YM+
Sbjct  135   PLPNIKFLASSAVFYTPFLRHIWSWCGLTPATRKNFVSLLSSGYSCILVPGGVQETFYMK  194

Query  579   HDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPIL  400
              D E  FLK+R+GF++IAM+ GTPLVPVFCFGQ + + WWKP  +L++K +RA+KFTP +
Sbjct  195   QDSEIAFLKARRGFIRIAMQTGTPLVPVFCFGQMHTFKWWKPDGELFMKIARAIKFTPTI  254

Query  399   FWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
             FWG +G+ +PF+ P+HVVVG+PIEV +N QPT E++A +   FI +L  LFE+HK R+GY
Sbjct  255   FWGVLGTPLPFKNPMHVVVGRPIEVKQNPQPTAEEVAEVQREFIASLKNLFERHKARVGY  314

Query  219   VDLQLKI  199
              DL+L+I
Sbjct  315   SDLKLEI  321



>ref|XP_009387694.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=336

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 231/313 (74%), Gaps = 3/313 (1%)
 Frame = -3

Query  1131  PAEFIGTASANSLLMTLM-MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIP  955
             PA F GT    SLL T++ ++ WLG     V +VL +++FLP   A  V G L   M IP
Sbjct  26    PAVFQGTDY--SLLQTIVALILWLGAIHLNVALVLVALLFLPARLAAAVFGFLLFFMVIP  83

Query  954   IDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSA  775
             ++  ++ G R +RY+CK A GYFP+ L+VEDI AF+ ++AYVFGYEPHS+ PI +  L+ 
Sbjct  84    LNDRNRLGRRLSRYICKSACGYFPITLHVEDITAFDSDQAYVFGYEPHSVLPIALCALAD  143

Query  774   FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQE  595
               GFMPLPKIK L S+AVFYTP +R IWTW+G+ PA +++F   L +GYSCI+VPGGVQE
Sbjct  144   HAGFMPLPKIKVLASSAVFYTPFLRQIWTWMGLIPASRKNFYEYLEAGYSCIIVPGGVQE  203

Query  594   AYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVK  415
              +++  D E  FLK+RKGFV+IAM+ G P+VPVFCFGQS VY WWKP   L+++ +R VK
Sbjct  204   TFHLNRDTEVAFLKTRKGFVRIAMETGRPIVPVFCFGQSYVYQWWKPGGNLFVQIARVVK  263

Query  414   FTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
             FTPI+FWG  G+ +PF+ P+HVVVG+PIE+ KN +P+ +++  +H++F++AL ELFEK+K
Sbjct  264   FTPIVFWGRFGTPIPFRHPLHVVVGRPIELMKNQEPSADEVNEVHAQFVDALQELFEKYK  323

Query  234   KRLGYVDLQLKIM  196
              R GY DLQL+I+
Sbjct  324   SRFGYPDLQLRIL  336



>gb|KHG28933.1| Diacylglycerol O-acyltransferase 2 -like protein [Gossypium arboreum]
Length=319

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 232/312 (74%), Gaps = 10/312 (3%)
 Frame = -3

Query  1125  EFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPI  952
             EF G     +N L   L +  W+G       ++L S +FLPF+K +M +G L + M +PI
Sbjct  16    EFRGKDEFPSNMLHGILAIAMWIGSVHFDFFLLLFSFLFLPFSKFLMALGFLLIFMVLPI  75

Query  951   DQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAF  772
             D   K+GL+         S YFP+ LYVED  AF P+RAYVFGYEPHS+ PIG+VTL+  
Sbjct  76    DPYGKFGLKL--------SSYFPITLYVEDFNAFNPDRAYVFGYEPHSVLPIGVVTLAGH  127

Query  771   TGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEA  592
             TGFMPLPKIK L S+AVF+TP +RHIWTWL ++PA ++ F SLL +GYSCIVVPGGVQE 
Sbjct  128   TGFMPLPKIKVLASSAVFHTPFLRHIWTWLDVAPASRKKFYSLLDAGYSCIVVPGGVQET  187

Query  591   YYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKF  412
             ++M+HD E  FLK+R+GFV+IA++MG PLVPVF FGQS VY+WWKP  K +L+ SRA+KF
Sbjct  188   FHMDHDSEIAFLKARRGFVRIAIEMGCPLVPVFAFGQSRVYDWWKPGGKFFLQLSRALKF  247

Query  411   TPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKK  232
             TP++FWG  G+ +P++RP+HVVVGKPIE+ +N +PT E++  +H +F++AL +LFE+HK 
Sbjct  248   TPMIFWGIFGTHLPYRRPMHVVVGKPIELKQNPKPTAEEVQEVHDQFVKALEDLFERHKA  307

Query  231   RLGYVDLQLKIM  196
             R+GY DL LKI+
Sbjct  308   RVGYADLPLKIL  319



>ref|XP_010932136.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Elaeis guineensis]
Length=367

 Score =   355 bits (911),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 207/257 (81%), Gaps = 0/257 (0%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            M IP+D+NSKWG + +R++CK A GYFP+ LYVEDIK F+PN+AYVF +EPHS+ PIG+V
Sbjct  111  MAIPLDENSKWGRKLSRWICKYAVGYFPVTLYVEDIKVFDPNQAYVFAFEPHSVLPIGVV  170

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPL K+K L S+AVFYTP +RH+WTWLG+  A +++F + L +GYSCIVVPG
Sbjct  171  ALADLTGFMPLTKVKVLASSAVFYTPFLRHLWTWLGLVSASRKNFYAYLEAGYSCIVVPG  230

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            GVQE  +M+HD E  FLK+RKGFV+IAM+ G P+VPVFCFGQS VY WWKPS KL++  +
Sbjct  231  GVQEMLHMDHDSEVAFLKARKGFVRIAMETGRPIVPVFCFGQSYVYKWWKPSGKLFVWIA  290

Query  426  RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            RA+KFTPI+FWG  GS +PF+ P+HVVVGKPI + +N +PT E++  +H++F+ A  ELF
Sbjct  291  RAIKFTPIVFWGRFGSPIPFRHPMHVVVGKPIGLKRNPKPTIEEINEVHAQFVAAFQELF  350

Query  246  EKHKKRLGYVDLQLKIM  196
            EKHK R GY DL+L+++
Sbjct  351  EKHKTRAGYPDLRLRVL  367



>ref|XP_003563898.2| PREDICTED: diacylglycerol O-acyltransferase 2-like [Brachypodium 
distachyon]
Length=341

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/314 (53%), Positives = 223/314 (71%), Gaps = 1/314 (0%)
 Frame = -3

Query  1134  TPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFI  958
             T A  +   +  SL  T+  L  WLG     V+++LAS+   P   A +V+ L    M I
Sbjct  28    TAAAMVFRGTNYSLPRTIAALVLWLGGIHFNVLLILASLFLFPLRVAALVVALQLFFMVI  87

Query  957   PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLS  778
             P++   KWG + AR++C+ A GYFP+ L+VED +AF+PNRAYVFGYEPHS+ PIG+  L+
Sbjct  88    PLNDEDKWGRKIARFICRYAMGYFPISLHVEDYEAFDPNRAYVFGYEPHSVLPIGVAALA  147

Query  777   AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQ  598
                GFMPLPK+K L S+AVFYTP +R IWTWLG+  A +++F S L +GYSC+VVPGG+Q
Sbjct  148   DHVGFMPLPKLKVLASSAVFYTPFLRQIWTWLGLIAATRKNFYSYLGAGYSCVVVPGGIQ  207

Query  597   EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAV  418
             E  +M+HD E  FLKSRKGFV+IAM+ G PLVPVFCFGQS  Y WW+P  KL++  +RA+
Sbjct  208   EILHMDHDSEVAFLKSRKGFVKIAMQSGCPLVPVFCFGQSYAYRWWRPGGKLFVNIARAL  267

Query  417   KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             KFTPI+FWG  G+ + F  P+HVVVG+PIE+ KN  PT +++  +H +F+ AL ELFEK+
Sbjct  268   KFTPIIFWGRYGTPIAFSTPMHVVVGRPIELKKNPLPTIDEINEVHGQFLTALQELFEKY  327

Query  237   KKRLGYVDLQLKIM  196
             K + GY  L L+++
Sbjct  328   KTKTGYPSLHLRVL  341



>ref|XP_008802155.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Phoenix dactylifera]
Length=365

 Score =   353 bits (907),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 211/258 (82%), Gaps = 0/258 (0%)
 Frame = -3

Query  969  LMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM  790
             M IP+++ SKWG + ++++CK A GYFP++L+VEDIK F+PN+AYVF +EPHS+ PIG+
Sbjct  108  FMAIPLNEKSKWGRKLSKWICKYAVGYFPVNLHVEDIKVFDPNQAYVFAFEPHSVLPIGV  167

Query  789  VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVP  610
            V L+  TGFMPLPK+K L S+AVFYTP +RH+WTW+G+  A +++F + L +GYSCIVVP
Sbjct  168  VALADHTGFMPLPKVKVLASSAVFYTPFLRHLWTWMGLVSASRKNFYAYLEAGYSCIVVP  227

Query  609  GGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
            GGVQE  +M+HD E  F+K+RKGFV+IAM+ G P+VPVFCFGQS +Y WWKPS KL+++F
Sbjct  228  GGVQEMLHMDHDSEVAFVKARKGFVRIAMETGRPIVPVFCFGQSYIYKWWKPSGKLFVQF  287

Query  429  SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
            +RA+KFTPI+FWG  GS +PF+ P+HVVVGKPIE+ +N +PT E++  +H+ F+ AL EL
Sbjct  288  ARAIKFTPIVFWGRFGSPIPFRHPMHVVVGKPIELKRNPKPTIEEINEVHALFVVALQEL  347

Query  249  FEKHKKRLGYVDLQLKIM  196
            FEKHK R GY DL+L+++
Sbjct  348  FEKHKIRAGYPDLRLRVL  365



>ref|XP_010270587.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X2 
[Nelumbo nucifera]
Length=331

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 234/335 (70%), Gaps = 7/335 (2%)
 Frame = -3

Query  1200  YMEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASI  1021
             +M E  G+   R  S  A   PT    +     +SLL  +  LA L  P  +VV ++   
Sbjct  4     FMPETIGD---REKSVNAGDEPT----VIQRKESSLLQMVTALALLLGPLHLVVALIFMA  56

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
              FLP   A  +  LL     +PI+  SK G   A Y+C     YFP+ L+VEDIKAFE  
Sbjct  57    CFLPNYLAFSIFVLLLFFTVLPINDESKLGRTLAWYICYHCCAYFPVTLHVEDIKAFESK  116

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFGYEPHS++PIG+V+L  FT FM LPKIK L S+A+FYTP +RHIWTWLGI+PA K
Sbjct  117   RAYVFGYEPHSVFPIGVVSLVDFTEFMHLPKIKLLASSAIFYTPFLRHIWTWLGITPATK  176

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F SLL +G+SCIVVPGGVQEA  M+H  E +F+K+RKGF++IA++ G PLVPVFCFGQ
Sbjct  177   RNFTSLLEAGHSCIVVPGGVQEACLMKHGSEIVFVKARKGFIRIAIQTGRPLVPVFCFGQ  236

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             ++V+ WW+PS KLY +  R +KFTPI+FWG  GS +P++RP+HVVVG+PI++ +N QPT 
Sbjct  237   TDVFKWWQPSGKLYRRLCRVIKFTPIIFWGTFGSPLPYRRPMHVVVGRPIKLKRNPQPTM  296

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             E++  +HS+F+ AL ELF KHK R+G+ D QL ++
Sbjct  297   EEVNEVHSQFVAALEELFAKHKARVGHADRQLTVL  331



>gb|ACO35365.1| diacylglycerol acyltransferase [Elaeis oleifera]
Length=327

 Score =   352 bits (902),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 205/257 (80%), Gaps = 0/257 (0%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            M IP+D+NSKWG + +R++CK A GYFP+ LYVEDIK F+PN+AYVF +EPHS+ PIG+V
Sbjct  71   MAIPLDENSKWGRKLSRWICKYAVGYFPVTLYVEDIKVFDPNQAYVFAFEPHSVLPIGVV  130

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPL K+K L S+AVFYTP +RH+WTWLG+  A +++F + L +GYSCIVVPG
Sbjct  131  ALADLTGFMPLTKVKVLASSAVFYTPFLRHLWTWLGLVSASRKNFYAYLEAGYSCIVVPG  190

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            GVQE  +M+HD E  FLK+RKGFV+IAM+ G P+VPVFCFGQS VY WWKPS KL++  +
Sbjct  191  GVQEMLHMDHDSEVAFLKARKGFVRIAMETGRPIVPVFCFGQSYVYKWWKPSGKLFVWIA  250

Query  426  RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            RA+KFTPI+FWG  GS +PFQ P+ VVVGKPI + +N +PT E++  +H++F+ A  ELF
Sbjct  251  RAIKFTPIVFWGRFGSPIPFQHPMQVVVGKPIGLKRNPKPTIEEINEVHAQFVAAFQELF  310

Query  246  EKHKKRLGYVDLQLKIM  196
            EKHK R GY D +L+++
Sbjct  311  EKHKTRAGYPDFRLRVL  327



>ref|NP_001150174.1| diacylglycerol O-acyltransferase 1 [Zea mays]
 gb|ACG38122.1| diacylglycerol O-acyltransferase 1 [Zea mays]
Length=333

 Score =   352 bits (902),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 222/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN  943
             F GTA  + L  T+ +  WLG       +VLAS+   P   A +V+      MF+P+   
Sbjct  26    FRGTAY-SPLRTTVALALWLGAIHFNAFLVLASLFLFPRRVAALVLATQLFFMFLPLSDK  84

Query  942   SKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGF  763
             S+ G + AR++ K   GYFP+ L+VED  AF+PNRAYVFGYEPHS+ PI +  L    GF
Sbjct  85    SRLGRKIARFISKYVIGYFPVTLHVEDYGAFDPNRAYVFGYEPHSVLPIAVGILGDLVGF  144

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
             MPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF S L +GYSCI+VPGGVQE  +M
Sbjct  145   MPLPKMKILASSAVFYTPFLRQIWTWLGLAPASRKSFYSYLGAGYSCIIVPGGVQEILHM  204

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
             +HD E  FLK RKGFV+IA++MG P+VPVF FGQS VY WW+P  KL +K +RA+KF+PI
Sbjct  205   DHDSEVAFLKPRKGFVKIAIEMGCPVVPVFAFGQSYVYKWWRPGGKLIVKIARAIKFSPI  264

Query  402   LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             +FWG +G+ +PF  P+HV+VG+PIEV KN QPT +++  +H +F+ A+ +LFEK+K R G
Sbjct  265   IFWGKLGTPIPFATPMHVIVGRPIEVVKNPQPTIDEINQVHGQFVVAMQDLFEKYKSRTG  324

Query  222   YVDLQLKIM  196
             Y DLQL+++
Sbjct  325   YPDLQLRVL  333



>ref|XP_010550516.1| PREDICTED: LOW QUALITY PROTEIN: diacylglycerol O-acyltransferase 
2 [Tarenaya hassleriana]
Length=323

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 236/319 (74%), Gaps = 6/319 (2%)
 Frame = -3

Query  1134  TPAEFIGTAS-ANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMF  961
             +P EF G     ++L+ +L+ +  WLG     V ++L SI FL     ++V+ LL L MF
Sbjct  5     SPREFRGEDEFPSNLIHSLVAVGIWLGAIHFNVALLLFSIFFLSPPLFLLVLALLLLFMF  64

Query  960   IPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAF-EPNR---AYVFGYEPHSIWPIG  793
             IPID+ SK+G   +RY+CK +   F    ++E++  F EPN      VFGYEPHS+ P+G
Sbjct  65    IPIDERSKFGRMVSRYICKHSCLRFSPSFFLEEVYLFMEPNLPXWDTVFGYEPHSVLPVG  124

Query  792   MVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
             +V L+  TGFMPLPKIK L STAVFYTP +RHIWTWLG++PA +++F SLL +GYSCI+V
Sbjct  125   VVALADLTGFMPLPKIKVLASTAVFYTPFLRHIWTWLGLAPASRRNFSSLLETGYSCIIV  184

Query  612   PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLK  433
             PGGVQE ++M+H  ET+FL SR+GFV+IA++ G PLVPVFCFGQS VY WWKPS KLYLK
Sbjct  185   PGGVQETFHMQHGVETVFLSSRRGFVRIAIQQGRPLVPVFCFGQSRVYKWWKPSGKLYLK  244

Query  432   FSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLE  253
             FSRA+KFTPI FWG  GS +P++ P+HVVVG PIEV KN  PT+E++A LH +F+EAL +
Sbjct  245   FSRAIKFTPICFWGVFGSPLPYRHPMHVVVGSPIEVTKNPHPTDEEVAKLHGQFVEALKD  304

Query  252   LFEKHKKRLGYVDLQLKIM  196
             LFE HK R GY DL+LKI+
Sbjct  305   LFEGHKARAGYPDLELKIL  323



>gb|AFW63609.1| diacylglycerol O-acyltransferase 1 [Zea mays]
Length=437

 Score =   353 bits (906),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 222/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN  943
             F GTA  + L  T+ +  WLG       +VLAS+   P   A +V+      MF+P+   
Sbjct  130   FRGTAY-SPLRTTVALALWLGAIHFNAFLVLASLFLFPRRVAALVLATQLFFMFLPLSDK  188

Query  942   SKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGF  763
             S+ G + AR++ K   GYFP+ L+VED  AF+PNRAYVFGYEPHS+ PI +  L    GF
Sbjct  189   SRLGRKIARFISKYVIGYFPVTLHVEDYGAFDPNRAYVFGYEPHSVLPIAVGILGDLVGF  248

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
             MPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF S L +GYSCI+VPGGVQE  +M
Sbjct  249   MPLPKMKILASSAVFYTPFLRQIWTWLGLAPASRKSFYSYLGAGYSCIIVPGGVQEILHM  308

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
             +HD E  FLK RKGFV+IA++MG P+VPVF FGQS VY WW+P  KL +K +RA+KF+PI
Sbjct  309   DHDSEVAFLKPRKGFVKIAIEMGCPVVPVFAFGQSYVYKWWRPGGKLIVKIARAIKFSPI  368

Query  402   LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             +FWG +G+ +PF  P+HV+VG+PIEV KN QPT +++  +H +F+ A+ +LFEK+K R G
Sbjct  369   IFWGKLGTPIPFATPMHVIVGRPIEVVKNPQPTIDEINQVHGQFVVAMQDLFEKYKSRTG  428

Query  222   YVDLQLKIM  196
             Y DLQL+++
Sbjct  429   YPDLQLRVL  437



>gb|ACG40288.1| diacylglycerol O-acyltransferase 1 [Zea mays]
Length=333

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 221/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN  943
             F GTA  + L  T+ +  WLG       +VLAS+   P   A +V+      MF+P+   
Sbjct  26    FRGTAY-SPLRTTVALALWLGAIHFNAFLVLASLFLFPRRVAALVLATQLFFMFLPLSDK  84

Query  942   SKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGF  763
             S+ G + AR++ K   GYFP+ L+VED  AF+PNRAYVFGYEPHS+ PI +  L    GF
Sbjct  85    SRLGRKIARFISKYVIGYFPVTLHVEDYGAFDPNRAYVFGYEPHSVLPIAVGILGDLVGF  144

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
             MPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF S L +GYSCI+VPGGVQE  +M
Sbjct  145   MPLPKMKILASSAVFYTPFLRQIWTWLGLAPASRKSFYSYLGAGYSCIIVPGGVQEILHM  204

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
             +HD E  FLK RKGFV+IA++MG P+VPVF FGQS VY WW+P  KL +K +RA+KF+PI
Sbjct  205   DHDSEVAFLKPRKGFVKIAIEMGCPVVPVFAFGQSYVYKWWRPGGKLIVKIARAIKFSPI  264

Query  402   LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             +FWG +G+ +PF  P+HV+VG+PIEV KN QPT +++  +H +F+ A+ +LFEK+  R G
Sbjct  265   IFWGKLGTPIPFATPMHVIVGRPIEVVKNPQPTIDEINQVHGQFVVAMQDLFEKYXSRTG  324

Query  222   YVDLQLKIM  196
             Y DLQL+++
Sbjct  325   YPDLQLRVL  333



>ref|XP_002452652.1| hypothetical protein SORBIDRAFT_04g030010 [Sorghum bicolor]
 gb|EES05628.1| hypothetical protein SORBIDRAFT_04g030010 [Sorghum bicolor]
Length=334

 Score =   349 bits (895),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 227/331 (69%), Gaps = 1/331 (0%)
 Frame = -3

Query  1185  GGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLP  1009
             G N      S  A         +   +A S L T + LA WLG       +VLAS+   P
Sbjct  4     GTNGLSNGASAAAGERADDGTTVFRGTAYSPLRTTVALALWLGAIHFNAFLVLASLFLFP  63

Query  1008  FTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYV  829
                A +V+      MF+P++  S+ G + AR++ K   GYFP+ L+VED  AF+ NRAYV
Sbjct  64    RRVAALVLATQLFFMFVPLNDKSRLGRKIARFISKYVIGYFPVTLHVEDYGAFDSNRAYV  123

Query  828   FGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFK  649
             FGYEPHS+ PI +  L    GFMPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF 
Sbjct  124   FGYEPHSVLPIAVGILGDLVGFMPLPKMKILASSAVFYTPFLRQIWTWLGLAPASRKSFY  183

Query  648   SLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY  469
             S L +GYSCI+VPGGVQE  +M+HD E  FLKSRKGFV+IA++MG P+VPVF FGQS VY
Sbjct  184   SYLGAGYSCIIVPGGVQEILHMDHDSEVAFLKSRKGFVKIAIEMGCPVVPVFAFGQSYVY  243

Query  468   NWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLA  289
              WW+P  KL +K +RA+KF+PI+FWG +G+ +PF  P+HVVVG+PIEV KN QP+ +++ 
Sbjct  244   KWWRPGGKLIVKIARAIKFSPIIFWGKLGTPIPFATPMHVVVGRPIEVVKNPQPSIDEIN  303

Query  288   ALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              +H +F+ A+ ++FEK+K R GY DL+L+++
Sbjct  304   EVHRQFVVAMQDMFEKYKTRTGYPDLRLRVL  334



>dbj|BAJ85730.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97783.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 229/335 (68%), Gaps = 3/335 (1%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASI  1021
             M   G   + R  ++          F GT    SL  T+  LA WLG     V+++LAS+
Sbjct  1     MGANGALEEERPRADGGDEEGGATVFRGTNY--SLPRTIAALALWLGGIHFNVLLILASL  58

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
                P   A +V+ L  + MFIP++   K G +  R++CK A GYFP+ L+VED +AF+ +
Sbjct  59    FLFPLRLAALVVALQLMFMFIPLNDEDKLGRKIGRFICKYAMGYFPISLHVEDYEAFDSS  118

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGK  661
             RAYVFGYEPHS+ PIG+  L+   GFMPLPK+K L S+AVF+TP +R IWTW+G+  A +
Sbjct  119   RAYVFGYEPHSVLPIGVAALANHVGFMPLPKLKVLASSAVFHTPFLRQIWTWIGLIAATR  178

Query  660   QSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
             ++F S L++GYSC+VVPGG+QE  +M+HD E  FLKSRKGFV+IAM+ G PLVPVFCFGQ
Sbjct  179   KNFYSYLAAGYSCVVVPGGIQEILHMDHDSEVAFLKSRKGFVKIAMQSGCPLVPVFCFGQ  238

Query  480   SNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTE  301
             S  Y WW+P  KL++  +RA+KFTPI+FWG  G+ + F  P+HVVVG+PIE+ KN  PT 
Sbjct  239   SKAYKWWRPGGKLFVNIARALKFTPIIFWGRYGTPIAFSSPMHVVVGRPIELKKNPLPTI  298

Query  300   EQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +++  +H +FI AL ELFEK+K + GY  L L+++
Sbjct  299   DEINEVHGQFIGALQELFEKYKTKAGYPGLHLRVL  333



>dbj|BAJ98415.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 226/306 (74%), Gaps = 1/306 (0%)
 Frame = -3

Query  1110  ASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             A+A S L T + LA WLG     V+++LASI  LP   A MV+G     M +P++  S+ 
Sbjct  27    ATAYSPLRTTLALALWLGAIHFNVLLLLASIFLLPRRVAAMVLGTQLFFMLVPVNDKSRP  86

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + AR++ K   GYFP+ L+VED KAF+P RAYVFGYEPHS+ PIG+  L    GFMPL
Sbjct  87    GRKIARFISKYVVGYFPVTLHVEDYKAFDPKRAYVFGYEPHSVLPIGLGALLDPVGFMPL  146

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
             PK K L STAVFYTP +R IWTWLG+ PA +++F S L +GY+CIVVPGGVQE  +M+HD
Sbjct  147   PKTKVLASTAVFYTPFLRQIWTWLGLVPASRKNFYSYLRAGYTCIVVPGGVQEMLHMDHD  206

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E  FLKSRKGFV+IAM+ G+PLVPVFCFGQS+VY WW+P  KL +K +RA+KFTPI+F+
Sbjct  207   SEVAFLKSRKGFVKIAMETGSPLVPVFCFGQSHVYKWWRPGGKLIVKIARAIKFTPIVFF  266

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  G+ +PF  P+H+VVG+PIEV KN QPT +++  +H +F+ A+ ELFEK+K + GY  
Sbjct  267   GKYGTPIPFATPLHLVVGRPIEVQKNPQPTYDEINKVHEQFVVAMQELFEKYKTKAGYDK  326

Query  213   LQLKIM  196
             L+L+++
Sbjct  327   LKLRVL  332



>ref|XP_004965355.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Setaria italica]
Length=334

 Score =   344 bits (882),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 201/268 (75%), Gaps = 0/268 (0%)
 Frame = -3

Query  999  AIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
            A +V+      MF+P++   KWG   AR++C+ A GYFP+ L+VED KAF+P+R YVFGY
Sbjct  67   AAIVVAFQLFFMFVPVNDRDKWGRSIARFICRHAMGYFPISLHVEDYKAFDPSRVYVFGY  126

Query  819  EPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
            EPHS+ PIG+  L+   GFMPL KIK L S+AVFYTP +R IWTWLG+ PA +++F S L
Sbjct  127  EPHSVLPIGLSALADLVGFMPLTKIKVLASSAVFYTPFLRQIWTWLGLVPATRKNFYSYL  186

Query  639  SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
             +GYSCIVVPGGV+E  +M++D E  FLKSRKGFV+IAM+ G PLVPVFCFGQS  Y WW
Sbjct  187  RAGYSCIVVPGGVREMLHMDNDSEVAFLKSRKGFVKIAMQSGCPLVPVFCFGQSYAYKWW  246

Query  459  KPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALH  280
            +P  KL++  +RAVKFTPI+FWG  G+  PF RP+HVVVGKPIEV KN QP  +++  +H
Sbjct  247  RPGGKLFVNIARAVKFTPIIFWGRFGTPFPFPRPMHVVVGKPIEVDKNPQPAIDEINEVH  306

Query  279  SRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +FI AL ELFEK+K + GY  L L+++
Sbjct  307  EQFIMALRELFEKYKGKAGYPGLHLRVL  334



>gb|EMT13438.1| 2-acylglycerol O-acyltransferase 1 [Aegilops tauschii]
Length=347

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/302 (53%), Positives = 218/302 (72%), Gaps = 1/302 (0%)
 Frame = -3

Query  1098  SLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRF  922
             SL  T+  LA WLG     V+++LAS+   P   A +V+ L  + MFIP++   K G + 
Sbjct  46    SLPRTIAALALWLGGIHFNVLLILASLFLFPLRLAALVVALQLVFMFIPLNDEDKLGRKI  105

Query  921   ARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIK  742
              R++CK A GYFP+ L+VED  AF+ +RAYVFGYEPHS+ PIG+  L+   GFMPLPK+K
Sbjct  106   GRFICKYAMGYFPISLHVEDYDAFDSSRAYVFGYEPHSVLPIGVAALANHVGFMPLPKLK  165

Query  741   GLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETM  562
              L S+AVF+TP +R IWTW+G+  A +++F S L++GYSC+VVPGG+QE  +M+HD E  
Sbjct  166   VLASSAVFHTPFLRQIWTWIGLIAATRKNFYSYLAAGYSCVVVPGGIQEILHMDHDSEVA  225

Query  561   FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMG  382
             FL SRKGFV+IAM+ G PLVPVFCFGQS  Y WW+P  KL++  +RA+KFTPI+FWG  G
Sbjct  226   FLNSRKGFVKIAMQAGCPLVPVFCFGQSKAYRWWRPGGKLFVNIARALKFTPIIFWGRYG  285

Query  381   SFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLK  202
             + + F  P+HVVVG+PIE+ KN  PT +++  +H +F+ AL ELFEK+K + GY  L L+
Sbjct  286   TPIAFSAPMHVVVGRPIELKKNPLPTIDEINEVHGQFVGALQELFEKYKTKAGYPGLHLR  345

Query  201   IM  196
             ++
Sbjct  346   VL  347



>gb|EAY87275.1| hypothetical protein OsI_08677 [Oryza sativa Indica Group]
Length=338

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 221/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN  943
             F GTA    +  T+ +  WLG       ++LAS+   P   A MV+      MF P++  
Sbjct  31    FRGTAQP-PVRTTVALALWLGAIHFNAFLLLASLFLFPRRVAAMVLATQLFFMFAPVNDM  89

Query  942   SKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGF  763
             S+ G + AR++ K   GYFP+ L+VED KAF+PNRAYVFGYEPHS+ PI +  L    GF
Sbjct  90    SRLGRKIARFISKCVIGYFPVTLHVEDYKAFDPNRAYVFGYEPHSVLPIALGVLLELVGF  149

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
             MPLPKIK L S+AVFYTP +R IWTWLG+ PA +++F S L +GYSC++VPGGVQE  +M
Sbjct  150   MPLPKIKVLASSAVFYTPFLRQIWTWLGLVPASRKNFYSYLKAGYSCVIVPGGVQEMLHM  209

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
             +HD E  FLKSRKGFV+IAM+ G+PLVPVF FGQS VY WW+P  KL +K +RA+KFTPI
Sbjct  210   DHDSEVAFLKSRKGFVKIAMETGSPLVPVFAFGQSYVYKWWRPGGKLIVKIARAIKFTPI  269

Query  402   LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             +FWG  G+ +PF  P+HVVVG+PIEV KN+QPT +++  +H +F+ AL ELFEK+K + G
Sbjct  270   MFWGNFGTPIPFATPMHVVVGRPIEVKKNAQPTFDEINEVHEQFVVALQELFEKYKTKAG  329

Query  222   YVDLQLKIM  196
             Y +L L+++
Sbjct  330   YPNLHLRVL  338



>ref|NP_001047917.1| Os02g0714100 [Oryza sativa Japonica Group]
 dbj|BAD07792.1| putative mono- or diacylglycerol acyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF09831.1| Os02g0714100 [Oryza sativa Japonica Group]
 gb|EAZ24377.1| hypothetical protein OsJ_08131 [Oryza sativa Japonica Group]
 dbj|BAG92365.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 221/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN  943
             F GTA    +  T+ +  WLG       ++LAS+   P   A MV+      MF P++  
Sbjct  31    FRGTAQP-PVRTTVALALWLGAIHFNAFLLLASLFLFPRRVAAMVLATQLFFMFAPVNDM  89

Query  942   SKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGF  763
             S+ G + AR++ K   GYFP+ L+VED KAF+PNRAYVFGYEPHS+ PI +  L    GF
Sbjct  90    SRLGRKIARFISKCVIGYFPVTLHVEDYKAFDPNRAYVFGYEPHSVLPIALGVLLELVGF  149

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
             MPLPKIK L S+AVFYTP +R IWTWLG+ PA +++F S L +GYSC++VPGGVQE  +M
Sbjct  150   MPLPKIKVLASSAVFYTPFLRQIWTWLGLVPASRKNFYSYLKAGYSCVIVPGGVQEMLHM  209

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
             +HD E  FLKSRKGFV+IAM+ G+PLVPVF FGQS VY WW+P  KL +K +RA+KFTPI
Sbjct  210   DHDSEVAFLKSRKGFVKIAMETGSPLVPVFAFGQSYVYKWWRPGGKLIVKIARAIKFTPI  269

Query  402   LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             +FWG  G+ +PF  P+HVVVG+PIEV KN+QPT +++  +H +F+ AL ELFEK+K + G
Sbjct  270   MFWGKFGTPIPFATPMHVVVGRPIEVKKNAQPTFDEINEVHEQFVVALQELFEKYKTKAG  329

Query  222   YVDLQLKIM  196
             Y +L L+++
Sbjct  330   YPNLHLRVL  338



>gb|EMS45964.1| Diacylglycerol O-acyltransferase 2 [Triticum urartu]
Length=336

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/302 (52%), Positives = 217/302 (72%), Gaps = 1/302 (0%)
 Frame = -3

Query  1098  SLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRF  922
             SL  T+  LA WLG     V+++LAS+   P   A +V+ L  + MF P++   K G + 
Sbjct  35    SLPRTIAALALWLGGIHFNVILILASLFLFPLRLAALVVALQLVFMFTPLNDEDKLGRKI  94

Query  921   ARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIK  742
              R++CK A GYFP+ L+VED  AF+ +RAYVFGYEPHS+ PIG+  L+   GFMPLPK+K
Sbjct  95    GRFICKYAMGYFPISLHVEDYNAFDSSRAYVFGYEPHSVLPIGVAALANHVGFMPLPKLK  154

Query  741   GLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETM  562
              L S+AVF+TP +R IWTW+G+  A +++F S L++GYSC+VVPGG+QE  +M+HD E  
Sbjct  155   VLASSAVFHTPFLRQIWTWIGLIAATRKNFYSYLAAGYSCVVVPGGIQEILHMDHDSEVA  214

Query  561   FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMG  382
             FL SRKGFV+IAM+ G PLVPVFCFGQS  Y WW+P  KL++  +RA+KFTPI+FWG  G
Sbjct  215   FLNSRKGFVKIAMQAGCPLVPVFCFGQSKAYRWWRPGGKLFVNIARALKFTPIIFWGRYG  274

Query  381   SFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLK  202
             + + F  P+HVVVG+PIE+ KN  PT +++  +H +F+ AL ELFEK+K + GY  L L+
Sbjct  275   TPIAFSSPMHVVVGRPIELKKNPLPTIDEINEVHGQFVGALQELFEKYKTKAGYPGLHLR  334

Query  201   IM  196
             ++
Sbjct  335   VL  336



>ref|XP_006849935.1| hypothetical protein AMTR_s00022p00123300 [Amborella trichopoda]
 gb|ERN11516.1| hypothetical protein AMTR_s00022p00123300 [Amborella trichopoda]
Length=330

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 232/328 (71%), Gaps = 2/328 (1%)
 Frame = -3

Query  1179  NVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTK  1000
             N +     + A     PA  +     +++   + +  WLG       +VL +    P  +
Sbjct  5     NGKQDGNGDAAVTEARPA-VLKRTEYDAVRSNVAVFFWLGAIHCNAFLVLTAFALFPSWR  63

Query  999   AIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
             +++++GLL LLM IP+D  SK G   AR++CK A GYFP+ L+VED+KAF PNRAYVF  
Sbjct  64    SLLILGLLILLMLIPLDDKSKLGQDIARFVCKYACGYFPVTLHVEDMKAFSPNRAYVFAV  123

Query  819   EPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
             EPHS+ PI +V+L  FTGFMPLPKIK L S+A+FYTP++RHIWTW+G+  A K++F S L
Sbjct  124   EPHSVLPIAIVSLCNFTGFMPLPKIKALASSAIFYTPILRHIWTWMGLVAATKKNFVSYL  183

Query  639   SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
               GYSCIV+PGG +E  YME   E  +LK+R GFV++AM MG+PLVPVFCFGQS++Y+WW
Sbjct  184   RDGYSCIVIPGGAREIMYMEKGSEVAYLKARTGFVRVAMDMGSPLVPVFCFGQSDIYSWW  243

Query  459   KPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALH  280
             K    LY++ ++A++FTP++FWG  G  +P++RP+HVVVG+PIEV +N QPT+E++A +H
Sbjct  244   KGKGDLYVRVTKALRFTPLVFWGRFGP-IPYRRPMHVVVGRPIEVNRNHQPTKEEVAEVH  302

Query  279   SRFIEALLELFEKHKKRLGYVDLQLKIM  196
              ++ EAL ELFE+HK   GY + QL+I+
Sbjct  303   QKYTEALRELFERHKAEAGYAEYQLRIL  330



>ref|XP_006648987.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Oryza brachyantha]
Length=306

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 203/266 (76%), Gaps = 0/266 (0%)
 Frame = -3

Query  993  MVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEP  814
            MV+      MF+P++  S+ G   AR++ K   GYFP+ L+VED KAF+P+RAYVFGYEP
Sbjct  41   MVLATQLFFMFVPVNDRSRLGREIARFISKYVVGYFPVTLHVEDYKAFDPSRAYVFGYEP  100

Query  813  HSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS  634
            HS+ PI + TL    GFMPLPK+K L S+AVFYTP +R IWTWLG+ PA +++F S L +
Sbjct  101  HSVLPIALGTLLDLVGFMPLPKMKVLASSAVFYTPFLRQIWTWLGLVPASRKNFYSYLKA  160

Query  633  GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKP  454
            GYSC++VPGGVQE  +M+HD E  FLK+RKGFV+IAM+ G+PLVPVF FGQS VY WW+P
Sbjct  161  GYSCVIVPGGVQEMLHMDHDSEVAFLKARKGFVKIAMETGSPLVPVFAFGQSYVYKWWRP  220

Query  453  SSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSR  274
            S KL ++ +RA+KFTPI+FWG  G+ +PF  P+HVVVG+PIEV K SQP+ +++  +H +
Sbjct  221  SGKLIVRIARALKFTPIIFWGKFGTPIPFATPMHVVVGRPIEVKKISQPSFDEINEVHEQ  280

Query  273  FIEALLELFEKHKKRLGYVDLQLKIM  196
            FI AL ELFEK+K + GY DL L+++
Sbjct  281  FIVALQELFEKYKTKAGYPDLHLRVL  306



>ref|XP_010919928.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Elaeis guineensis]
Length=325

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 227/313 (73%), Gaps = 0/313 (0%)
 Frame = -3

Query  1134  TPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIP  955
             T    I + + +++     M+ WLG     +++ L  +IF   T A +++GL+  LM +P
Sbjct  13    TEMTVIRSTNHSTVHALTAMIIWLGSIHLNILLFLLFVIFCRTTVAFLILGLIIPLMIVP  72

Query  954   IDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSA  775
             +D NSK G  +ARY+ K A GYFP+ +++ED +AF+ N+AYV   EPHS++PIG ++L +
Sbjct  73    VDNNSKLGQAYARYVGKYAPGYFPVTVHMEDARAFDQNKAYVLAAEPHSVFPIGCLSLLS  132

Query  774   FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQE  595
             FTG MPL K K L STA+F+TP++R I TW+G+ PA K++F   L +GYSCI++PGGVQE
Sbjct  133   FTGLMPLSKTKALASTAMFHTPILRQISTWMGLVPATKKNFIRYLETGYSCIIIPGGVQE  192

Query  594   AYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVK  415
               YM H+ E  +LK R GFVQ+A++ G+PLVPVFCFGQSNVY WWKP  K Y+  +RA++
Sbjct  193   ILYMNHNYEVAYLKRRYGFVQVAIETGSPLVPVFCFGQSNVYKWWKPQGKFYVHVARAIR  252

Query  414   FTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
             F P++FWG +GS VP+++PIH++VG+PIE+ +N  P+ E++A +H+RFI A+ +LF +++
Sbjct  253   FAPLIFWGVLGSPVPYRKPIHIIVGRPIEIKQNLNPSREEVAEVHARFISAMEKLFVRYR  312

Query  234   KRLGYVDLQLKIM  196
             +  G+ D++L+I+
Sbjct  313   EVAGHNDIELRIV  325



>gb|ACU20344.1| unknown [Glycine max]
Length=317

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 222/305 (73%), Gaps = 0/305 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S N       ++ +LG     + ++L + +FLP +K ++V GLL + + IP+D+NS +
Sbjct  12    SESRNVFKTVPALVLYLGAIHFNLALILWATVFLPLSKGLLVFGLLLVFVLIPVDENSIF  71

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + ++Y+CK    YFP+ L+VE+ KAF P++AYVFGYEPHS++PIG+V L   TGFMPL
Sbjct  72    GHKLSKYICKHICSYFPITLHVEEAKAFRPDQAYVFGYEPHSVFPIGIVALGDSTGFMPL  131

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
              K K L S+AVFY P +RHIWTWLG +P  KQ+F S L +GYSCI+VPGGV+E ++ME  
Sbjct  132   AKTKFLASSAVFYIPFLRHIWTWLGFTPVTKQNFISSLEAGYSCILVPGGVRETFFMEPG  191

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
             CE  FLK R+GFV+IA++MG PLVPVFCFGQ+  Y WWKP  +L    +R +K  P+ FW
Sbjct  192   CEIAFLKQRRGFVRIALQMGLPLVPVFCFGQTKAYKWWKPPGRLMQNLARFLKIIPLFFW  251

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS +PF+ P+++VVG+PIE+ KN +PT EQ+A +HS+F+EAL +LF++HK   GY +
Sbjct  252   GIYGSPIPFKNPLYIVVGRPIELEKNPEPTMEQVAKVHSQFVEALQDLFDRHKAHAGYTN  311

Query  213   LQLKI  199
             L+LKI
Sbjct  312   LELKI  316



>ref|XP_003547891.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X1 
[Glycine max]
Length=317

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 222/305 (73%), Gaps = 0/305 (0%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S N       ++ +LG     + ++L + +FLP +K ++V GLL + + IP+D+NS +
Sbjct  12    SESRNVFKTVPALVLYLGAIHFNLALILWATVFLPLSKGLLVFGLLLVFVLIPVDENSIF  71

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + ++Y+CK    YFP+ L+VE+ KAF P++AYVFGYEPHS++PIG+V L   TGFMPL
Sbjct  72    GHKLSKYICKHICSYFPITLHVEEAKAFRPDQAYVFGYEPHSVFPIGIVALGDSTGFMPL  131

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
              K K L S+AVFY P +RHIWTWLG +P  KQ+F S L +GYSCI+VPGGV+E ++ME  
Sbjct  132   AKTKFLASSAVFYIPFLRHIWTWLGFTPVTKQNFISSLEAGYSCILVPGGVRETFFMEPG  191

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
             CE  FLK R+GFV+IA++MG PLVPVFCFGQ+  Y WWKP  +L    +R +K  P+ FW
Sbjct  192   CEIAFLKQRRGFVRIALQMGLPLVPVFCFGQTKAYKWWKPPGRLMQNLARFLKIIPLFFW  251

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS +PF+ P+++VVG+PIE+ KN +PT EQ+A +HS+F+EAL +LF++HK   GY +
Sbjct  252   GIYGSPIPFKNPLYIVVGRPIELEKNPEPTMEQVAKVHSQFVEALQDLFDRHKAHAGYTN  311

Query  213   LQLKI  199
             L+LKI
Sbjct  312   LELKI  316



>ref|XP_010270586.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X1 
[Nelumbo nucifera]
Length=362

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 234/366 (64%), Gaps = 38/366 (10%)
 Frame = -3

Query  1200  YMEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASI  1021
             +M E  G+   R  S  A   PT    +     +SLL  +  LA L  P  +VV ++   
Sbjct  4     FMPETIGD---REKSVNAGDEPT----VIQRKESSLLQMVTALALLLGPLHLVVALIFMA  56

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
              FLP   A  +  LL     +PI+  SK G   A Y+C     YFP+ L+VEDIKAFE  
Sbjct  57    CFLPNYLAFSIFVLLLFFTVLPINDESKLGRTLAWYICYHCCAYFPVTLHVEDIKAFESK  116

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAV--------------------  721
             RAYVFGYEPHS++PIG+V+L  FT FM LPKIK L S+AV                    
Sbjct  117   RAYVFGYEPHSVFPIGVVSLVDFTEFMHLPKIKLLASSAVRFLPLMPVRYGIKQNRMVKQ  176

Query  720   -----------FYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
                        FYTP +RHIWTWLGI+PA K++F SLL +G+SCIVVPGGVQEA  M+H 
Sbjct  177   DLCSRPYKVGIFYTPFLRHIWTWLGITPATKRNFTSLLEAGHSCIVVPGGVQEACLMKHG  236

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
              E +F+K+RKGF++IA++ G PLVPVFCFGQ++V+ WW+PS KLY +  R +KFTPI+FW
Sbjct  237   SEIVFVKARKGFIRIAIQTGRPLVPVFCFGQTDVFKWWQPSGKLYRRLCRVIKFTPIIFW  296

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
             G  GS +P++RP+HVVVG+PI++ +N QPT E++  +HS+F+ AL ELF KHK R+G+ D
Sbjct  297   GTFGSPLPYRRPMHVVVGRPIKLKRNPQPTMEEVNEVHSQFVAALEELFAKHKARVGHAD  356

Query  213   LQLKIM  196
              QL ++
Sbjct  357   RQLTVL  362



>ref|XP_007156273.1| hypothetical protein PHAVU_003G272600g [Phaseolus vulgaris]
 gb|ESW28267.1| hypothetical protein PHAVU_003G272600g [Phaseolus vulgaris]
Length=332

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 207/291 (71%), Gaps = 0/291 (0%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGY  889
             +LG     ++++L +  FLP +KA++V GLLF+ + IP+D  S +G + ++Y+CK    Y
Sbjct  42    YLGTIHFNLILILFATFFLPLSKALLVFGLLFVFVMIPVDDKSMFGRKLSKYICKNICSY  101

Query  888   FPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTP  709
             FP+ L+VE+ KAF PN AYVFGYEPHS +PIGMV L    G MPL K K L S+AVFY P
Sbjct  102   FPIKLHVEEPKAFLPNHAYVFGYEPHSAFPIGMVALGDGAGMMPLAKTKFLASSAVFYIP  161

Query  708   VMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQI  529
              MRHIW WLG +   K++F S L  GYS I VPGGV E  ++E   E +FLK R+GFV+I
Sbjct  162   FMRHIWRWLGFTAVTKKNFISSLECGYSVIFVPGGVHETVFLEAGSEIVFLKERRGFVRI  221

Query  528   AMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHV  349
             AM+MG PLVPVFCFGQ+N + WWK   KL  K +R +K  P+ +WG  GS +PF+ P+++
Sbjct  222   AMEMGVPLVPVFCFGQTNSFKWWKVPGKLIQKLARFMKIVPLFYWGIYGSPIPFKNPLYI  281

Query  348   VVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              VGKPIE+ KNS+PT EQ+  +HS+F+EAL +LFE+HK   GY +LQLKI+
Sbjct  282   AVGKPIELHKNSEPTMEQVVKVHSQFVEALQDLFERHKAEAGYTNLQLKIV  332



>ref|NP_001241731.1| diacylglycerol O-acyltransferase 1 [Zea mays]
 gb|ACG25956.1| diacylglycerol O-acyltransferase 1 [Zea mays]
Length=332

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 199/268 (74%), Gaps = 0/268 (0%)
 Frame = -3

Query  999  AIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
            A +V+    L MF P++   KWG   AR++C+ A GYFP+ L+VED K+ +P+RAYVFGY
Sbjct  65   AAIVVAFQLLFMFAPVNDRDKWGRSVARFICRHAMGYFPITLHVEDYKSLDPSRAYVFGY  124

Query  819  EPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
            EPHS+ PIG+  L+   GF+PL KIK L S+AVFYTP +R IWTWLG+ PA +++F   L
Sbjct  125  EPHSVLPIGLSALADLVGFLPLTKIKVLASSAVFYTPFLRQIWTWLGLVPATRKNFYCYL  184

Query  639  SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
             +GYSCIVVPGGV+E  +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW
Sbjct  185  GAGYSCIVVPGGVREMLHMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWW  244

Query  459  KPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALH  280
            +P  KL++K +RAVKFTPI+FWG  G+  PF +P+HVVVGKPIEV K   PT +++  +H
Sbjct  245  RPGGKLFIKIARAVKFTPIIFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEINEVH  304

Query  279  SRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +FI A+ +LFEK+K + GY  L L+++
Sbjct  305  EQFIIAMRDLFEKYKAKAGYPGLHLRVL  332



>ref|XP_004509476.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Cicer arietinum]
Length=318

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 213/304 (70%), Gaps = 0/304 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             + NSL   + +    G     +  +L S+ FLP + +  VI  L L   +P+D+NS  GL
Sbjct  15    TRNSLKSVVALALCFGAIHFNLAFILFSLFFLPLSLSPWVIAFLMLFTVLPVDKNSLLGL  74

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             + +R++CK    YFP+ L+VED +AF  NR+YVF YEPHS++P G   L   TGFM +PK
Sbjct  75    KLSRFICKHVCTYFPITLHVEDAEAFHLNRSYVFCYEPHSVFPFGSFALHNNTGFMRIPK  134

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             I+ L S+A FY P +R IWTWLG S   KQ+  SLL+SGYSCI+VPGG +E  +MEH CE
Sbjct  135   IRFLVSSAAFYIPFLRQIWTWLGFSSVTKQNVISLLASGYSCIIVPGGTRETLFMEHGCE  194

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
              ++LK R+GFV++AM+MG PLVPVFCFGQ+N+Y WWK   KL    +R++K  P++FWG 
Sbjct  195   NVYLKERRGFVRLAMEMGHPLVPVFCFGQTNIYKWWKAPGKLIQSIARSMKIFPLIFWGR  254

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              G+ VPF+ P++VVVG+PI++ K  QPT +Q+A +HS FIEAL +LFE+HK + GY +L+
Sbjct  255   FGTPVPFKNPLYVVVGRPIQLEKTPQPTSDQVAKVHSEFIEALQDLFERHKVQAGYENLE  314

Query  207   LKIM  196
             LKI+
Sbjct  315   LKIV  318



>gb|ACL54036.1| unknown [Zea mays]
 gb|AFW86521.1| diacylglycerol O-acyltransferase 1 [Zea mays]
Length=332

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 224/325 (69%), Gaps = 5/325 (2%)
 Frame = -3

Query  1155  NEAAPPPTPAE----FIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIM  991
             N AA  P   E     +   +  SL  T + LA WLG     V++VLAS+  L    A +
Sbjct  8     NRAAEKPRDGEGGEARVFRCTDYSLPRTTLALALWLGGIHFNVLLVLASLFLLSGRAAAI  67

Query  990   VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
             V+    L MF P++   KWG   AR++C+ A GYFP+ L+VED K+ +P+RAYVFGYEPH
Sbjct  68    VVAFQLLFMFAPVNDRDKWGQSVARFICRHAMGYFPITLHVEDYKSLDPSRAYVFGYEPH  127

Query  810   SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
             S+ PIG+  L+   GF+PL KIK L S+AVFYTP +R IWTWLG+ PA +++F   L +G
Sbjct  128   SVLPIGLSALADLVGFLPLTKIKVLASSAVFYTPFLRQIWTWLGLVPATRKNFYCYLGAG  187

Query  630   YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPS  451
             YSCIVVPGGV+E  +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P 
Sbjct  188   YSCIVVPGGVREMLHMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWWRPG  247

Query  450   SKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
              KL++K +RAVKFTPI+FWG  G+  PF +P+HVVVGKPIEV K   PT +++  +H +F
Sbjct  248   GKLFIKIARAVKFTPIIFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEINEVHEQF  307

Query  270   IEALLELFEKHKKRLGYVDLQLKIM  196
             I A+ +LFEK+K + GY  L L+++
Sbjct  308   IIAMRDLFEKYKAKAGYPGLHLRVL  332



>ref|XP_006837415.1| hypothetical protein AMTR_s00111p00149430 [Amborella trichopoda]
 gb|ERN00269.1| hypothetical protein AMTR_s00111p00149430 [Amborella trichopoda]
Length=326

 Score =   330 bits (847),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 214/308 (69%), Gaps = 0/308 (0%)
 Frame = -3

Query  1119  IGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNS  940
             I + + +S    + +  WLG     +V+     +F P   A+++  L+ L   IP+D  S
Sbjct  19    IKSKTYSSFHTLIAITLWLGALHLNLVITALVFLFFPLKYAVLLFMLMVLNTLIPVDDQS  78

Query  939   KWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFM  760
             K+G R ARY+ K   GYFP  + +EDI++F+PN+AYV   EPHSI+PIG ++L   TG M
Sbjct  79    KFGGRVARYIGKYGPGYFPTTVLIEDIQSFDPNQAYVLAAEPHSIFPIGCLSLLNITGLM  138

Query  759   PLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYME  580
             PL K KGL S A FY P++R + TW G+ PA K++F   L +GYSCIV+PGGVQE +YME
Sbjct  139   PLSKTKGLASNATFYPPLLRQVGTWTGLVPATKKNFVKYLEAGYSCIVIPGGVQEIFYME  198

Query  579   HDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPIL  400
             H  E  +LK R+GFV+IA++ G PLVP+FCFGQ+NVYNWWKP   LY + +RA++F P+L
Sbjct  199   HGSEVAYLKKRQGFVRIAIETGRPLVPIFCFGQTNVYNWWKPKGDLYTRIARAIRFAPLL  258

Query  399   FWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
             +WG  G+ +P++RP+HV+VG+PIE+ +N  P++E++A +H+ F+  L +L ++HK   G+
Sbjct  259   YWGMFGTHIPYRRPMHVIVGRPIELKRNPNPSKEEVAEVHALFVSKLEQLCQRHKAAAGH  318

Query  219   VDLQLKIM  196
              D+QL+++
Sbjct  319   ADIQLRVI  326



>ref|XP_002972054.1| hypothetical protein SELMODRAFT_96204 [Selaginella moellendorffii]
 ref|XP_002972601.1| hypothetical protein SELMODRAFT_172922 [Selaginella moellendorffii]
 gb|EFJ26687.1| hypothetical protein SELMODRAFT_172922 [Selaginella moellendorffii]
 gb|EFJ26971.1| hypothetical protein SELMODRAFT_96204 [Selaginella moellendorffii]
Length=340

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 210/303 (69%), Gaps = 0/303 (0%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             ++  +L  + +L WLG      +V L  +  L    AI V+GL  LLM +P    S  G 
Sbjct  37    ASGGVLSWIAVLIWLGAIHFNTIVGLVVLANLRRAWAIAVMGLYLLLMVLPAHHESPLGR  96

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             + A ++CK A  +FP+ L+V+DIK+F+ ++AYVF  EPHSI PIG+++L  +TG+MP  K
Sbjct  97    KVATFICKYAPKHFPIRLHVDDIKSFDLSKAYVFAVEPHSILPIGIISLCHYTGYMPFTK  156

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             I+ L S+AVF TP++RHIWTWLG+ PA +++F  LL+ GYSCIVVPGGVQE  YMEH  E
Sbjct  157   IRALASSAVFATPILRHIWTWLGLVPASRKTFGKLLNDGYSCIVVPGGVQECLYMEHGHE  216

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
              +FLK R GFV++A++ G PLVPVFCFGQ+  Y WWKP  +LY K SRA+ FTP++FWG 
Sbjct  217   VVFLKKRFGFVRVAIETGAPLVPVFCFGQTEAYKWWKPKGELYAKLSRAIGFTPLVFWGM  276

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              GS VP Q+ ++V VG PIEV K SQP+ E++A +  +FI AL ELFEKHK   GY D  
Sbjct  277   YGSPVPCQQEMYVAVGNPIEVTKTSQPSREEVANVLEKFIVALQELFEKHKAAAGYKDTM  336

Query  207   LKI  199
             L +
Sbjct  337   LHV  339



>ref|XP_008344179.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Malus domestica]
Length=266

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             +N L M + +  WLG     V ++L +I FLPF+KA++V GLL L M IP+D+ SK G  
Sbjct  23    SNVLHMFVALGIWLGTIHFNVGLILFTIFFLPFSKALLVFGLLVLFMIIPVDEKSKIGRS  82

Query  924   FARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKI  745
              +RY+CK A  YFP+ LY EDI AF+PNRAYVFGYEPHS+ PIG+V L+  TGF+PLPKI
Sbjct  83    LSRYICKHACAYFPVTLYAEDINAFDPNRAYVFGYEPHSVLPIGVVALADLTGFLPLPKI  142

Query  744   KGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET  565
             K L S+AVFYTP +RHIWTWLG++PA K +F S LS+GYSCI+VPGGVQE +YMEH  E 
Sbjct  143   KALASSAVFYTPFLRHIWTWLGLAPATKSNFISHLSAGYSCIIVPGGVQETFYMEHGTEI  202

Query  564   MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYM  385
              FLKSR+GFV+IAM++G PLVPVFCFGQSNVY WWKPS +L+LKF+RA+KFTPI FWG  
Sbjct  203   AFLKSRRGFVRIAMELGHPLVPVFCFGQSNVYKWWKPSGELFLKFARAIKFTPIFFWGVF  262

Query  384   G  382
             G
Sbjct  263   G  263



>dbj|BAG95286.1| unnamed protein product [Oryza sativa Japonica Group]
Length=234

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 184/233 (79%), Gaps = 0/233 (0%)
 Frame = -3

Query  894  GYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFY  715
            GYFP+ L+VED K F+PNRAYVFG+EPHS+ PIG+  L+   GFMPLPKIK L S+AVFY
Sbjct  2    GYFPISLHVEDYKCFDPNRAYVFGFEPHSVLPIGVAALADLVGFMPLPKIKVLASSAVFY  61

Query  714  TPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFV  535
            TP +R IWTWLG+ PA +++F+S L +GYSCI+VPGGVQE  +M+HD E  FLKSRKGFV
Sbjct  62   TPFLRQIWTWLGLIPATRKNFQSYLGAGYSCIIVPGGVQEILHMDHDSEIAFLKSRKGFV  121

Query  534  QIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPI  355
            +IAM+ G PLVPVFCFGQS  Y WW+P  KL++K +RA+KFTPI+FWG  G+ +PF  P+
Sbjct  122  KIAMQSGCPLVPVFCFGQSYAYKWWRPKGKLFVKIARAIKFTPIVFWGRYGTPIPFPTPM  181

Query  354  HVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            HVVVG+PIEV KNSQPT +++  +H +F  AL +LF+K+K   GY  L L+++
Sbjct  182  HVVVGRPIEVEKNSQPTIDEINEVHEQFTVALQDLFDKYKTETGYPGLHLRVL  234



>ref|XP_011004406.1| PREDICTED: diacylglycerol O-acyltransferase 2 isoform X2 [Populus 
euphratica]
Length=297

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 215/304 (71%), Gaps = 29/304 (10%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGL  928
             S+N +L  + +  WLG    +V++V+ S++FL F+K ++V GLL LL+F+PID ++K G 
Sbjct  23    SSNIILSLIAVAIWLGSIHFVVLLVIFSLLFLSFSKCLLVFGLLLLLVFVPIDDDNKLGR  82

Query  927   RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
             R   Y+C+ A  YFP+ L+VEDI AF P+RAYVFGYEPHS+WPIG+V L+  TGFMPL K
Sbjct  83    RLCWYICRHACCYFPVTLHVEDINAFHPDRAYVFGYEPHSVWPIGVVALADHTGFMPLRK  142

Query  747   IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             +K L S+AVF  P +RHIWTW G++ A K++F SLLS+GY+CIV PGGVQE +YMEHD E
Sbjct  143   VKVLASSAVFLVPFLRHIWTWCGLTSATKKNFTSLLSAGYTCIVNPGGVQETFYMEHDNE  202

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
                                          S VY WWKPS KL+LK SRA+KFTP++F G 
Sbjct  203   -----------------------------SKVYKWWKPSGKLFLKISRAIKFTPVVFGGI  233

Query  387   MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
              G+ +PFQRP+H+VVG+PIE+ +N QPT E+LA +H +F+ AL +LF++H+ R+G+ DL+
Sbjct  234   FGTPLPFQRPMHIVVGRPIELKQNLQPTVEELAEVHGQFVAALEDLFKRHRARVGFADLE  293

Query  207   LKIM  196
             LKI+
Sbjct  294   LKIL  297



>ref|XP_008392825.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Malus domestica]
Length=276

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 180/235 (77%), Gaps = 0/235 (0%)
 Frame = -3

Query  996  IMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYE  817
            +   GLL L + IPID  SK G   +RY+CK A  YFP+ L+ EDI AF+PNR+YVFGYE
Sbjct  42   VHAFGLLVLFVIIPIDDKSKIGRSLSRYICKHACSYFPVTLHAEDINAFDPNRSYVFGYE  101

Query  816  PHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS  637
            PHS++ IG+  L+  TGF+PL KIK L S+AVFYTP MRHIWTWLG SPA + +F S LS
Sbjct  102  PHSVFAIGVXALADLTGFLPLTKIKTLASSAVFYTPFMRHIWTWLGFSPATRSNFISHLS  161

Query  636  SGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK  457
            +GYSC++VPGGV+E +YME   E  FLKSR+GFV+IAM++G PLVPVFCFGQS VY WW+
Sbjct  162  AGYSCVIVPGGVREIFYMEPGTEVAFLKSRRGFVRIAMELGHPLVPVFCFGQSKVYKWWR  221

Query  456  PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQL  292
            PS +L  KF+RA+KF P+ FWG  G+ VP+  P+HVVVGKPI++ K  QPT E++
Sbjct  222  PSGELVWKFARALKFXPVFFWGIFGTPVPYSHPMHVVVGKPIDLKKTPQPTMEEV  276



>ref|XP_006599273.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X2 
[Glycine max]
Length=303

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 214/305 (70%), Gaps = 14/305 (5%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S N       ++ +LG     + ++L + +FLP +K ++V GLL + + IP+D+NS +
Sbjct  12    SESRNVFKTVPALVLYLGAIHFNLALILWATVFLPLSKGLLVFGLLLVFVLIPVDENSIF  71

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + ++Y+CK    YFP+ L+VE+ KAF P++AYVFGYEPHS++PIG+V L   TGFMPL
Sbjct  72    GHKLSKYICKHICSYFPITLHVEEAKAFRPDQAYVFGYEPHSVFPIGIVALGDSTGFMPL  131

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
              K K L S+AVFY P +RHIWTWLG +P  KQ+F S L +GYSCI+VPGGV+E ++ME  
Sbjct  132   AKTKFLASSAVFYIPFLRHIWTWLGFTPVTKQNFISSLEAGYSCILVPGGVRETFFMEPG  191

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
             CE  FLK R+GFV+IA++MG PLVPVFCFGQ+  Y WWKP  +L    +R          
Sbjct  192   CEIAFLKQRRGFVRIALQMGLPLVPVFCFGQTKAYKWWKPPGRLMQNLAR----------  241

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
                 S +PF+ P+++VVG+PIE+ KN +PT EQ+A +HS+F+EAL +LF++HK   GY +
Sbjct  242   ----SPIPFKNPLYIVVGRPIELEKNPEPTMEQVAKVHSQFVEALQDLFDRHKAHAGYTN  297

Query  213   LQLKI  199
             L+LKI
Sbjct  298   LELKI  302



>gb|AET03522.2| type 2 acyl-CoA diacylglycerol acyltransferase [Medicago truncatula]
Length=317

 Score =   312 bits (800),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 207/283 (73%), Gaps = 0/283 (0%)
 Frame = -3

Query  1044  VVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVE  865
             + ++L +I FL F+KA+++ G L LLM +P+D+NS  G + +R++CK    YFP+ L++E
Sbjct  35    LALILFAIFFLSFSKALLLFGFLMLLMILPVDKNSLLGQKLSRFICKHVCSYFPITLHLE  94

Query  864   DIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
             D +AF  N+ YVF YEPHS++P G+  L     FMP+P I+ L S+A FY P +R IWTW
Sbjct  95    DAEAFHLNQPYVFCYEPHSVFPFGIFALHDNIDFMPIPNIRFLVSSAAFYIPYLRQIWTW  154

Query  684   LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPL  505
             LG S   K++  SLL +G SCI+VPGG++E  +MEH CE ++LK RKGFV+IAM+MG PL
Sbjct  155   LGFSYVTKKNLISLLVAGESCIIVPGGMRETLFMEHGCENVYLKERKGFVRIAMEMGHPL  214

Query  504   VPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEV  325
             VPVFCFGQ+N+Y WWK S KL    + ++K  P++FWG  GS VPF+ P++VVVGKPI+V
Sbjct  215   VPVFCFGQTNIYKWWKASGKLIQNLASSMKIFPLIFWGKFGSPVPFKNPLYVVVGKPIQV  274

Query  324   GKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
              K  +PT EQ+A +HS F+EAL ELFE+HK + G  +L+LKI+
Sbjct  275   EKIPEPTSEQVAKVHSEFVEALQELFERHKTQAGCTNLELKIV  317



>gb|EMS48367.1| Diacylglycerol O-acyltransferase 2 [Triticum urartu]
Length=346

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 194/277 (70%), Gaps = 22/277 (8%)
 Frame = -3

Query  960  IPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL  781
            +P   +  +G R  R++ K   GYFP+ L+VED KAF+P RAYVFGYEPHS+ PIG+  L
Sbjct  70   LPCCLDLTFGGRLRRFISKYVVGYFPVTLHVEDYKAFDPKRAYVFGYEPHSVLPIGLGAL  129

Query  780  SAFTGFMPLPKIKGLGSTAV----------------------FYTPVMRHIWTWLGISPA  667
                GFMPLPK K L STAV                      FYTP +R IWTWLG+ PA
Sbjct  130  LDLVGFMPLPKTKVLASTAVRNPLITFLNVHCRCLIEFSLSVFYTPFLRQIWTWLGLVPA  189

Query  666  GKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCF  487
             +++F S L +GY+CIVVPGGVQE  +M+HD E  FLKSRKGFV+IAM+ G+PLVPVFCF
Sbjct  190  SRKNFNSYLRAGYTCIVVPGGVQEMLHMDHDSEVAFLKSRKGFVKIAMETGSPLVPVFCF  249

Query  486  GQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQP  307
            GQS VY WW+P  KL +K +RA+KFTP++F+G  G+ +PF  P+H+VVG+PIEV KN QP
Sbjct  250  GQSLVYKWWRPGGKLIVKIARAIKFTPVIFFGKYGTPIPFATPLHLVVGRPIEVQKNPQP  309

Query  306  TEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            T +++  +H +F+ A+ ELFEK+K + GY  L+L+++
Sbjct  310  TYDEINEVHEQFVVAMQELFEKYKTKAGYDKLELRVL  346



>gb|ACN32157.1| unknown [Zea mays]
 gb|AFW86524.1| hypothetical protein ZEAMMB73_897295 [Zea mays]
Length=323

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 217/325 (67%), Gaps = 14/325 (4%)
 Frame = -3

Query  1155  NEAAPPPTPAE----FIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIM  991
             N AA  P   E     +   +  SL  T + LA WLG     V++VLAS+  L    A +
Sbjct  8     NRAAEKPRDGEGGEARVFRCTDYSLPRTTLALALWLGGIHFNVLLVLASLFLLSGRAAAI  67

Query  990   VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
             V+    L MF P++   KWG   AR++C+ A GYFP+ L+VED K+ +P+RAYVFGYEPH
Sbjct  68    VVAFQLLFMFAPVNDRDKWGQSVARFICRHAMGYFPITLHVEDYKSLDPSRAYVFGYEPH  127

Query  810   SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
             S+ PIG+  L+   GF+PL KIK L S+A         IWTWLG+ PA +++F   L +G
Sbjct  128   SVLPIGLSALADLVGFLPLTKIKVLASSA---------IWTWLGLVPATRKNFYCYLGAG  178

Query  630   YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPS  451
             YSCIVVPGGV+E  +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P 
Sbjct  179   YSCIVVPGGVREMLHMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWWRPG  238

Query  450   SKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
              KL++K +RAVKFTPI+FWG  G+  PF +P+HVVVGKPIEV K   PT +++  +H +F
Sbjct  239   GKLFIKIARAVKFTPIIFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEINEVHEQF  298

Query  270   IEALLELFEKHKKRLGYVDLQLKIM  196
             I A+ +LFEK+K + GY  L L+++
Sbjct  299   IIAMRDLFEKYKAKAGYPGLHLRVL  323



>ref|XP_006599274.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X3 
[Glycine max]
Length=296

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 211/305 (69%), Gaps = 21/305 (7%)
 Frame = -3

Query  1113  TASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW  934
             + S N       ++ +LG     + ++L + +FLP +K ++V GLL + + IP+D+NS +
Sbjct  12    SESRNVFKTVPALVLYLGAIHFNLALILWATVFLPLSKGLLVFGLLLVFVLIPVDENSIF  71

Query  933   GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPL  754
             G + ++Y+CK    YFP+ L+VE+ KAF P++AYVFGYEPHS++PIG+V L   TGFMPL
Sbjct  72    GHKLSKYICKHICSYFPITLHVEEAKAFRPDQAYVFGYEPHSVFPIGIVALGDSTGFMPL  131

Query  753   PKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
              K K L S+AVFY P +RHIWTWLG +P  KQ+F S L +GYSCI+VPGGV+E ++ME  
Sbjct  132   AKTKFLASSAVFYIPFLRHIWTWLGFTPVTKQNFISSLEAGYSCILVPGGVRETFFMEPG  191

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFW  394
             CE  FLK R+GFV+IA++MG PLVPVFCFGQ+  Y WWKP  +                 
Sbjct  192   CEIAFLKQRRGFVRIALQMGLPLVPVFCFGQTKAYKWWKPPGR-----------------  234

Query  393   GYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
                 S +PF+ P+++VVG+PIE+ KN +PT EQ+A +HS+F+EAL +LF++HK   GY +
Sbjct  235   ----SPIPFKNPLYIVVGRPIELEKNPEPTMEQVAKVHSQFVEALQDLFDRHKAHAGYTN  290

Query  213   LQLKI  199
             L+LKI
Sbjct  291   LELKI  295



>ref|XP_008796323.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Phoenix dactylifera]
Length=325

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 193/254 (76%), Gaps = 0/254 (0%)
 Frame = -3

Query  957  PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLS  778
            P+D NSK G  +ARY+ K A GYFP+ +++ED +AF+ N+AYV   EPHS++PIG ++L 
Sbjct  72   PVDDNSKLGQAYARYVGKYAPGYFPVTVHMEDARAFDQNKAYVLAAEPHSVFPIGCLSLL  131

Query  777  AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQ  598
            +FTG MPL K K L STA+F TP +R + TW+G+ PA K++F   L +GYSCI++PGGVQ
Sbjct  132  SFTGLMPLSKTKALASTAMFCTPFLRQMSTWMGLVPATKKNFIRYLEAGYSCIIIPGGVQ  191

Query  597  EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAV  418
            E  YM H+ E  FLK R+GFVQ+A++ G+PLVPVFCFGQ+NVY WWKP  K Y+  +RA+
Sbjct  192  EIIYMNHNYEVAFLKRRRGFVQVAIETGSPLVPVFCFGQTNVYKWWKPQGKFYIHVARAI  251

Query  417  KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
            +F P++FWG  GS +P+++PI ++VG+PIE+ +N  P+ E++A +H+RF+ A+ +LF ++
Sbjct  252  RFAPLIFWGAFGSPIPYRKPIDIIVGRPIEIRQNLNPSREEVAEVHARFVSAIEKLFVRY  311

Query  237  KKRLGYVDLQLKIM  196
            ++  G  +++LKI+
Sbjct  312  REVTGLNNIELKIV  325



>gb|AFW86522.1| hypothetical protein ZEAMMB73_897295 [Zea mays]
Length=304

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 202/294 (69%), Gaps = 5/294 (2%)
 Frame = -3

Query  1155  NEAAPPPTPAE----FIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIM  991
             N AA  P   E     +   +  SL  T + LA WLG     V++VLAS+  L    A +
Sbjct  8     NRAAEKPRDGEGGEARVFRCTDYSLPRTTLALALWLGGIHFNVLLVLASLFLLSGRAAAI  67

Query  990   VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
             V+    L MF P++   KWG   AR++C+ A GYFP+ L+VED K+ +P+RAYVFGYEPH
Sbjct  68    VVAFQLLFMFAPVNDRDKWGQSVARFICRHAMGYFPITLHVEDYKSLDPSRAYVFGYEPH  127

Query  810   SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
             S+ PIG+  L+   GF+PL KIK L S+AVFYTP +R IWTWLG+ PA +++F   L +G
Sbjct  128   SVLPIGLSALADLVGFLPLTKIKVLASSAVFYTPFLRQIWTWLGLVPATRKNFYCYLGAG  187

Query  630   YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPS  451
             YSCIVVPGGV+E  +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P 
Sbjct  188   YSCIVVPGGVREMLHMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWWRPG  247

Query  450   SKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLA  289
              KL++K +RAVKFTPI+FWG  G+  PF +P+HVVVGKPIEV K   PT +++ 
Sbjct  248   GKLFIKIARAVKFTPIIFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEVG  301



>gb|AAQ89590.1| mono- or diacylglycerol acyltransferase [Spirodela polyrhiza]
Length=322

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 211/314 (67%), Gaps = 0/314 (0%)
 Frame = -3

Query  1137  PTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFI  958
             P P   +  A+  S + +L+       P ++   +    ++   T ++ +IG L LL+F+
Sbjct  9     PAPETVVVKANGRSAIRSLVATMLWVCPIALTAFLCLVALYCRSTASLWIIGFLLLLVFV  68

Query  957   PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLS  778
             P+   SK+G     ++ + + GYF ++++ ED+KAF+ +R+YV   EPHSI+PIG V+L 
Sbjct  69    PVSDKSKYGRAIGSFVGRYSPGYFHVNVHFEDVKAFDDSRSYVIAAEPHSIFPIGAVSLL  128

Query  777   AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQ  598
               TG MPL K K L STA+F TP +R + TW+G+ PA +++F + L +GYSCIV+PGGVQ
Sbjct  129   NITGLMPLTKSKVLASTAIFCTPFLRQVTTWMGLVPATRKNFVNYLKAGYSCIVIPGGVQ  188

Query  597   EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAV  418
             E  YM  D E  +LK R GFV++A++ G+PLVPVFCFGQ+  ++WWKP  +LY++ SRA+
Sbjct  189   EIIYMNKDYEVAYLKKRHGFVRVAIETGSPLVPVFCFGQNEAFSWWKPGGRLYVRLSRAI  248

Query  417   KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             +F P++FWG +GS +P++ PI VVVGKP+EV +N  P+ E++A LH++F+  +  LF K+
Sbjct  249   RFAPLVFWGVLGSPIPYRSPIDVVVGKPMEVKQNPNPSAEEVAELHAQFLSNVETLFSKY  308

Query  237   KKRLGYVDLQLKIM  196
             ++  G    +L+I+
Sbjct  309   RESTGNAGAELRIL  322



>gb|KEH40833.1| diacylglycerol acyltransferase type 2 [Medicago truncatula]
Length=314

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 208/308 (68%), Gaps = 2/308 (1%)
 Frame = -3

Query  1116  GTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSK  937
              T S+N L   + +    G     + ++L ++ FLP +KA++V  LL + M +P ++NS 
Sbjct  8     NTKSSNRLKSVVALALCFGAIHFNIALILFALFFLPLSKALLVFALLIVFMVLPANKNSY  67

Query  936   WGLRFARYLCKQASGYFPMHLYVEDI-KAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFM  760
              G + +R++ K    YFP+ L+++D  +AF PN++YVF YEPHS++P G+  L     F 
Sbjct  68    LGRKISRFIGKHVRSYFPITLHLDDDPQAFHPNQSYVFAYEPHSVFPFGIFALLDNVDF-  126

Query  759   PLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYME  580
             P+P I+ L S++VFY P +R +W WLG +   K++  SLL +G SC++VPGG +E  +ME
Sbjct  127   PIPNIRFLVSSSVFYIPFLRQVWIWLGFTSVDKKNLISLLEAGNSCMLVPGGNRETLFME  186

Query  579   HDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPIL  400
             H  E +FLK R+GFV+IAM+MG PLVPVFCFGQ+  Y WWK   KL    +R++K   ++
Sbjct  187   HGFENVFLKERRGFVRIAMEMGHPLVPVFCFGQTKTYKWWKVPGKLIENIARSLKTIQLI  246

Query  399   FWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
             FWG +GS +PF+ P++V VG+PI+V K  +PT EQ+A +HS F+EAL +LFE+HK + GY
Sbjct  247   FWGVLGSPIPFKNPLYVAVGRPIQVEKILEPTREQVAKVHSEFLEALQDLFERHKTQAGY  306

Query  219   VDLQLKIM  196
              +L+LK +
Sbjct  307   TNLKLKFV  314



>ref|XP_001777726.1| predicted protein [Physcomitrella patens]
 gb|EDQ57506.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 201/299 (67%), Gaps = 0/299 (0%)
 Frame = -3

Query  1095  LLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFAR  916
             L   + M+ WLG      +V +  ++ LP   AI ++ +   LMF+P + ++  G + AR
Sbjct  10    LWSIIAMVMWLGGFHINFIVGILCLVHLPSPWAITILAIWVTLMFLPAEYDTPMGSKVAR  69

Query  915   YLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGL  736
             ++   A  YFP+ +  ED  AF+PN++YV   EPHS+ PIG+V L+  +G +P+  ++ L
Sbjct  70    FIVTHAKNYFPIKVIFEDESAFDPNQSYVIAAEPHSVLPIGIVVLTPQSGILPVNNLRAL  129

Query  735   GSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFL  556
              S+AVF++PV+RHIWTWLG++P  ++SF + L  G SCIVVPGGVQE  +ME   E +FL
Sbjct  130   ASSAVFWSPVVRHIWTWLGVAPVSRKSFTAFLQKGISCIVVPGGVQECLFMEDHREVVFL  189

Query  555   KSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSF  376
             K R GFV+IAM+ G+PLVP FCFGQ N Y WWKP+ K Y + SRA+ FTP++FWG  G  
Sbjct  190   KQRYGFVRIAMEAGSPLVPTFCFGQRNAYKWWKPTGKWYNQLSRAIGFTPLVFWGRYGGP  249

Query  375   VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
             VP++ P++ VVGKPI V K + P++E+++ +  +FIEAL  LFEKHK  L + D  L +
Sbjct  250   VPYRTPMYYVVGKPIPVPKTTNPSQEEVSVILGQFIEALEALFEKHKGSLEFEDDTLLV  308



>ref|XP_003629046.1| 2-acylglycerol O-acyltransferase [Medicago truncatula]
Length=355

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/321 (47%), Positives = 208/321 (65%), Gaps = 38/321 (12%)
 Frame = -3

Query  1044  VVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVE  865
             + ++L +I FL F+KA+++ G L LLM +P+D+NS  G + +R++CK    YFP+ L++E
Sbjct  35    LALILFAIFFLSFSKALLLFGFLMLLMILPVDKNSLLGQKLSRFICKHVCSYFPITLHLE  94

Query  864   DIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAV------------  721
             D +AF  N+ YVF YEPHS++P G+  L     FMP+P I+ L S+AV            
Sbjct  95    DAEAFHLNQPYVFCYEPHSVFPFGIFALHDNIDFMPIPNIRFLVSSAVRLLLSSFIFFTK  154

Query  720   ------------------FYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQE  595
                               FY P +R IWTWLG S   K++  SLL +G SCI+VPGG++E
Sbjct  155   SKNLFTSDSFINEKYGQAFYIPYLRQIWTWLGFSYVTKKNLISLLVAGESCIIVPGGMRE  214

Query  594   AYYMEHDCE--------TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
               +MEH CE         ++LK RKGFV+IAM+MG PLVPVFCFGQ+N+Y WWK S KL 
Sbjct  215   TLFMEHGCEVHYLSNAKNVYLKERKGFVRIAMEMGHPLVPVFCFGQTNIYKWWKASGKLI  274

Query  438   LKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
                + ++K  P++FWG  GS VPF+ P++VVVGKPI+V K  +PT EQ+A +HS F+EAL
Sbjct  275   QNLASSMKIFPLIFWGKFGSPVPFKNPLYVVVGKPIQVEKIPEPTSEQVAKVHSEFVEAL  334

Query  258   LELFEKHKKRLGYVDLQLKIM  196
              ELFE+HK + G  +L+LKI+
Sbjct  335   QELFERHKTQAGCTNLELKIV  355



>gb|ACV40232.1| type 2 acyl-CoA diacylglycerol acyltransferase [Vernonia galamensis]
Length=338

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 199/294 (68%), Gaps = 4/294 (1%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLAS-IIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASG  892
             W+G    I+ ++  S I+F P T A MVIG   +LM +P+D+NSK+GLR   Y+ K   G
Sbjct  46    WIGSIHFILFLLFISYILFSPPTSA-MVIGFQVILMVLPLDENSKFGLRIFSYVSKYVMG  104

Query  891   YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYT  712
             +FP+ LYVED+K F+ NRAYVFG+ PHS++P+G+  L      +P+P IK L S  +F T
Sbjct  105   HFPVTLYVEDMKCFQSNRAYVFGFHPHSVFPLGVAILCEHLAVIPIPNIKFLTSNPIFRT  164

Query  711   PVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET--MFLKSRKGF  538
             PV+R IW+W G   A K++F + LS+GY+C+V+PGGVQE  +M    E+  +F+  RKGF
Sbjct  165   PVLRQIWSWCGAIAASKKNFTAYLSAGYTCVVIPGGVQEILHMRQGAESDNVFISRRKGF  224

Query  537   VQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRP  358
             +++A++  TPLVPVF FGQ++ Y WW+P  + Y+  +RA++F P +FWG +GS +P + P
Sbjct  225   IKVAIQTVTPLVPVFFFGQAHTYKWWRPKCEFYVLKARAIRFGPTVFWGRLGSHLPCKNP  284

Query  357   IHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
               VVVG+PI V K  +PT ++++     +  +L  LF+K+K  +G+  L+LKI+
Sbjct  285   TVVVVGRPITVEKTLKPTIDEISKFQREYTVSLRNLFDKYKTEIGHPGLELKIL  338



>gb|AFW86523.1| hypothetical protein ZEAMMB73_897295 [Zea mays]
Length=270

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 180/263 (68%), Gaps = 5/263 (2%)
 Frame = -3

Query  1155  NEAAPPPTPAE----FIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLPFTKAIM  991
             N AA  P   E     +   +  SL  T + LA WLG     V++VLAS+  L    A +
Sbjct  8     NRAAEKPRDGEGGEARVFRCTDYSLPRTTLALALWLGGIHFNVLLVLASLFLLSGRAAAI  67

Query  990   VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
             V+    L MF P++   KWG   AR++C+ A GYFP+ L+VED K+ +P+RAYVFGYEPH
Sbjct  68    VVAFQLLFMFAPVNDRDKWGQSVARFICRHAMGYFPITLHVEDYKSLDPSRAYVFGYEPH  127

Query  810   SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
             S+ PIG+  L+   GF+PL KIK L S+AVFYTP +R IWTWLG+ PA +++F   L +G
Sbjct  128   SVLPIGLSALADLVGFLPLTKIKVLASSAVFYTPFLRQIWTWLGLVPATRKNFYCYLGAG  187

Query  630   YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPS  451
             YSCIVVPGGV+E  +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P 
Sbjct  188   YSCIVVPGGVREMLHMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWWRPG  247

Query  450   SKLYLKFSRAVKFTPILFWGYMG  382
              KL++K +RAVKFTPI+FWG  G
Sbjct  248   GKLFIKIARAVKFTPIIFWGRFG  270



>ref|XP_001758758.1| predicted protein [Physcomitrella patens]
 gb|EDQ76264.1| predicted protein [Physcomitrella patens]
Length=313

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/295 (42%), Positives = 190/295 (64%), Gaps = 0/295 (0%)
 Frame = -3

Query  1098  SLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFA  919
              +L  L ++ W+G     V+VV   +  L    A+ ++     L+FIP+  N   G   A
Sbjct  13    DVLTFLAIVVWMGGLHLNVLVVGICLANLRSHWALTLLAFWIALIFIPVRPNGGLGQAVA  72

Query  918   RYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKG  739
             RY+CK A  YFP+ +  +D  AF+  ++YVF  EPHS+ PIG++ L   +G +P+P ++ 
Sbjct  73    RYICKYAPAYFPIKVVFDDENAFDSKKSYVFAAEPHSLLPIGIIALQPLSGNLPVPNLRA  132

Query  738   LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMF  559
             L ++AVF+TPV+RH+W+WLG+S   ++     L  G S I++PGGVQE  YME   E ++
Sbjct  133   LATSAVFWTPVVRHVWSWLGVSRVTRKFMTEFLQKGTSVIIIPGGVQECLYMERGREVVY  192

Query  558   LKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGS  379
             LK R GFV++A++ G+ +VP FCFGQ+N Y WWKP+ + Y + SR + FTP++FWG  G+
Sbjct  193   LKKRYGFVKVALETGSLIVPTFCFGQTNCYKWWKPTGQWYSRLSRRIGFTPLVFWGRYGT  252

Query  378   FVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
              +PF+ P+  V+GKPIEV +N   + E++A +  ++IEA+  L+E HK  LG+ D
Sbjct  253   PIPFRTPMTYVIGKPIEVVRNPNASHEEVAKVLEQYIEAVERLYENHKAALGFKD  307



>gb|KCW53319.1| hypothetical protein EUGRSUZ_J02571 [Eucalyptus grandis]
Length=189

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  762  MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
            MPLPKIK L S+AVFYTP +RHIWTW G +PA K++F SLL +GYSCI+VPGG+QE   M
Sbjct  1    MPLPKIKFLASSAVFYTPFLRHIWTWCGFTPAAKRNFISLLGAGYSCIIVPGGIQEVLLM  60

Query  582  EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
            E + E  F++SRKGFV+IAM+MG PLVPVFC+GQS VY WWKP  KLY +FSRA+KF  I
Sbjct  61   ERESEIAFVQSRKGFVRIAMEMGCPLVPVFCYGQSKVYQWWKPGGKLYQQFSRALKFPLI  120

Query  402  LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             FWG  GS +PF+ P+HVVVG+PIE+ K S+PT E++  +H +F+EA  +LFE+HK R+G
Sbjct  121  PFWGVFGSLIPFRNPMHVVVGRPIELEKISKPTMEEVNEVHGKFVEAFRDLFERHKARVG  180

Query  222  YVDLQLKIM  196
            + DL+LKI+
Sbjct  181  HTDLKLKIL  189



>dbj|BAK03129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 168/258 (65%), Gaps = 7/258 (3%)
 Frame = -3

Query  1182  GNVQHRSPSNEAAPPPTPAE-FIGTASANSLLMTLMMLA-WLGVPPSIVVVVLASIIFLP  1009
             G ++   P  +       A  F GT    SL  T+  LA WLG     V+++LAS+   P
Sbjct  5     GALEEERPRADGGDEEGGATVFRGTNY--SLPRTIAALALWLGGIHFNVLLILASLFLFP  62

Query  1008  FTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYV  829
                A +V+ L  + MFIP++   K G +  R++CK A GYFP+ L+VED +AF+ +RAYV
Sbjct  63    LRLAALVVALQLMFMFIPLNDEDKLGRKIGRFICKYAMGYFPISLHVEDYEAFDSSRAYV  122

Query  828   FGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFK  649
             FGYEPHS+ PIG+  L+   GFMPLPK+K L S+AVF+TP +R IWTW+G+  A +++F 
Sbjct  123   FGYEPHSVLPIGVAALANHVGFMPLPKLKVLASSAVFHTPFLRQIWTWIGLIAATRKNFY  182

Query  648   SLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSN--  475
             S L++GYSC+VVPGG+QE  +M+HD E  FLKSRKGFV+IAM+ G PLVPVFCFGQ    
Sbjct  183   SYLAAGYSCVVVPGGIQEILHMDHDSEVAFLKSRKGFVKIAMQSGCPLVPVFCFGQVARL  242

Query  474   -VYNWWKPSSKLYLKFSR  424
               Y+ + P      KF +
Sbjct  243   FFYSGYVPPDCFNCKFRK  260



>gb|EAZ36838.1| hypothetical protein OsJ_21181 [Oryza sativa Japonica Group]
Length=317

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 173/327 (53%), Gaps = 83/327 (25%)
 Frame = -3

Query  1086  TLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFAR---  916
             T+ +  WLG     V +VLAS+   P   A MV+    L M IP++   K G + AR   
Sbjct  44    TVALALWLGGIHFNVFLVLASLFLFPLRVAAMVVAFQLLFMLIPLNDKDKLGRKIARNVA  103

Query  915   ---------------------------YLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYE  817
                                        ++C+ A GYFP+ L+VED K F+PNRAYVFG+E
Sbjct  104   PFPPIAENFSHLFLGCWTDREHVPCCRFICRYAMGYFPISLHVEDYKCFDPNRAYVFGFE  163

Query  816   PHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS  637
             PHS+ PIG+  L+   GFMPLPKIK L S+AVFYTP +R IWTWLG+ PA +++F+S L 
Sbjct  164   PHSVLPIGVAALADLVGFMPLPKIKVLASSAVFYTPFLRQIWTWLGLIPATRKNFQSYLG  223

Query  636   SGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK  457
             +GYSCI+VPGGVQE  +M+HD E   L++ K                             
Sbjct  224   AGYSCIIVPGGVQEILHMDHDSEANPLQNYKR----------------------------  255

Query  456   PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHS  277
                            TPI          PF  P+HVVVG+PIEV KNSQPT +++  +H 
Sbjct  256   ---------------TPI----------PFPTPMHVVVGRPIEVEKNSQPTIDEINEVHE  290

Query  276   RFIEALLELFEKHKKRLGYVDLQLKIM  196
             +F  AL +LF+K+K   GY  L L+++
Sbjct  291   QFTVALQDLFDKYKTETGYPGLHLRVL  317



>emb|CBI37485.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 154/242 (64%), Gaps = 7/242 (3%)
 Frame = -3

Query  1197  MEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             MEE+    Q  S S+E     T A   G    + +     +  WLG    I  +VL + +
Sbjct  200   MEER--KEQRVSSSSE---EETVAALRGRREDSIIHAIEALTLWLGAIHFIFALVLKAFL  254

Query  1017  FLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNR  838
             FL    A+ + GLL +   IP++   K+G + +RY+C+    YF + L+VEDI AF+PN 
Sbjct  255   FLSVPVALTIFGLLLVFTVIPVNDKCKFGRKLSRYICENGCSYFRVTLHVEDINAFDPNH  314

Query  837   A--YVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAG  664
                 +FGYEPHSI     V L+ FTGFMPLP+IK L  +AVFYTP ++H+WTWLG +PA 
Sbjct  315   MPMVIFGYEPHSILLTSFVALADFTGFMPLPRIKFLAISAVFYTPFLQHVWTWLGFTPAA  374

Query  663   KQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
             K+ F SLL SG+SCI+VPGGVQE   MEH CE  FLKSRKGFV IAM+MG  LVPVFCFG
Sbjct  375   KKIFTSLLGSGHSCIIVPGGVQEPCLMEHGCEIAFLKSRKGFVHIAMEMGRSLVPVFCFG  434

Query  483   QS  478
             Q+
Sbjct  435   QA  436



>ref|XP_010270588.1| PREDICTED: diacylglycerol O-acyltransferase 2-like isoform X3 
[Nelumbo nucifera]
Length=284

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 160/271 (59%), Gaps = 38/271 (14%)
 Frame = -3

Query  1200  YMEEKGGNVQHRSPSNEAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASI  1021
             +M E  G+   R  S  A   PT  +       +SLL  +  LA L  P  +VV ++   
Sbjct  4     FMPETIGD---REKSVNAGDEPTVIQ----RKESSLLQMVTALALLLGPLHLVVALIFMA  56

Query  1020  IFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPN  841
              FLP   A  +  LL     +PI+  SK G   A Y+C     YFP+ L+VEDIKAFE  
Sbjct  57    CFLPNYLAFSIFVLLLFFTVLPINDESKLGRTLAWYICYHCCAYFPVTLHVEDIKAFESK  116

Query  840   RAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAV--------------------  721
             RAYVFGYEPHS++PIG+V+L  FT FM LPKIK L S+AV                    
Sbjct  117   RAYVFGYEPHSVFPIGVVSLVDFTEFMHLPKIKLLASSAVRFLPLMPVRYGIKQNRMVKQ  176

Query  720   -----------FYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHD  574
                        FYTP +RHIWTWLGI+PA K++F SLL +G+SCIVVPGGVQEA  M+H 
Sbjct  177   DLCSRPYKVGIFYTPFLRHIWTWLGITPATKRNFTSLLEAGHSCIVVPGGVQEACLMKHG  236

Query  573   CETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
              E +F+K+RKGF++IA++ G PLVPVFCFGQ
Sbjct  237   SEIVFVKARKGFIRIAIQTGRPLVPVFCFGQ  267



>gb|KHN41793.1| Diacylglycerol O-acyltransferase 2 [Glycine soja]
Length=161

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 8/162 (5%)
 Frame = -3

Query  966  MFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV  787
            M +PI+Q S++G   +R++CK A  YFP+ L+VED+KAF+PNRAYVFGYEPHS+ PIG+V
Sbjct  1    MVLPINQKSRFGRNLSRFICKHACNYFPITLHVEDMKAFDPNRAYVFGYEPHSVLPIGIV  60

Query  786  TLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
             L+  TGFMPLPK+K L +         RH WTWLG++PA K+ F SLL+SG+SCI++PG
Sbjct  61   ALAEHTGFMPLPKVKVLLAA--------RHTWTWLGLTPATKKIFISLLASGHSCILIPG  112

Query  606  GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
            GVQEA+ M+   E  FLK+R+GFV+I M  G PLVPVFCFGQ
Sbjct  113  GVQEAFLMQRGTEIAFLKARRGFVRITMVKGRPLVPVFCFGQ  154



>ref|XP_005647498.1| DAGAT-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE22954.1| DAGAT-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=319

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/300 (39%), Positives = 171/300 (57%), Gaps = 9/300 (3%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPID-QNSKWGLRFARYLCKQASG  892
             W+G   + V+ ++ ++  LP   A+  + L+ L + IP+D    +W     R+  +QA+ 
Sbjct  20    WVGALFATVLSLIVALWNLPDPYAVAWLALMGLSLAIPLDLPTPRWARALTRFSLEQAAK  79

Query  891   YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM-VTLSAFTGFMP--LPKIKGLGSTAV  721
             Y  + L +ED  A  P R YV GYEPHS  P  + +     +  +P  L  +K L ++A 
Sbjct  80    YHDLSLIIEDPAALRPGRPYVVGYEPHSALPTALPMVFCEHSPIVPPALKSVKTLATSAC  139

Query  720   FYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKG  541
             FY PV+RH+W WLG  PA     + +LS G S +V PGGV+E  +ME   E +FL  R G
Sbjct  140   FYCPVVRHLWWWLGGRPASAAVMRGMLSKGDSALVCPGGVRECLHMEKGREAVFLSGRTG  199

Query  540   FVQIAMKMGTPLVPVFCFGQSNVYNWWK---PS--SKLYLKFSRAVKFTPILFWGYMGSF  376
             FV+IAM+ G PLVPVF FGQ++ Y W K   P+   +L  + +RA+ F P+  +G  G+ 
Sbjct  200   FVRIAMQYGAPLVPVFVFGQTDAYGWAKLGPPAVPQELAERLARAIGFLPLFMYGVWGTP  259

Query  375   VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +P +  I +V+GKPIEV K  QP+  ++      F + L  LFE+HK   GY  LQL I+
Sbjct  260   LPRKVKITMVIGKPIEVPKTEQPSSAEVEKYLDTFKQELSALFERHKVAAGYPKLQLLII  319



>ref|XP_004172576.1| PREDICTED: diacylglycerol O-acyltransferase 2-like, partial [Cucumis 
sativus]
Length=177

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  1068  WLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGY  889
             WLG       + L S+ +L  +KA++V  LL +L+ IP+D  SK+G   ARY+C+ A  Y
Sbjct  11    WLGGIHLNFALGLISLFYLSLSKALLVFALLLILVLIPVDHKSKYGRVLARYICQNACSY  70

Query  888   FPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTP  709
             FP+ L+VEDI AF+ NRAYVFGYEPHS+ PIG+V L+  TGFMPL K+K L S+AVFYTP
Sbjct  71    FPVTLHVEDIHAFDTNRAYVFGYEPHSVLPIGVVALADLTGFMPLKKLKVLASSAVFYTP  130

Query  708   VMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
              +RHIWTW+G++PA +++F SLL++GYSCI+VPGGVQE ++MEH+ E
Sbjct  131   FLRHIWTWMGLTPATRKNFISLLAAGYSCIIVPGGVQETFHMEHNSE  177



>ref|XP_002503155.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64413.1| predicted protein [Micromonas sp. RCC299]
Length=330

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 176/317 (56%), Gaps = 15/317 (5%)
 Frame = -3

Query  1101  NSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN-SKWGLR  925
             +S+   L++  WL      + ++ AS+ FLP   A+  +  L  L+ +P+ +   +WG+ 
Sbjct  14    DSMWNILLITTWLCTAHIALALLAASLYFLPHPLAVGTLASLIALVLLPVRRPFPRWGIA  73

Query  924   FARYLCKQASGYFPMHLYVED----IKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMP  757
              AR +   A  YFPM L  ED    ++A       + G EPH + P+ +++ + +  + P
Sbjct  74    IARAITYAAMDYFPMSLEWEDQPSFVEASVKGVPSIIGCEPHGVLPLSIISFADYCYYGP  133

Query  756   -----LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEA  592
                  + + + L ++ +FY P++R +W+WLGI P  +   ++ L  G S +++PGGV E 
Sbjct  134   ETPSIVKETRALATSTIFYIPLLRQLWSWLGIDPISRAHMRAQLERGRSVLMIPGGVAEC  193

Query  591   YYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK-----PSSKLYLKFS  427
               M   CET++L+ R GFV++A++ G  LVP + FGQ+  Y++WK      S     + +
Sbjct  194   LRMTPKCETVYLRKRFGFVKMAIQTGAQLVPAYSFGQTRTYSYWKLGPPLCSDATTARLA  253

Query  426   RAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
             + +   P+ FWG  GS +P Q  IH VVGK I V K + PT E +AA    FI A+ +LF
Sbjct  254   KIIGLAPMTFWGRWGSPMPRQEKIHTVVGKAIPVEKRADPTNEDVAAKLEEFIGAVKDLF  313

Query  246   EKHKKRLGYVDLQLKIM  196
             E+H+   GY D++L ++
Sbjct  314   ERHRGENGYGDVELVVL  330



>ref|XP_007046428.1| Diacylglycerol acyltransferase family isoform 4 [Theobroma cacao]
 gb|EOX90585.1| Diacylglycerol acyltransferase family isoform 4 [Theobroma cacao]
Length=222

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -3

Query  1125  EFIGTAS--ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPI  952
             EF G     +N++   L M  WLG      +++L S +FLPF+K ++V GLL L M +PI
Sbjct  16    EFSGRHEFPSNTMHALLAMGIWLGAIHFNALLLLFSFLFLPFSKFLVVFGLLLLFMILPI  75

Query  951   DQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAF  772
             D  SK+G R +RY+CK A  YFP+ L+VEDI AF P+RAYVFG+EPHS+ PIG+V L+  
Sbjct  76    DPYSKFGRRLSRYICKHACSYFPITLHVEDIHAFHPDRAYVFGFEPHSVLPIGVVALADL  135

Query  771   TGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEA  592
             TGFMPLPKIK L S+AVFYTP +RHIWTWLG++PA K++F SLL +GYSCI+VPGGVQE 
Sbjct  136   TGFMPLPKIKVLASSAVFYTPFLRHIWTWLGLTPATKKNFSSLLDAGYSCILVPGGVQET  195

Query  591   YYMEHDCETMF  559
             ++ME   E + 
Sbjct  196   FHMEPGSEDLL  206



>ref|XP_003083539.1| putative mono-or diacylglycerol acyltransfe (ISS) [Ostreococcus 
tauri]
 emb|CAL58088.1| Diacylglycerol acyltransferase [Ostreococcus tauri]
Length=325

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/324 (34%), Positives = 179/324 (55%), Gaps = 23/324 (7%)
 Frame = -3

Query  1104  ANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLR  925
             + S++   ++L WLG+  ++VVVV+ +I+ L   +A+ V+  L  L  +P     +WG+ 
Sbjct  2     SRSIVDHGVLLVWLGLFHALVVVVVVAIVALERRRAMTVLAALMSLSVVPRRIRPRWGVT  61

Query  924   FARYLCKQASGYFPMHLYVEDIKAF----EPNRAYVFGYEPHSIWPIGMVTLSAFTGF--  763
              AR + + A  YFP  L  E+ +A+          + G EPH   P+ ++  + +  F  
Sbjct  62    LARAITRTAKSYFPCALTFENEEAYLKGARKGVGRLVGLEPHGALPLSVIAFADYFMFDE  121

Query  762   ----------MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
                             + L S A+F+ P++RH+WTWLG+ P  ++   S+LS G +C++V
Sbjct  122   DGIEARGMNHAASMNSRALASGAIFHVPLVRHLWTWLGLEPISRRRMTSMLSDGSTCVIV  181

Query  612   PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK------PS  451
             PGGV E   ME   ET++LK R GFV+IA++ G  LVP + FGQ+  Y +W+      P+
Sbjct  182   PGGVAECMAMERGVETLYLKRRYGFVKIAIQTGAALVPAYTFGQTRAYKYWRLGPPLVPT  241

Query  450   SKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
             S +   FS+   F P++FWG   + +P+  P+H VVG+ IE  +N  P+ E++ A    F
Sbjct  242   S-VANWFSKTFSFAPMVFWGKWFTPIPYATPLHTVVGELIETTQNDNPSREEVQAKLDEF  300

Query  270   IEALLELFEKHKKRLGYVDLQLKI  199
             I A+  L+++HK   GY D+ L +
Sbjct  301   IVAMRSLYDRHKSAHGYADVDLVV  324



>ref|XP_003061169.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54819.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   196 bits (497),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 181/333 (54%), Gaps = 16/333 (5%)
 Frame = -3

Query  1149  AAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
             AAP       + T S  SL   LMM AWLGV  ++V +V  +  FLP   A   I L+ L
Sbjct  3     AAPASARDPALATGS-GSLYNHLMMFAWLGVVHAVVALVAVACYFLPHPVATCAIALVAL  61

Query  969   LMFIPIDQ-NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRA----YVFGYEPHSI  805
                 P+   +  WGL  AR + K A  YFP+ +  ED +A+    A     V G EPHS+
Sbjct  62    AALTPVTTPHPAWGLAIARAITKAAVRYFPLTMEWEDERAYLDAAAKGVPAVIGLEPHSV  121

Query  804   WPIGMVTLSA---FTGFMP--LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
              P+ +V       FT   P  +   + L +  +F  PV++H+W+WLG+    +++ K+LL
Sbjct  122   LPLSIVAFGNYFFFTESTPECVRNSRALATGTIFVIPVLKHLWSWLGMDAISRRAMKTLL  181

Query  639   SSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW  460
               G S +++PGGV E   M    ET++LK R GFV++A++ G  LVP F FGQ+  Y++W
Sbjct  182   DDGRSVLIIPGGVAECLQMRPGVETIYLKKRFGFVKLAIQTGASLVPAFTFGQTRSYSYW  241

Query  459   KPSSKLYLK-----FSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQ  295
             +    L        F+RA +  P++FWG  GS +P   P+H VVGKPI V K S+P+ E 
Sbjct  242   RLGPPLVPHVVAEVFARACRVAPMVFWGKWGSPIPNMVPMHTVVGKPIPVKKQSEPSNEY  301

Query  294   LAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +    + F+ A+  L+ +HK + GY +  L ++
Sbjct  302   VQEKLNEFVAAMESLYARHKGKHGYAESTLVVL  334



>ref|XP_001421576.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99869.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=316

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/315 (34%), Positives = 166/315 (53%), Gaps = 22/315 (7%)
 Frame = -3

Query  1077  MLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNS-KWGLRFARYLCKQ  901
             M AWLG+    V V   ++  LP   A+  +  L     IP    + +WG R AR + + 
Sbjct  1     MFAWLGLIHVDVAVTALAVWTLPSAMAVTALATLVAAAAIPRTVATPRWGARLARAVTRT  60

Query  900   ASGYFPMHLYVED----IKAFEPNRAYVFGYEPHSIWPIGMVTLSAF----------TGF  763
             A+ YFP  L  ED    ++A     A V G EPH + P+ +++ + +           G 
Sbjct  61    ATAYFPTRLEFEDEEAYLRAVRNEEACVIGLEPHGVLPLSVISFAEYFMHDEEGARRRGL  120

Query  762   MPLPKIKGLGSTA--VFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAY  589
              P  +       +  +F  P+++H+WTWLG+ P  K     +L +G + +++PGGV E  
Sbjct  121   TPAARRGARALASAAIFKVPLVKHLWTWLGLDPISKACMLRMLRAGKTAVIIPGGVAECM  180

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF-----SR  424
              ME   ET++L+ R GFV+IA+  G  L+P + FGQS  Y +W+    +  KF      +
Sbjct  181   AMERGVETLYLRKRYGFVKIAIVTGAKLIPAYTFGQSRTYGYWRLGPPIVPKFVADWIGK  240

Query  423   AVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFE  244
                F PI+FWG   + +P+   ++ VVGKPIEV KN  P++E++ A    FI+A+  L++
Sbjct  241   TFSFAPIIFWGKFCTPIPYATALNTVVGKPIEVEKNPDPSKEEVQAKLDEFIDAMRSLYD  300

Query  243   KHKKRLGYVDLQLKI  199
              HK R GY D++L I
Sbjct  301   SHKARFGYEDVRLVI  315



>gb|KFM22531.1| Diacylglycerol O-acyltransferase 2 [Auxenochlorella protothecoides]
Length=337

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 161/278 (58%), Gaps = 16/278 (6%)
 Frame = -3

Query  987  IGLLFLLMFIPID-QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAF-EPNRAYVFGYEP  814
            + LL + +F P+D    K+  R+ RY    AS Y+P+ +     +AF +  + +V GYEP
Sbjct  60   LALLVIALFTPLDVPCPKFMTRYLRYCTTAASEYYPVTIRYVKREAFKDTKKPFVIGYEP  119

Query  813  HSIWPIGMVTLSAFTGFMPLPKIKG---LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSL  643
            HS+ P  M    +      LP+++    L S+A F+ P+ RH+W WLG  P  + SF + 
Sbjct  120  HSVMPQAMSMFGSQPHPDVLPELQHARLLASSAGFWAPLTRHLWWWLGARPVSRDSFAAQ  179

Query  642  LSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNW  463
            L SG S  + PGGVQE  YME   E ++L+ R+GFV++A++ GTPLVPVF FGQ+  Y++
Sbjct  180  LRSGSSVALCPGGVQECLYMERGAEVVYLRRRRGFVRLALQHGTPLVPVFAFGQTETYSY  239

Query  462  ------WK----PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNS  313
                  W+    P SK Y  F R + + P+L +G +G+ +P + PI++V+G+PI V +  
Sbjct  240  VRPFIDWRTSLIPKSK-YFSFVRRIGYVPMLIFGSLGTAMPKKFPINIVIGEPIVVPRVD  298

Query  312  QPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
             P  EQ+     +FI A+  +FE +K   GY  L+L +
Sbjct  299  SPPPEQVEEYLQKFIAAMQGIFEGYKAECGYPTLKLIV  336



>ref|XP_006402203.1| hypothetical protein EUTSA_v10015808mg, partial [Eutrema salsugineum]
 gb|ESQ43656.1| hypothetical protein EUTSA_v10015808mg, partial [Eutrema salsugineum]
Length=124

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -3

Query  567  TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
             +FL SR+GFV+IAM+ GTPLVPVFCFGQS+VY WWKP  KLYLK SRA++FTPI FWG 
Sbjct  1    NVFLSSRRGFVRIAMEHGTPLVPVFCFGQSHVYKWWKPDWKLYLKLSRAIRFTPICFWGV  60

Query  387  MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GS +P+++P+ VVVGKPIEV K  QP+ E++A LH +F+EAL +LFE+HK R+GY DLQ
Sbjct  61   FGSPLPYRQPMDVVVGKPIEVSKTLQPSNEEIAKLHGQFVEALKDLFERHKARVGYSDLQ  120

Query  207  LKIM  196
            L I+
Sbjct  121  LNIL  124



>ref|XP_002957707.1| hypothetical protein VOLCADRAFT_77655 [Volvox carteri f. nagariensis]
 gb|EFJ41256.1| hypothetical protein VOLCADRAFT_77655 [Volvox carteri f. nagariensis]
Length=327

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 167/313 (53%), Gaps = 29/313 (9%)
 Frame = -3

Query  1122  FIGTASANSLLMTLMMLAWLGVPPSIVV--VVLASIIFLPFTKAIMVIGLLFLLMFIPID  949
             ++    A +LL+  ++ A+  + PS  V  V  A + F  FT   +V G L         
Sbjct  23    YVSAIYATALLLPAILTAFAVLGPSNTVPWVATALLAFCTFTPLHLVTGTL---------  73

Query  948   QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFT  769
                    RF ++  ++AS YFP  +  ED +AF  +  Y+FG+ PHS  P+ + T+  F+
Sbjct  74    -----SERFVQFSVRRASAYFPARIICEDAEAFRSDTGYLFGFCPHSALPVALPTV--FS  126

Query  768   GFMPL-PK-----IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPG  607
                PL PK       GL S+  F  P++R ++ WLG+ PA +   + LLS     +VVPG
Sbjct  127   TNSPLLPKALRGRTHGLASSVCFQVPIVRQLYWWLGVRPATRAVMRKLLSERRVAVVVPG  186

Query  606   GVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKP-----SSKL  442
             GVQE   M+H  E  +L SR GF++IA++ G P+VPV+ FGQ+  Y+W +P     SS L
Sbjct  187   GVQEVLRMQHGKEVAYLSSRTGFIRIAVQCGAPIVPVWAFGQTRAYSWIRPGPPLVSSWL  246

Query  441   YLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEA  262
               + SR     PI  +G  GS +P +  I VVVG+PI V +   P  E ++ L  +F+  
Sbjct  247   VSRISRTFGAVPIFMYGAYGSSMPHRERITVVVGRPIPVQQMDAPPPEVVSELLRKFMNE  306

Query  261   LLELFEKHKKRLG  223
             L  L++KHK + G
Sbjct  307   LQALYDKHKGQYG  319



>ref|XP_001693189.1| diacylglycerol acyl transferase [Chlamydomonas reinhardtii]
 gb|EDP03215.1| diacylglycerol acyl transferase [Chlamydomonas reinhardtii]
 gb|AGO32159.1| diacylglycerol acyltransferase type 2 [Chlamydomonas reinhardtii]
Length=327

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 146/249 (59%), Gaps = 15/249 (6%)
 Frame = -3

Query  927  RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
            RF ++   +A+ YFP  + V D +AF  +R Y+FG+ PHS  PI +    A T  + LPK
Sbjct  72   RFVQFSVARAAAYFPTRVVVTDPEAFRTDRGYLFGFCPHSALPIALPIAFATTSPL-LPK  130

Query  747  -----IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
                   GL S+  F  P++R ++ WLG+ PA +QS   LL +    ++VPGGVQE   M
Sbjct  131  ELRGRTHGLASSVCFSAPIVRQLYWWLGVRPATRQSISGLLRARKVAVLVPGGVQEVLNM  190

Query  582  EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPS-----SKLYLKFSRAV  418
            EH  E  +L SR GFV++A++ G PLVPV+ FGQ+  Y+W++P      + L  + SRA 
Sbjct  191  EHGKEVAYLSSRTGFVRLAVQHGAPLVPVWAFGQTRAYSWFRPGPPLVPTWLVERISRAA  250

Query  417  KFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNS----QPTEEQLAALHSRFIEALLEL  250
               PI  +G  G+ +P + P+ +VVG+PI V + +    +P  E LAAL  RF + L  L
Sbjct  251  GAVPIGMFGQYGTPMPHREPLTIVVGRPIPVPELAPGQLEPEPEVLAALLKRFTDDLQAL  310

Query  249  FEKHKKRLG  223
            ++KHK + G
Sbjct  311  YDKHKAQFG  319



>ref|XP_005843408.1| hypothetical protein CHLNCDRAFT_10860, partial [Chlorella variabilis]
 gb|EFN51306.1| hypothetical protein CHLNCDRAFT_10860 [Chlorella variabilis]
Length=227

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 140/240 (58%), Gaps = 22/240 (9%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGST-----  727
            YFPM +  ED  AF+ +R +V GYEPHS+ P+G      FT +   P    L +T     
Sbjct  2    YFPMTIEFEDKDAFKEDRPFVVGYEPHSVLPVGSCM---FTTYAQSPVPPSLTNTHIAVT  58

Query  726  -AVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEH--DCETMFL  556
              VF  P MR+   W+G   A ++  +S L+SG + ++ PGGVQE +YM+   D E +FL
Sbjct  59   GTVFLAPYMRNFLWWMGCRSASREVLQSSLASGTTVVLCPGGVQECFYMDPQPDREVVFL  118

Query  555  KSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSF  376
            K R GF+++AM+ G P+VPVF FGQ+  Y+           F R + + P+  WGY+GS 
Sbjct  119  KQRTGFIRLAMRAGAPVVPVFAFGQTPHYS-----------FVRRIGYVPMFVWGYLGSA  167

Query  375  VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            VP+Q P+H+VVGKPI V   + P+ E++     ++I AL  +FE+HK   G+ D  L I+
Sbjct  168  VPYQVPMHLVVGKPIHVPHRADPSPEEVWQHLEQYIAALAGIFERHKAAAGHPDATLTII  227



>ref|XP_006397051.1| hypothetical protein EUTSA_v10029434mg, partial [Eutrema salsugineum]
 gb|ESQ38504.1| hypothetical protein EUTSA_v10029434mg, partial [Eutrema salsugineum]
Length=124

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -3

Query  567  TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
             +FL SR+GFV+IAM+ GTPLVPVFCFGQS+VY WWKP  KLYLK SRA++FTPI FWG 
Sbjct  1    NVFLSSRRGFVRIAMEHGTPLVPVFCFGQSHVYKWWKPDWKLYLKLSRAIRFTPICFWGV  60

Query  387  MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GS +P+++P+ VVVGKPIEV K  QP+  ++A LH +F+E L +LFE+HK R+GY DLQ
Sbjct  61   FGSPLPYRQPMDVVVGKPIEVSKTLQPSNAEIAKLHGQFVEGLKDLFERHKARVGYSDLQ  120

Query  207  LKIM  196
            L I+
Sbjct  121  LNIL  124



>gb|AID16200.1| diacylglycerol acyltransferase type 2 [Ettlia oleoabundans]
Length=325

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/258 (38%), Positives = 148/258 (57%), Gaps = 16/258 (6%)
 Frame = -3

Query  927  RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAF-TGFMP--  757
            RF R+    A  YFP+ +  E       N  +V GYEPHS+ P G+     + T  +P  
Sbjct  68   RFLRFSMVAAYEYFPVKVVWEGEGDDYDNGPFVIGYEPHSVLPQGICIFCQYATDAVPRG  127

Query  756  LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEH  577
            L   + L S+A F+ P+MRH+W WLG  P  +  F++LL  G S  V PGG++E  YME 
Sbjct  128  LANTRILVSSAGFWAPIMRHLWWWLGCRPVSRNCFQALLKKGRSVAVCPGGIKECMYMER  187

Query  576  DC--ETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK----------PSSKLYLK  433
            +   E ++L+ R GFV++A++ G PLVPVF FGQ+++Y++ +          P ++ +  
Sbjct  188  ESGRECIYLRKRHGFVRLALQAGAPLVPVFAFGQTDLYSYCRLFFDWPRNLIPRAQ-WTS  246

Query  432  FSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLE  253
              R + + P++ WG+MGSF+P Q P+++VVGKPI V    +PT+EQ+     RFI  +  
Sbjct  247  IVRRLGYVPMIVWGWMGSFMPKQVPMYIVVGKPIPVPTVEEPTQEQVEEYLQRFISEMER  306

Query  252  LFEKHKKRLGYVDLQLKI  199
            LF +HK+   +    L I
Sbjct  307  LFAEHKEAASHPHASLTI  324



>gb|KDD73230.1| diacylglycerol acyltransferase [Helicosporidium sp. ATCC 50920]
Length=335

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 147/258 (57%), Gaps = 15/258 (6%)
 Frame = -3

Query  927  RFARYLCKQASGYFPMHLYVEDIKAFEPNRA-YVFGYEPHSIWPIGMVTLSAFTGFMP--  757
            +F +Y  K    YFP+ +   +  AF+     YV GYEPHS+ P  +     +  FM   
Sbjct  77   KFLKYSFKITKDYFPITIDYVNRDAFKNGSGPYVIGYEPHSVLPQAISYFGDYGTFMDFI  136

Query  756  ---LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYY  586
               L + + L S+  F+ P+MRH+W WLG  P  ++SF+S+L  G +  + PGGVQE  +
Sbjct  137  APCLARSRLLVSSTGFWAPIMRHLWWWLGCRPVDRKSFRSILKEGRNVALCPGGVQECLH  196

Query  585  MEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF--------  430
            M    E M+L+ R GFV++A++ G PLVP F FGQ+ VY + +P   + L F        
Sbjct  197  MGAGKEVMYLRKRHGFVKLAIEAGAPLVPTFAFGQTEVYRYVRPFIDVPLFFVPRHRAFS  256

Query  429  -SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLE  253
             +R + + P+L  G++G+ +P + PI V+VG+PI V K   P  E +     +FI+A++ 
Sbjct  257  IARRIGYVPMLISGWLGTAMPHRIPIRVIVGEPISVPKQDSPPPELVQEYLDKFIDAMVA  316

Query  252  LFEKHKKRLGYVDLQLKI  199
            LFE +K R GY  L++++
Sbjct  317  LFEDNKVRYGYKHLRMEV  334



>emb|CAN72688.1| hypothetical protein VITISV_037521 [Vitis vinifera]
Length=526

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  837  AYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQ  658
            AYVFGYEPHSI     V L+ FTGFMPLP+IK L  +AVFYTP ++H+WTWLG +PA K+
Sbjct  407  AYVFGYEPHSILXTXFVALADFTGFMPLPRIKFLAISAVFYTPFLQHVWTWLGFTPAAKK  466

Query  657  SFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQS  478
             F SLL SG+SCI+VPGGVQE   MEH CE  FLKSRKGFV IAM+MG  LVPVFCFGQ+
Sbjct  467  XFTSLLGSGHSCIIVPGGVQEPCLMEHGCEIAFLKSRKGFVHIAMEMGRSLVPVFCFGQA  526



>gb|AFW60565.1| hypothetical protein ZEAMMB73_440876 [Zea mays]
Length=646

 Score =   177 bits (450),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 111/170 (65%), Gaps = 21/170 (12%)
 Frame = -3

Query  990  VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
            V+      MF+P+   S+ G + AR++ K    YFP+ L+VED  AF+PNRAYVFGYEPH
Sbjct  419  VLATQLFFMFLPLSDKSRLGCKIARFISKYVIEYFPVTLHVEDYGAFDPNRAYVFGYEPH  478

Query  810  SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
            S+ PI +  L    GFMPLPK+K L S+AVFYTP +R IWTWLG++PA ++SF S L +G
Sbjct  479  SVLPIAVGILGDLVGFMPLPKLKILASSAVFYTPFLRQIWTWLGLAPASRKSFYSYLGAG  538

Query  630  YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
            YSCI+VPG                     GFV+IA++MG P+VPVF FGQ
Sbjct  539  YSCIIVPG---------------------GFVKIAIEMGCPVVPVFAFGQ  567



>gb|AFW69147.1| hypothetical protein ZEAMMB73_149235 [Zea mays]
Length=285

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 108/170 (64%), Gaps = 21/170 (12%)
 Frame = -3

Query  990  VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
            V+      MF P+   S+ G + AR++ K    YFP+ L+VED  AF+PNRAYVFGYEPH
Sbjct  58   VLATQLFFMFRPLSDKSRLGRKIARFISKYVIEYFPVTLHVEDYGAFDPNRAYVFGYEPH  117

Query  810  SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
            S+ PI +  L    GFMPLPK+K L S+ VFYTP +R IWTWLG++PA ++SF S L +G
Sbjct  118  SVLPIAVGILGDLVGFMPLPKLKILASSVVFYTPFLRQIWTWLGLAPASRKSFYSYLGAG  177

Query  630  YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
            YSCI+V G                     GFV+IA++MG P+VPVF FGQ
Sbjct  178  YSCIIVLG---------------------GFVKIAIEMGCPVVPVFAFGQ  206



>gb|AFW86527.1| hypothetical protein ZEAMMB73_897295 [Zea mays]
Length=133

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  588  YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFT  409
            +M +D E  FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P  KL++K +RAVKFT
Sbjct  3    HMNNDSEVAFLKSRKGFVKIAIQSGCPLVPVFCFGQSYAYKWWRPGGKLFIKIARAVKFT  62

Query  408  PILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
            PI+FWG  G+  PF +P+HVVVGKPIEV K   PT +++  +H +FI A+ +LFEK+K +
Sbjct  63   PIIFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEINEVHEQFIIAMRDLFEKYKAK  122

Query  228  LGYVDLQLKIM  196
             GY  L L+++
Sbjct  123  AGYPGLHLRVL  133



>ref|XP_008646663.1| PREDICTED: uncharacterized protein LOC103628190 [Zea mays]
Length=424

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 108/170 (64%), Gaps = 21/170 (12%)
 Frame = -3

Query  990  VIGLLFLLMFIPIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPH  811
            V+      MF P+   S+ G + AR++ K    YFP+ L+VED  AF+PNRAYVFGYEPH
Sbjct  199  VLATQLFFMFRPLSDKSRLGRKIARFISKYVIEYFPVTLHVEDYGAFDPNRAYVFGYEPH  258

Query  810  SIWPIGMVTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG  631
            S+ PI +  L    GFMPLPK+K L S+ VFYTP +R IWTWLG++PA ++SF S L +G
Sbjct  259  SVLPIAVGILGDLVGFMPLPKLKILASSVVFYTPFLRQIWTWLGLAPASRKSFYSYLGAG  318

Query  630  YSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
            YSCI+V G                     GFV+IA++MG P+VPVF FGQ
Sbjct  319  YSCIIVLG---------------------GFVKIAIEMGCPVVPVFAFGQ  347



>ref|XP_002294483.1| hypothetical protein THAPSDRAFT_37867 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED88317.1| hypothetical protein THAPSDRAFT_37867, partial [Thalassiosira 
pseudonana CCMP1335]
Length=309

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/310 (33%), Positives = 164/310 (53%), Gaps = 15/310 (5%)
 Frame = -3

Query  1083  LMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCK  904
             L +  WLG    +V + +  +      + +++IGL  + + +P       G +   ++ +
Sbjct  1     LAVTLWLGWNGIVVCIAVYLLFIANNIERMVIIGLATMSLILPAHFPGALGYKIGDWIMR  60

Query  903   QASGYFPMHLYVED----IKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPKIKGL  736
             QA  YF +   +ED    I+    N+A +F + PH + P  +   +     +P  KI   
Sbjct  61    QAEKYFGLKTVIEDEEDLIRHANENKAVIFAFNPHDMLPYAVFAFAPTLKRLP-GKIGKD  119

Query  735   G----STAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE  568
             G    S+A+F  P +R ++TW+   P  K++F   L  G S   VPGGVQE   ++ +  
Sbjct  120   GTCLMSSAIFNIPFLRQVYTWVNSLPVDKKTFLGRLKRGQSFAFVPGGVQEVIMLDPNQP  179

Query  567   ---TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILF  397
                 ++LK+RKGFV++A+  G+P+VPVF F     Y +W P  KL  + SR + F P+LF
Sbjct  180   KDVVLYLKNRKGFVKLALATGSPIVPVFGFHLDGSYGYWLPKGKLVERLSRTLGFLPLLF  239

Query  396   WG-YMGSF-VPFQRPIHVVVGKPIEV-GKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             WG +M  F +P  + IHVVVG  I+V  +    ++E +   H+ F++ L  LFE+HK+  
Sbjct  240   WGRWMIPFGIPHPKKIHVVVGSAIDVPNEGEDVSQESIEKYHAIFLKELEALFERHKEEA  299

Query  225   GYVDLQLKIM  196
             GY   QLKI+
Sbjct  300   GYGHRQLKIV  309



>ref|XP_004169998.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Cucumis sativus]
Length=110

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  525  MKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVV  346
            M+MGTPLVPVFCFGQS+VY WWKP  K +L+FSRA+KFTPI+FWG  GS +P++R +HVV
Sbjct  1    MEMGTPLVPVFCFGQSSVYQWWKPGGKFFLQFSRAIKFTPIVFWGVFGSPLPYRRQMHVV  60

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            VG+PIEV KN  PT +++  LH RF+EAL  +FE++K +LGY DLQL ++
Sbjct  61   VGRPIEVKKNPNPTSDEVLDLHGRFVEALESMFERYKGQLGYDDLQLNVL  110



>ref|XP_011030707.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Populus euphratica]
Length=110

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -3

Query  525  MKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVV  346
            M+ G PLVPVFCFGQS VY WWKPS KL+LK SRA+KFTP++F G  G+ +PFQRP+H+V
Sbjct  1    MENGAPLVPVFCFGQSKVYKWWKPSGKLFLKISRAIKFTPVVFGGIFGTPLPFQRPMHIV  60

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            VG+PIE+ +N QPT E+LA +H +F+ AL +LF++H+ R+G+ DL+LKI+
Sbjct  61   VGRPIELKQNLQPTVEELAEVHGQFVAALEDLFKRHRARVGFADLELKIL  110



>ref|XP_006402180.1| hypothetical protein EUTSA_v10015985mg, partial [Eutrema salsugineum]
 gb|ESQ43633.1| hypothetical protein EUTSA_v10015985mg, partial [Eutrema salsugineum]
Length=116

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 94/124 (76%), Gaps = 8/124 (6%)
 Frame = -3

Query  567  TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGY  388
             +FL SR+GFV+IAM+ GTPLVPVFCFGQ        P  KLYLK SRA++FTPI FWG 
Sbjct  1    NVFLSSRRGFVRIAMEHGTPLVPVFCFGQ--------PDWKLYLKLSRAIRFTPICFWGV  52

Query  387  MGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GS +P ++P+ VVVGKPIEV K  QP+ E++A LH +F+EAL +LFE+HK R+GY DLQ
Sbjct  53   FGSPLPCRQPMDVVVGKPIEVSKTLQPSNEEIAKLHGQFVEALKDLFERHKARVGYSDLQ  112

Query  207  LKIM  196
            L I+
Sbjct  113  LNIL  116



>gb|EWM23187.1| diacylglycerol acyltransferase type 2 [Nannochloropsis gaditana]
Length=360

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 166/300 (55%), Gaps = 15/300 (5%)
 Frame = -3

Query  1107  SANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLM----FIPIDQNS  940
              A ++L   +M++W  +   +V++ L  +  L F    +V G  F+LM    F+P+D   
Sbjct  56    EALAMLTMGVMMSWYYL---VVILSLLCVAGLFFPTWRVVAGTAFVLMWSAAFLPLDYQG  112

Query  939   KWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIG-MVTLSAFTGF  763
              W      +L K    YF     +E+  A +P + Y+F   PH I+P G ++++S     
Sbjct  113   -WDAFCNSFLFKLWRDYFHYEYILEE--AIDPKKRYLFAEMPHGIFPWGEVISISITKQL  169

Query  762   MPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYM  583
              P  ++  +G++ +F  P +RH ++W+G  PA  ++ K +   G  C V  GGV E + +
Sbjct  170   FPGSRVGSIGASVIFLLPGLRHFFSWIGCRPASPENIKKIFEEGADCAVTVGGVAEMFLV  229

Query  582   EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYL----KFSRAVK  415
               D E ++LK  KGF++ A+K G  +VPVFC+G S +++    SS+L +    + SR +K
Sbjct  230   GGDKERLYLKKHKGFIREAIKNGADVVPVFCYGNSKLFSVVGESSRLSMGLLKRLSRRIK  289

Query  414   FTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
              + ++F+G +   +P + P+  VVGKP+ V +   P++E++AA+H+ F E + EL+ K +
Sbjct  290   ASVLIFYGRLCLPIPIRHPLLFVVGKPLPVVQKDAPSKEEIAAMHALFCEKVEELYYKFR  349



>emb|CDX85154.1| BnaC07g07520D [Brassica napus]
Length=121

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 8/116 (7%)
 Frame = -3

Query  570  ETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG  391
            + +F+ SR+GFV+IAM+ GTPLVPVFCFGQS VY WWKP+  LYLK SRA+KFTPI FWG
Sbjct  6    QNLFISSRRGFVRIAMEHGTPLVPVFCFGQSRVYKWWKPNWNLYLKLSRAIKFTPICFWG  65

Query  390  YMGSF--------VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
              G          +P++ P+HVV+GKPIEV K  QPT+E++A +H +F+EAL +LF
Sbjct  66   VFGGIHISFCKSPIPYRHPLHVVIGKPIEVSKTLQPTDEEIAKVHGQFVEALKDLF  121



>ref|XP_007512274.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66362.1| predicted protein [Bathycoccus prasinos]
Length=332

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 98/329 (30%), Positives = 161/329 (49%), Gaps = 38/329 (12%)
 Frame = -3

Query  1077  MLAWLGV--PPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSK----WGLRFAR  916
             M  WLG+    +++V  L  I+    +      GL+   + I    N K    WGLR A 
Sbjct  1     MHVWLGLFHANAMIVSALIFIVMKDVSTPSFRNGLIITYVTICFLPNKKPYPKWGLRLAN  60

Query  915   YLCKQASGYFPM---HLYVED-IKAFEPNRAYVFGYEPHSIWPIGMVTLSA---FTGFMP  757
             ++   A  YFP+   H+  E  +K        + G EPH + P+ M  ++    F G + 
Sbjct  61    HIVHAAMQYFPLKNKHVSEEKHLKLIANGTPILIGLEPHGVLPLQMAAIADYYLFDGAIR  120

Query  756   LPK--------------------IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS  637
               +                         S+++FY P++RH+W WLG+ P  +   K +LS
Sbjct  121   TARDHECFKNEEERQRLRDAFAVSSAFASSSIFYVPLVRHLWPWLGLDPISRYHVKKVLS  180

Query  636   SGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK  457
             +G   I+VPGGV E   ME + E ++L+ R GFV+IA++ G  L+P + FG +  Y+WW+
Sbjct  181   NGGVAIIVPGGVSEVLKMEKEREVVYLRKRYGFVKIAIQSGAALMPAYAFGATRTYSWWR  240

Query  456   -----PSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQL  292
                   + KL  + S+ + F PI+FWG      P +  +  V G PIEV +   PT+E +
Sbjct  241   LGPPLMTKKLAERISKILLFAPIVFWGRFFGPCPRRGRVVTVYGPPIEVKQTDDPTQEYV  300

Query  291   AALHSRFIEALLELFEKHKKRLGYVDLQL  205
               +  +FIE L +++ +++   GY  ++L
Sbjct  301   REVLDKFIEELEKVYRENRDEFGYKGVEL  329



>gb|ETI37899.1| hypothetical protein F443_16242 [Phytophthora parasitica P1569]
 gb|ETM37932.1| hypothetical protein L914_15638 [Phytophthora parasitica]
Length=361

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 126/226 (56%), Gaps = 11/226 (5%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG----FMPLPKIKGLGSTAVFYTPVMRHIW  691
            +A + N+ Y+FG+ PH I  I +  +S + G      P  + + LG++ +FY P+ R + 
Sbjct  133  QALDSNKKYIFGFHPHGI--IVLSRVSTYGGNWEKVFPGIETRALGASTMFYVPLGRELC  190

Query  690  TWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKM  517
             WLG   A + +   +L+ G S +V PGGV E +  + + +   + LK R GFV++AM+ 
Sbjct  191  LWLGGVDASRSTADKVLNDGTSIVVYPGGVPEIFKTDPNSKLNELVLKKRLGFVKLAMRH  250

Query  516  GTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVV  346
            G  LVP F FG+  +YN W P   +   F + +K   I+FWG   +M    P  +   VV
Sbjct  251  GAELVPSFVFGEKWLYNMWNPPQGVIDFFRKTLKIPMIIFWGKFMWMPKQPPKGKRFGVV  310

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GKPI   +   PTEE++ A+H++++ A+  LF ++KK  GY D +
Sbjct  311  YGKPIPTKQTDNPTEEEIRAVHTQYVAAIERLFSQYKKEFGYDDDE  356



>gb|ETK78105.1| hypothetical protein L915_15796 [Phytophthora parasitica]
 gb|ETL31535.1| hypothetical protein L916_15692 [Phytophthora parasitica]
 gb|ETL84797.1| hypothetical protein L917_15497 [Phytophthora parasitica]
 gb|ETP07785.1| hypothetical protein F441_16071 [Phytophthora parasitica CJ01A1]
 gb|ETP35816.1| hypothetical protein F442_16099 [Phytophthora parasitica P10297]
Length=361

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 125/226 (55%), Gaps = 11/226 (5%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG----FMPLPKIKGLGSTAVFYTPVMRHIW  691
            +A + N+ Y+FG+ PH I  I +  +S + G      P  + + LG++ +FY P+ R + 
Sbjct  133  QALDSNKKYIFGFHPHGI--IVLSRVSTYGGNWEKVFPGIETRALGASTMFYVPLGRELC  190

Query  690  TWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKM  517
             WLG   A + +   +L+ G S +V PGGV E +  + + +   + LK R GFV++AM+ 
Sbjct  191  LWLGGVDASRSTADKVLNDGTSIVVYPGGVPEIFKTDPNSKLNELVLKKRLGFVKLAMRH  250

Query  516  GTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVV  346
            G  LVP F FG+  +YN W P   +   F + +K   I+FWG   +M    P  +   VV
Sbjct  251  GAELVPSFVFGEKWLYNMWNPPQGVIDFFRKTLKIPMIIFWGKFMWMPKQPPKGKRFGVV  310

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GKPI   +   PTEE++ A+H++++  +  LF ++KK  GY D +
Sbjct  311  YGKPIPTKQTDNPTEEEICAVHTQYVAEIERLFSQYKKEFGYDDDE  356



>ref|XP_003745579.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-like [Metaseiulus 
occidentalis]
Length=348

 Score =   141 bits (355),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/250 (35%), Positives = 138/250 (55%), Gaps = 22/250 (9%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMP-LPKI--KGLGST  727
            +FP+HL        +P + Y+FGY PH I   G  +   +  TGF    P I    L   
Sbjct  101  FFPIHLV--KTADLDPEQNYIFGYHPHGITSAGAFSNFATEATGFSEKFPGIVPHLLTLE  158

Query  726  AVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFL  556
              F+ P+ R +    G+S   ++S  +LL+    G + I+V GG QEA     +   + L
Sbjct  159  GQFFFPLHRELVLACGLSSVSRESIINLLNYKGKGNAAIIVIGGAQEALDAVPETYRLNL  218

Query  555  KSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSS------KLYLKFSRAVKFTPILFW  394
             SR+GFV++A++ G  LVPVF FG+++++ +  PS       K+ +  +R + F+P +F 
Sbjct  219  NSRRGFVRMAIQNGAQLVPVFSFGENDIF-YQSPSDSESTVRKIQVALTRMLGFSPPIFH  277

Query  393  G-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
            G     Y   F+PF++PI+ V+G PI V KN+ P+ E++  LH ++I+AL  LFE HKK 
Sbjct  278  GRGVFQYTWGFIPFRKPIYTVIGAPIHVKKNADPSIEEIQDLHKKYIQALRSLFETHKKS  337

Query  228  LGYVDLQLKI  199
             G  ++ L+I
Sbjct  338  FGAENIDLEI  347



>gb|ETO66656.1| hypothetical protein F444_16239 [Phytophthora parasitica P1976]
Length=361

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 125/226 (55%), Gaps = 11/226 (5%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG----FMPLPKIKGLGSTAVFYTPVMRHIW  691
            +A + N+ Y+FG+ PH I  I +  +S + G      P  + + LG++ +FY P+ R + 
Sbjct  133  QALDSNKKYIFGFHPHGI--IVLSRVSTYGGNWEKVFPGIETRALGASTMFYVPLGRELC  190

Query  690  TWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKM  517
             WLG   A + +   +L+ G S +V PGGV E +  + + +   + LK R GFV++AM+ 
Sbjct  191  LWLGGVDASRSTADKVLNDGTSIVVYPGGVPEIFKTDPNSKLNELVLKKRLGFVKLAMRH  250

Query  516  GTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVV  346
            G  LVP F FG+  +YN W P   +   F + +K   I+FWG   +M    P  +   VV
Sbjct  251  GAELVPSFVFGEKWLYNMWNPPQGVIDFFRKTLKIPMIIFWGKFMWMPKQPPKGKRFGVV  310

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GKPI   +   PTEE++ A+H++++  +  LF ++KK  GY D +
Sbjct  311  YGKPIPTKQTDNPTEEEIRAVHTQYVAEIERLFSQYKKEFGYDDDE  356



>ref|XP_008911342.1| hypothetical protein PPTG_16282 [Phytophthora parasitica INRA-310]
 gb|ETN03226.1| hypothetical protein PPTG_16282 [Phytophthora parasitica INRA-310]
Length=361

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 125/226 (55%), Gaps = 11/226 (5%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTLSAFTG----FMPLPKIKGLGSTAVFYTPVMRHIW  691
            +A + N+ Y+FG+ PH I  I +  +S + G      P  + + LG++ +FY P+ R + 
Sbjct  133  QALDSNKKYIFGFHPHGI--IVLSRVSTYGGNWEKVFPGIETRALGASTMFYVPLGRELC  190

Query  690  TWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKM  517
             WLG   A + +   +L+ G S +V PGGV E +  + + +   + LK R GFV++AM+ 
Sbjct  191  LWLGGVDASRSTADKVLNDGTSIVVYPGGVPEIFKTDPNSKLNELVLKKRLGFVKLAMRH  250

Query  516  GTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVV  346
            G  LVP F FG+  +YN W P   +   F + +K   I+FWG   +M    P  +   VV
Sbjct  251  GAELVPSFVFGEKWLYNMWNPPQGVIDFFRKTLKIPMIIFWGKFMWMPKQPPKGKRFGVV  310

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
             GKPI   +   PTEE++ A+H++++  +  LF ++KK  GY D +
Sbjct  311  YGKPIPTKQTDNPTEEEIRAVHTQYVAEIERLFSQYKKEFGYDDDE  356



>ref|XP_006403242.1| hypothetical protein EUTSA_v10003409mg, partial [Eutrema salsugineum]
 gb|ESQ44695.1| hypothetical protein EUTSA_v10003409mg, partial [Eutrema salsugineum]
Length=173

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 7/141 (5%)
 Frame = -3

Query  615  VPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ-SNVYNWWKPSSKLY  439
            + G ++    +E   E+     R+GF   AM+ GT     F F   S++Y WWKP  KLY
Sbjct  39   IEGVIELKRELERSSESHRKFGRRGF---AMEHGTLW---FQFSALSHLYKWWKPDWKLY  92

Query  438  LKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
            LK SRA++FTPI FWG  GS +P+++P+ VVVGKPIEV K  QP+ E++A LH +F+EAL
Sbjct  93   LKLSRAIRFTPICFWGVFGSPLPYRQPMDVVVGKPIEVSKTLQPSNEEIAKLHGQFVEAL  152

Query  258  LELFEKHKKRLGYVDLQLKIM  196
             +LFE+HK R+GY DLQL I+
Sbjct  153  KDLFERHKARVGYSDLQLNIL  173



>ref|XP_006942072.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Felis catus]
Length=329

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 150/279 (54%), Gaps = 31/279 (11%)
 Frame = -3

Query  981  LLFLLMFIPIDQNSKWGLRFARY----LCKQASGYFPMHLYVEDIKAFE--PNRAYVFGY  820
            L  +  F+  D  ++ G RFA      + K+   YFP+ L    +K  E  P+R YV G 
Sbjct  46   LYLVWFFLDWDTPNRGGRRFAFMKTWSMWKELRDYFPVKL----VKTAELPPDRNYVIGG  101

Query  819  EPHSIWPIGMVT-----LSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQS  655
             PH I  +G+ T     ++ F+   P  ++  +G + +FY P+ R   +  GI    ++S
Sbjct  102  HPHGIMSVGIFTNFNTEMNGFSKHFPGIRLTSVGLSFIFYFPIYRDYVSSYGICSVNQRS  161

Query  654  FKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
               +LS    G + +++ GG QEA Y       + L++RKGFV++A++ G  LVP + FG
Sbjct  162  LDFILSQPQPGQAVVIIIGGAQEALYAIPGTHHLVLRNRKGFVRLALRHGASLVPAYSFG  221

Query  483  QSNVYNW--WKPSSKLYL---KFSRAVKFTPILFWGYMGSF-------VPFQRPIHVVVG  340
            ++++++   + P S  YL    F +   ++P +FWG  G F       +PF RPI  VVG
Sbjct  222  ENDIFHLKAFAPGSWQYLCQVAFKKLTSYSPCIFWG-RGLFSANSWGLLPFARPITTVVG  280

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            +PI V +   PTEE+++  H+ +++AL  LFE+HK+  G
Sbjct  281  RPIPVPRILCPTEEEVSHYHTLYMQALETLFEEHKETCG  319



>ref|XP_008870786.1| hypothetical protein H310_07219 [Aphanomyces invadans]
 gb|ETW00651.1| hypothetical protein H310_07219 [Aphanomyces invadans]
Length=358

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 163/334 (49%), Gaps = 21/334 (6%)
 Frame = -3

Query  1143  PPPTPAEFIGTASANSL--LMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFL  970
             P PT  + +     NSL  +M+   + +L V P    + L  I  + +T   + + L++L
Sbjct  27    PDPTFRDSLPAVVFNSLEFIMSFTAIHYL-VWPVFTSIFLYYIHKIGYTYVSVALVLVYL  85

Query  969   LMFI--------PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEP  814
               F+        P +   +W       L      Y  + +  E   A +P + YVF Y P
Sbjct  86    PTFLNNAHKKLTPKEGGMQWDWLREHSLWNLMCSYTKLEIVRE--AALDPTKQYVFAYHP  143

Query  813   HSIWPIGMVTLSA--FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLL  640
             H I  +  ++  A  F    P    + LG+T +F+ P+ R I  WL    A +++ + +L
Sbjct  144   HGILILSRISTYAGNFEKLFPGIVARALGATPMFFIPMAREICLWLAAVDASRKNAERIL  203

Query  639   SSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYN  466
                 S IV PGG +E +  + + +  T+ L  R GF+++A++ G  +VP F FG+  +YN
Sbjct  204   KEKMSVIVYPGGSKEIFLTDPNSKQTTLVLNKRLGFIKLAVRYGADVVPTFVFGEKWMYN  263

Query  465   WWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ----RPIHVVVGKPIEVGKNSQPTEE  298
              W P   +   F   +K   +LFWG   +++P +    R   VV GKPI V +N  P+E+
Sbjct  264   IWNPPQSVRHFFLSTLKVPLLLFWGRFFTWLPKRLTGKRRFGVVFGKPIPVTQNENPSED  323

Query  297   QLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
             +L  +H+ + E L +LF ++K   GY D ++ ++
Sbjct  324   ELIQIHALYKEELTDLFTRYKAEFGYDDDEVLVI  357



>ref|XP_009826313.1| hypothetical protein H257_03774 [Aphanomyces astaci]
 gb|ETV84621.1| hypothetical protein H257_03774 [Aphanomyces astaci]
Length=414

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 133/255 (52%), Gaps = 19/255 (7%)
 Frame = -3

Query  954  IDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSA  775
            + Q+S W     +++C     Y  + +  E     +P + YVF Y PH I  +  ++  A
Sbjct  164  LRQHSAW-----KFMC----SYTKLEIVRE--AELDPTKQYVFAYHPHGILILSRISTYA  212

Query  774  --FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGV  601
              F    P    + LG+T +FY P+ R I  WL    A +++ + +L    S IV PGG 
Sbjct  213  GNFEALFPGIVARALGATPMFYIPMAREICLWLAAVDASRKNAERILKDKMSVIVYPGGS  272

Query  600  QEAYYMEHDCE--TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFS  427
            +E +  +   +  T+ L  R GF+++A++ G  +VP F FG+  +YN W P   +   F 
Sbjct  273  KEIFLTDPKSKQTTLVLNKRLGFIRLAVRYGADIVPTFVFGEKWMYNIWNPPKSVRHFFL  332

Query  426  RAVKFTPILFWGYMGSFVPFQ----RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
              +K   +LFWG   +++P +    R   VV GKPI V +N  PTEE+L  +H+ ++E L
Sbjct  333  STLKVPLLLFWGRGFTWLPKRLTGKRKFGVVHGKPIPVVQNENPTEEELVKIHTLYVEEL  392

Query  258  LELFEKHKKRLGYVD  214
             +LF ++K + GY D
Sbjct  393  NDLFLRYKAQFGYDD  407



>ref|XP_007073968.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Panthera tigris 
altaica]
Length=329

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/279 (34%), Positives = 147/279 (53%), Gaps = 31/279 (11%)
 Frame = -3

Query  981  LLFLLMFIPIDQNSKWGLRFARY----LCKQASGYFPMHLYVEDIKAFE--PNRAYVFGY  820
            L  +  F+  D  ++ G RFA      + KQ   YFP+ L    +K  E  P+R YV G 
Sbjct  46   LYLVWFFLDWDTPNRGGRRFAFMKTWSMWKQLRDYFPVKL----VKTAELPPDRNYVIGG  101

Query  819  EPHSIWPIGMVT-----LSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQS  655
             PH I  +G+ T     ++ F+   P  ++   G + +FY P  R      GI    ++S
Sbjct  102  HPHGIMSLGVFTNFSTEMNDFSKHFPGIRLTLAGLSFIFYFPFYRDYTASYGICSVNRRS  161

Query  654  FKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
               +LS    G + +++ GG QEA Y       + L++RKGFV++A++ G  LVPV+ FG
Sbjct  162  LDFILSQPEPGQAVVIIIGGAQEALYAIPGTHHLVLRNRKGFVRLALRHGASLVPVYSFG  221

Query  483  QSNVYNW--WKPSSKLYL---KFSRAVKFTPILFWGYMGSF-------VPFQRPIHVVVG  340
            +++V++   + P S  YL    F +   ++P +FWG  G F       +PF RPI  VVG
Sbjct  222  ENDVFHLKAFAPGSWQYLCQVAFKKLTGYSPCIFWG-RGLFSANSWGLLPFARPITTVVG  280

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            +PI V +   PTEE++   H+ +++AL  LFE+HK+  G
Sbjct  281  RPIPVPQILCPTEEEVDHYHTLYMQALETLFEEHKESCG  319



>ref|XP_005690058.1| PREDICTED: 2-acylglycerol O-acyltransferase 2 [Capra hircus]
Length=353

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 169/358 (47%), Gaps = 63/358 (18%)
 Frame = -3

Query  1194  EEKGGNVQHRSPSN-EAAPPPTPAEFIGTASANSLLMTLMMLAWLGVPPSIVVVVLASII  1018
             E +  +  HR  S  E AP   P E          L T  +L W+            SI+
Sbjct  7     ELRDASRTHRGASMVEFAPLFVPLE--------RRLQTFAVLQWI-----------FSIL  47

Query  1017  FLPFTKAIMVIGLLFL---------LMFIPIDQNSKW-GLRFARYL-----CKQASGYFP  883
              LP    ++ IGLLF           +++ +DQN  W G R +  L      K    YFP
Sbjct  48    VLPLLCPVVFIGLLFTRFWFFSILYAIWLYLDQNKPWQGGRHSEILRHWVIWKYMKDYFP  107

Query  882   MHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKIKGLGSTA--VF  718
             + L        +P+R Y+ G+ PH +  IG+ T   S  TGF  + P I+   +T    F
Sbjct  108   ISLV--KTAELDPSRNYLAGFHPHGVLSIGVFTNLCSGSTGFFSVFPGIQPHVTTINIFF  165

Query  717   YTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFLKSR  547
             + P  R      G+ PA K+S   +LS   SG   ++  GG++EA         + L++R
Sbjct  166   WIPFFRDYIMQGGMVPADKESVAHILSRKGSGNLVVITVGGIKEALKTRPGANKLVLRNR  225

Query  546   KGFVQIAMKMGTPLVPVFCFGQSNVYN--------WWK-PSSKLYLKFSRAVKFTPILFW  394
             KGFV++A+  G  LVP+F FG ++++         WWK    +LY K   A+     LF+
Sbjct  226   KGFVRLALMHGADLVPIFSFGDNDLFVHPKKSLGFWWKWLIDQLYKKIGVALP----LFY  281

Query  393   G-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
             G     Y   F+P++RPI  VVGKPIEV K   P++E++  LH R++  L  LFE HK
Sbjct  282   GRGVFQYSFGFMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQRYMNELENLFEAHK  339



>emb|CBJ27686.1| mono-or diacylglycerol acyltransferase type 2 [Ectocarpus siliculosus]
Length=388

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 120/217 (55%), Gaps = 9/217 (4%)
 Frame = -3

Query  834  YVFGYEPHSIWPIG-MVTLSAFT---GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPA  667
            Y     PH I P+G +VT+ +F    GF      KGL + A    P+MRH+  W+G   A
Sbjct  175  YFLCAPPHGILPVGNLVTMLSFPMVWGF----SFKGLTTDAALRLPLMRHVMAWIGCQSA  230

Query  666  GKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCF  487
            G++     +  G+S  + PGGV E +   +D E +FLK+RKGFV+++++MGT LVP + F
Sbjct  231  GREEVARSVGEGWSVGLCPGGVAEIFDSNNDNEVLFLKARKGFVKLSLRMGTTLVPCYTF  290

Query  486  GQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGK-NSQ  310
            G + ++  W+    +    SR + F  +L WG M   +  ++P+ VV G+PI V K   +
Sbjct  291  GNTRIFRSWQDPYGILRALSRKLGFGLLLVWGRMLLPIILRQPLLVVTGRPIVVPKPAGE  350

Query  309  PTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
            PT+  +   H  F+  L  +F+K+K   G+ + +L I
Sbjct  351  PTQADIDKYHDLFVAELRRIFDKYKGPYGWGEKELII  387



>gb|KDO23510.1| hypothetical protein SPRG_11432 [Saprolegnia parasitica CBS 223.65]
Length=337

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 125/232 (54%), Gaps = 10/232 (4%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSA--FTGFMPLPKIKGLGSTAVF  718
            Y  M +  E+  A +  + YVF Y PH I  +  ++  A  F    P    + L +T +F
Sbjct  99   YLGMEIVREE--ALDATKQYVFAYHPHGILVLSRLSYYAGNFDALFPGIHARVLAATPMF  156

Query  717  YTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRK  544
            Y P+ R I  WL    A + + + +L +  S IV PGG +E +    + +   + L  R 
Sbjct  157  YVPLGREICLWLDAVDASRATAQKVLDNKLSIIVYPGGSKEIFQTNPNSKETVLVLNHRL  216

Query  543  GFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ  364
            GF+++A+K G  LVP+F FG+  +YN W P   +   F   +K   +LFWG   +++P+Q
Sbjct  217  GFIKLAIKNGVELVPIFVFGEKWMYNMWNPPKSVTEAFLTYLKVPMLLFWGRFCTWMPYQ  276

Query  363  ----RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
                R + VV GKPI V ++  PT++++AA+ ++++E+L  +F  +K   GY
Sbjct  277  LTGKRKLGVVYGKPIPVQQSDNPTDDEVAAVQAKYVESLQTIFSTYKASFGY  328



>ref|XP_005954165.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-like [Pantholops 
hodgsonii]
Length=334

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 102/301 (34%), Positives = 151/301 (50%), Gaps = 43/301 (14%)
 Frame = -3

Query  1026  SIIFLPFTKAIMVIGLLF---------LLMFIPIDQNSKW-GLRFARYL-----CKQASG  892
             SI+ LP    ++ IGLLF           +++ +DQN  W G R +  L      K    
Sbjct  26    SILVLPLLSPVVFIGLLFTRFWFFSILYAIWLYLDQNKPWQGGRHSETLRHWVMWKHMKD  85

Query  891   YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKIKGLGSTA-  724
             YFP+ L        +P+R Y+ G+ PH +  IG+ T   S  TGF  + P I+   +T  
Sbjct  86    YFPISLV--KTAELDPSRNYLAGFHPHGVLSIGVFTNLCSGSTGFFSVFPGIQPHVTTIN  143

Query  723   -VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFL  556
               F+ P  R      G+ PA K+S   +LS   SG    +  GG++EA         + L
Sbjct  144   IFFWIPFFRDYIMQGGLVPADKESVAHILSRKGSGNLVAITVGGIKEALKTRPGANKLVL  203

Query  555   KSRKGFVQIAMKMGTPLVPVFCFGQSNVYN--------WWK-PSSKLYLKFSRAVKFTPI  403
             ++RKGF+++A+  G  LVP+F FG ++++         WWK    +LY K   A+     
Sbjct  204   RNRKGFIRLALMHGADLVPIFSFGDNDLFVHPKKSLGFWWKWFIDQLYKKIGVALP----  259

Query  402   LFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             LF+G     Y   F+P++RPI  VVGKPIEV K   P++E++  LH R++  L  LFE H
Sbjct  260   LFYGRGVFQYSFGFMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQRYMNELENLFEAH  319

Query  237   K  235
             K
Sbjct  320   K  320



>gb|ELT87803.1| hypothetical protein CAPTEDRAFT_131195 [Capitella teleta]
Length=341

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 149/299 (50%), Gaps = 31/299 (10%)
 Frame = -3

Query  1038  VVLASIIFLPFTKAIMVIGLLFLLMFIPIDQN--SKWGLRFARYLCKQA-----SGYFPM  880
             V L ++++L FT    V     L ++  ++ N  S  G R A +L   A       +FP+
Sbjct  37    VSLLALVYLMFTDYYWVALGYTLWIYYDVNYNKTSSRGGRHAVWLRNSALWRYFRDFFPV  96

Query  879   HLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAF----TGF-MPLPKIKG--LGSTAV  721
             +L         P   Y+ GY PH I  IG   L  F    TGF    P IK   +     
Sbjct  97    NLV--KTADLNPENNYLLGYHPHGI--IGCGALCNFASDTTGFKTEYPGIKAHLMTLKGN  152

Query  720   FYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFLKS  550
             F  P+MR    W G+    K+S + +L    +G + +VV GG +EA         + LK 
Sbjct  153   FRWPLMRAFLLWSGVCDVSKESLQWILKEQGTGNAAVVVVGGAEEALQARPGNYDLTLKR  212

Query  549   RKGFVQIAMKMGTPLVPVFCFGQSNVY-----NWWKPSSKLYLKFSRAVKFTPILFWG--  391
             RKGF+++A+K G  LVPVF FG+++++            K    F  A  F+P+LF G  
Sbjct  213   RKGFIKMAIKTGARLVPVFSFGENDIFIQADNKRGSAIRKFQDSFKSAFGFSPVLFHGRG  272

Query  390   ---YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
                Y    +PF+RPI+ VVGKPI V ++ +PT+E +  +H ++I+ L +LF+ HK++ G
Sbjct  273   VFNYTFGLLPFRRPIYTVVGKPILVKESPEPTQEYIDEIHQQYIDDLCQLFDDHKEKYG  331



>ref|XP_006074155.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-like [Bubalus bubalis]
Length=328

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 158/305 (52%), Gaps = 24/305 (8%)
 Frame = -3

Query  1092  LMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW-GLRFAR  916
             L TL++L W+    S+ ++     I L FT+   +I +L+ + +  +D+   W G R   
Sbjct  15    LQTLVVLQWVSCLVSMAILSYVVFIGLLFTR-FWIISILYAVWWY-LDRAKPWQGSRHID  72

Query  915   YL-----CKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMP  757
              L      K    YFP+ L        +P+R Y+ GY PH I  +G  T   +  TGF  
Sbjct  73    VLRRWSVWKYMKDYFPISLV--KTANLDPSRNYLAGYHPHGIATVGAFTNFCTDGTGFSS  130

Query  756   L-PKIKG--LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQE  595
             L P I+   +     F+ PV R      G+  A K+S   +LS    G    ++ GGVQE
Sbjct  131   LFPGIRSHLMVLNLWFWAPVFRDYIIIGGMVAADKESVSHILSREGGGNLLAIIVGGVQE  190

Query  594   AYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF--SRA  421
             A         + L++RKGF+++A+  G  LVP+F FG++++Y+  + S   +L++   R 
Sbjct  191   ALDARRGGYKLVLRNRKGFIRLALMHGADLVPIFSFGENDIYDQVENSPGTWLRWFQDRL  250

Query  420   VKFTPI---LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
              K T     LF+G  G  +P++RPI  VVGKPIEV K   P++E++  LH R+++ L  L
Sbjct  251   QKVTGGSIPLFYGSFG-LMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQRYMKELENL  309

Query  249   FEKHK  235
             FE HK
Sbjct  310   FEAHK  314



>ref|XP_002500702.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61960.1| predicted protein [Micromonas sp. RCC299]
Length=357

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/234 (34%), Positives = 121/234 (52%), Gaps = 8/234 (3%)
 Frame = -3

Query  900  ASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGFMPLPKIKGLGST  727
            +  YFP  L +      +P + YVFG+ PH I  +  + +    +    P   ++ LG++
Sbjct  116  SQAYFPARL-IRTTPPLDPTKKYVFGWHPHGILILSRIHVYGGVWETLFPGVDVRVLGAS  174

Query  726  AVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETM--FLK  553
             +F  P  R I  W+G   AG+++ + +L +G S  V PGG  E +  + +       L 
Sbjct  175  PMFKVPGCREICLWMGAVDAGRKTAERVLRAGKSMAVYPGGSVEIFDTDPNSRETRCHLA  234

Query  552  SRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFV  373
             RKGFV++A+  G  LVPVF FG+   Y      SK+     R +K   I+FWG   ++ 
Sbjct  235  RRKGFVKLAIAHGASLVPVFVFGEKRCYRRLNVPSKVRHWLLRTLKIPLIVFWGRWFTWY  294

Query  372  PFQRPIHVVVGKPI---EVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY  220
            P   P  VV G PI   E+   ++PTE Q+  LH+R+  A++EL+EKHK   GY
Sbjct  295  PIASPQTVVFGAPIEAPELDPGTEPTETQVDELHARYTAAVVELYEKHKADAGY  348



>ref|XP_008603917.1| hypothetical protein SDRG_00227 [Saprolegnia diclina VS20]
 gb|EQC42494.1| hypothetical protein SDRG_00227 [Saprolegnia diclina VS20]
Length=337

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 120/223 (54%), Gaps = 8/223 (4%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTLSA--FTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
            +A +  + Y+F Y PH I  +  ++  A  F    P    + L +T +FY P+ R I  W
Sbjct  108  EALDATKQYIFAYHPHGILILSRLSYYAGNFDALFPGIHARVLAATPMFYVPLGREICLW  167

Query  684  LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKMGT  511
            L    A + + + +L +  S IV PGG +E +    + +   + L  R GF+++A+K G 
Sbjct  168  LDAVDASRATAQKVLDNKLSIIVYPGGSKEIFQTNPNSKETVLVLNHRLGFIKLAIKNGV  227

Query  510  PLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ----RPIHVVV  343
             LVP+F FG+  +YN W P   +   F   +K   +LFWG   +++P+Q    R   VV 
Sbjct  228  ELVPIFVFGEKWMYNMWNPPKSVTEAFLTYLKVPMLLFWGRFCTWMPYQFTGKRKFGVVY  287

Query  342  GKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
            GKPI V ++  PT++++AA+ ++++ +L  +F  +K   GY D
Sbjct  288  GKPIPVQQSDNPTDDEVAAVQAKYVASLQTIFSSYKASFGYDD  330



>ref|XP_002895811.1| 2-acylglycerol O-acyltransferase, putative [Phytophthora infestans 
T30-4]
 gb|EEY54640.1| 2-acylglycerol O-acyltransferase, putative [Phytophthora infestans 
T30-4]
Length=320

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 122/224 (54%), Gaps = 11/224 (5%)
 Frame = -3

Query  852  FEPNRAYVFGYEPHSIWPIGMVTLSAFTG----FMPLPKIKGLGSTAVFYTPVMRHIWTW  685
             + N+ Y+FG+ PH I  I +  +S + G      P    + LG++ +FY P+ R +  W
Sbjct  94   LDSNKKYIFGFHPHGI--IVLSRVSTYGGNWEKVFPGIPTRALGASTMFYVPLGRELCLW  151

Query  684  LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET--MFLKSRKGFVQIAMKMGT  511
            LG   A + +   +L+ G S +V PGGV E +  + + +   + LK R GFV++AM+ G 
Sbjct  152  LGGVDASRSTADKVLNDGTSIVVYPGGVPEIFKTDPNSKVNELVLKKRLGFVKLAMRHGA  211

Query  510  PLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVVVG  340
             LVP F FG+  +YN W P   +   F + ++   I+FWG   +M    P  +   VV G
Sbjct  212  ELVPSFVFGEKWLYNMWNPPQGVIDFFRKTLRIPMIVFWGKFMWMPKQPPKGKRFGVVYG  271

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
            KPI     + P+EE++ A+H++++  +  LF ++KK  GY D +
Sbjct  272  KPIPTKLTANPSEEEIRAVHTQYVAEIQRLFSEYKKDFGYDDDE  315



>ref|XP_004016381.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-like [Ovis aries]
Length=334

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 104/301 (35%), Positives = 150/301 (50%), Gaps = 43/301 (14%)
 Frame = -3

Query  1026  SIIFLPFTKAIMVIGLLFL-LMFIPI--------DQNSKW-GLRFAR-----YLCKQASG  892
             SI+ LPF   ++ IGLLF    F  I        DQN  W G R +       + K    
Sbjct  26    SILVLPFLCLVVFIGLLFTRFWFFSILYAIWLYSDQNKPWQGGRHSEIVRHWVIWKHMKD  85

Query  891   YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKIKGLGSTA-  724
             YFP+ L        +P+R Y+ G+ PH +  IG+ T   S  TGF  + P I+   +T  
Sbjct  86    YFPVSLV--KTAELDPSRNYLAGFHPHGVLSIGVFTNLCSESTGFFSVFPGIQPHVTTIN  143

Query  723   -VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFL  556
               F+ P  R      G+ P  K+S   +LS   SG   ++  GG++EA         + L
Sbjct  144   IFFWIPFFRDYIMKGGLVPVDKKSVAHILSRKGSGNLVVITVGGIKEALKTRPGANKLVL  203

Query  555   KSRKGFVQIAMKMGTPLVPVFCFGQSNVYN--------WWK-PSSKLYLKFSRAVKFTPI  403
             ++RKGFV++A+  G  LVP+F FG ++++         WWK    +LY K   A+     
Sbjct  204   RNRKGFVRLALMHGADLVPIFSFGDNDLFVHPKKSLGFWWKWFIDQLYKKTGVALP----  259

Query  402   LFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKH  238
             LF+G     Y   F+P++RPI  VVGKPIEV K   P++E++  LH R++  L  LFE H
Sbjct  260   LFYGRGVFQYSFGFIPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQRYMNELENLFEAH  319

Query  237   K  235
             K
Sbjct  320   K  320



>ref|XP_004761644.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Mustela putorius 
furo]
 ref|XP_004822967.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Mustela putorius 
furo]
Length=329

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/282 (33%), Positives = 147/282 (52%), Gaps = 32/282 (11%)
 Frame = -3

Query  987  IGLLFLL-MFIPIDQNSKWGLRFA--RYLC--KQASGYFPMHLYVEDIKAFE--PNRAYV  829
            + +L+L+ +++  D   + G RF   R L   +    Y+P+ L    +K  E  P+R YV
Sbjct  43   VSVLYLVWLYLDWDTPKQGGRRFEWIRNLAMWRHVRDYYPVKL----VKTAELPPDRNYV  98

Query  828  FGYEPHSIWPIGM-----VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAG  664
                PH I  +G        ++ F+   P  +    G   +F+ PV R      G+ P  
Sbjct  99   LSVHPHGIMCVGAFCNFSTDVTGFSKKFPGIQTSMTGLGVLFHLPVYREYLMSYGLRPVS  158

Query  663  KQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVF  493
            +QS   +LS    G + I++ GG QE+ Y       + L++RKGFV++A++ G  LVPV+
Sbjct  159  RQSLDFILSQPQRGQAVIIMVGGAQESLYAVPGKHCLILRNRKGFVRLALRHGASLVPVY  218

Query  492  CFGQSNVYNW--WKPSSKLYL---KFSRAVKFTPILFWGYMGSF-------VPFQRPIHV  349
             FG+++++ +  +  +S  YL    F R + F+P +FWG  G F       +PF RPI  
Sbjct  219  SFGENDIFKFKAFATNSWQYLCQITFKRIMGFSPCIFWG-QGLFSANSWGLLPFARPITT  277

Query  348  VVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            VVG+PI V +   PTEE++   H  F+EAL +LFE HK+  G
Sbjct  278  VVGRPIPVPQRLDPTEEEVDHYHMLFMEALEQLFEDHKESCG  319



>ref|XP_009520152.1| hypothetical protein PHYSODRAFT_486821 [Phytophthora sojae]
 gb|EGZ24864.1| hypothetical protein PHYSODRAFT_486821 [Phytophthora sojae]
Length=350

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 124/229 (54%), Gaps = 8/229 (3%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
            +  +PN+ Y+FG+ PH I  +  + +   +F    P  K + LG++ +FY P+ R +  W
Sbjct  122  QELDPNKQYIFGFHPHGIIVLSRIAIFGGSFEDIFPGIKYRILGASPMFYIPLGRELCLW  181

Query  684  LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCET--MFLKSRKGFVQIAMKMGT  511
            +G   A + + + +L  G S +V PGGV   +    + +   + LK+R GFV++AM  G 
Sbjct  182  MGGVDASRSTGEKVLDEGNSIVVYPGGVAGIFKTNPNSKETQLVLKNRLGFVKLAMNHGA  241

Query  510  PLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVVVG  340
             LVP F FG+  +YN W P + +   F + +    ++FWG   +M       +   VV G
Sbjct  242  DLVPTFVFGEKWLYNMWNPPTGVISFFRKTLGIPVLVFWGKFWWMPKAPAKGKRFGVVYG  301

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGY-VDLQLKIM  196
            KPI    +  PT+E++ A+H+++I  +  +F+++K   GY VD  L IM
Sbjct  302  KPISTKHSGNPTDEEVRAIHTQYIAEIERIFKQYKSEFGYEVDETLAIM  350



>ref|XP_008603915.1| hypothetical protein SDRG_00225 [Saprolegnia diclina VS20]
 gb|EQC42492.1| hypothetical protein SDRG_00225 [Saprolegnia diclina VS20]
Length=339

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 132/259 (51%), Gaps = 16/259 (6%)
 Frame = -3

Query  957  PIDQNSKW-GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL  781
            P     +W GLR   +L K    Y  + +  E  +A + ++ Y+FG+ PH I  + +  +
Sbjct  79   PATGGMQWDGLRM-HWLWKLMCEYVGLEIVRE--QALDASKQYIFGFHPHGI--LVLSRM  133

Query  780  SAFTG----FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
            S + G      P  +++ LG+T +FY P+ R +  WLG   A + + + +L    S +V 
Sbjct  134  SCYAGNWEKVHPGIEVRALGATPMFYVPLGRELCLWLGAVDASRSTAQKVLDKKLSIVVY  193

Query  612  PGGVQEAYYMEHDCET--MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
            PGG +E +    + +   + LK R GF+++A+K G  LVP F FG+  +YN W P   L 
Sbjct  194  PGGSKEIFLTNPNIKQTELVLKKRLGFIKLAIKNGADLVPTFVFGEKWMYNLWNPPKGLR  253

Query  438  LKFSRAVKFTPILFWGYMGSFVPFQ----RPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
                +  K   +LFWG   ++VP +    R + +V G PI V +   PT++   A H+ +
Sbjct  254  ATVLQVFKVPLLLFWGCWCTWVPLRLAGKRHMGIVYGAPIAVEQKDDPTDDDCLAYHATY  313

Query  270  IEALLELFEKHKKRLGYVD  214
              AL  +F+ +K   GY D
Sbjct  314  SAALQRIFDTYKSDFGYDD  332



>ref|XP_006414977.1| hypothetical protein EUTSA_v10026593mg [Eutrema salsugineum]
 gb|ESQ56430.1| hypothetical protein EUTSA_v10026593mg [Eutrema salsugineum]
Length=118

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 85/119 (71%), Gaps = 10/119 (8%)
 Frame = -3

Query  525  MKMGTPLVPVFCFGQSNVYNWWKPSSKLYL---------KFSRAVKFTPILFWGYMGSFV  373
            M+ GTPLVPVFCFGQ  +Y +    +++ +         + SRA++FTPI FWG  GS +
Sbjct  1    MEHGTPLVPVFCFGQI-LYRFCFSITRVQMVEARLETLPELSRAIRFTPICFWGVFGSPL  59

Query  372  PFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKIM  196
            P+++P+ VVVGKPIEV K  QP+ E++A LH +F+EAL +LFE+HK R+GY DLQL I+
Sbjct  60   PYRQPMDVVVGKPIEVSKTLQPSNEEIAKLHGQFVEALKDLFERHKARVGYSDLQLNIL  118



>gb|KDO23508.1| hypothetical protein SPRG_11430 [Saprolegnia parasitica CBS 223.65]
Length=339

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 131/259 (51%), Gaps = 16/259 (6%)
 Frame = -3

Query  957  PIDQNSKW-GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL  781
            P     +W GLR   +L K    Y  + +  E  +  +  + Y+FG+ PH I  + +  +
Sbjct  79   PATGGMQWDGLR-THWLWKLMCEYVGLEIVRE--QELDAAKQYIFGFHPHGI--LVLSRM  133

Query  780  SAFTG----FMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
            S + G      P  +++ LG+T +FY P+ R +  WLG   A + + + +L    S +V 
Sbjct  134  SCYAGNWEQVHPGIEVRALGATPMFYVPLGRELCLWLGAVDASRSTAQKVLDKKLSIVVY  193

Query  612  PGGVQEAYYMEHDCET--MFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLY  439
            PGG +E +    + +   + LK R GF+++A+K G  LVP F FG+  +YN W P   L 
Sbjct  194  PGGSKEIFLTNPNIKQTELVLKKRLGFIKLAIKNGADLVPTFVFGEKWMYNLWNPPKGLR  253

Query  438  LKFSRAVKFTPILFWGYMGSFVPFQ----RPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
                + +K   +LFWG   ++VP +    R + +V G PI V +   PT++   A H+ +
Sbjct  254  ATVLQVLKVPLLLFWGRWCTWVPLRLAGKRRMGIVYGTPIAVEQKDDPTDDDCLAYHATY  313

Query  270  IEALLELFEKHKKRLGYVD  214
              AL  +F+ +K   GY D
Sbjct  314  AAALQRIFDAYKTDFGYDD  332



>ref|XP_008671628.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Zea mays]
Length=246

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  582  EHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPI  403
            E+     FLKSRKGFV+IA++ G PLVPVFCFGQS  Y WW+P  KL++K +RAVKFTPI
Sbjct  146  EYAGAVAFLKSRKGFVKIAIQYGCPLVPVFCFGQSYAYKWWRPGGKLFIKIARAVKFTPI  205

Query  402  LFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLA  289
            +FWG  G+  PF +P+HVVVGKPIEV K   PT +++ 
Sbjct  206  IFWGRFGTPFPFPKPMHVVVGKPIEVNKIPHPTIDEVG  243



>ref|XP_007558068.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Poecilia formosa]
Length=355

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/241 (37%), Positives = 126/241 (52%), Gaps = 25/241 (10%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFE--PNRAYVFGYEPHSIWPIGMVTL--SAFTGF-MPLPKIK-GLGS  730
            YFP+ L    IK  +  PNR YVFGY PH I+  G      +  TGF    P IK  L +
Sbjct  112  YFPIRL----IKTHDLLPNRNYVFGYHPHGIFCFGAFCNFGTEATGFSKKFPGIKPSLAT  167

Query  729  TA-VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETM  562
             A  F  PV+R      GI P  + S   LLS   +G + ++V GG  E+ +      ++
Sbjct  168  LAGNFRLPVLRDYLMSGGICPVNRHSIDYLLSCNGTGNAVVIVVGGAAESLHCVPGVNSV  227

Query  561  FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY--------NWWKPSSKLYLKFSRAVKFTP  406
             LK+RKGFV++A++ G+ LVPV+ FG+++ Y          W+   K   +  + + F P
Sbjct  228  TLKNRKGFVKLALQKGSDLVPVYSFGENDAYKQVIFEEGTCWRALQK---RLQKILGFAP  284

Query  405  ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             LF+G     VPF  PI  +VG+PI V K   PTEE +   H  ++ +L  LF+K+K R 
Sbjct  285  CLFYGSAWGIVPFCNPITTIVGEPITVPKIEDPTEEMVDLYHGMYVRSLRCLFDKYKTRF  344

Query  225  G  223
            G
Sbjct  345  G  345



>ref|XP_001632983.1| predicted protein [Nematostella vectensis]
 gb|EDO40920.1| predicted protein [Nematostella vectensis]
Length=322

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 146/296 (49%), Gaps = 34/296 (11%)
 Frame = -3

Query  1029  ASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARYLCKQ------ASGYFPMHLYV  868
             A+ + L FT+   ++ L  L      +   K G +F     +          Y+P+ L  
Sbjct  20    AAFLLLLFTRLWFLVALYLLWAVYDWNTQKKGGRKFGNDFMRGLPVFRYMRDYYPITL--  77

Query  867   EDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKI--KGLGSTAVFYTPVM  703
             E     +P R Y+FGY PH     G V   +S   GF  L P I       +++ ++ + 
Sbjct  78    EKTAGLDPKRNYIFGYHPHGYILEGAVVGMVSDACGFRDLFPGITPHMTAHSSILHSFLF  137

Query  702   RHIWTWLGISPAGKQSFK---SLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQ  532
             R I   LG     ++S +   + L  G+S IVV GG  E    +     + LK+RKGF +
Sbjct  138   REILLSLGFVDVARESLEFALTHLGPGHSVIVVVGGAAEMMNAKEGLYALTLKNRKGFAK  197

Query  531   IAMKMGTPLVPVFCFGQSNVYN---------------WWKPSSKLYLKFSRAVKFTPILF  397
             +A++ G+PLVP+  FGQ++V +               W +   + YL  + +   + +L 
Sbjct  198   LALETGSPLVPMIAFGQNDVMSQLFNTMGSRFWHFNLWLRKMGRKYLGVTLS---SIVLI  254

Query  396   WGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
              G  G  +P++ P+++VVG+PI V K +QP+++++ ALHSR++  L ELF+ HK +
Sbjct  255   HGRFGILMPYRTPVNIVVGRPIPVSKIAQPSQKEVDALHSRYLRDLRELFDNHKSQ  310



>ref|XP_005844537.1| hypothetical protein CHLNCDRAFT_138958 [Chlorella variabilis]
 gb|EFN52435.1| hypothetical protein CHLNCDRAFT_138958 [Chlorella variabilis]
Length=271

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 119/254 (47%), Gaps = 44/254 (17%)
 Frame = -3

Query  927  RFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMPLPK  748
            RF R+    A  YFP+ +  E          YV GYEPHS+ P G+     +     L K
Sbjct  50   RFLRFSMVAAGEYFPVKIVWEGDADDYSKGPYVIGYEPHSVLPQGICIFCRYASDACLIK  109

Query  747  -IKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDC  571
              + L S+A F+ P MRH+W WLG  P  +  F++LL  G                    
Sbjct  110  NTRILVSSAGFWAPFMRHLWWWLGCRPVSRHCFQALLRKG--------------------  149

Query  570  ETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK----------PSSKLYLKFSRA  421
                        ++A++ G PLVPVF FGQ+ +Y++ +          P ++ +  F R 
Sbjct  150  ------------RLALEAGAPLVPVFAFGQTQLYDYCRLFFDWPRNLVPRAQ-WGSFVRR  196

Query  420  VKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
            + + P+L WG+ GSF+P Q P+ +VVG+PI V +   PT EQ       FI  +  LF +
Sbjct  197  IGYVPMLVWGWCGSFMPRQVPMCIVVGRPIPVPRIEHPTHEQTDKYLQLFIAEMERLFRE  256

Query  240  HKKRLGYVDLQLKI  199
            HK+  G+    L I
Sbjct  257  HKEAAGHGHATLTI  270



>ref|XP_005806752.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Xiphophorus 
maculatus]
Length=355

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 126/241 (52%), Gaps = 25/241 (10%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFE--PNRAYVFGYEPHSIWPIGMVTL--SAFTGF-MPLPKIK-GLGS  730
            YFP+ L    IK  +  PNR Y+ GY PH I+  G      +  TGF    P IK  L +
Sbjct  112  YFPVRL----IKTHDLLPNRNYILGYHPHGIFCFGAFCNFGTEATGFSKKFPGIKPSLAT  167

Query  729  TA-VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETM  562
             A  F  PV+R      GI P  + S   LLS   +G + ++V GG  E+ +      ++
Sbjct  168  LAGNFRLPVLRDYLMSGGICPVNRHSIDYLLSCNGTGNAVVIVVGGAAESLHSAPGMNSV  227

Query  561  FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY--------NWWKPSSKLYLKFSRAVKFTP  406
             LK+RKGFV++A++ G+ LVPV+ FG+++ Y          W+   K   +  + + F P
Sbjct  228  TLKNRKGFVKLALQKGSDLVPVYSFGENDAYKQVIFEEGTCWRALQK---RLQKMLGFAP  284

Query  405  ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             LF+G     VPF  PI  +VG+PI V K   PTEE +   H  ++ +LL LF+K+K R 
Sbjct  285  CLFYGSAWGIVPFCNPITTIVGEPITVPKIEDPTEEMVELYHGMYVRSLLCLFDKYKTRF  344

Query  225  G  223
            G
Sbjct  345  G  345



>ref|XP_004347733.1| Diacylglycerol acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21901.1| Diacylglycerol acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
Length=352

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 136/260 (52%), Gaps = 17/260 (7%)
 Frame = -3

Query  945  NSKWGLRFARYLCKQASGYFPMHLYVEDIKAFE-PNRAYVFGYEPH-----SIWPIGMVT  784
              +W      ++    + YFPM L    I+  E P   Y+FG  PH     S +PIG   
Sbjct  98   KRRWEWFLTSWITDALTDYFPMKL----IRTKELPPGQYIFGVHPHGVMPFSAFPIGKT-  152

Query  783  LSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGG  604
             S +    P  +++ L ++ +F  P+ R +  W G   A + + +  L + +S +++PGG
Sbjct  153  -SQWPKLFPGIRVQSLTASCLFKMPITRELALWAGGIDASRANAERALENKFSLLILPGG  211

Query  603  VQEAYYME-HDCE-TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF  430
              E      H  E  + L+ RKGF+++A+K G PLVPV+ FG + +Y+    +       
Sbjct  212  SLEILEAHPHLSEQVLVLERRKGFIELALKYGIPLVPVYSFGATELYDQLNLAKSWREWM  271

Query  429  SRAVKFTPILFWGYM-GSFVPFQRPIHVVVGKPIEVGKN--SQPTEEQLAALHSRFIEAL  259
               ++F P + WG      +P + P++VVVG+P+ V     +QPT+E + ALH+R+ +AL
Sbjct  272  IHRLRFAPTIAWGTSPWKLLPAKCPVYVVVGEPVTVDHEPMAQPTKEAIDALHARYKQAL  331

Query  258  LELFEKHKKRLGYVDLQLKI  199
            L LFEKHK   GY + +L I
Sbjct  332  LALFEKHKHAYGYGNSRLVI  351



>ref|XP_010868998.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Esox lucius]
 ref|XP_010868999.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Esox lucius]
Length=362

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 124/246 (50%), Gaps = 29/246 (12%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM-----VTLSAFTGFMPLPKIKGLGST  727
            YFP+ L     +   P+R Y+FGY PH I+  G         + F+   P  K   +   
Sbjct  113  YFPIRLI--KTQNLLPSRNYIFGYHPHGIFSFGAFCNFGTEATGFSKKFPGIKPSLVTLD  170

Query  726  AVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFL  556
              F  PV R      GI P  + S   LLS   +G + ++V GG  E+        ++ L
Sbjct  171  GNFRMPVFREYLMCGGICPVNRNSIDYLLSQNGTGNAVVIVVGGAAESLNCAPGINSVTL  230

Query  555  KSRKGFVQIAMKMGTPLVPVFCFGQSNVY--------NWWKPSSKLYLKFSRAVKFTPIL  400
            K+RKGFV++A++ G+ LVPV+ FG++NVY         WW+ + K   K  + + F P L
Sbjct  231  KNRKGFVRLALQQGSDLVPVYSFGENNVYKQVIFEEGTWWRLAQK---KLQKILGFAPCL  287

Query  399  FWGYMGSF-------VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
            F G  G F       VP+ +PI  VVG+PI V K  QP ++ +   H+ +I +L  LF+K
Sbjct  288  FHG-CGFFSSDTWGMVPYNKPITTVVGEPITVPKIEQPPQDMVDLYHAMYIRSLGNLFDK  346

Query  240  HKKRLG  223
            HK R G
Sbjct  347  HKTRFG  352



>ref|XP_004992811.1| hypothetical protein PTSG_05918 [Salpingoeca rosetta]
 gb|EGD74554.1| hypothetical protein PTSG_05918 [Salpingoeca rosetta]
Length=352

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 124/228 (54%), Gaps = 15/228 (7%)
 Frame = -3

Query  879  HLYVEDIKAFEPNRAYVFGYEPHSIWPIG-MVTL------SAFTGFMPLPKIKGLGSTAV  721
            H+ +       P+++Y+FG  PHS+ P G M+ +      S F    P    + L +T  
Sbjct  116  HVQLVKTADLNPDQSYIFGLHPHSVLPFGAMIAIGDETEDSQFKKLFPGIDFRTLAATFC  175

Query  720  FYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKG  541
            FY PV R I  W G+  A + S K +L+ G S  +VPGG  EA +   + + ++LK+R+G
Sbjct  176  FYVPVYRDILLWGGVVDAARYSAKRILNMGLSLALVPGGATEALHCHPEKDVVYLKNRRG  235

Query  540  FVQIAMKMGTPLVPVFCFGQSNVYNWWKPSS----KLYLKFSRAVKFTPILFWGYMGSFV  373
            F+++A++ G+ LVPVF F ++N Y+     +    KL  KF R    +  L    + + +
Sbjct  236  FIKLALETGSHLVPVFSFNENNTYDLIGIDNPLIDKLKNKFQRVFGISLPL----IKNVL  291

Query  372  PFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKR  229
            P +  I  VVG PI V K   P++EQ+    +++IEAL +L+  ++++
Sbjct  292  PKECHITTVVGAPIAVPKIEDPSKEQVQQYLNQYIEALRKLYNDNREK  339



>ref|XP_003738944.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-A-like [Metaseiulus 
occidentalis]
Length=364

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 106/345 (31%), Positives = 163/345 (47%), Gaps = 40/345 (12%)
 Frame = -3

Query  1152  EAAPPPTPAEF-IGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLL  976
             E AP  TP E  + T SA S+  + +     G+  S+ +    S   +P         L+
Sbjct  32    EFAPINTPLERRLQTFSAASMSFSFLFAGLGGILLSVYLFFFTSYYLIP---------LI  82

Query  975   FLLMFI-PIDQNSKWGLRFAR----YLCKQASGYFPMHLYVEDIKAFE--PNRAYVFGYE  817
             +++ ++  ID   + G R+ R     + +    YFP+ L    +K  E   +R Y+ GY 
Sbjct  83    YMVWYVYDIDTCERGGRRWQRLRKLRVWRYMRDYFPLRL----VKTAELPADRNYIIGYH  138

Query  816   PHSIWPIGMVTLSA-----FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSF  652
             PH I   G V   A     F+   P      L     F  P  R +    GI    ++S 
Sbjct  139   PHGIMSFGAVVNFATEGTKFSEVFPGIVTHPLTLRMNFLFPFYRELPLLYGICCVSQKSI  198

Query  651   KSLLS---SGYSCIVVPGGVQEAYYMEH-DCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
             + +L+    G + ++V GG QEA      D   + LK RKGF ++A++ G  LVPVF FG
Sbjct  199   EWILNRKGKGNAAVIVIGGAQEALDAHRGDDYHLTLKHRKGFARVALQNGADLVPVFSFG  258

Query  483   QSNVY----NWWKPSSKLYLKF-SRAVKFTPILFWG-----YMGSFVPFQRPIHVVVGKP  334
             +++++    N      +++ +F  R V  +P LF G     Y   +VPF+ PI  VVG P
Sbjct  259   ENDIFTQVENPRGSKLRMFQEFVKRLVGVSPALFHGRGVFQYTWGYVPFRSPITTVVGAP  318

Query  333   IEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
             I V + + P+ EQ+  LH R++E L E+FE HK R G    +L I
Sbjct  319   IRVERVANPSREQVDELHGRYVEQLREIFETHKHRCGESHKKLLI  363



>ref|XP_008426466.1| PREDICTED: diacylglycerol O-acyltransferase 2 [Poecilia reticulata]
Length=355

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 125/241 (52%), Gaps = 25/241 (10%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFE--PNRAYVFGYEPHSIWPIGMVTL--SAFTGF-MPLPKIK-GLGS  730
            YFP+ L    IK  +  PNR Y+ GY PH I+  G      +  TGF    P IK  L +
Sbjct  112  YFPVRL----IKTHDLLPNRNYILGYHPHGIFCFGAFCNFGTEATGFSKKFPGIKPSLAT  167

Query  729  TA-VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETM  562
             A  F  PV+R      GI P  + S   LLS   +G + ++V GG  E+ +      ++
Sbjct  168  LAGNFRLPVLRDYLMSGGICPVNRHSIDYLLSCNGTGNAVVIVVGGAAESLHCVPGVNSV  227

Query  561  FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY--------NWWKPSSKLYLKFSRAVKFTP  406
             LK+RKGFV++A++ G+ LVPV+ FG+++ Y          W+   K   +  + + F P
Sbjct  228  TLKNRKGFVKLALRKGSDLVPVYSFGENDAYKQVIFEEGTCWRALQK---RLQKILGFAP  284

Query  405  ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRL  226
             LF+G     VPF  PI  +VG+PI V K   PTEE +   H  ++ +L  LF+K+K R 
Sbjct  285  CLFYGSAWGIVPFCNPITTIVGEPITVPKIEDPTEEMVDLYHGMYVRSLRCLFDKYKTRF  344

Query  225  G  223
            G
Sbjct  345  G  345



>ref|XP_007639883.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Cricetulus griseus]
 ref|XP_007622443.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Cricetulus griseus]
Length=329

 Score =   129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 143/279 (51%), Gaps = 37/279 (13%)
 Frame = -3

Query  978  LFLLMFIPID--QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFE--PNRAYVFGYEPH  811
            L+L    PI   ++S+W  ++  +  K    YFP+ L    +K  E   +R YV G  PH
Sbjct  51   LYLDWNTPIQGGRHSRWMRKWTVW--KHQRDYFPIKL----LKTAELPADRNYVLGAHPH  104

Query  810  SIWPIGM-----VTLSAFTGFMPLPKIKGLGST--AVFYTPVMRHIWTWLGISPAGKQSF  652
             I   G+        +AF  F   P +K   +T   VFY P+ R    + G+ P  +QS 
Sbjct  105  GIMATGIFCNFSTDCNAF--FQLFPGLKPWVATLAGVFYLPIYREYLMFNGLCPVSRQSL  162

Query  651  KSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
              +LS    G +  ++ GG QE+ Y       + L++RKGFV++A++ G  LVPV+ FG+
Sbjct  163  DFILSQAQLGQAVTILIGGAQESLYAAPGEHRLALRTRKGFVRLALRHGASLVPVYSFGE  222

Query  480  SNVY-------NWWKPSSKLYLKFSRAVKFTPILFWGYM------GSFVPFQRPIHVVVG  340
            +++Y       N W+   +  + F R + F+P +FWG           VPF +PI  VVG
Sbjct  223  NDIYRTKSFDQNSWQ--YRCQVAFKRLMGFSPCIFWGRSLFSAESWGLVPFAQPITTVVG  280

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            +PI V ++  PTE+ +   H  +++AL +LFE HK+  G
Sbjct  281  RPIHVPQSLTPTEDHVDHYHQLYMKALEQLFEDHKEAHG  319



>ref|XP_003923532.1| PREDICTED: 2-acylglycerol O-acyltransferase 2 [Saimiri boliviensis 
boliviensis]
Length=334

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 148/312 (47%), Gaps = 24/312 (8%)
 Frame = -3

Query  1092  LMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARY  913
             L T  +L W+     +  + +A  I L FT+  ++  L  +  ++  D+  + G R    
Sbjct  15    LQTFAVLQWVFSFLMLAEICIAGFIALLFTRFWLLSVLYAVWWYLDRDKPRQGGRRIQAI  74

Query  912   LC----KQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIG-----MVTLSAFTGFM  760
              C    K    YFP+ L        +P+R Y+ G+ PH +   G         + F+   
Sbjct  75    RCWTIWKYMKDYFPISLV--KTAELDPSRNYIAGFHPHGVLAAGAFANLCTESTGFSSIF  132

Query  759   PLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAY  589
             P      +  T  F  P  R      G+  + K+S   +LS    G    ++ GG QEA 
Sbjct  133   PGINPHLMMLTLWFRVPFFRDYIMSAGLVTSEKESAAHILSRKGGGNLLGIIVGGAQEAL  192

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF--SRAVK  415
                    T+ L++RKGF+++A+  G PLVP+F FG++++++    SS  +L+   +R  K
Sbjct  193   DARPGSFTLLLRNRKGFIRLALTHGAPLVPIFSFGENDLFDQVSNSSGSWLRCIQNRLQK  252

Query  414   FTPI---LFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
                I   LF G     Y    +P++RPI  VVGKPIEV K   P+EE++  LH R+I+ L
Sbjct  253   IMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKEL  312

Query  258   LELFEKHKKRLG  223
               LFE HK +  
Sbjct  313   CNLFEAHKHKFN  324



>ref|XP_001253431.1| PREDICTED: 2-acylglycerol O-acyltransferase 2 isoform X1 [Bos 
taurus]
Length=328

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 155/305 (51%), Gaps = 24/305 (8%)
 Frame = -3

Query  1092  LMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKW-GLRFAR  916
             L TL++L  +    S+ ++     I L FT+   +I +L+ + +  +D+   W G R   
Sbjct  15    LQTLVVLQAVSCLVSMAILSYVVFIGLLFTR-FWIISILYAVWWY-LDRAKPWQGSRHID  72

Query  915   YL-----CKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMP  757
              L      K    YFP+ L        +P+R Y+ GY PH I  +G  T   +  TGF  
Sbjct  73    VLRRWSVWKYMKDYFPISLV--KTADLDPSRNYLVGYHPHGIATVGAFTNFCTDGTGFSS  130

Query  756   L-PKIKG--LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQE  595
             L P I+   +     F+ PV R      G+  A K+S   +LS    G    +V GGVQE
Sbjct  131   LFPGIRSHLMVLNLCFWAPVFRDYIIISGMVAADKESASHILSREGGGNLLAIVVGGVQE  190

Query  594   AYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF-----  430
             A         + L++RKGF+++A+  G  LVP+F FG++++Y+  + S   +L++     
Sbjct  191   ALDARPGGYKLVLRNRKGFIRLALMHGADLVPIFSFGENDIYDQVENSPGTWLRWFQDGL  250

Query  429   SRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLEL  250
              R  + + +L +G  G  +P++RPI  VVGKPIEV K   P++E++  LH  ++  L  L
Sbjct  251   QRVTRGSILLVYGSFG-LMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQHYMTELENL  309

Query  249   FEKHK  235
             FE HK
Sbjct  310   FEAHK  314



>ref|XP_002108095.1| hypothetical protein TRIADDRAFT_63184 [Trichoplax adhaerens]
 gb|EDV28893.1| hypothetical protein TRIADDRAFT_63184 [Trichoplax adhaerens]
Length=340

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 127/240 (53%), Gaps = 20/240 (8%)
 Frame = -3

Query  897  SGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM-VTLSA----FTGFMPLPKIKGLG  733
            S YFP    V      +P+R Y+F Y PH +  +G  VT  A    F    P   +  L 
Sbjct  90   SDYFPCK--VIKTCQLDPSRNYLFAYHPHGLISLGFQVTFVANGNDFQEQFPGIIVHPLT  147

Query  732  STAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCETM  562
             + VF  P +R     +G+    + S + +L     G+S  +V GG  EA         +
Sbjct  148  LSLVFRFPFIRDFLLSVGVCDVSRDSCQYILEKMGPGHSIGIVIGGAAEALDAHPGYSRL  207

Query  561  FLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK--PSS---KLYLKFSRAVKFTPILF  397
             LK+R+GF++IA+K G  LVP++CFG++++Y+     P S      ++F RA  F P LF
Sbjct  208  KLKNRRGFIRIALKSGADLVPMYCFGENDLYDQASNPPGSWLRNFQIRFMRATTFIPPLF  267

Query  396  WG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKK  232
             G     Y    +P+++P++VVVGKPI V K   PTEEQ+A LH  +I +L ELF +++K
Sbjct  268  HGRGVFNYSFGLLPYRKPLNVVVGKPICVEKVENPTEEQVAELHQIYISSLKELFTQYRK  327



>gb|ELW56463.1| 2-acylglycerol O-acyltransferase 3 [Tupaia chinensis]
Length=431

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 165/349 (47%), Gaps = 49/349 (14%)
 Frame = -3

Query  1170  HRSPSNEAAPPPTPAE--FIGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKA  997
              R   + A PP  PA+  +     A  +   ++   ++G+  S +V      IFL FT+ 
Sbjct  89    QRMDDSTALPPSVPAKPRWKQWLEAVGIFQYVLTFLFMGLFFSCLV------IFLLFTRF  142

Query  996   IMVIGLLFLLMFIPIDQNSKWGLRFA----RYLCKQASGYFPMHLYVEDIKAFE--PNRA  835
               +       +++  D  SK G R+     + + K    YFP+ L    +K  E  P+R 
Sbjct  143   WFISVFYLTWLYLDWDTPSKGGRRYEWLRNQTVWKHLRDYFPIKL----VKTAELPPDRN  198

Query  834   YVFGYEPHSIWPIGMVTLSAFTGF----------MPLPKIKGLGSTAVFYTPVMRHIWTW  685
             YV G  PH     G++   +F  F           P  ++       +FY PV R     
Sbjct  199   YVLGSHPH-----GILLAGSFCNFGTEGNGCSQHFPGLRLSMAALAILFYLPVYREYLMC  253

Query  684   LGISPAGKQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMG  514
             LG  P  ++S   LLS    G + +++ GG  EA Y       + LK RKGFV++A++ G
Sbjct  254   LGARPVSRESLDFLLSQPKLGQAVVIMVGGAHEALYAIPGEHCLTLKKRKGFVRLALRHG  313

Query  513   TPLVPVFCFGQSNVYNWWKPSSKLY-----LKFSRAVKFTPILFWGYMGSF-------VP  370
               LVPV+ FG+++++     ++  +     + F + V F+P +FWG  G F       +P
Sbjct  314   ASLVPVYTFGENDIFRLKAFATDTWQYWCQVTFKKLVGFSPCIFWG-RGLFSANSWGLLP  372

Query  369   FQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
             F  PI  VVG+PI V +   PT+E++   H+ ++ AL +LFE+HK+  G
Sbjct  373   FSVPITTVVGRPIPVPQCLDPTQEEVDHYHTLYMRALEQLFEEHKESCG  421



>emb|CBN77027.1| mono-or diacylglycerol acyltransferase type 2 [Ectocarpus siliculosus]
Length=386

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 125/223 (56%), Gaps = 6/223 (3%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIG-MVTLSAFTGFMP-LPKIKGLGSTAVF  718
            YF     +E+    +P++ Y+F   PH + P+G +++ S      P +  I G+ + AV 
Sbjct  155  YFRWQCVLEE--PLDPDKRYMFAEMPHGVMPLGQLLSCSIVRHVFPGVKNISGVAADAVL  212

Query  717  YTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCETMFLKSRKGF  538
             TP +R +++W+GI  AG++S   +     +  VV GG+ E + + +  E ++LK RK F
Sbjct  213  RTPGIRLLYSWMGIRKAGRKSILDMFEEDINVAVVVGGIAEMFMVSNHTEKLYLKKRKNF  272

Query  537  VQIAMKMGTPLVPVFCFGQSNVYNW--WKPSSKLYLKFSRAVKFTPILFWGYMGSFVPFQ  364
             +I+++ G  +VPV+ FG S ++     + +     + SR  K   +LF+G  G+ VP +
Sbjct  273  TKISIEAGADIVPVYFFGNSLLHGLVGGEGADNCLCRLSRKFKTALVLFYGRFGTPVPRR  332

Query  363  RPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
            + + +V G+PI V +++ P++E +  LH+  +  + EL+ KH+
Sbjct  333  KELKMVAGRPIAVVQSNNPSDEYVDDLHAELLRRVEELYYKHR  375



>ref|NP_872180.1| Protein K07B1.4, isoform b [Caenorhabditis elegans]
 pir||T15251 hypothetical protein K07B1.4 - Caenorhabditis elegans
 emb|CCD68615.1| Protein K07B1.4, isoform b [Caenorhabditis elegans]
Length=339

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 129/246 (52%), Gaps = 30/246 (12%)
 Frame = -3

Query  897  SGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMP--------LPKIK  742
            + YFP+ L+       E N  Y+ GY PH     G+++++AF  F          LP+I+
Sbjct  89   ANYFPVKLHTTSDMPEEHN--YLIGYHPH-----GIISMAAFINFATNGTGILDTLPRIR  141

Query  741  GLGSTAV--FYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEH  577
                T V  F+TP  R      G+    ++S K +L     G + ++V GG +EA     
Sbjct  142  FHLCTLVGQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKKGKAVVLVVGGAEEALDAHP  201

Query  576  DCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK-PSSKLYLKFS----RAVKF  412
             C  + LK RKGFV+IA++ G  LVP + FG+++++N  + P      +F     R + F
Sbjct  202  GCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGF  261

Query  411  TPILFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            +P  F+G     Y    +PF++PI+ V+G PI V K   PT+EQ+  LH  +++ L ELF
Sbjct  262  SPPAFYGRGVFNYTFGLLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELF  321

Query  246  EKHKKR  229
            E+HK +
Sbjct  322  EEHKTK  327



>ref|NP_505413.1| Protein K07B1.4, isoform a [Caenorhabditis elegans]
 emb|CCD68614.1| Protein K07B1.4, isoform a [Caenorhabditis elegans]
Length=349

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 129/246 (52%), Gaps = 30/246 (12%)
 Frame = -3

Query  897  SGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTLSAFTGFMP--------LPKIK  742
            + YFP+ L+       E N  Y+ GY PH     G+++++AF  F          LP+I+
Sbjct  99   ANYFPVKLHTTSDMPEEHN--YLIGYHPH-----GIISMAAFINFATNGTGILDTLPRIR  151

Query  741  GLGSTAV--FYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEH  577
                T V  F+TP  R      G+    ++S K +L     G + ++V GG +EA     
Sbjct  152  FHLCTLVGQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKKGKAVVLVVGGAEEALDAHP  211

Query  576  DCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK-PSSKLYLKFS----RAVKF  412
             C  + LK RKGFV+IA++ G  LVP + FG+++++N  + P      +F     R + F
Sbjct  212  GCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGF  271

Query  411  TPILFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELF  247
            +P  F+G     Y    +PF++PI+ V+G PI V K   PT+EQ+  LH  +++ L ELF
Sbjct  272  SPPAFYGRGVFNYTFGLLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELF  331

Query  246  EKHKKR  229
            E+HK +
Sbjct  332  EEHKTK  337



>ref|XP_006971459.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Peromyscus maniculatus 
bairdii]
Length=329

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 149/279 (53%), Gaps = 30/279 (11%)
 Frame = -3

Query  981  LLFLL-MFIPIDQNSKWGLRFARY-----LCKQASGYFPMHLYVEDIKAFEPNRAYVFGY  820
            LL+L+ +++  D  S+ G R +R+     + K    YFP+ L          +R YV G 
Sbjct  45   LLYLVWLYLDWDTPSQ-GGRCSRWTRKWTIWKHQRDYFPIKLL--KTAELPADRNYVLGA  101

Query  819  EPHSIWPIGMVT--LSAFTGFMPL-PKIKGLGSTAV--FYTPVMRHIWTWLGISPAGKQS  655
             PH +   G+     +    F  L P ++   +T V  FY P+ R    ++G+ P  +QS
Sbjct  102  HPHGVMSTGIFCNFSTDSNDFCQLFPGLRPWVATLVGLFYLPIYRDYLMFIGLCPVSRQS  161

Query  654  FKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFG  484
               +LS    G +  ++ GG QEA Y       + L++RKGFV++A++ G  LVPV+ FG
Sbjct  162  LDFILSQPQLGQAVTIIIGGAQEALYAVPGEHCITLRTRKGFVRLALRHGASLVPVYSFG  221

Query  483  QSNVYNW--WKPSSKLY---LKFSRAVKFTPILFWGYMGSF-------VPFQRPIHVVVG  340
            ++++Y +  + P+S  +   + F R + F+P +FWG  G F       +PF +PI  VVG
Sbjct  222  ENDIYRFKSFAPNSWQHWCQVAFKRLMGFSPCVFWG-RGLFSANSWGLLPFAKPIATVVG  280

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            +PI V +  +PTE+Q+   H  +++AL +LFE HK+  G
Sbjct  281  RPIHVPQCLKPTEDQVNHYHQLYMKALEQLFEDHKETYG  319



>gb|EEZ98242.1| hypothetical protein TcasGA2_TC000681 [Tribolium castaneum]
Length=339

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 129/257 (50%), Gaps = 30/257 (12%)
 Frame = -3

Query  948  QNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM-----VT  784
            QN KW         K  S YF + L +      +PNR Y+F   PH + P G+       
Sbjct  79   QNWKW--------FKYTSDYFLITLKLAPGFQLDPNRNYLFACFPHGVLPAGLFHAMSTK  130

Query  783  LSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS---GYSCIVV  613
             S F        +K +  T +FY P  R +    G   +  +S   +LS    G   ++ 
Sbjct  131  NSRFRQLYKDFSVKTVILTLLFYLPFTRELILAHGAISSSTKSINYVLSKPQGGQIVLLF  190

Query  612  PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYN------WWKPS  451
            PGG  EA Y +       +K RKGFV++A++ G PLVPV  FG++++YN       W+  
Sbjct  191  PGGALEATYTKPGIYKFVVKKRKGFVRLALQNGAPLVPVITFGENDLYNITGDNYCWEVF  250

Query  450  SKLYLKFSRAVKFTPILFWG---YMGSF--VPFQRPIHVVVGKPIEVGKNSQPTEEQLAA  286
              +  K +    FTPILF G   +  SF  VP +RP+  V+GKPIEV K   P+EEQ+  
Sbjct  251  QNIVRKMA---GFTPILFNGRGIFQRSFGLVPLERPLMTVLGKPIEVTKVENPSEEQIKQ  307

Query  285  LHSRFIEALLELFEKHK  235
            LH +F E L++LF+K+K
Sbjct  308  LHQKFQEELVKLFDKYK  324



>ref|XP_002683800.2| PREDICTED: 2-acylglycerol O-acyltransferase 2 isoform X2, partial 
[Bos taurus]
Length=304

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 125/237 (53%), Gaps = 16/237 (7%)
 Frame = -3

Query  906  KQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKIKG-  739
            K    YFP+ L        +P+R Y+ GY PH I  +G  T   +  TGF  L P I+  
Sbjct  57   KYMKDYFPISLV--KTADLDPSRNYLVGYHPHGIATVGAFTNFCTDGTGFSSLFPGIRSH  114

Query  738  -LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDC  571
             +     F+ PV R      G+  A K+S   +LS    G    +V GGVQEA       
Sbjct  115  LMVLNLCFWAPVFRDYIIISGMVAADKESASHILSREGGGNLLAIVVGGVQEALDARPGG  174

Query  570  ETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF-----SRAVKFTP  406
              + L++RKGF+++A+  G  LVP+F FG++++Y+  + S   +L++      R  + + 
Sbjct  175  YKLVLRNRKGFIRLALMHGADLVPIFSFGENDIYDQVENSPGTWLRWFQDGLQRVTRGSI  234

Query  405  ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
            +L +G  G  +P++RPI  VVGKPIEV K   P++E++  LH  ++  L  LFE HK
Sbjct  235  LLVYGSFG-LMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQHYMTELENLFEAHK  290



>ref|XP_001730209.1| hypothetical protein MGL_2591 [Malassezia globosa CBS 7966]
 gb|EDP42995.1| hypothetical protein MGL_2591 [Malassezia globosa CBS 7966]
Length=289

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 126/242 (52%), Gaps = 25/242 (10%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGFMP-----LPKIKGLG  733
            YFP+ L+       +P + Y+FGY PH I+ +G V    S   GF       +P +  L 
Sbjct  41   YFPIQLH--KTADLDPTKNYLFGYHPHGIFGLGSVASFGSEACGFSKKFPGLIPHVLTLQ  98

Query  732  STAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG--YSCIVVPGGVQEAYYMEHDCETMF  559
            +   FYTP+ R     LG     + S +S+L SG   S ++V GG QE+         + 
Sbjct  99   NN--FYTPIYREWLMLLGYRSVSRSSCESILRSGPGESILIVVGGAQESLAAHAGFMDLT  156

Query  558  LKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYL-----KFSRAVKFT-PIL-  400
            LK R GF+++A++ G  LVPV  FG++ +Y   +   K  L     K   A  FT PIL 
Sbjct  157  LKCRLGFIKVALRTGASLVPVVSFGENEMYYQVENDRKSTLYKIQQKIKAACGFTMPILV  216

Query  399  ----FWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKK  232
                F  Y G ++P+QRPI+VVVG PI V KN  PT EQ+  L   +I+AL  L+++HK 
Sbjct  217  GRGFFHRYYG-WLPYQRPINVVVGAPIHVEKNPNPTPEQVQTLQQEYIQALTRLWDEHKD  275

Query  231  RL  226
            + 
Sbjct  276  QF  277



>ref|XP_006155804.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Tupaia chinensis]
Length=471

 Score =   129 bits (323),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 143/293 (49%), Gaps = 31/293 (11%)
 Frame = -3

Query  1023  IIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFA----RYLCKQASGYFPMHLYVEDIK  856
             +IFL FT+   +       +++  D  SK G R+     + + K    YFP+ L    +K
Sbjct  174   VIFLLFTRFWFISVFYLTWLYLDWDTPSKGGRRYEWLRNQTVWKHLRDYFPIKL----VK  229

Query  855   AFE--PNRAYVFGYEPHSIWPIGMVTLSAFTG-----FMPLPKIKGLGSTAVFYTPVMRH  697
               E  P+R YV G  PH I   G        G       P  ++       +FY PV R 
Sbjct  230   TAELPPDRNYVLGSHPHGILLAGSFCNFGTEGNGCSQHFPGLRLSMAALAILFYLPVYRE  289

Query  696   IWTWLGISPAGKQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIA  526
                 LG  P  ++S   LLS    G + +++ GG  EA Y       + LK RKGFV++A
Sbjct  290   YLMCLGARPVSRESLDFLLSQPKLGQAVVIMVGGAHEALYAIPGEHCLTLKKRKGFVRLA  349

Query  525   MKMGTPLVPVFCFGQSNVYNWWKPSSKLY-----LKFSRAVKFTPILFWGYMGSF-----  376
             ++ G  LVPV+ FG+++++     ++  +     + F + V F+P +FWG  G F     
Sbjct  350   LRHGASLVPVYTFGENDIFRLKAFATDTWQYWCQVTFKKLVGFSPCIFWG-RGLFSANSW  408

Query  375   --VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
               +PF  PI  VVG+PI V +   PT+E++   H+ ++ AL +LFE+HK+  G
Sbjct  409   GLLPFSVPITTVVGRPIPVPQCLDPTQEEVDHYHTLYMRALEQLFEEHKESCG  461



>ref|XP_003745429.1| PREDICTED: 2-acylglycerol O-acyltransferase 2-like [Metaseiulus 
occidentalis]
Length=356

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 164/344 (48%), Gaps = 38/344 (11%)
 Frame = -3

Query  1152  EAAPPPTPAEF-IGTASANSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLL  976
             + AP  TP E  + T SA S+  + +     G+  S+ +    +  ++P         L+
Sbjct  24    DFAPMNTPWERRLQTFSAASMSFSFLFAGLGGIILSMFLFFFTNHYWIP---------LI  74

Query  975   FLLMFI-PIDQNSKWGLRFAR----YLCKQASGYFPMHLY-VEDIKAFEPNRAYVFGYEP  814
             +++ +I  ++   + G R+ R     + +    YFP+HL    D+ A   +R Y+ GY P
Sbjct  75    YMVWYIYDLETCERGGRRWQRLRELRVWRYMRDYFPVHLVKTADLPA---DRNYIIGYHP  131

Query  813   HSIWPIG-MVTLSA----FTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFK  649
             H I   G M+  +     F+ F P      L     F  P  R +    G   A K+S +
Sbjct  132   HGIMSFGAMINFATEGTKFSDFFPGIFTHVLTLRLNFLFPFYRELPLLYGCCSASKESIE  191

Query  648   SLLS---SGYSCIVVPGGVQEAYYMEH-DCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQ  481
              +L+    G + ++V GG QEA      D   + LK RKGF ++A++ G  LVPVF FG+
Sbjct  192   WILNRKGKGQAAVIVIGGAQEALDAHRADDYHLTLKHRKGFARLALQYGADLVPVFSFGE  251

Query  480   SNVYNWWK-PSSKLYLKFSRAVK----FTPILFWG-----YMGSFVPFQRPIHVVVGKPI  331
             +++++  + P       F   VK    F+P  F G     Y   +VPF+ PI  VVG PI
Sbjct  252   NDIFDQVENPRGSKLRSFQEFVKKIVGFSPAFFHGRGVFQYTWGYVPFRSPITTVVGAPI  311

Query  330   EVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQLKI  199
              V + + PT EQ+  LH +++E L  +FE HK R G    +L I
Sbjct  312   RVERVANPTREQVEELHGKYVEQLRGIFETHKHRCGESHKKLMI  355



>tpg|DAA21905.1| TPA: monoacylglycerol O-acyltransferase 2-like [Bos taurus]
Length=297

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 125/237 (53%), Gaps = 16/237 (7%)
 Frame = -3

Query  906  KQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMPL-PKIKG-  739
            K    YFP+ L        +P+R Y+ GY PH I  +G  T   +  TGF  L P I+  
Sbjct  50   KYMKDYFPISLV--KTADLDPSRNYLVGYHPHGIATVGAFTNFCTDGTGFSSLFPGIRSH  107

Query  738  -LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDC  571
             +     F+ PV R      G+  A K+S   +LS    G    +V GGVQEA       
Sbjct  108  LMVLNLCFWAPVFRDYIIISGMVAADKESASHILSREGGGNLLAIVVGGVQEALDARPGG  167

Query  570  ETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF-----SRAVKFTP  406
              + L++RKGF+++A+  G  LVP+F FG++++Y+  + S   +L++      R  + + 
Sbjct  168  YKLVLRNRKGFIRLALMHGADLVPIFSFGENDIYDQVENSPGTWLRWFQDGLQRVTRGSI  227

Query  405  ILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHK  235
            +L +G  G  +P++RPI  VVGKPIEV K   P++E++  LH  ++  L  LFE HK
Sbjct  228  LLVYGSFG-LMPYRRPITTVVGKPIEVQKTPHPSQEEVDRLHQHYMTELENLFEAHK  283



>ref|XP_004587242.1| PREDICTED: 2-acylglycerol O-acyltransferase 3-like [Ochotona 
princeps]
Length=341

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 149/306 (49%), Gaps = 39/306 (13%)
 Frame = -3

Query  1035  VLASIIFLPFT---------KAIMVIGLLFLL-MFIPIDQNSKWGLRFARY----LCKQA  898
             VLA II  PF+           +  + +L+L+ +++  D  S+ G R+ R     + K  
Sbjct  30    VLAVIILGPFSCLLLFLFLFTQLWPLTVLYLMWLYLDRDTPSQGGRRWKRLKNWSIWKHQ  89

Query  897   SGYFPMHLYVEDIKAFE--PNRAYVFGYEPHSIWPIGMVT--LSAFTGF-MPLPKIKGLG  733
               YFP+ L    +K  E  PN+ YV G  PH I  +GMV   +S    F    P ++   
Sbjct  90    RDYFPIKL----VKTAELPPNQNYVLGSHPHGIMCMGMVCNFMSECNDFSRRFPGLQPWI  145

Query  732   STAV--FYTPVMRHIWTWLGISPAGKQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCE  568
             +T V  FY PV R      G+ P  + S   +LS    G + ++V GG QE         
Sbjct  146   TTLVEFFYLPVFRDYLLAAGLRPVSRHSLDFVLSQPQLGQAVVIVIGGGQELLSTSPGQH  205

Query  567   TMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF-----SRAVKFTPI  403
              + L +RKGFV++A++ G  LVP + FG+++V+N        +L        R + F+P 
Sbjct  206   FLKLLNRKGFVRLALRHGASLVPTYSFGENDVFNTKTFPEGSWLNLCQVVHKRIIGFSPC  265

Query  402   LFWGYM------GSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
             +FWG           +P  RPI  VVG PI V + S PTEEQ+   H  ++EAL  LFE+
Sbjct  266   VFWGRSIFLPNSWGLLPHPRPITTVVGAPIHVPQLSAPTEEQVDHYHRLYMEALERLFEE  325

Query  240   HKKRLG  223
             HK+  G
Sbjct  326   HKESCG  331



>ref|XP_001630435.1| predicted protein [Nematostella vectensis]
 gb|EDO38372.1| predicted protein [Nematostella vectensis]
Length=337

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 127/255 (50%), Gaps = 24/255 (9%)
 Frame = -3

Query  933  GLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGM-----VTLSAFT  769
            GLR  +Y       YFP+ L        +P++ YVFGY PH I   G         + F+
Sbjct  79   GLRVWKYF----RDYFPIQLV--KTTELDPSKHYVFGYHPHGILCAGAFCNFATEATNFS  132

Query  768  GFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS---GYSCIVVPGGVQ  598
               P      L   A+F  P+ R      G+      S + +L +   G S ++V GG  
Sbjct  133  EVFPGITPHLLPLMALFKPPLFRDYIMSSGMCDVTHDSCEYILQNKGPGNSIVIVVGGAS  192

Query  597  EAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSS-----KLYLK  433
            EA         + LK+R GF+++A++ G  LVPV+ FG+++V+N           ++  K
Sbjct  193  EALDAHPGTNVLTLKARYGFIKLAIRNGASLVPVYAFGENDVFNQVSNPRGSMLRRIQTK  252

Query  432  FSRAVKFTPILFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFI  268
              + V F P+LF+G     Y    +P ++PIHVVVG PIEV KN  P+ +++  +H  + 
Sbjct  253  IQKTVAFAPVLFYGRGIFQYTFGLLPHRKPIHVVVGSPIEVEKNENPSRDEVQRVHDLYE  312

Query  267  EALLELFEKHKKRLG  223
            + L++LFE +K++ G
Sbjct  313  DKLVKLFEDNKEKYG  327



>ref|XP_004354544.1| Monoacylglycerol Oacyltransferase 2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR24399.1| Monoacylglycerol Oacyltransferase 2, putative [Acanthamoeba castellanii 
str. Neff]
Length=315

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 151/314 (48%), Gaps = 21/314 (7%)
 Frame = -3

Query  1101  NSLLMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSK-----  937
             +++ +TL+   ++ V P ++V +   ++F P+    + +GL+   +++  D + +     
Sbjct  9     DAVALTLLNGCYV-VGPLVLVGLPVWLLFTPWW--WLGVGLITAYLYLSFDGSERRLGKP  65

Query  936   WGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL-----SAF  772
             W       + +    YFP    V      +P+  YV    PH    +            +
Sbjct  66    WRWFHDHAVFRYLFDYFPCS--VVKTAELDPSNVYVLAVHPHGTLALNRAIFCFNKQDRW  123

Query  771   TGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVVPGGVQEA  592
                 P  + + L +++ F  P +R +W W     A K    ++L    S +V PGG  E 
Sbjct  124   NKQFPGIETRDLVASSAFKIPFIRDLWLWTSCVDASKPVAANVLRHHLSVLVYPGGEAEQ  183

Query  591   YYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKF  412
                E+  E + LKSRKGFV++AM+ G  LVP++ FG++++Y  +    +  +  S+  + 
Sbjct  184   IRTEYGKENIHLKSRKGFVRLAMEEGAHLVPIYVFGETSLYKTYSWGMRWRMWVSKRFRV  243

Query  411   TPILFWGYMGSFV--PFQRPIHVVVGKP-IEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
               +LF   MG F+  P+  P+  VVG+P I V K   P+ E + ALH R++ AL  LFEK
Sbjct  244   AVVLF---MGRFLAAPYAVPLTAVVGEPIIPVTKTDNPSAEAVDALHERYVAALSALFEK  300

Query  240   HKKRLGYVDLQLKI  199
             HK   GY D  L I
Sbjct  301   HKAAHGYADRTLHI  314



>ref|XP_001633322.1| predicted protein [Nematostella vectensis]
 gb|EDO41259.1| predicted protein [Nematostella vectensis]
Length=338

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 132/265 (50%), Gaps = 29/265 (11%)
 Frame = -3

Query  930  LRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVT--LSAFTGFMP  757
            L+  +Y C+    +FP+ L        +P + Y+  Y PH I  +G +    S  TGF  
Sbjct  81   LKMWKYFCE----FFPISLI--KTADLDPQKNYIICYHPHGIMSLGALGNFCSEATGFSE  134

Query  756  -----LPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGV  601
                  P I  L     F  PV R      G+    K+S   ++     G++ ++V GG 
Sbjct  135  KFPGITPHILTLAGNMKF--PVTRDYMMAFGVCTVEKESIHHIMERMGKGHAAVIVTGGA  192

Query  600  QEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWW---KPSS--KLYL  436
             E+         + LK RKGFV+IAMK G  LVPVF FG++ +Y+     + SS  +   
Sbjct  193  AESLDAHPGSFKITLKERKGFVKIAMKTGASLVPVFSFGENELYSQVDNPRGSSIRQWQT  252

Query  435  KFSRAVKFTPILFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRF  271
            K    + F P LF+G     Y    +P +RPI+ VVG PI V +N QP+ EQ+  LH ++
Sbjct  253  KMKNLMGFAPPLFYGRGIFQYTYGILPHRRPINTVVGAPITVERNPQPSWEQVCELHKQY  312

Query  270  IEALLELFEKHKKRLGYV-DLQLKI  199
            + AL ELF+KHK + G   D+ L+I
Sbjct  313  VTALCELFDKHKIKYGIEKDVHLEI  337



>ref|XP_003780937.1| PREDICTED: 2-acylglycerol O-acyltransferase 2 [Otolemur garnettii]
Length=334

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 98/308 (32%), Positives = 151/308 (49%), Gaps = 24/308 (8%)
 Frame = -3

Query  1092  LMTLMMLAWLGVPPSIVVVVLASIIFLPFTKAIMVIGLLFLLMFIPIDQNSKWGLRFARY  913
             L T  +L W+    ++ ++     I L FT+   +  L     ++  D   + G R   +
Sbjct  15    LQTFAVLQWVFSFLALALICTVGFIGLLFTRFWFLAVLYAAWWYLDWDTPWQGGRRVQAF  74

Query  912   LC----KQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIG--MVTLSAFTGFMPL-  754
              C    K    YFP+ L        EP+R Y+ G+ PH +   G  +   +  TGF  L 
Sbjct  75    RCWTIWKYMRDYFPISLV--KTAELEPSRNYIAGFHPHGVLAAGAFINLCTESTGFSSLF  132

Query  753   PKIKG--LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAY  589
             P I+   +  T  F  P  R      G+  + K+S   +LS    G    ++ GG QEA 
Sbjct  133   PGIRPHLMMLTLWFRVPFFRDYIMTSGLVSSEKESAAHILSRKGGGNLLGIIIGGAQEAL  192

Query  588   YMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLKF--SRAVK  415
                    T+ L++RKGF+++A+  G PLVP+F FG +++++  + SS  +L+   +R  K
Sbjct  193   DARPGAFTLLLRNRKGFIRLALTHGVPLVPIFSFGDNDLFDQVENSSGSWLRCVQNRLQK  252

Query  414   FTPI---LFWG-----YMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEAL  259
                I   LF G     Y    +P++RPI  VVGKPIEV K   P+EE+++ LH R+I+ L
Sbjct  253   IMGISLPLFHGRGIFQYSFGLMPYRRPITTVVGKPIEVKKTLHPSEEEVSQLHQRYIKEL  312

Query  258   LELFEKHK  235
               LFE HK
Sbjct  313   CNLFEAHK  320



>emb|CCG82856.1| Diacylglycerol O-acyltransferase 1, partial [Taphrina deformans 
PYCC 5710]
Length=320

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 136/257 (53%), Gaps = 21/257 (8%)
 Frame = -3

Query  951  DQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMV--TLS  778
            D+   W LR ++ L +  + Y+PM L+       +P R Y+FGY PH I  +G +    +
Sbjct  54   DRRQMW-LRKSK-LWRWFTDYYPMTLH--KTHELDPKRKYIFGYHPHGIISMGAMGNLAT  109

Query  777  AFTGFMPL-PKIKG--LGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSG--YSCIVV  613
              TGF  L P I    L   + F+ P+ R      G++   K+S +++L  G   +  +V
Sbjct  110  EATGFTELFPGITNTVLTLASNFHMPIYRDYLMAQGLASVSKRSCENILRQGPGRAITIV  169

Query  612  PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWK--PSSKLY  439
             GG QE+         + LK R G  +IAM+ G  LVP++ FG++++Y   +  P + LY
Sbjct  170  IGGAQESLLSRPHVNDLVLKKRLGVFKIAMRQGADLVPIYSFGENDIYQQIRNEPGTWLY  229

Query  438  L---KFSRAVKFTPILF-----WGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAAL  283
                 F +   FT  +F       Y    +PF+ PI+ VVG+PI V KN+ P+ E++ A+
Sbjct  230  TFQQLFKKGAGFTVPMFHARGVLNYDFGLMPFRAPINTVVGRPIRVEKNANPSLEEIQAV  289

Query  282  HSRFIEALLELFEKHKK  232
             +++IEAL E++++HK 
Sbjct  290  QAQYIEALTEIWDQHKD  306



>ref|XP_006733819.1| PREDICTED: LOW QUALITY PROTEIN: 2-acylglycerol O-acyltransferase 
3 [Leptonychotes weddellii]
Length=662

 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 144/281 (51%), Gaps = 30/281 (11%)
 Frame = -3

Query  987  IGLLFLLMFI-PIDQNSKWGLRFARY----LCKQASGYFPMHLYVEDIKAFE--PNRAYV  829
            + +L+L+ F+   D+ ++ G RF       + K A  Y+P+ L    +K  E  P+R YV
Sbjct  376  VSVLYLVWFLLDWDRPNQGGRRFEWTRNWAMWKHARDYYPIKL----VKTAELPPDRNYV  431

Query  828  FGYEPHSIWPIGM-----VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAG  664
             G  PH I  IG         + F+   P  ++      ++F+ P+ R      GI    
Sbjct  432  LGAHPHGIMCIGTFCNFSTEANNFSKQFPGIQVSPAVLASLFHFPIYRDYIMSYGICSVN  491

Query  663  KQSFKSLLSS---GYSCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVF  493
             +S   +LS    G + I++ GG QE+ Y       + L+ RKGFV++A++ G  LVPV+
Sbjct  492  WRSLNFVLSQRRLGQAVIIMVGGAQESLYAIPGKHCLILRDRKGFVRLALRHGASLVPVY  551

Query  492  CFGQSNVYNWWKPSSKLY-----LKFSRAVKFTPILFWGY------MGSFVPFQRPIHVV  346
             FG+++V+N+   ++  +     + F + + F P +FWG+          VPF RPI  V
Sbjct  552  SFGENDVFNFKAFATNSWQYMCQITFKKIMGFAPCIFWGHGLFSANSWGLVPFARPITTV  611

Query  345  VGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLG  223
            VG+PI V +   PTEE++   H  ++EAL +LFE HK+  G
Sbjct  612  VGRPIPVPQRLDPTEEEVDRYHMLYMEALEQLFEDHKESCG  652



>ref|XP_004347514.1| 2-acylglycerol O-acyltransferase 2-A [Capsaspora owczarzaki ATCC 
30864]
 gb|EFW46805.1| 2-acylglycerol O-acyltransferase 2-A [Capsaspora owczarzaki ATCC 
30864]
Length=350

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 124/248 (50%), Gaps = 20/248 (8%)
 Frame = -3

Query  912  LCKQASGYFPM------------HLYVEDIKA--FEPNRAYVFGYEPHSIWPIG-MVTLS  778
            LC+Q+ G  P+            +  V  +K    +P + Y+FG  PH I P G MV + 
Sbjct  90   LCEQSGGRKPVARKWPVFELLRKYFSVSIVKTADLDPKKQYIFGCHPHGILPFGTMVGMG  149

Query  777  -----AFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSSGYSCIVV  613
                  F    P    + L +T  FY P+ R +    G+  A + S   ++ +GYS  +V
Sbjct  150  YQFPGGFADLFPGVDYRVLAATFCFYLPLYRDLLLASGVVDAARYSAHKIMRNGYSITLV  209

Query  612  PGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVYNWWKPSSKLYLK  433
            PGG  EA Y   D + + LK R+GFV++A++ G  LVPVF F ++N +      +K    
Sbjct  210  PGGATEALYANPDKDVVVLKKRRGFVRLALEHGASLVPVFGFNENNTFKQMASDNKTMHA  269

Query  432  FSRAVKFTPILFWGYMGSFVPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLE  253
              +  +    +    + + +P +  + VVVG+PIEV K+ +P++EQ+      +IE L +
Sbjct  270  LKKQFQSIFGISLPLITNIIPRRTKVTVVVGRPIEVPKSPEPSDEQVQKYLDLYIEGLKQ  329

Query  252  LFEKHKKR  229
            L+ ++K +
Sbjct  330  LYRENKDK  337



>ref|XP_003970760.1| PREDICTED: diacylglycerol O-acyltransferase 2-like [Takifugu 
rubripes]
Length=361

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 128/246 (52%), Gaps = 29/246 (12%)
 Frame = -3

Query  891  YFPMHLYVEDIKAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGF-MPLPKIK-GLGSTA  724
            YFP+ L         PNR Y+FGY PH I+  G      +  TGF    P I+  L + A
Sbjct  112  YFPIRLI--KTHNLLPNRNYIFGYHPHGIFCFGAFCNFGTEATGFSKKFPGIRPSLATLA  169

Query  723  -VFYTPVMRHIWTWLGISPAGKQSFKSLLS---SGYSCIVVPGGVQEAYYMEHDCETMFL  556
              F  PV+R      GI P  K S   LLS   +G + I+V GG  E+        ++ L
Sbjct  170  GNFRLPVLRDYLMSGGICPVNKNSIDYLLSQNGTGNAVIIVIGGAAESLQCAPGMNSVTL  229

Query  555  KSRKGFVQIAMKMGTPLVPVFCFGQSNVY--------NWWKPSSKLYLKFSRAVKFTPIL  400
            K+RKGFV++A++ G+ LVPV+ FG+++VY        ++W+   K   +  + + F P L
Sbjct  230  KNRKGFVRLALQKGSDLVPVYSFGENDVYKQVIFEEGSYWRMWQK---RLQKILGFAPCL  286

Query  399  FWGYMGSF-------VPFQRPIHVVVGKPIEVGKNSQPTEEQLAALHSRFIEALLELFEK  241
            F G  G F       VPF +PI  +VG+PI V K   PT E +   H  +I++LL LFEK
Sbjct  287  FHG-CGLFCSSSWGIVPFCKPITTIVGEPITVPKIEDPTAEMVDLYHEMYIKSLLSLFEK  345

Query  240  HKKRLG  223
            +K R G
Sbjct  346  YKARFG  351



>ref|XP_008900467.1| hypothetical protein PPTG_07846 [Phytophthora parasitica INRA-310]
 gb|ETI53837.1| hypothetical protein F443_03266 [Phytophthora parasitica P1569]
 gb|ETK93705.1| hypothetical protein L915_03149 [Phytophthora parasitica]
 gb|ETL47101.1| hypothetical protein L916_03117 [Phytophthora parasitica]
 gb|ETM00203.1| hypothetical protein L917_03047 [Phytophthora parasitica]
 gb|ETM53392.1| hypothetical protein L914_03119 [Phytophthora parasitica]
 gb|ETN14199.1| hypothetical protein PPTG_07846 [Phytophthora parasitica INRA-310]
 gb|ETO82558.1| hypothetical protein F444_03332 [Phytophthora parasitica P1976]
 gb|ETP23647.1| hypothetical protein F441_03251 [Phytophthora parasitica CJ01A1]
 gb|ETP51638.1| hypothetical protein F442_03248 [Phytophthora parasitica P10297]
Length=355

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 121/224 (54%), Gaps = 7/224 (3%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
            +  +P + Y+FG+ PH I  +  + +    F    P  K + LG++A++Y P+ R I  W
Sbjct  127  QELDPKKQYIFGFHPHGIIVLSRLAIFGRNFDDVFPGIKNRLLGASAMYYVPLGRDICLW  186

Query  684  LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKMGT  511
            LG   A + + + +L  G S IV PGGV E +  + + +   + LK R GF+++AM+ G 
Sbjct  187  LGGVDASRSTGEKVLKEGNSIIVYPGGVPEIFRTDPNSKETQLVLKKRLGFIKLAMRHGA  246

Query  510  PLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVVVG  340
             L+P F FG+  +YN W P   +   F +A+    ++FWG   +M       +   +V G
Sbjct  247  DLIPTFIFGEKWLYNMWNPPRFIINFFRKALGIPVLVFWGKFWWMPKAPAEGKRYGLVYG  306

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVDLQ  208
            KPI       PT+E++ A+H++++  +  +F+++K   GY + +
Sbjct  307  KPIVTKHTPNPTDEEIRAVHAQYVAEIERIFKQYKSEFGYEEDE  350



>gb|ETI53835.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETM00201.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM53390.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO82556.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=339

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 117/222 (53%), Gaps = 7/222 (3%)
 Frame = -3

Query  858  KAFEPNRAYVFGYEPHSIWPIGMVTL--SAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTW  685
            +  +PN+ Y+FG+ PH I  +  + +   +F    P    + LG++ +FY P+ R +  W
Sbjct  111  QELDPNKRYIFGFHPHGIIVLSRIAIFGGSFEDVFPGITYRILGASPMFYIPLGRELCLW  170

Query  684  LGISPAGKQSFKSLLSSGYSCIVVPGGVQEAYYMEHDCE--TMFLKSRKGFVQIAMKMGT  511
            +G   A + + + +L  G S +V PGGV   +    + +   + LK+R GFV++AM  G 
Sbjct  171  MGGVDASRSTGEKVLKEGSSIVVYPGGVSGIFKTNPNSKETQLVLKNRLGFVKLAMNHGA  230

Query  510  PLVPVFCFGQSNVYNWWKPSSKLYLKFSRAVKFTPILFWG---YMGSFVPFQRPIHVVVG  340
             LVP F FG+  +YN W P   +   F + +    ++FWG   +M       +   VV G
Sbjct  231  DLVPTFVFGEKWLYNMWNPPKGVIDFFRKTLGIPVLVFWGKFWWMPKAPEKGKRYGVVYG  290

Query  339  KPIEVGKNSQPTEEQLAALHSRFIEALLELFEKHKKRLGYVD  214
            +PI    N  PTEE++ A+HS+++  +  +F ++K   GY +
Sbjct  291  RPITTKLNPNPTEEEICAIHSQYVAEIERIFGRYKLEFGYEE  332



>ref|XP_005080529.1| PREDICTED: 2-acylglycerol O-acyltransferase 3 [Mesocricetus auratus]
Length=329

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 129/268 (48%), Gaps = 35/268 (13%)
 Frame = -3

Query  957  PIDQNSKWGLRFARYLCKQASGYFPMHLYVEDIKAFE--PNRAYVFGYEPHSIWPIGM--  790
            P D   KW +       K    YFP+ L    +K  E   +R YV G  PH I   G+  
Sbjct  64   PCDWMRKWTV------WKLQRDYFPIKL----LKTAELPADRNYVLGAHPHGIMGTGIFC  113

Query  789  ---VTLSAFTGFMPLPKIKGLGSTAVFYTPVMRHIWTWLGISPAGKQSFKSLLSS---GY  628
                  +AF+   P  +        +FY P+ R    + GI P  + S   +LS    G 
Sbjct  114  NFSTDSNAFSQLFPGLRPWVATLAGLFYFPIYREYLMFNGICPVSRHSLDFILSQPQLGQ  173

Query  627  SCIVVPGGVQEAYYMEHDCETMFLKSRKGFVQIAMKMGTPLVPVFCFGQSNVY-------  469
            +  +V GG QE+ Y       + L++RKGFV +A++ G  LVPV+ FG++++Y       
Sbjct  174  AVTIVIGGAQESLYTAPGEHRLELRTRKGFVHLALRHGASLVPVYSFGENDIYRIKSFDQ  233

Query  468  NWWKPSSKLYLKFSRAVKFTPILFWGYM------GSFVPFQRPIHVVVGKPIEVGKNSQP  307
            N W+   +  L F R + F+P +FWG           VPF +PI  VVG PI V +   P
Sbjct  234  NSWQ--YRCQLAFKRIMGFSPCIFWGRSLFSAKSWGLVPFAQPITTVVGHPIHVPQCPTP  291

Query  306  TEEQLAALHSRFIEALLELFEKHKKRLG  223
            TE+Q+   H  +++AL +LFE HK+  G
Sbjct  292  TEDQVDRYHQLYMKALEQLFEDHKEAHG  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4077857314062