BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22394_g1_i5 len=1009 path=[1:0-801 6936:802-802 972:803-1008]

Length=1009
                                                                      Score     E

ref|XP_011036118.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    333   2e-108   
ref|XP_007051825.1|  Bestrophin-like protein isoform 1                  325   2e-104   
ref|XP_010255389.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    317   1e-101   
gb|KCW71630.1|  hypothetical protein EUGRSUZ_E00157                     311   3e-100   
gb|KHG25991.1|  hypothetical protein F383_04863                         312   1e-99    
gb|KDP28640.1|  hypothetical protein JCGZ_14411                         312   1e-99    
gb|KCW71629.1|  hypothetical protein EUGRSUZ_E00157                     311   2e-99    
ref|XP_010055143.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    311   2e-99    
ref|XP_009779200.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    311   2e-99    
ref|XP_002511848.1|  conserved hypothetical protein                     310   6e-99    Ricinus communis
ref|XP_009629643.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    309   1e-98    
ref|XP_002273844.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    306   2e-97    Vitis vinifera
ref|XP_011036109.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    303   1e-96    
ref|XP_011036100.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    303   4e-96    
ref|XP_004240104.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    299   9e-95    
ref|XP_006345590.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    297   7e-94    
emb|CDP08827.1|  unnamed protein product                                295   8e-93    
ref|XP_008232914.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    292   5e-92    
ref|XP_008806805.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    289   2e-91    
ref|XP_004306792.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    286   1e-89    
ref|XP_009346967.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    286   2e-89    
ref|XP_011093144.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    284   1e-88    
ref|XP_010105942.1|  hypothetical protein L484_017290                   283   2e-88    
gb|EYU35086.1|  hypothetical protein MIMGU_mgv1a006904mg                283   3e-88    
ref|XP_002320128.2|  hypothetical protein POPTR_0014s07860g             281   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006445063.1|  hypothetical protein CICLE_v10020374mg             279   1e-87    
ref|XP_006491084.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    278   3e-87    
ref|XP_006445064.1|  hypothetical protein CICLE_v10020374mg             280   4e-87    
emb|CBI40350.3|  unnamed protein product                                275   5e-86    
ref|XP_010544724.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    275   3e-85    
emb|CDY42497.1|  BnaC04g21840D                                          272   2e-84    
ref|XP_009138777.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    271   5e-84    
gb|KCW71628.1|  hypothetical protein EUGRSUZ_E00157                     270   6e-84    
gb|KFK35326.1|  hypothetical protein AALP_AA5G270100                    271   6e-84    
emb|CDY48927.1|  BnaA09g39100D                                          271   7e-84    
ref|XP_006397763.1|  hypothetical protein EUTSA_v10001467mg             270   2e-83    
emb|CAB71062.1|  putative protein                                       268   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116798.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    268   1e-82    
ref|NP_191691.2|  bestrophin-like protein                               268   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_182111.1|  Bestrophin-like protein                               267   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402493.1|  hypothetical protein EUTSA_v10006010mg             266   4e-82    
ref|XP_002876606.1|  hypothetical protein ARALYDRAFT_907660             266   7e-82    
ref|XP_010413427.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    265   2e-81    
ref|XP_007218264.1|  hypothetical protein PRUPE_ppa008190mg             263   2e-81    
ref|XP_002880204.1|  hypothetical protein ARALYDRAFT_483727             263   8e-81    
emb|CDX71745.1|  BnaC08g31290D                                          263   9e-81    
dbj|BAF02248.1|  hypothetical protein                                   261   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473805.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    260   3e-80    
ref|XP_006295941.1|  hypothetical protein CARUB_v10025078mg             261   7e-80    
ref|XP_010506566.1|  PREDICTED: UPF0187 protein At2g45870, chloro...    259   2e-79    
ref|XP_006291217.1|  hypothetical protein CARUB_v10017348mg             259   3e-79    
ref|XP_008368092.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    260   3e-79    
ref|XP_010518230.1|  PREDICTED: UPF0187 protein At2g45870, chloro...    258   6e-79    
emb|CDY27352.1|  BnaC04g50530D                                          256   3e-78    
ref|XP_010512468.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    256   6e-78    
ref|XP_009142375.1|  PREDICTED: UPF0187 protein At2g45870, chloro...    255   1e-77    
ref|XP_010670570.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    254   3e-77    
ref|XP_010508100.1|  PREDICTED: UPF0187 protein At2g45870, chloro...    253   1e-76    
emb|CDY37072.1|  BnaA04g26500D                                          251   4e-76    
ref|XP_008338893.1|  PREDICTED: uncharacterized protein LOC103401948    259   6e-76    
ref|XP_004510796.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    248   5e-75    
gb|KFK37376.1|  hypothetical protein AALP_AA4G248600                    244   2e-73    
ref|XP_010918544.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    242   1e-72    
ref|XP_008806803.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    240   7e-72    
gb|ABR16579.1|  unknown                                                 240   1e-71    Picea sitchensis
ref|XP_007135048.1|  hypothetical protein PHAVU_010G097300g             236   9e-70    
gb|KEH18868.1|  bestrophin-like protein                                 228   5e-68    
ref|XP_003521899.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    229   2e-67    
gb|EPS60979.1|  hypothetical protein M569_13821                         229   2e-66    
ref|XP_007051826.1|  Bestrophin-like protein isoform 2                  218   2e-64    
ref|XP_009411529.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    213   2e-61    
ref|XP_003529947.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    213   2e-61    
ref|XP_001754349.1|  predicted protein                                  204   9e-59    
ref|XP_001761167.1|  predicted protein                                  202   1e-57    
ref|XP_004986072.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    199   4e-56    
ref|XP_002466026.1|  hypothetical protein SORBIDRAFT_01g050290          197   2e-55    Sorghum bicolor [broomcorn]
ref|XP_006445061.1|  hypothetical protein CICLE_v10020374mg             191   6e-54    
ref|NP_001143185.1|  uncharacterized protein LOC100275685               189   3e-52    Zea mays [maize]
gb|ACL54730.1|  unknown                                                 189   4e-52    Zea mays [maize]
ref|XP_002965156.1|  hypothetical protein SELMODRAFT_65241              185   7e-52    
ref|XP_002962243.1|  hypothetical protein SELMODRAFT_65166              185   9e-52    
ref|XP_010418596.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    183   1e-51    
ref|NP_001048682.1|  Os03g0106000                                       185   6e-51    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85884.1|  predicted protein                                      184   1e-50    
ref|XP_003562221.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    172   5e-46    
ref|XP_008354243.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0187 prot...    166   3e-44    
ref|XP_001757529.1|  predicted protein                                  152   4e-39    
ref|XP_006650954.1|  PREDICTED: UPF0187 protein At3g61320, chloro...    142   2e-36    
ref|XP_001762184.1|  predicted protein                                  143   6e-36    
gb|KHN42212.1|  UPF0187 protein, chloroplastic                          137   2e-35    
gb|KHN26978.1|  UPF0187 protein, chloroplastic                          137   3e-35    
ref|XP_006827657.1|  hypothetical protein AMTR_s00009p00251540          137   2e-34    
ref|XP_001785122.1|  predicted protein                                  135   3e-33    
ref|XP_001757527.1|  predicted protein                                  124   2e-29    
ref|XP_001760828.1|  predicted protein                                  120   1e-27    
ref|XP_001763440.1|  predicted protein                                  116   5e-26    
ref|XP_005643731.1|  UPF0187-domain-containing protein                  112   1e-24    
ref|XP_008669850.1|  PREDICTED: uncharacterized protein LOC100275...    108   2e-23    
gb|EMT19485.1|  hypothetical protein F775_25165                         107   3e-23    
tpg|DAA42825.1|  TPA: hypothetical protein ZEAMMB73_156509              106   3e-23    
ref|XP_001690694.1|  hypothetical protein CHLREDRAFT_180771             105   2e-22    Chlamydomonas reinhardtii
gb|EMS56622.1|  hypothetical protein TRIUR3_04506                       102   7e-22    
ref|XP_005843733.1|  hypothetical protein CHLNCDRAFT_9818               102   2e-21    
ref|XP_001754623.1|  predicted protein                                92.0    5e-18    
gb|KFM28033.1|  UPF0187 protein, chloroplastic                        92.8    2e-17    
ref|XP_005848889.1|  hypothetical protein CHLNCDRAFT_21860            88.6    9e-17    
ref|XP_001702034.1|  predicted protein                                88.6    2e-16    Chlamydomonas reinhardtii
ref|XP_005848510.1|  hypothetical protein CHLNCDRAFT_144992           87.4    2e-15    
ref|XP_006574293.1|  PREDICTED: UPF0187 protein At2g45870, chloro...  79.3    2e-14    
ref|XP_001697952.1|  hypothetical protein CHLREDRAFT_105828           81.3    4e-14    Chlamydomonas reinhardtii
ref|XP_002957909.1|  hypothetical protein VOLCADRAFT_121660           82.0    5e-14    
ref|XP_002950724.1|  hypothetical protein VOLCADRAFT_104839           81.3    8e-14    
ref|XP_003059798.1|  predicted protein                                74.7    2e-11    
ref|XP_005845811.1|  hypothetical protein CHLNCDRAFT_58489            70.1    5e-10    
ref|XP_005845925.1|  hypothetical protein CHLNCDRAFT_32075            70.1    6e-10    
ref|WP_011553749.1|  membrane protein                                 68.6    1e-09    
ref|XP_002945729.1|  hypothetical protein VOLCADRAFT_85997            67.0    6e-09    
ref|XP_005845524.1|  hypothetical protein CHLNCDRAFT_136634           65.5    2e-08    
ref|XP_005843048.1|  hypothetical protein CHLNCDRAFT_141619           65.5    2e-08    
ref|XP_005849094.1|  hypothetical protein CHLNCDRAFT_143620           65.5    2e-08    
ref|XP_002953907.1|  hypothetical protein VOLCADRAFT_106175           65.5    2e-08    
ref|XP_002956818.1|  hypothetical protein VOLCADRAFT_97891            64.7    3e-08    
ref|XP_005784966.1|  hypothetical protein EMIHUDRAFT_122975           62.8    8e-08    
ref|XP_005758002.1|  hypothetical protein EMIHUDRAFT_107237           62.8    1e-07    
ref|XP_005760402.1|  hypothetical protein EMIHUDRAFT_218002           62.4    2e-07    
ref|XP_005756210.1|  hypothetical protein EMIHUDRAFT_221952           62.4    2e-07    
ref|XP_002500465.1|  predicted protein                                61.2    4e-07    Micromonas commoda
ref|XP_002180945.1|  predicted protein                                60.5    7e-07    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_025646953.1|  MULTISPECIES: hypothetical protein               59.7    1e-06    
ref|XP_005849238.1|  hypothetical protein CHLNCDRAFT_34835            60.1    1e-06    
ref|XP_005834010.1|  hypothetical protein GUITHDRAFT_52696            57.4    2e-06    
ref|XP_001689657.1|  predicted protein                                58.5    3e-06    Chlamydomonas reinhardtii
ref|XP_002180761.1|  predicted protein                                58.2    5e-06    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_027420594.1|  hypothetical protein                             57.4    5e-06    
ref|XP_005833734.1|  hypothetical protein GUITHDRAFT_107530           57.8    6e-06    
ref|XP_005709103.1|  hypothetical protein Gasu_03530                  57.4    7e-06    
ref|XP_005763363.1|  hypothetical protein EMIHUDRAFT_215245           57.4    7e-06    
ref|WP_012306097.1|  hypothetical protein                             57.0    8e-06    
ref|WP_030007083.1|  hypothetical protein                             57.0    8e-06    
ref|XP_005773069.1|  hypothetical protein EMIHUDRAFT_242012           57.4    9e-06    
ref|XP_001697963.1|  low-CO2-inducible membrane protein               56.2    9e-06    Chlamydomonas reinhardtii
ref|XP_001697691.1|  hypothetical protein CHLREDRAFT_195314           56.2    1e-05    Chlamydomonas reinhardtii
ref|WP_025650724.1|  MULTISPECIES: hypothetical protein               55.8    2e-05    
gb|KDD74270.1|  bestrophin                                            55.8    2e-05    
dbj|GAJ67191.1|  hypothetical protein MA13_contig00004-0260           54.3    2e-05    
ref|XP_002945810.1|  hypothetical protein VOLCADRAFT_102778           56.2    3e-05    
ref|XP_005770556.1|  hypothetical protein EMIHUDRAFT_54215            54.3    6e-05    
ref|XP_005785617.1|  hypothetical protein EMIHUDRAFT_426591           54.3    7e-05    
ref|XP_005759737.1|  hypothetical protein EMIHUDRAFT_414796           54.3    8e-05    
ref|XP_002180738.1|  predicted protein                                53.1    2e-04    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_007393382.1|  hypothetical protein                             52.8    2e-04    
ref|XP_002289965.1|  predicted protein                                53.1    2e-04    Thalassiosira pseudonana CCMP1335
ref|XP_005828791.1|  hypothetical protein GUITHDRAFT_112228           52.0    2e-04    
ref|XP_003080595.1|  COG3781: Predicted membrane protein (ISS)        52.4    3e-04    
ref|XP_005767452.1|  hypothetical protein EMIHUDRAFT_459409           52.4    3e-04    
ref|WP_010199112.1|  hypothetical protein                             51.6    4e-04    
emb|CBJ26187.1|  conserved unknown protein                            51.6    5e-04    
ref|XP_002507093.1|  hypothetical protein MICPUN_54949                51.6    6e-04    Micromonas commoda
ref|WP_022608835.1|  putative membrane protein                        51.2    6e-04    
ref|WP_006631076.1|  hypothetical protein                             50.8    7e-04    
ref|XP_002178861.1|  predicted protein                                50.8    8e-04    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005647741.1|  UPF0187-domain-containing protein                50.8    8e-04    
ref|XP_002291842.1|  predicted protein                                50.4    8e-04    Thalassiosira pseudonana CCMP1335



>ref|XP_011036118.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic isoform X3 
[Populus euphratica]
Length=364

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/258 (75%), Positives = 221/258 (86%), Gaps = 1/258 (0%)
 Frame = +1

Query  235   SFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrss  414
             SF+ +  +SQN P  P   I+    +LR IP+WAD +QE  MQ+KR+LY HE W  HRSS
Sbjct  45    SFKTLSSNSQNPPKKPSKAIT-ITSLLRAIPEWADRVQERGMQKKRSLYNHEKWAEHRSS  103

Query  415   lrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQ  594
              RH+RHLL+SL+SRV+LSLVPPVIAFTSVA+++ASYNSAV +H+LP FFPVLR SSLPYQ
Sbjct  104   FRHIRHLLSSLSSRVVLSLVPPVIAFTSVAVVIASYNSAVEMHFLPGFFPVLRTSSLPYQ  163

Query  595   LTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQ  774
             LTAPALALLLVFRTEASYSR E G+ AWTKVI+G +DFA QVISGV+  S+  LK+ LL+
Sbjct  164   LTAPALALLLVFRTEASYSRFEDGKTAWTKVISGTNDFARQVISGVDGSSNSALKSELLR  223

Query  775   YIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCH  954
             YIMAFP+ALKESKISCFHEGI  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCH
Sbjct  224   YIMAFPIALKESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCH  283

Query  955   WIVVPATFISAASLFCIE  1008
             WIVVP+TFISAASLFCIE
Sbjct  284   WIVVPSTFISAASLFCIE  301



>ref|XP_007051825.1| Bestrophin-like protein isoform 1 [Theobroma cacao]
 gb|EOX95982.1| Bestrophin-like protein isoform 1 [Theobroma cacao]
Length=416

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/293 (68%), Positives = 213/293 (73%), Gaps = 56/293 (19%)
 Frame = +1

Query  298   NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
             N   +LR IPDWAD IQE  MQQ RALY HE+WV HRSSLRHLRHLL+SL SRVILSLVP
Sbjct  64    NLVSLLRAIPDWADRIQERGMQQNRALYNHENWVYHRSSLRHLRHLLSSLQSRVILSLVP  123

Query  478   PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
             PV+AFTSVA+++A YN+AV LHWLP FFPVLRASSLPYQLTAPALALLLVFRTEASYSR 
Sbjct  124   PVLAFTSVAVVIAGYNTAVDLHWLPGFFPVLRASSLPYQLTAPALALLLVFRTEASYSRF  183

Query  658   EQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----------  804
             E+GR AWTKVIAG +DFA QVI+GVE+  D+ +KNALL YIMAFPVALK           
Sbjct  184   EEGRKAWTKVIAGTNDFARQVIAGVENSGDECMKNALLHYIMAFPVALKCHVMYGSDIGR  243

Query  805   --------------------------------------ESK-------ISCFHEGISACE  849
                                                   ESK       ISCFHEGI  CE
Sbjct  244   DLQNLLEGDDLAVVLNSKHRPRCIIEFISQSLKVLNLEESKRTMLESKISCFHEGIGVCE  303

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             QL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  304   QLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  356



>ref|XP_010255389.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Nelumbo 
nucifera]
Length=407

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 234/347 (67%), Gaps = 65/347 (19%)
 Frame = +1

Query  145   IQHPTNFSCASHHKP---LSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWIL  315
             I+ P N S +SH  P   L  H PL   K  K+SFRV+C  S ++      Q  +F  IL
Sbjct  8     IRSPANLSSSSHLTPKEVLRLHSPL-PQKPSKISFRVLCAQSSDS-----EQTRHFISIL  61

Query  316   RVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFT  495
             R +PDWAD I+E  MQ+KR+LY HE WV HRSSLRH+RHLL+S++SRVILSL+PPV  FT
Sbjct  62    RSVPDWADGIKERGMQKKRSLYDHETWVQHRSSLRHVRHLLSSMSSRVILSLIPPVFVFT  121

Query  496   SVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLA  675
             SVA+ +ASYNSAVSLHWLPEFFP+LRASSLPYQLTAPALALLLVFRTEASYSR E+GR A
Sbjct  122   SVAVAIASYNSAVSLHWLPEFFPLLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKA  181

Query  676   WTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----------------  804
             WTKVIAG ++FA QV++ V S SD  L+ ALLQYIMAFPVALK                 
Sbjct  182   WTKVIAGTNEFARQVMASVNSSSDVTLRKALLQYIMAFPVALKCHVIYGSDIKKDMQSLL  241

Query  805   --------------------------------ESKISCFHEGIS-------ACEQLIGIP  867
                                             +SK +     IS        CEQL+GIP
Sbjct  242   EEDDLVVVLSSKHRPRCIIEFISQSIRLLHLEDSKRTVLESKISCFHEGIGVCEQLMGIP  301

Query  868   IPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IPLSYTRLTSRFLVLWHLTLPIILWDDC+WIVVPATFISAASLFCIE
Sbjct  302   IPLSYTRLTSRFLVLWHLTLPIILWDDCNWIVVPATFISAASLFCIE  348



>gb|KCW71630.1| hypothetical protein EUGRSUZ_E00157 [Eucalyptus grandis]
Length=338

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 197/324 (61%), Positives = 222/324 (69%), Gaps = 61/324 (19%)
 Frame = +1

Query  208   LFSSKLKKLSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYK  384
             L S     +SF+V+   +  ++P  PP  IS    ILR+IPDWADA++E  MQ+KR LY 
Sbjct  17    LHSVHSNTISFKVLSSQAGDSSPQRPPAIIS----ILRMIPDWADALKEQGMQRKRTLYN  72

Query  385   HEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP  564
             HEDW+ HRSS RH+RHLL+SL+SRVILSL+PPV AFT VA+++ASYN+AV + WLPEFFP
Sbjct  73    HEDWLQHRSSQRHVRHLLSSLSSRVILSLIPPVTAFTLVAVMIASYNTAVLMEWLPEFFP  132

Query  565   VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS  744
             VLR SSLPYQLTAPALALLLVFRTEASYSR ++GR  W KVIA   DFA QVIS VES  
Sbjct  133   VLRTSSLPYQLTAPALALLLVFRTEASYSRFQEGRQIWVKVIAEVDDFARQVISTVESNE  192

Query  745   DKLLKNALLQYIMAFPVALK----------------------------------------  804
             D  LK  LL+YIMAFPVALK                                        
Sbjct  193   DSALKKLLLEYIMAFPVALKCHVTYGSDIGQDLRNRIEGDDLAMILKSKHRPRCIIEFIS  252

Query  805   ---------ESK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPII  936
                      ESK       +SCFHEGIS CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+I
Sbjct  253   QSLRLLNLEESKRNVLESNLSCFHEGISTCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVI  312

Query  937   LWDDCHWIVVPATFISAASLFCIE  1008
             LWDDCHWIVVPATFISAASLFCIE
Sbjct  313   LWDDCHWIVVPATFISAASLFCIE  336



>gb|KHG25991.1| hypothetical protein F383_04863 [Gossypium arboreum]
Length=416

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 210/294 (71%), Gaps = 57/294 (19%)
 Frame = +1

Query  298   NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
             N   +LR IPDWAD IQE  MQQ RALY HE WV HRSSLRHLRHLL+SL SRVILSLVP
Sbjct  64    NLITLLRAIPDWADRIQERGMQQNRALYNHEKWVHHRSSLRHLRHLLSSLQSRVILSLVP  123

Query  478   PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
             PV+AFTSVA +VA YN+AV LHW P FFPVLRASSLPYQLTAPALALLLVFRTEASYSR 
Sbjct  124   PVLAFTSVATVVALYNTAVDLHWFPGFFPVLRASSLPYQLTAPALALLLVFRTEASYSRY  183

Query  658   EQGRLAWTKVIAGASDFAVQVISGVE-SKSDKLLKNALLQYIMAFPVALK----------  804
             E+GR AWTKVIAG +DFA QVI+GV+ S  D+ +K ALLQYIMAFPVALK          
Sbjct  184   EEGRKAWTKVIAGTNDFARQVIAGVDNSADDQSIKAALLQYIMAFPVALKCHVMYGSDIG  243

Query  805   ---------------------------------------ESK-------ISCFHEGISAC  846
                                                    ESK       ISCFHEGI  C
Sbjct  244   RDLQNLLEVDDLAVILNSKHRPRCIIEFISQSLHLLNLEESKRTTLESKISCFHEGIGVC  303

Query  847   EQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             EQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  304   EQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  357



>gb|KDP28640.1| hypothetical protein JCGZ_14411 [Jatropha curcas]
Length=414

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 224/324 (69%), Gaps = 60/324 (19%)
 Frame = +1

Query  211   FSSKLKK--LSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYK  384
             FSSKL+K  LSF+ +   S   P  P T       +LR IPDWAD ++E  MQQKR LY 
Sbjct  34    FSSKLQKPILSFKTLSSHSSIPPESPKTL--TLVSLLRAIPDWADGVKERGMQQKRTLYN  91

Query  385   HEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP  564
             H+ WV HRSSLRH+RHLL+SL SRVILSL+PPVIAFTSVA I+ASYNSAV +H+LP FFP
Sbjct  92    HKKWVEHRSSLRHIRHLLSSLQSRVILSLIPPVIAFTSVAAIIASYNSAVEMHFLPGFFP  151

Query  565   VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS  744
             VLRASSLPYQLTAPALALLLVFRTEASYSR E+GR AWTKVI+G +DFA QVI+ V++ S
Sbjct  152   VLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKAWTKVISGTNDFARQVIATVDNCS  211

Query  745   DKLLKNALLQYIMAFPVALK----------------------------------------  804
             D  L+NALL YI+AFP+ALK                                        
Sbjct  212   DAFLRNALLHYIIAFPIALKCHVTYGSDIERDLKNLLEVDDLAVVLNSRHRPRCIIEFIS  271

Query  805   ---------ESK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPII  936
                      ESK       I C HEGI  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPII
Sbjct  272   QSLQLLNLEESKRNLLESKIPCLHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPII  331

Query  937   LWDDCHWIVVPATFISAASLFCIE  1008
             LWDDCHWIVVPATF+SAASLFCIE
Sbjct  332   LWDDCHWIVVPATFVSAASLFCIE  355



>gb|KCW71629.1| hypothetical protein EUGRSUZ_E00157 [Eucalyptus grandis]
Length=403

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 197/324 (61%), Positives = 222/324 (69%), Gaps = 61/324 (19%)
 Frame = +1

Query  208   LFSSKLKKLSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYK  384
             L S     +SF+V+   +  ++P  PP  IS    ILR+IPDWADA++E  MQ+KR LY 
Sbjct  17    LHSVHSNTISFKVLSSQAGDSSPQRPPAIIS----ILRMIPDWADALKEQGMQRKRTLYN  72

Query  385   HEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP  564
             HEDW+ HRSS RH+RHLL+SL+SRVILSL+PPV AFT VA+++ASYN+AV + WLPEFFP
Sbjct  73    HEDWLQHRSSQRHVRHLLSSLSSRVILSLIPPVTAFTLVAVMIASYNTAVLMEWLPEFFP  132

Query  565   VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS  744
             VLR SSLPYQLTAPALALLLVFRTEASYSR ++GR  W KVIA   DFA QVIS VES  
Sbjct  133   VLRTSSLPYQLTAPALALLLVFRTEASYSRFQEGRQIWVKVIAEVDDFARQVISTVESNE  192

Query  745   DKLLKNALLQYIMAFPVALK----------------------------------------  804
             D  LK  LL+YIMAFPVALK                                        
Sbjct  193   DSALKKLLLEYIMAFPVALKCHVTYGSDIGQDLRNRIEGDDLAMILKSKHRPRCIIEFIS  252

Query  805   ---------ESK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPII  936
                      ESK       +SCFHEGIS CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+I
Sbjct  253   QSLRLLNLEESKRNVLESNLSCFHEGISTCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVI  312

Query  937   LWDDCHWIVVPATFISAASLFCIE  1008
             LWDDCHWIVVPATFISAASLFCIE
Sbjct  313   LWDDCHWIVVPATFISAASLFCIE  336



>ref|XP_010055143.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Eucalyptus 
grandis]
Length=414

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 197/324 (61%), Positives = 222/324 (69%), Gaps = 61/324 (19%)
 Frame = +1

Query  208   LFSSKLKKLSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYK  384
             L S     +SF+V+   +  ++P  PP  IS    ILR+IPDWADA++E  MQ+KR LY 
Sbjct  28    LHSVHSNTISFKVLSSQAGDSSPQRPPAIIS----ILRMIPDWADALKEQGMQRKRTLYN  83

Query  385   HEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP  564
             HEDW+ HRSS RH+RHLL+SL+SRVILSL+PPV AFT VA+++ASYN+AV + WLPEFFP
Sbjct  84    HEDWLQHRSSQRHVRHLLSSLSSRVILSLIPPVTAFTLVAVMIASYNTAVLMEWLPEFFP  143

Query  565   VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS  744
             VLR SSLPYQLTAPALALLLVFRTEASYSR ++GR  W KVIA   DFA QVIS VES  
Sbjct  144   VLRTSSLPYQLTAPALALLLVFRTEASYSRFQEGRQIWVKVIAEVDDFARQVISTVESNE  203

Query  745   DKLLKNALLQYIMAFPVALK----------------------------------------  804
             D  LK  LL+YIMAFPVALK                                        
Sbjct  204   DSALKKLLLEYIMAFPVALKCHVTYGSDIGQDLRNRIEGDDLAMILKSKHRPRCIIEFIS  263

Query  805   ---------ESK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPII  936
                      ESK       +SCFHEGIS CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+I
Sbjct  264   QSLRLLNLEESKRNVLESNLSCFHEGISTCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVI  323

Query  937   LWDDCHWIVVPATFISAASLFCIE  1008
             LWDDCHWIVVPATFISAASLFCIE
Sbjct  324   LWDDCHWIVVPATFISAASLFCIE  347



>ref|XP_009779200.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Nicotiana 
sylvestris]
Length=417

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 235/353 (67%), Gaps = 67/353 (19%)
 Frame = +1

Query  142   TIQHPTNFSCASHHK---PLSFHPPLFSSKL--KKLSF---RVVCCSSQNNPHPPPTQIS  297
             +IQ PTN S +SH     P       F SKL  KK SF   +V CC  Q   +   T  S
Sbjct  9     SIQSPTNASFSSHFTLKLPSKLQQQSFPSKLSYKKFSFSTFKVRCCPQQTPENQNST--S  66

Query  298   NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
                 ILR+IPDWAD IQE  M++KR+LYKHE WV HRSSLRH+RHL +SLNSRVILSLVP
Sbjct  67    ALISILRIIPDWADRIQEEGMKKKRSLYKHESWVQHRSSLRHVRHLFSSLNSRVILSLVP  126

Query  478   PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
             PVIAFTSVA+++ASYNSAVS+HWLPEFFPVLRAS LPYQLTAPALALLLVFRTEASYSR 
Sbjct  127   PVIAFTSVAVVIASYNSAVSMHWLPEFFPVLRASPLPYQLTAPALALLLVFRTEASYSRF  186

Query  658   EQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----------  804
             E G+ AWTKVIAG +DFA QVI+ V+ KSD +LK ALLQYIMAFPVALK           
Sbjct  187   ETGKKAWTKVIAGTNDFARQVIACVD-KSDAVLKEALLQYIMAFPVALKCHITYGSDIAS  245

Query  805   -----------------ESKISCFHEGISAC----------------------------E  849
                              + +  C    IS C                            E
Sbjct  246   DLKNLLEADDLALVLSSKHRPRCVIGFISQCLQSLNLEGTKLTQLESKISCFHEGIGVCE  305

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             QL GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  306   QLAGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  358



>ref|XP_002511848.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50517.1| conserved hypothetical protein [Ricinus communis]
Length=417

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 225/333 (68%), Gaps = 62/333 (19%)
 Frame = +1

Query  190   LSFHPPLFSSKLKK----LSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENR  357
             L+ H   F SK  +    LS + +C     NPH   T       +LR IPDW+D I+E  
Sbjct  28    LTLHLTTFPSKPNRKKSNLSLKTLCSKPPPNPHKTLTLTLIS--LLRAIPDWSDRIKERG  85

Query  358   MQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVS  537
             MQQKR LY H  WV HRSSLRHLRHLL+SL SRVILSL+PPVIAFTSVA+I+ASYNSAV 
Sbjct  86    MQQKRTLYNHNKWVEHRSSLRHLRHLLSSLQSRVILSLIPPVIAFTSVAVIIASYNSAVE  145

Query  538   LHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQ  717
             +H+ P FFPVLRASSLPYQLTAPALALLLVFRTEASYSR E+GR AWTKVI+G +DFA Q
Sbjct  146   MHFFPGFFPVLRASSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWTKVISGVNDFARQ  205

Query  718   VISGVESKSDKLLKNALLQYIMAFPVALK-------------------------------  804
             VI+ V++  D +LKNALLQY++AFPVALK                               
Sbjct  206   VIATVDNSKDAVLKNALLQYVIAFPVALKCHVIYGSDINRDLRNLLEVDDLAMLLNSRHR  265

Query  805   ------------------ESK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLV  909
                               ESK       ISC HEGI  CEQL+GIPIPLSYTRLTSRFLV
Sbjct  266   PRCIIEFISQSLQLLNLEESKRHLLESKISCLHEGIGVCEQLMGIPIPLSYTRLTSRFLV  325

Query  910   LWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  326   LWHLTLPIILWDDCHWIVVPATFISAASLFCIE  358



>ref|XP_009629643.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=417

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 235/353 (67%), Gaps = 67/353 (19%)
 Frame = +1

Query  142   TIQHPTNFSCASH---HKPLSFHPPLFSSKL--KKL---SFRVVCCSSQNNPHPPPTQIS  297
             +IQ PTN S +SH     P       F SKL  KKL   +F+V CC  Q   +  PT  S
Sbjct  9     SIQSPTNASFSSHFTLKTPSKLQQQSFPSKLNFKKLRFSTFKVRCCPQQTPQNQNPT--S  66

Query  298   NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
                 ILR+IPDWAD IQE  M++KR+LY HE W+ HRSSLRH+RHL +SLNSRVILSLVP
Sbjct  67    ALISILRIIPDWADRIQEEGMKKKRSLYTHESWMQHRSSLRHVRHLFSSLNSRVILSLVP  126

Query  478   PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
             PVIAFTSVA+++ASYNSAVS+HWLPE FPVLRAS LPYQLTAPALALLLVFRTEASYSR 
Sbjct  127   PVIAFTSVAVVIASYNSAVSMHWLPELFPVLRASPLPYQLTAPALALLLVFRTEASYSRF  186

Query  658   EQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----------  804
             E G+ AWTKVIAG +DFA QVI+ V+ KSD +LK ALLQYIMAFPVALK           
Sbjct  187   ETGKKAWTKVIAGTNDFARQVIACVD-KSDAVLKAALLQYIMAFPVALKCHITYGSDIAS  245

Query  805   -----------------ESKISCFHEGISAC----------------------------E  849
                              + +  C    IS C                            E
Sbjct  246   DLKNLLEADDLAVVLSSKHRPRCIIGFISQCLQSLHLEGTKLTQLESKISCFHEGIGVCE  305

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             QL GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  306   QLAGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  358



>ref|XP_002273844.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Vitis vinifera]
Length=419

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 235/347 (68%), Gaps = 58/347 (17%)
 Frame = +1

Query  142   TIQHPTNFSCASHHKPL-SFHPPLFSSKLKKLSFRV-VCCSSQNNPHPPPTQISNFPWIL  315
             +IQ PTN +  S  K + +FH     SK  KLSFRV    S+ + P P  TQ      IL
Sbjct  7     SIQLPTNLAPYSSLKTIPNFHFLPLPSKPTKLSFRVFSSRSADSPPPPSSTQNLTLISIL  66

Query  316   RVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFT  495
             R +PDWADAI+E  MQQKR+LY HE WV HRSS RH+RHLL+S +SRVILSL+PPVIAFT
Sbjct  67    RTVPDWADAIKERGMQQKRSLYNHETWVEHRSSRRHVRHLLSSFSSRVILSLIPPVIAFT  126

Query  496   SVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLA  675
             SVA+IVASYNSAV+ HWLPEFFP+LRASSLPYQLTAPALALLLVFRTEASYSR E+GR A
Sbjct  127   SVAVIVASYNSAVTFHWLPEFFPLLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKA  186

Query  676   WTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----------------  804
             WTK+IAG +DFA QV++GVES  D LLK ALLQYIMAFPVALK                 
Sbjct  187   WTKIIAGTNDFARQVVAGVESSGDALLKKALLQYIMAFPVALKCHVIYGSDIRQDLQNLL  246

Query  805   -----------ESKISCFHEGISACEQLI----------------------------GIP  867
                        + +  C  E IS   QL+                            GIP
Sbjct  247   EVDDLAVVLSSKHRPRCIIEFISQSLQLLNLDDAKRHVLESKLSCFHEGIGVCEQLMGIP  306

Query  868   IPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IPLSYTRLTSRFLVLWHLTLPIILW+DC+WIVVPATFISAASLFCIE
Sbjct  307   IPLSYTRLTSRFLVLWHLTLPIILWEDCNWIVVPATFISAASLFCIE  353



>ref|XP_011036109.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic isoform X2 
[Populus euphratica]
Length=375

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 221/314 (70%), Gaps = 57/314 (18%)
 Frame = +1

Query  235   SFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrss  414
             SF+ +  +SQN P  P   I+    +LR IP+WAD +QE  MQ+KR+LY HE W  HRSS
Sbjct  45    SFKTLSSNSQNPPKKPSKAIT-ITSLLRAIPEWADRVQERGMQKKRSLYNHEKWAEHRSS  103

Query  415   lrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQ  594
              RH+RHLL+SL+SRV+LSLVPPVIAFTSVA+++ASYNSAV +H+LP FFPVLR SSLPYQ
Sbjct  104   FRHIRHLLSSLSSRVVLSLVPPVIAFTSVAVVIASYNSAVEMHFLPGFFPVLRTSSLPYQ  163

Query  595   LTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQ  774
             LTAPALALLLVFRTEASYSR E G+ AWTKVI+G +DFA QVISGV+  S+  LK+ LL+
Sbjct  164   LTAPALALLLVFRTEASYSRFEDGKTAWTKVISGTNDFARQVISGVDGSSNSALKSELLR  223

Query  775   YIMAFPVALK-------------------------------------------------E  807
             YIMAFP+ALK                                                 E
Sbjct  224   YIMAFPIALKCHVTYGSNIGQDLQNLLEAGDLAIVLKSRHRPRCIIEFISQCLQLLNVDE  283

Query  808   SK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV  966
             SK       ISCFHEGI  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV
Sbjct  284   SKRNLLESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV  343

Query  967   PATFISAASLFCIE  1008
             P+TFISAASLFCIE
Sbjct  344   PSTFISAASLFCIE  357



>ref|XP_011036100.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic isoform X1 
[Populus euphratica]
Length=420

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 221/314 (70%), Gaps = 57/314 (18%)
 Frame = +1

Query  235   SFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrss  414
             SF+ +  +SQN P  P   I+    +LR IP+WAD +QE  MQ+KR+LY HE W  HRSS
Sbjct  45    SFKTLSSNSQNPPKKPSKAIT-ITSLLRAIPEWADRVQERGMQKKRSLYNHEKWAEHRSS  103

Query  415   lrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQ  594
              RH+RHLL+SL+SRV+LSLVPPVIAFTSVA+++ASYNSAV +H+LP FFPVLR SSLPYQ
Sbjct  104   FRHIRHLLSSLSSRVVLSLVPPVIAFTSVAVVIASYNSAVEMHFLPGFFPVLRTSSLPYQ  163

Query  595   LTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQ  774
             LTAPALALLLVFRTEASYSR E G+ AWTKVI+G +DFA QVISGV+  S+  LK+ LL+
Sbjct  164   LTAPALALLLVFRTEASYSRFEDGKTAWTKVISGTNDFARQVISGVDGSSNSALKSELLR  223

Query  775   YIMAFPVALK-------------------------------------------------E  807
             YIMAFP+ALK                                                 E
Sbjct  224   YIMAFPIALKCHVTYGSNIGQDLQNLLEAGDLAIVLKSRHRPRCIIEFISQCLQLLNVDE  283

Query  808   SK-------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV  966
             SK       ISCFHEGI  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV
Sbjct  284   SKRNLLESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVV  343

Query  967   PATFISAASLFCIE  1008
             P+TFISAASLFCIE
Sbjct  344   PSTFISAASLFCIE  357



>ref|XP_004240104.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Solanum 
lycopersicum]
Length=412

 Score =   299 bits (766),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 228/351 (65%), Gaps = 66/351 (19%)
 Frame = +1

Query  139   MTIQHPTNFSCASHH-----KPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNF  303
              TIQ PTN S +SH            PP++    KKL+FRV+C S  +        IS  
Sbjct  8     FTIQSPTNASFSSHFTLKNPSKSQQQPPVY----KKLNFRVLCSSQPSRTPQNSNLISTL  63

Query  304   PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPV  483
               ILRV+PDWAD IQE  M++KR+LYKHE WV HRSSLRH+RHL +S NSRV+LSL+PPV
Sbjct  64    VKILRVVPDWADKIQEGGMRKKRSLYKHETWVQHRSSLRHVRHLFSSFNSRVVLSLIPPV  123

Query  484   IAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQ  663
             IAFTS A ++ASYNSAVS HWLPEFFP+LRAS  PYQLTAPALALLLVFRTEASYSR E 
Sbjct  124   IAFTSFAFVIASYNSAVSFHWLPEFFPILRASPQPYQLTAPALALLLVFRTEASYSRFEA  183

Query  664   GRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----ESKI----  816
             G+ AWTKVIAG +DFA QVI+ V+ K D +LK ALLQYIMAFPVALK     +S I    
Sbjct  184   GKKAWTKVIAGTNDFARQVIACVD-KRDDVLKEALLQYIMAFPVALKCHIVYDSDIASDL  242

Query  817   ----------------------------------------SCFHEGISACEQLIG-----  861
                                                     S     IS   + IG     
Sbjct  243   KNLLEADDLAVVLSSKHRPRCIIGFIAQSLQSLNLEGTILSQLESKISCFHEGIGVCEQL  302

Query  862   --IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
               IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  303   LGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  353



>ref|XP_006345590.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Solanum 
tuberosum]
Length=412

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 230/351 (66%), Gaps = 66/351 (19%)
 Frame = +1

Query  139   MTIQHPTNFSCASH---HKPLSFH--PPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNF  303
              TIQ PTN S +SH    KP +    PP++    KK +FRV+C S  +        IS  
Sbjct  8     FTIQSPTNASFSSHFTLKKPSNSQQQPPVY----KKFTFRVLCSSQPSRTPQNSNLISTL  63

Query  304   PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPV  483
               ILRV+PDWAD IQE  M++KR+LYKHE WV HRSSLRHLRHL +S NSRV+LSL+PPV
Sbjct  64    VKILRVVPDWADKIQEGGMRKKRSLYKHETWVQHRSSLRHLRHLFSSFNSRVVLSLIPPV  123

Query  484   IAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQ  663
             IAFTS A ++A YNSAVSLHWLPEFFP+LRAS  PYQLTAPALALLLVFRTEASYSR E 
Sbjct  124   IAFTSFAFVIACYNSAVSLHWLPEFFPILRASPQPYQLTAPALALLLVFRTEASYSRFEA  183

Query  664   GRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-----ESKI----  816
             G+ AWTKVIAG +DFA QVI+ V+ K D +LK ALLQYIMAFPVALK     +S I    
Sbjct  184   GKKAWTKVIAGTNDFARQVIACVD-KRDDVLKEALLQYIMAFPVALKCHIVYDSDIASDL  242

Query  817   ----------------------------------------SCFHEGISACEQLIGI----  864
                                                     S     I+   + IG+    
Sbjct  243   KNLLEADDLALVVSSKHRPRCIIGFISQSLQSLNLDGTILSQLESKITCFHEGIGVCEQL  302

Query  865   ---PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  303   LGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  353



>emb|CDP08827.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 193/330 (58%), Positives = 218/330 (66%), Gaps = 57/330 (17%)
 Frame = +1

Query  190   LSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPP-TQISNFPWILRVIPDWADAIQENRMQQ  366
             L  H      K  +L+ RV+C    +    P   +  N   ILR IPDWAD I+E  M++
Sbjct  26    LKVHQQSIHFKHSRLTLRVICAGQPSQSPQPSSNETLNIISILRAIPDWADGIKERGMRR  85

Query  367   KRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHW  546
             KRALY HE WV HRSSLRH+RHL++SLNSRVILSLVPPV+AFT+ A+I+ASYNSAVSLHW
Sbjct  86    KRALYNHEKWVEHRSSLRHVRHLMSSLNSRVILSLVPPVLAFTTAAVIIASYNSAVSLHW  145

Query  547   LPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS  726
             LPE FP+L ASSLPYQLTAPALALLLVFRTEASY+R E+GR AWTKVIAG SDFA QVI+
Sbjct  146   LPEIFPLLHASSLPYQLTAPALALLLVFRTEASYARFEEGRKAWTKVIAGTSDFARQVIA  205

Query  727   GVESKSDKLLKNALLQYIMAFPVALK----------------------------------  804
              V   +D  LKNALLQYIMAFPV LK                                  
Sbjct  206   NVGCTTDASLKNALLQYIMAFPVVLKCHLIHGSNVAQDLQDVLDDGDLAVILRSKDRPRC  265

Query  805   ---------------ESKISCFHEGIS-------ACEQLIGIPIPLSYTRLTSRFLVLWH  918
                            E+K +     IS        CE+L+GIPIPLSYTRLTSRFL LWH
Sbjct  266   IIEFISQSIQLLSMEEAKRNILESKISCFHEGIGVCEELMGIPIPLSYTRLTSRFLFLWH  325

Query  919   LTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LTLPIILWDDC+WIVVPATFISAASLFCIE
Sbjct  326   LTLPIILWDDCNWIVVPATFISAASLFCIE  355



>ref|XP_008232914.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Prunus 
mume]
Length=416

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 204/351 (58%), Positives = 232/351 (66%), Gaps = 65/351 (19%)
 Frame = +1

Query  145   IQHPTNFSCA-SHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQ------ISNF  303
             I+  TN S +  +  P +F  P   SK K L F+V+CCS    P+PP +       I   
Sbjct  9     IKPATNISLSCKYSTPNTF--PTLPSKPKTLKFKVLCCSPSPTPNPPSSSSSSSSPIQAA  66

Query  304   PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPV  483
               IL++IPDWAD+I+E   +Q R LY HE WV HRSS RHLRH LTSL+SRVILSL+PPV
Sbjct  67    ISILQIIPDWADSIKERGFRQNRTLYDHEKWVHHRSSYRHLRHFLTSLSSRVILSLIPPV  126

Query  484   IAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQ  663
             IAFT VA+++ASYNSAVSL+WLP FFPVLR+S+LPYQLTAPALALLLVFRTEASYSR E+
Sbjct  127   IAFTLVAVVIASYNSAVSLNWLPGFFPVLRSSTLPYQLTAPALALLLVFRTEASYSRFEE  186

Query  664   GRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-------------  804
             GR AWTKVIAGA+DFA Q+I  VE+  D  LK ALLQYI+AFPVALK             
Sbjct  187   GRKAWTKVIAGANDFARQIIFAVENSGDAQLKKALLQYIVAFPVALKCHVVYGSDIRQDL  246

Query  805   ---------------ESKISCFHEGIS----------------------------ACEQL  855
                            + + SC  E IS                             CEQL
Sbjct  247   QNLLELDDLLVVLNSKHRPSCIIEFISQSLRLLNLEDSRRIMLQSKISCFHEGIGVCEQL  306

Query  856   IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IG PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  307   IGTPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  357



>ref|XP_008806805.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=352

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 214/283 (76%), Gaps = 19/283 (7%)
 Frame = +1

Query  181   HKPLSFH-----PPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAI  345
               PL FH     PP  S   K L   ++C  S N+P P           LR + +WADA+
Sbjct  18    QNPLKFHYSHSSPP--SHPTKFLLLPILCSKSANSPFPS----------LRWVSEWADAV  65

Query  346   QENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYN  525
             +E  M+++R LY  +DW  HRSS RHLRHLL+SL+SRVILSL+PPV + T+VA  +A YN
Sbjct  66    KERGMRKRRPLYTPDDWRDHRSSSRHLRHLLSSLSSRVILSLIPPVFSLTAVAAALALYN  125

Query  526   SAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASD  705
             SAVSL WLP+FFP+ RASSLPYQLTAPALALLLVFRTEASYSR  +GR AW KV+AGA++
Sbjct  126   SAVSLAWLPDFFPLFRASSLPYQLTAPALALLLVFRTEASYSRFVEGRKAWMKVVAGANE  185

Query  706   FAVQVISGV--ESKSDKLLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLS  879
              A  VISG      +D  ++ ALL YIMAFPVALKESKISCFHEGI  CEQL+G PIPLS
Sbjct  186   LAGMVISGRGHNGGADAGVRRALLNYIMAFPVALKESKISCFHEGIGVCEQLMGTPIPLS  245

Query  880   YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             YTRLTSRFLVLWHLTLP+ILWDDC+WIVVPATFISAASLFCIE
Sbjct  246   YTRLTSRFLVLWHLTLPVILWDDCNWIVVPATFISAASLFCIE  288



>ref|XP_004306792.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=414

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/289 (62%), Positives = 201/289 (70%), Gaps = 56/289 (19%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             ILR+IPDWAD I+E   +Q R LY HE WV HRSS RHLRH LTSL+SRVILSL+PPVIA
Sbjct  67    ILRIIPDWADEIKERGFRQDRTLYDHEKWVHHRSSYRHLRHFLTSLSSRVILSLIPPVIA  126

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT VA+++ASYN+AV+L WLPE FP+LR+S+LPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  127   FTLVAVVIASYNTAVALEWLPEVFPMLRSSTLPYQLTAPALALLLVFRTEASYSRFEEGR  186

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK---------------  804
              AWTKVIAG +DFA Q+ISGVE+  D  LK ALLQY++AFPVALK               
Sbjct  187   KAWTKVIAGTNDFARQIISGVENSGDAELKKALLQYVVAFPVALKCHVIYGSNMGRDLQN  246

Query  805   ----------------------------------ESKISCFHEGIS-------ACEQLIG  861
                                               ES+ +     +S        CE LIG
Sbjct  247   LLEVDDLLVVLSSKHGPGCIIEFISQNIRMLKLEESRRNMLESNMSCFHEGISVCENLIG  306

Query  862   IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  307   TPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  355



>ref|XP_009346967.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Pyrus 
x bretschneideri]
Length=433

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 226/345 (66%), Gaps = 67/345 (19%)
 Frame = +1

Query  151   HPTNFSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQ---ISNFPWILRV  321
             HP +FS       L F      S+ K L F+++C  S      PP+    +     ILR+
Sbjct  38    HPQHFST------LQFQN--LPSRPKTLKFKILCSQSPTPDPSPPSSSSPVQTLISILRI  89

Query  322   IPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSV  501
             IPDWAD  QE  M+Q R LY HE W+ HR+S RHLRHLL+SL+SRVILSL+PPVIAFT V
Sbjct  90    IPDWADRTQERGMRQHRTLYDHEKWMHHRNSYRHLRHLLSSLSSRVILSLIPPVIAFTLV  149

Query  502   AIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWT  681
             A+++ASYN+AV+L  LP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AWT
Sbjct  150   AVVIASYNTAVALDLLPGIFPLLRSSSLPYQLTAPALALLLVFRTEASYSRFEEGRKAWT  209

Query  682   KVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-------------------  804
             +VIAGA+DFA Q+IS VE+  D  LK ALLQYI+AFPVALK                   
Sbjct  210   EVIAGANDFARQIISSVETSGDAQLKKALLQYIVAFPVALKCHVIYGSDIGRDLQNLLEV  269

Query  805   ------------------------------ESK-------ISCFHEGISACEQLIGIPIP  873
                                           ESK       ISCFHEGI  CEQLIG PIP
Sbjct  270   DDLLVVLNSKHRPGCIIQFISRSLQLLKLEESKRIMLQSKISCFHEGIGVCEQLIGTPIP  329

Query  874   LSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAAS FCIE
Sbjct  330   LSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASPFCIE  374



>ref|XP_011093144.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Sesamum 
indicum]
Length=430

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 199/283 (70%), Gaps = 56/283 (20%)
 Frame = +1

Query  328   DWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAI  507
             DWAD I+E  M+QKR LY HE WV HRSS RH+RH L+SL+SRVILSLVPPVI FTSVA+
Sbjct  81    DWADGIKERGMKQKRFLYDHEHWVQHRSSARHVRHFLSSLSSRVILSLVPPVIVFTSVAV  140

Query  508   IVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKV  687
             I+A+YNSAVS+HWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSR E+G+ AWTKV
Sbjct  141   IIATYNSAVSMHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRFEEGKKAWTKV  200

Query  688   IAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK---------------------  804
             IAG +DFA QVI+ VES SD +LK A+LQYIMAFPVALK                     
Sbjct  201   IAGTNDFAGQVIASVESPSDAMLKKAILQYIMAFPVALKCHIINGSDIAKDLKTLLEVDD  260

Query  805   -------ESKISCFHEGISACEQLI----------------------------GIPIPLS  879
                    + +  C  E IS   QL+                            GIPIPLS
Sbjct  261   LAVVLSSKHRPRCIIEFISQSLQLLDLEATKRHTLESKLCCFHEGIGVCEQLMGIPIPLS  320

Query  880   YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             YTRLTSRFLVLWH TLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  321   YTRLTSRFLVLWHFTLPIILWDDCHWIVVPATFISAASLFCIE  363



>ref|XP_010105942.1| hypothetical protein L484_017290 [Morus notabilis]
 gb|EXC06824.1| hypothetical protein L484_017290 [Morus notabilis]
Length=408

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 227/354 (64%), Gaps = 70/354 (20%)
 Frame = +1

Query  145   IQHPTN----FSCASHHKPLSF---HPPLFSSKLKKLSFRVVCCS--SQNNPHPPPTQIS  297
             + HPT     FS +S+  P +F   HP L S   K    +++  S  ++++P P  + IS
Sbjct  1     MAHPTKPTSAFSLSSNFTPKTFSNLHPTLPSKPNKTFYLKILSSSNPTKSSPSPAKSLIS  60

Query  298   NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
                 ILRV+PDWAD ++E  M+Q R LY HE WV HRSSLRH+RHLL+SL+SRVILSLVP
Sbjct  61    ----ILRVVPDWADGVKERGMKQNRTLYNHEKWVHHRSSLRHVRHLLSSLSSRVILSLVP  116

Query  478   PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
             PVIAFTS A  +A YN AV   WLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSR 
Sbjct  117   PVIAFTSFAAAIAGYNYAVLADWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRF  176

Query  658   EQGRLAWTKVIAGASDFAVQ-VISGVESKSDKLLKNALLQYIMAFPVALK----------  804
             E+GR AWTKVIAGA+DFA Q V+    S  D  +K ALLQYIMAFPVALK          
Sbjct  177   EEGRKAWTKVIAGANDFAGQVVVGVGSSSGDAPIKKALLQYIMAFPVALKCHVIYGSDVA  236

Query  805   ---------------------------------------ESKISCFHEGIS-------AC  846
                                                    ES+ +     IS        C
Sbjct  237   ADLKNLLEVDDLVVVLNSKHRPRCVIQFIKQSLKMLKLEESRRNMLESKISCFHEGISVC  296

Query  847   EQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             EQLIG PIPLSYTRLTSRFLVLWHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  297   EQLIGTPIPLSYTRLTSRFLVLWHLTLPIILWDECHWIVVPATFISAASLFCIE  350



>gb|EYU35086.1| hypothetical protein MIMGU_mgv1a006904mg [Erythranthe guttata]
Length=426

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 210/313 (67%), Gaps = 56/313 (18%)
 Frame = +1

Query  238   FRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrssl  417
              R  CC S  + +    Q S F  IL  +P+W D+IQE  +++KR+LY H DWV HRSS 
Sbjct  48    LRFSCCQSSKDSNFSLNQDSTFFSILLALPNWVDSIQEKGLEKKRSLYDHGDWVQHRSSS  107

Query  418   rhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQL  597
             RH+RH L+SL SRVILSL+PPVI FTSVA++V++YN+AV+L WLPEFFP+LRASSLPYQL
Sbjct  108   RHVRHFLSSLGSRVILSLLPPVIVFTSVAVVVSTYNTAVALAWLPEFFPILRASSLPYQL  167

Query  598   TAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQY  777
             TAPALALLLVFRTEASYSR ++G+ AWTKV++G +DFA QVI+      D +LK A+LQY
Sbjct  168   TAPALALLLVFRTEASYSRFDEGKKAWTKVVSGTNDFARQVIASAVGPDDSVLKTAILQY  227

Query  778   IMAFPVALK-----ESKIS-----------------------CFHEGIS-----------  840
             ++AFPVALK     +S I                        C  E IS           
Sbjct  228   VVAFPVALKCHVIHDSDIEQDLKNILETDDLAVVLTSNHRPRCIIEFISQSLRSLDVDPT  287

Query  841   -----------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP  969
                               CEQL+GIPIPLSYTRLTSRFLVLWH TLPIILWDDCHWIVVP
Sbjct  288   KLQVLESKLSCFHEGIGVCEQLLGIPIPLSYTRLTSRFLVLWHFTLPIILWDDCHWIVVP  347

Query  970   ATFISAASLFCIE  1008
             ATFISAASLFCIE
Sbjct  348   ATFISAASLFCIE  360



>ref|XP_002320128.2| hypothetical protein POPTR_0014s07860g [Populus trichocarpa]
 gb|EEE98443.2| hypothetical protein POPTR_0014s07860g [Populus trichocarpa]
Length=420

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 226/346 (65%), Gaps = 63/346 (18%)
 Frame = +1

Query  157   TNFSCASH---HKPLSFHPPLFSSKLKKLS---FRVVCCSSQNNPHPPPTQISNFPWILR  318
             TN S +S      PL      F SK  K S   F+ +  +SQ  P  P   I+    +LR
Sbjct  13    TNISLSSRFTPKTPLKLPLTTFPSKPLKASTPAFKTLSFNSQTPPKKPSKAIT-ITSLLR  71

Query  319   VIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTS  498
              IPDWAD ++E  M++KR+LY HE WV HRSS RH+RHLL+SL+SRV+LSLVPPVIAFTS
Sbjct  72    AIPDWADRVKERGMRKKRSLYNHEKWVEHRSSFRHVRHLLSSLSSRVVLSLVPPVIAFTS  131

Query  499   VAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAW  678
             VA++VASYNSAV +H+LP FFPVLR SSLPYQLTAPALALLLVFRTEASYSR E G+ AW
Sbjct  132   VAVVVASYNSAVEMHFLPGFFPVLRTSSLPYQLTAPALALLLVFRTEASYSRFEDGKTAW  191

Query  679   TKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK------------------  804
             TKVI+G +DFA QVISGV+  S+  LK+ LL+YIMAFP+ALK                  
Sbjct  192   TKVISGTNDFARQVISGVDGSSNSALKSELLRYIMAFPIALKCHVTYGSNIGQDLQNLLE  251

Query  805   ----------ESKISCFHEGISAC----------------------------EQLIGIPI  870
                         +  C  E IS C                            EQL+GIPI
Sbjct  252   AGDLAIVLKSRHRPRCIIEFISQCLQLLNLDESMRNLLESKISCFHEGIGVCEQLMGIPI  311

Query  871   PLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             PLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP+TFISAASLFCIE
Sbjct  312   PLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPSTFISAASLFCIE  357



>ref|XP_006445063.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|ESR58303.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|KDO86137.1| hypothetical protein CISIN_1g015152mg [Citrus sinensis]
Length=364

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 215/316 (68%), Gaps = 60/316 (19%)
 Frame = +1

Query  232   LSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhr  408
             L+F+ + C  SQ+      T+      +LR IPDWAD ++E  ++QKR LY HE WV HR
Sbjct  41    LTFKTLSCLESQSQSE---TKTLTLISVLRAIPDWADRVKERGVKQKRTLYSHEKWVEHR  97

Query  409   sslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLP  588
             SSLRH+RHLL+SL+SRVILSL+PPVIAFT VA+++ASYNSA+  H LP F PVLRASSLP
Sbjct  98    SSLRHVRHLLSSLSSRVILSLIPPVIAFTMVAVVIASYNSALDSHLLPGFLPVLRASSLP  157

Query  589   YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNAL  768
             YQLTAPALALLLVFRTEASYSR   G+ AWT++IAG +DFA  VISG ++ +D+ +K++L
Sbjct  158   YQLTAPALALLLVFRTEASYSRFVDGKKAWTQIIAGTNDFATMVISGTDNSTDECIKDSL  217

Query  769   LQYIMAFPVALK-----ESKIS-----------------------CFHEGIS--------  840
             L+YIMAFPVALK     +S +S                       C  E IS        
Sbjct  218   LRYIMAFPVALKGHVICDSDVSGDLQDLLDADDLAIVLDSKHRPRCIIEFISQSLQLLNL  277

Query  841   --------------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  960
                                  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI
Sbjct  278   EATKQNMLESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  337

Query  961   VVPATFISAASLFCIE  1008
             VVPATFISAASLFCIE
Sbjct  338   VVPATFISAASLFCIE  353



>ref|XP_006491084.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO86136.1| hypothetical protein CISIN_1g015152mg [Citrus sinensis]
Length=363

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 215/316 (68%), Gaps = 60/316 (19%)
 Frame = +1

Query  232   LSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhr  408
             L+F+ + C  SQ+      T+      +LR IPDWAD ++E  ++QKR LY HE WV HR
Sbjct  41    LTFKTLSCLESQSQSE---TKTLTLISVLRAIPDWADRVKERGVKQKRTLYSHEKWVEHR  97

Query  409   sslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLP  588
             SSLRH+RHLL+SL+SRVILSL+PPVIAFT VA+++ASYNSA+  H LP F PVLRASSLP
Sbjct  98    SSLRHVRHLLSSLSSRVILSLIPPVIAFTMVAVVIASYNSALDSHLLPGFLPVLRASSLP  157

Query  589   YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNAL  768
             YQLTAPALALLLVFRTEASYSR   G+ AWT++IAG +DFA  VISG ++ +D+ +K++L
Sbjct  158   YQLTAPALALLLVFRTEASYSRFVDGKKAWTQIIAGTNDFATMVISGTDNSTDECIKDSL  217

Query  769   LQYIMAFPVALK-----ESKIS-----------------------CFHEGIS--------  840
             L+YIMAFPVALK     +S +S                       C  E IS        
Sbjct  218   LRYIMAFPVALKGHVICDSDVSGDLQDLLDADDLAIVLDSKHRPRCIIEFISQSLQLLNL  277

Query  841   --------------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  960
                                  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI
Sbjct  278   EATKQNMLESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  337

Query  961   VVPATFISAASLFCIE  1008
             VVPATFISAASLFCIE
Sbjct  338   VVPATFISAASLFCIE  353



>ref|XP_006445064.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 ref|XP_006491083.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|ESR58304.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|KDO86135.1| hypothetical protein CISIN_1g015152mg [Citrus sinensis]
Length=412

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 215/316 (68%), Gaps = 60/316 (19%)
 Frame = +1

Query  232   LSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhr  408
             L+F+ + C  SQ+      T+      +LR IPDWAD ++E  ++QKR LY HE WV HR
Sbjct  41    LTFKTLSCLESQSQSE---TKTLTLISVLRAIPDWADRVKERGVKQKRTLYSHEKWVEHR  97

Query  409   sslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLP  588
             SSLRH+RHLL+SL+SRVILSL+PPVIAFT VA+++ASYNSA+  H LP F PVLRASSLP
Sbjct  98    SSLRHVRHLLSSLSSRVILSLIPPVIAFTMVAVVIASYNSALDSHLLPGFLPVLRASSLP  157

Query  589   YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNAL  768
             YQLTAPALALLLVFRTEASYSR   G+ AWT++IAG +DFA  VISG ++ +D+ +K++L
Sbjct  158   YQLTAPALALLLVFRTEASYSRFVDGKKAWTQIIAGTNDFATMVISGTDNSTDECIKDSL  217

Query  769   LQYIMAFPVALK-----ESKIS-----------------------CFHEGIS--------  840
             L+YIMAFPVALK     +S +S                       C  E IS        
Sbjct  218   LRYIMAFPVALKGHVICDSDVSGDLQDLLDADDLAIVLDSKHRPRCIIEFISQSLQLLNL  277

Query  841   --------------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  960
                                  CEQL+GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI
Sbjct  278   EATKQNMLESKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWI  337

Query  961   VVPATFISAASLFCIE  1008
             VVPATFISAASLFCIE
Sbjct  338   VVPATFISAASLFCIE  353



>emb|CBI40350.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 194/273 (71%), Gaps = 56/273 (21%)
 Frame = +1

Query  358   MQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVS  537
             MQQKR+LY HE WV HRSS RH+RHLL+S +SRVILSL+PPVIAFTSVA+IVASYNSAV+
Sbjct  1     MQQKRSLYNHETWVEHRSSRRHVRHLLSSFSSRVILSLIPPVIAFTSVAVIVASYNSAVT  60

Query  538   LHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQ  717
              HWLPEFFP+LRASSLPYQLTAPALALLLVFRTEASYSR E+GR AWTK+IAG +DFA Q
Sbjct  61    FHWLPEFFPLLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKAWTKIIAGTNDFARQ  120

Query  718   VISGVESKSDKLLKNALLQYIMAFPVALK----------------------------ESK  813
             V++GVES  D LLK ALLQYIMAFPVALK                            + +
Sbjct  121   VVAGVESSGDALLKKALLQYIMAFPVALKCHVIYGSDIRQDLQNLLEVDDLAVVLSSKHR  180

Query  814   ISCFHEGISACEQLI----------------------------GIPIPLSYTRLTSRFLV  909
               C  E IS   QL+                            GIPIPLSYTRLTSRFLV
Sbjct  181   PRCIIEFISQSLQLLNLDDAKRHVLESKLSCFHEGIGVCEQLMGIPIPLSYTRLTSRFLV  240

Query  910   LWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LWHLTLPIILW+DC+WIVVPATFISAASLFCIE
Sbjct  241   LWHLTLPIILWEDCNWIVVPATFISAASLFCIE  273



>ref|XP_010544724.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Tarenaya 
hassleriana]
Length=411

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 203/300 (68%), Gaps = 57/300 (19%)
 Frame = +1

Query  280   PPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrV  459
             P T  S    +LR IPDWAD I+E RMQQKR+LY HE+W+ HRSSLRH+RH+L+SL+SRV
Sbjct  53    PKTLTSRLISLLRAIPDWADGIKERRMQQKRSLYTHENWLEHRSSLRHVRHVLSSLSSRV  112

Query  460   ILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTE  639
             ILSL+PPV  FT+ A++++ YNSAV L WLP  FPVLRASSLPYQLTAPALALLLVFRTE
Sbjct  113   ILSLIPPVFFFTTFAVVISGYNSAVGLQWLPGIFPVLRASSLPYQLTAPALALLLVFRTE  172

Query  640   ASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK-LLKNALLQYIMAFPVALK----  804
             ASYSR E+GR AWTKVIAG +D A QVI+ V+S  D  ++K+ LL+YI AFPVALK    
Sbjct  173   ASYSRFEEGRKAWTKVIAGTNDLARQVIASVDSSGDDSVIKDMLLRYITAFPVALKCHVV  232

Query  805   ------------------------ESKISCFHEGISACEQLI------------------  858
                                     + +  C  E IS   QL+                  
Sbjct  233   YGSDIARDLQNVLEADDLSLVLQSKHRPRCVIEFISQSLQLLKLEDSKRNLLESKMLHLH  292

Query  859   ----------GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                       GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  293   EGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  352



>emb|CDY42497.1| BnaC04g21840D [Brassica napus]
Length=397

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 183/326 (56%), Positives = 212/326 (65%), Gaps = 59/326 (18%)
 Frame = +1

Query  205   PLFSSKLKKLSFRVVCCSSQNNPHPP-PTQISNFPWILRVIPDWADAIQENRMQQKRALY  381
             P+FS+  +K +F +      + P P   T   N   +LR +PDWAD I+E  MQQKR LY
Sbjct  16    PIFSTGPRK-TFHLKPPRVSSGPEPGTKTLTENLISLLRAVPDWADEIKERGMQQKRTLY  74

Query  382   KHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFF  561
              HE WV HRSSLRH+RHL++S +SRVILSL+PPV  FTSVA+++ASYNSAV+L WLP  F
Sbjct  75    THEKWVEHRSSLRHVRHLVSSFSSRVILSLIPPVFFFTSVAVLIASYNSAVALEWLPGIF  134

Query  562   PVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESK  741
             P+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW ++IAG  D A QVI  V+  
Sbjct  135   PILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVRIIAGTDDLARQVICSVDGS  194

Query  742   SDKL-LKNALLQYIMAFPVALK--------------------------ESKI--SCFHEG  834
              D+L LK+ LL+Y  AFPVALK                          ESK    C  E 
Sbjct  195   GDELVLKDLLLRYFAAFPVALKCHVIYGSDIARDLRNLIEADDLSLILESKHRPRCVIEF  254

Query  835   IS----------------------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLP  930
             IS                             CEQL+GIPIPLSYTRLTSRFLV WHLTLP
Sbjct  255   ISQSLQLLKLDDTKRDLLESKMLHLHEGIGVCEQLMGIPIPLSYTRLTSRFLVFWHLTLP  314

Query  931   IILWDDCHWIVVPATFISAASLFCIE  1008
             IILWD+CHWIVVPATFISAASLFCIE
Sbjct  315   IILWDECHWIVVPATFISAASLFCIE  340



>ref|XP_009138777.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Brassica 
rapa]
 emb|CDX89110.1| BnaA04g00760D [Brassica napus]
Length=399

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 203/306 (66%), Gaps = 58/306 (19%)
 Frame = +1

Query  265   NNPHP-PPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhllt  441
             + P P   T   N   +LR +PDWAD I+E  MQQKR LY HE WV HRSSLRH+RHL++
Sbjct  35    SGPEPGAKTLTENLISLLRAVPDWADEIKERGMQQKRTLYTHEKWVEHRSSLRHVRHLVS  94

Query  442   slnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALL  621
             S +SRVILSL+PPV  FTSVA+++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALL
Sbjct  95    SFSSRVILSLIPPVFFFTSVAVVIASYNSAVALEWLPGIFPILRSSSLPYQLTAPALALL  154

Query  622   LVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVA  798
             LVFRTEASYSR E+GR AW ++IAG  D A QVI  V+   D+L +K+ LL+YI AFPVA
Sbjct  155   LVFRTEASYSRYEEGRKAWVRIIAGTDDLARQVICSVDGSGDELVIKDLLLRYIAAFPVA  214

Query  799   LK--------------------------ESKI--SCFHEGIS------------------  840
             LK                          ESK    C  E IS                  
Sbjct  215   LKCHVIYGSDIARDLRNLIEADDLSLILESKHRPRCVIEFISQSLQLLKLDDTKRDLLES  274

Query  841   ----------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
                        CEQL+GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAA
Sbjct  275   KMLHLHEGIGVCEQLMGIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAA  334

Query  991   SLFCIE  1008
             SLFCIE
Sbjct  335   SLFCIE  340



>gb|KCW71628.1| hypothetical protein EUGRSUZ_E00157 [Eucalyptus grandis]
Length=378

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 209/299 (70%), Gaps = 36/299 (12%)
 Frame = +1

Query  208   LFSSKLKKLSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYK  384
             L S     +SF+V+   +  ++P  PP  IS    ILR+IPDWADA++E  MQ+KR LY 
Sbjct  17    LHSVHSNTISFKVLSSQAGDSSPQRPPAIIS----ILRMIPDWADALKEQGMQRKRTLYN  72

Query  385   HEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP  564
             HEDW+ HRSS RH+RHLL+SL+SRVILSL+PPV AFT VA+++ASYN+AV + WLPEFFP
Sbjct  73    HEDWLQHRSSQRHVRHLLSSLSSRVILSLIPPVTAFTLVAVMIASYNTAVLMEWLPEFFP  132

Query  565   VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKV----------------IAG  696
             VLR SSLPYQLTAPALALLLVFRTEASYSR ++GR  W K                 +  
Sbjct  133   VLRTSSLPYQLTAPALALLLVFRTEASYSRFQEGRQIWVKKLLLEYIMAFPVALKCHVTY  192

Query  697   ASDFAVQVISGVESKS------DKLLKNALLQYIMA--FPVALKESK-------ISCFHE  831
              SD    + + +E          K     ++++I      + L+ESK       +SCFHE
Sbjct  193   GSDIGQDLRNRIEGDDLAMILKSKHRPRCIIEFISQSLRLLNLEESKRNVLESNLSCFHE  252

Query  832   GISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIS CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+ILWDDCHWIVVPATFISAASLFCIE
Sbjct  253   GISTCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCHWIVVPATFISAASLFCIE  311



>gb|KFK35326.1| hypothetical protein AALP_AA5G270100 [Arabis alpina]
Length=402

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 219/343 (64%), Gaps = 61/343 (18%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKLKK-LSFRVVCCSSQNNPHPPPTQI--SNFPWILRVIPD  330
             N S +S+  P S   PLFS+ ++K +  +    SS  NP    T+    N   +LR +PD
Sbjct  2     NLSISSNFTPKS-QFPLFSTIIRKPIILKPPHASSDPNPSDSITKTLTQNLISLLRSVPD  60

Query  331   WADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAII  510
             WAD I+E  MQQKR LY HE WV HRSSLRH+RHL +S +SRVILSL+PPV  FTSVA++
Sbjct  61    WADEIKERGMQQKRTLYTHEKWVEHRSSLRHVRHLFSSFSSRVILSLIPPVFFFTSVAVV  120

Query  511   VASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVI  690
             +A YNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +I
Sbjct  121   IAVYNSAVALDWLPGVFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGII  180

Query  691   AGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK---------------------  804
             +G  D A QVI  V+S  D L LK+ +L+YI AFPVALK                     
Sbjct  181   SGTDDLARQVICSVDSSGDDLILKDLVLRYIAAFPVALKCHVIYGSDIARDLRNLIEADD  240

Query  805   -----ESKI--SCFHEGIS----------------------------ACEQLIGIPIPLS  879
                  ESK    C  E IS                             CEQL+GIPIPLS
Sbjct  241   LSLILESKHRPRCVIEFISQSLQLLKIDDAKRDLLESKMLHLHEGIGVCEQLMGIPIPLS  300

Query  880   YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             YTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  301   YTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  343



>emb|CDY48927.1| BnaA09g39100D [Brassica napus]
Length=404

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 212/340 (62%), Gaps = 57/340 (17%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWAD  339
             N S +S+    S   P   ++   L    V    +++     T   N   +LR +PDWAD
Sbjct  6     NLSVSSNFTQRSLSEPRLRNRPLHLKPPRVSPGPESDLSGAKTLTENLISLLRSVPDWAD  65

Query  340   AIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVAS  519
              I+E  MQQKR LY HE WV HRSSLRH+ HL +S +SRVILSL+PPV  FTSVAI++AS
Sbjct  66    EIKERGMQQKRTLYTHEKWVEHRSSLRHVHHLFSSFSSRVILSLIPPVFFFTSVAIVIAS  125

Query  520   YNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGA  699
             YNSAV+L WLP FFP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG 
Sbjct  126   YNSAVALDWLPSFFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGT  185

Query  700   SDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK------------------------  804
              D A QVI  V+   D+L +K+ LL+Y+ AFPVALK                        
Sbjct  186   DDLARQVICSVDGSGDELVIKDLLLRYVAAFPVALKCHVTYGSDVARDLRSLIEADDLSL  245

Query  805   --ESKI--SCFHEGIS----------------------------ACEQLIGIPIPLSYTR  888
               ESK    C  E IS                             CEQL+GIPIPL+YTR
Sbjct  246   ILESKHRPRCVIEFISQSLQLLKLDDTKRDLLESKMLHLHEGIGVCEQLMGIPIPLAYTR  305

Query  889   LTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  306   LTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  345



>ref|XP_006397763.1| hypothetical protein EUTSA_v10001467mg [Eutrema salsugineum]
 gb|ESQ39216.1| hypothetical protein EUTSA_v10001467mg [Eutrema salsugineum]
Length=411

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 217/349 (62%), Gaps = 60/349 (17%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSS--QNNPHPPPTQISNFPWI  312
             M +   +NF+  +  KP    P + +   K L F   C SS  + +  PP         +
Sbjct  5     MNLSFSSNFTQRALLKP-RLCPGISARARKSLHFNPYCISSGPKFDDSPPINLSEKLISL  63

Query  313   LRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAF  492
             L+ +P+W+D I+E RMQQKR+LY HE WV HRSSLRHLRH+ +S +SRVILSL+PPV  F
Sbjct  64    LKAVPNWSDGIKERRMQQKRSLYTHEKWVRHRSSLRHLRHVSSSPSSRVILSLIPPVFFF  123

Query  493   TSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRL  672
             T+VAI++A YNSAV L WLP FFPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR 
Sbjct  124   TTVAILIAGYNSAVGLDWLPNFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGRK  183

Query  673   AWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK---------------  804
             AW K+I G +D A QV+S V    D+L +++ LL+YI AFPVALK               
Sbjct  184   AWVKIITGTNDLARQVVSSVHGSGDELIIRDTLLRYIAAFPVALKCHVIYGSDIADDLRN  243

Query  805   -----------ESKI--SCFHEGISACEQLI----------------------------G  861
                        ESK    C  + IS   QL+                            G
Sbjct  244   VIEADDLSLILESKHRPRCLIQFISQSLQLLKLDSTKIDMLESKMLQLQEGISVCEQLMG  303

Query  862   IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHW VVPATFISAASLFCIE
Sbjct  304   IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWNVVPATFISAASLFCIE  352



>emb|CAB71062.1| putative protein [Arabidopsis thaliana]
Length=406

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 218/350 (62%), Gaps = 63/350 (18%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKPLSFHPPLFSSKLKK---LSFRVVCCSSQNNPHPPPTQISNFPW  309
             M +   +NF+   H   L    P+FS+  +K   L    V    ++N     T       
Sbjct  1     MNLSVSSNFT---HRSLLESRFPIFSTGFRKSVNLKPPRVSSGPESNDSGHETLTDKLIH  57

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR +PDWAD I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  
Sbjct  58    LLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFF  117

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVA+++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  118   FTSVAVVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  177

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG +D A QVI  V+S  D+L +K+ LL+YI AFPVALK              
Sbjct  178   KAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDLR  237

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  238   NLIEADDLSLILQAKHRPRCVIEFISQSIQLLKLDDAKRDLLESKMLHLHEGIGVCEQLM  297

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  298   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  347



>ref|XP_009116798.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Brassica 
rapa]
Length=404

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 210/340 (62%), Gaps = 57/340 (17%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWAD  339
             N S +S+    S   P   +K   L    V    +++     T   N   +LR +PDWAD
Sbjct  6     NLSVSSNFTQRSLSEPRLRNKPLHLKPPRVSPGPESDLSGAKTLTENLISLLRSVPDWAD  65

Query  340   AIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVAS  519
              I+E  MQQKR LY HE WV HRSSLRH+ HL +S +SRVILSL+PPV  FTSVAI +AS
Sbjct  66    EIKERGMQQKRTLYTHEKWVEHRSSLRHVHHLFSSFSSRVILSLIPPVFFFTSVAIFIAS  125

Query  520   YNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGA  699
             YNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG 
Sbjct  126   YNSAVALDWLPSVFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGT  185

Query  700   SDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK------------------------  804
              D A QVI  V+   D+L +K+ LL+Y+ AFPVALK                        
Sbjct  186   DDLARQVICSVDGSGDELVIKDLLLRYVAAFPVALKCHVTYGSDVARDLRNLIEADDLSL  245

Query  805   --ESKI--SCFHEGIS----------------------------ACEQLIGIPIPLSYTR  888
               ESK    C  E IS                             CEQL+GIPIPL+YTR
Sbjct  246   IIESKHRPRCVIEFISQSLQLLKLDDTKRDLLESKMLHLHEGIGVCEQLMGIPIPLAYTR  305

Query  889   LTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  306   LTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  345



>ref|NP_191691.2| bestrophin-like protein [Arabidopsis thaliana]
 sp|Q9M2D2.2|YU88_ARATH RecName: Full=UPF0187 protein At3g61320, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL24280.1| AT3g61320/T20K12_220 [Arabidopsis thaliana]
 gb|AAN12915.1| At3g61320/T20K12_220 [Arabidopsis thaliana]
 gb|AEE80187.1| bestrophin-like protein [Arabidopsis thaliana]
Length=410

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 218/350 (62%), Gaps = 63/350 (18%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKPLSFHPPLFSSKLKK---LSFRVVCCSSQNNPHPPPTQISNFPW  309
             M +   +NF+   H   L    P+FS+  +K   L    V    ++N     T       
Sbjct  5     MNLSVSSNFT---HRSLLESRFPIFSTGFRKSVNLKPPRVSSGPESNDSGHETLTDKLIH  61

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR +PDWAD I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  
Sbjct  62    LLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFF  121

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVA+++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  122   FTSVAVVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  181

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG +D A QVI  V+S  D+L +K+ LL+YI AFPVALK              
Sbjct  182   KAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDLR  241

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  242   NLIEADDLSLILQAKHRPRCVIEFISQSIQLLKLDDAKRDLLESKMLHLHEGIGVCEQLM  301

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  302   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  351



>ref|NP_182111.1| Bestrophin-like protein [Arabidopsis thaliana]
 sp|O80832.1|YU87_ARATH RecName: Full=UPF0187 protein At2g45870, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC28537.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL69450.1| At2g45870/F4I18.15 [Arabidopsis thaliana]
 gb|AEC10612.1| Bestrophin-like protein [Arabidopsis thaliana]
Length=410

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 217/347 (63%), Gaps = 65/347 (19%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKL-----KKLSFRV--VCCSSQNNPHPPPTQISNFPWILR  318
             N S +S+   LSF  P   S +     K L F+    C SS       P        +L+
Sbjct  6     NLSFSSNFTNLSFLKPRLYSGISARAPKSLHFKFNPSCVSSGPKSDDSPLS-EKLISLLK  64

Query  319   VIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTS  498
              +P+W+D I+E RMQQKR+LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  FT+
Sbjct  65    AVPNWSDGIKERRMQQKRSLYTHENWVRHRSSLRHLRHVSSSPSSRVILSLIPPVFFFTT  124

Query  499   VAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAW  678
             VAI++A YNSAV L WLP+FFPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR AW
Sbjct  125   VAILIAGYNSAVDLDWLPDFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGRKAW  184

Query  679   TKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK-----------------  804
              K+I+G +D A  VIS V    D+L +++ALL+YI+AFPVALK                 
Sbjct  185   VKIISGTNDLARLVISSVHGSGDELIIRDALLRYIVAFPVALKCHVIYGSDIASDLKNVI  244

Query  805   -----------ESKISCFHEGISACEQLI----------------------------GIP  867
                        + +  C  + IS   QL+                            GIP
Sbjct  245   EVDDLSLILQSKHRPRCVIQFISQSLQLLNLDSTKIDMLETKMMQLQEGIGVCEQLMGIP  304

Query  868   IPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVPATFISAASLFCIE
Sbjct  305   IPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIE  351



>ref|XP_006402493.1| hypothetical protein EUTSA_v10006010mg [Eutrema salsugineum]
 gb|ESQ43946.1| hypothetical protein EUTSA_v10006010mg [Eutrema salsugineum]
Length=408

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 214/350 (61%), Gaps = 61/350 (17%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKPLSFHPPLFSSKLKK---LSFRVVCCSSQNNPHPPPTQISNFPW  309
             M +    N S +S+    S  P LFS+ ++K   L    V     +      T       
Sbjct  1     MPMYQSMNLSVSSNFTQRSLFP-LFSTGVRKSVHLKPSRVSPGPDSGDSGTQTLTEKLIL  59

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             ILR +PDWAD I+E  MQQKR LY HE WV HRSSLRH+RHL++S +SRVILSL+PPV  
Sbjct  60    ILRAVPDWADGIKERGMQQKRTLYTHEKWVEHRSSLRHVRHLVSSFSSRVILSLIPPVFF  119

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVAI++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  120   FTSVAIVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  179

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG  D A QVI  V+S  D L +K+ LL+YI AFPVALK              
Sbjct  180   KAWVGIIAGTDDLARQVICSVDSSGDDLIIKDLLLRYIAAFPVALKCHVIYGSDTARDLR  239

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  240   NLIEADDLSLILQSKHRPRCVIEFISQSLQLLKIDDTKRDLLESKMLHLHQGIGVCEQLM  299

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  300   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  349



>ref|XP_002876606.1| hypothetical protein ARALYDRAFT_907660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52865.1| hypothetical protein ARALYDRAFT_907660 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 217/350 (62%), Gaps = 63/350 (18%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKPLSFHPPLFSSKLKK---LSFRVVCCSSQNNPHPPPTQISNFPW  309
             M +   +NF+   H   L    P+FS+  +K   L    V    ++      T       
Sbjct  5     MNLSVSSNFA---HRSLLESRFPIFSTGFRKSVNLKPPRVSSGPESGDSGHETLTEKLIL  61

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR +PDWAD I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  
Sbjct  62    LLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFF  121

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVA+++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  122   FTSVAVVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  181

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG +D A QVI  V+S  D+L +K+ LL+YI AFPVALK              
Sbjct  182   KAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDLR  241

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  242   NLIEADDLSLILQAKHRPRCVIEFISQSIQLLKLDDAKRDLLESKMLHLHEGIGVCEQLM  301

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  302   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  351



>ref|XP_010413427.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 178/339 (53%), Positives = 209/339 (62%), Gaps = 69/339 (20%)
 Frame = +1

Query  163   FSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADA  342
             FS     KP++  PP  SS               +N             +LR +PDWAD 
Sbjct  28    FSTTGFRKPVNLKPPRVSS------------GPDSNDSGEKNLTEQLISLLRAVPDWADE  75

Query  343   IQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASY  522
             I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  FTSVA+++ASY
Sbjct  76    IKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFFFTSVAVVIASY  135

Query  523   NSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGAS  702
             N+AV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG +
Sbjct  136   NTAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGTN  195

Query  703   DFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK-------------------------  804
             D A QVI  V+S  D+L +K+ LL+Y+ AFPVALK                         
Sbjct  196   DLARQVICSVDSSGDELIIKDLLLRYVAAFPVALKCHVIYGSDIARDLRNLIEADDLSLI  255

Query  805   ---ESKISCFHEGISACEQLI----------------------------GIPIPLSYTRL  891
                + +  C  E IS   QL+                            GIPIPLSYTRL
Sbjct  256   LQSKHRPRCVIEFISQSIQLLELDDSKRDLLESKMLHLHEGIGVCEQLMGIPIPLSYTRL  315

Query  892   TSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             TSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  316   TSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  354



>ref|XP_007218264.1| hypothetical protein PRUPE_ppa008190mg [Prunus persica]
 gb|EMJ19463.1| hypothetical protein PRUPE_ppa008190mg [Prunus persica]
Length=342

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 188/268 (70%), Gaps = 56/268 (21%)
 Frame = +1

Query  373   ALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLP  552
              LY HE WV HRSS RHLRH LTSL+SRVILSL+PPVIAFT VA+++ASYNSAVSL+WLP
Sbjct  16    TLYDHEKWVHHRSSYRHLRHFLTSLSSRVILSLIPPVIAFTLVAVVIASYNSAVSLNWLP  75

Query  553   EFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGV  732
              FFPVLR+S+LPYQLTAPALALLLVFRTEASYSR E+GR AWTKVIAGA+DFA Q+IS V
Sbjct  76    GFFPVLRSSTLPYQLTAPALALLLVFRTEASYSRFEEGRKAWTKVIAGANDFARQIISAV  135

Query  733   ESKSDKLLKNALLQYIMAFPVALK----------------------------ESKISCFH  828
             E+  D  LK ALLQYI+AFPVALK                            + + SC  
Sbjct  136   ENSGDAQLKKALLQYIVAFPVALKCHVVYGSDIRQDLQNLLELDDLLVVLNSKHRPSCII  195

Query  829   EGIS----------------------------ACEQLIGIPIPLSYTRLTSRFLVLWHLT  924
             E IS                             CEQLIG PIPLSYTRLTSRFLVLWHLT
Sbjct  196   EFISQSLRLLNLEDSRRIMLQSKISCFHEGIGVCEQLIGTPIPLSYTRLTSRFLVLWHLT  255

Query  925   LPIILWDDCHWIVVPATFISAASLFCIE  1008
             LPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  256   LPIILWDDCHWIVVPATFISAASLFCIE  283



>ref|XP_002880204.1| hypothetical protein ARALYDRAFT_483727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56463.1| hypothetical protein ARALYDRAFT_483727 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 216/348 (62%), Gaps = 66/348 (19%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKL-----KKLSFRV--VCCSSQNNPHPPPTQISNFPWILR  318
             N S +S+    SF  P   S +     K L F+    C SS +     P        +L+
Sbjct  6     NLSFSSNFTNRSFLKPRLCSGISARAPKSLHFKFNPSCLSSGSKSDDSPLS-EKLISLLK  64

Query  319   VIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTS  498
              +P+W+D I+E RM+QKR+LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  FT+
Sbjct  65    AVPNWSDGIKERRMEQKRSLYTHENWVRHRSSLRHLRHVSSSPSSRVILSLIPPVFFFTT  124

Query  499   VAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAW  678
             VA ++A YNSAV L WLP+FFPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR AW
Sbjct  125   VAFLIAGYNSAVDLDWLPDFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGRKAW  184

Query  679   TKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK-----------------  804
              K+I+G +D A  VIS V    D+L +++ALL+YI+AFPVALK                 
Sbjct  185   VKIISGTNDLARLVISSVHGSGDELVIRDALLRYIVAFPVALKVCHVIYGSDIATDLQNV  244

Query  805   ------------ESKISCFHEGISACEQLI----------------------------GI  864
                         + +  C  + IS   QL+                            GI
Sbjct  245   IEADDLSLILQSKHRPRCVIQFISQSLQLLNLDSTKIDMLESKMMQLQEGIGVCEQLMGI  304

Query  865   PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             PIPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVPATFISAASLFCIE
Sbjct  305   PIPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIE  352



>emb|CDX71745.1| BnaC08g31290D [Brassica napus]
Length=403

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 211/352 (60%), Gaps = 74/352 (21%)
 Frame = +1

Query  139   MTIQHPTNFSCAS-----HHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNF  303
             M +   +NF+  S       KPL   PP  SS              +++     T   N 
Sbjct  5     MNLSVSSNFTQRSLSESRFRKPLHLKPPRVSS------------GPESDLSGAKTLTENL  52

Query  304   PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPV  483
               +LR +PDWAD I+E  MQQKR LY HE WV HRSSLRH+ HL +S +SRVILSL PPV
Sbjct  53    ISLLRAVPDWADEIKERGMQQKRTLYTHEKWVEHRSSLRHVHHLFSSFSSRVILSLFPPV  112

Query  484   IAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQ  663
               FTSVAI++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+
Sbjct  113   FFFTSVAIVIASYNSAVALDWLPSIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEE  172

Query  664   GRLAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK------------  804
             GR AW  +IAG  D A QVI  V S  D+L +K+ LL+Y+ AFPVALK            
Sbjct  173   GRKAWVGIIAGTDDLARQVICSVGSSGDELVIKDLLLRYVAAFPVALKCHVTYGSDVARD  232

Query  805   --------------ESKI--SCFHEGISACEQLI--------------------------  858
                           ESK    C  E IS   QL+                          
Sbjct  233   LQNLIEGDDLSLILESKHRPRCVIEFISQSLQLLKLDDTKRDLLESKMLQLHEGIGVCEQ  292

Query  859   --GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
               GIPIPL+YTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  293   LMGIPIPLAYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  344



>dbj|BAF02248.1| hypothetical protein [Arabidopsis thaliana]
Length=354

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/290 (59%), Positives = 197/290 (68%), Gaps = 57/290 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR +PDWAD I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  
Sbjct  6     LLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFF  65

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVA+++ASYNSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  66    FTSVAVVIASYNSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  125

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG +D A QVI  V+S  D+L +K+ LL+YI AFPVALK              
Sbjct  126   KAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDLR  185

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  186   NLIEADDLSLILQAKHRPRCVIEFISQSIQLLKLDDAKRDLLESKMLHLHEGIGVCEQLM  245

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  246   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  295



>ref|XP_010473805.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic, partial 
[Camelina sativa]
Length=355

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 197/290 (68%), Gaps = 57/290 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR +PDWAD I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  
Sbjct  7     LLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFF  66

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTSVA+++ASYN+AV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  67    FTSVAVVIASYNTAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGR  126

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK--------------  804
              AW  +IAG +D A QVI  V+S  D+L +K+ LL+Y+ AFPVALK              
Sbjct  127   KAWVGIIAGTNDLARQVICSVDSSGDELIIKDLLLRYVAAFPVALKCHVIYGSDIARDLR  186

Query  805   --------------ESKISCFHEGISACEQLI----------------------------  858
                           + +  C  E IS   QL+                            
Sbjct  187   NLIEADDLSLILQSKHRPRCVIEFISQSIQLLKLDDSKRDLLESKMLHLHEGIGVCEQLM  246

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  247   GIPIPLSYTRLTSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  296



>ref|XP_006295941.1| hypothetical protein CARUB_v10025078mg [Capsella rubella]
 gb|EOA28839.1| hypothetical protein CARUB_v10025078mg [Capsella rubella]
Length=410

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 214/353 (61%), Gaps = 69/353 (20%)
 Frame = +1

Query  139   MTIQHPTNFSCASHHKP-----LSFHPPLFSSKLKKLSFRVV-CCSSQNNPHPPPTQISN  300
             M +   +NF+  S  KP     +S  PP      K L F+    C+S        T    
Sbjct  5     MNLTFSSNFTNRSFLKPRLRSGISARPP------KSLHFKFNPSCASSGPKSDDSTLSEK  58

Query  301   FPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPP  480
                +L+ +P+W+D I+E RMQQKR+LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PP
Sbjct  59    LISLLKAVPNWSDGIKERRMQQKRSLYTHENWVRHRSSLRHLRHVSSSPSSRVILSLIPP  118

Query  481   VIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLE  660
             V  FT+VAI++A YNSAV L WLP FFPVLRAS LPYQLTAPALALLLVFRTEASYSR E
Sbjct  119   VFFFTTVAILIACYNSAVGLDWLPHFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFE  178

Query  661   QGRLAWTKVIAGASDFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK-----ESKIS-  819
             QGR AW K+I G +D A  V S V    D+L +K ALL+YI AFPVALK      S I+ 
Sbjct  179   QGRKAWVKIITGTNDLARLVTSSVHGSGDELIIKEALLRYIAAFPVALKCHVIYGSDIAS  238

Query  820   ----------------------CFHEGISACEQLI-------------------------  858
                                   C  + IS   QL+                         
Sbjct  239   DLQNVIDADDLSLILQSTHRPRCVIQFISQSLQLLNLESTKIDMLESKMLQLQEGIGVCE  298

Query  859   ---GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                GIPIPLSYTRLTSRFLVLWHLTLPIILWDDC W VVPATFISAASLFCIE
Sbjct  299   QLMGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCRWNVVPATFISAASLFCIE  351



>ref|XP_010506566.1| PREDICTED: UPF0187 protein At2g45870, chloroplastic-like [Camelina 
sativa]
Length=412

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 196/291 (67%), Gaps = 58/291 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L+ +P+W+D I+E RMQQKR LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  
Sbjct  63    LLKAVPNWSDGIKERRMQQKRTLYSHENWVRHRSSLRHLRHVSSSTSSRVILSLIPPVCF  122

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+VAI++ASYNSAV L WLP++FPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR
Sbjct  123   FTTVAILIASYNSAVGLGWLPDYFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGR  182

Query  670   LAWTKVIAGASDFAVQVISGVE--SKSDKLLKNALLQYIMAFPVALK-------------  804
              AW K+I G +D A  VIS V   S  + L+K++LL+YI AFPVALK             
Sbjct  183   KAWAKIINGTNDLARLVISSVRHGSADELLIKDSLLRYIAAFPVALKCHVIYGSDIASDL  242

Query  805   ---------------ESKISCFHEGISACEQLI---------------------------  858
                            + +  C  + IS   QL+                           
Sbjct  243   QNVIDADDLSLILQSKHRPRCIIQFISQSLQLLNLDSSKIDMLESKMMQLQEGIGVCEQL  302

Query  859   -GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              GIPIPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVPATFISAASLFCIE
Sbjct  303   MGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIE  353



>ref|XP_006291217.1| hypothetical protein CARUB_v10017348mg [Capsella rubella]
 gb|EOA24115.1| hypothetical protein CARUB_v10017348mg [Capsella rubella]
Length=412

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 209/339 (62%), Gaps = 69/339 (20%)
 Frame = +1

Query  163   FSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADA  342
             FS     K ++  PP  SS             S ++ H   T+      +LR +PDWAD 
Sbjct  27    FSTTGFRKSVNLKPPRVSSG----------PDSGDSGHRTLTE--QLVLLLRAVPDWADE  74

Query  343   IQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASY  522
             I+E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  FTSVA+++ASY
Sbjct  75    IKERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFFFTSVAVVIASY  134

Query  523   NSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGAS  702
             NSAV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG +
Sbjct  135   NSAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGTN  194

Query  703   DFAVQVISGVESKSDKL-LKNALLQYIMAFPVALK-------------------------  804
             D A QVI  V+S  D+L +K+ LL+YI AFPVALK                         
Sbjct  195   DLARQVICSVDSSGDELIIKDLLLRYIAAFPVALKCHVIYGSDIARDLRNLIEADDLTLI  254

Query  805   ------------------------ESKISCFHEGISACEQLIGI-------PIPLSYTRL  891
                                     +SK       +    + IG+       PIPLSYTRL
Sbjct  255   LQSKHRPRCVIEFISQSIGLLKLDDSKRDLLESKMLHLHEGIGVCEQLMGIPIPLSYTRL  314

Query  892   TSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             TSRFLV WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  315   TSRFLVFWHLTLPIILWDECHWIVVPATFISAASLFCIE  353



>ref|XP_008368092.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Malus 
domestica]
Length=433

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 175/289 (61%), Positives = 197/289 (68%), Gaps = 56/289 (19%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             ILR+IPDW D  QE  M+Q R LY HE W+ HRSS RHLRHL +SL+SRVILSL+PPVIA
Sbjct  86    ILRIIPDWXDRTQERGMRQHRXLYDHEKWMHHRSSYRHLRHLXSSLSSRVILSLIPPVIA  145

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT VA+++ASYN+AV+L  LP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  146   FTLVAVVIASYNTAVALDLLPGIFPLLRSSSLPYQLTAPALALLLVFRTEASYSRFEEGR  205

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK---------------  804
              AWT+VIAGA+DFA Q+IS VE+  D  LK ALLQYI+AFPVALK               
Sbjct  206   KAWTEVIAGANDFARQIISSVETSGDAQLKKALLQYIVAFPVALKCHVIYGSDIARDLQN  265

Query  805   -------------ESKISCFHEGISACEQL----------------------------IG  861
                          + +  C  + IS   QL                            IG
Sbjct  266   LLEVDDLLVVLNSKHRPGCIIQFISRSLQLLKLEESRRIMLQSKISCFHEGIGICEQLIG  325

Query  862   IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  326   TPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  374



>ref|XP_010518230.1| PREDICTED: UPF0187 protein At2g45870, chloroplastic [Camelina 
sativa]
Length=412

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 215/348 (62%), Gaps = 65/348 (19%)
 Frame = +1

Query  160   NFSCASHHKPLSFHPPLFSSKL------KKLSFRVVCCSSQNNPHPPPTQISN-FPWILR  318
             N S +S+    +F  P   S +      K L F+     + + P    + +S     +L+
Sbjct  6     NLSFSSNFNHRAFLKPRLCSGISATRPPKSLHFKFNPSCASSAPKSDDSSLSEKLISLLK  65

Query  319   VIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTS  498
              +P+W+D I+E RMQQKR LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  FT+
Sbjct  66    AVPNWSDGIKERRMQQKRTLYSHENWVRHRSSLRHLRHVSSSTSSRVILSLIPPVCFFTT  125

Query  499   VAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAW  678
             VAI++ASYNSAV L WLP+FFPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR AW
Sbjct  126   VAILIASYNSAVGLGWLPDFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGRKAW  185

Query  679   TKVIAGASDFAVQVISGVESKSDK--LLKNALLQYIMAFPVALK----------------  804
              K+I G +D A  VIS V   S    ++K++LL+YI AFPVALK                
Sbjct  186   AKIINGTNDLARLVISSVRDGSGDELIIKDSLLRYIAAFPVALKCHVIYGSDIASDLQNV  245

Query  805   --ESKIS----------CFHEGISACEQLI----------------------------GI  864
               E  +S          C  + IS   QL+                            GI
Sbjct  246   IDEDDLSLILQSKHRPRCVIQFISQSLQLLNLDSTKIDMLESKMMQLQEGIGVCEQLMGI  305

Query  865   PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             PIPLSYTRLTSRFLVLWHLTLP+ILWDDC W VVPATFISAASLFCIE
Sbjct  306   PIPLSYTRLTSRFLVLWHLTLPVILWDDCRWNVVPATFISAASLFCIE  353



>emb|CDY27352.1| BnaC04g50530D [Brassica napus]
Length=409

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 195/292 (67%), Gaps = 59/292 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L+ +P+W+D I+E RM+QKR+LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  
Sbjct  59    LLKAVPNWSDGIKERRMRQKRSLYTHENWVRHRSSLRHLRHVSSSASSRVILSLIPPVFF  118

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+VA+++A YNSAV L  LP FFPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR
Sbjct  119   FTTVAVLIAGYNSAVGLELLPSFFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGR  178

Query  670   LAWTKVIAGASDFAVQVISGVESKSDK---LLKNALLQYIMAFPVALK------------  804
              AW K+I G +D A QV+S V   S     ++++ALL+YI AFPVALK            
Sbjct  179   KAWVKIITGTNDLARQVVSSVNGSSGDDELIIRDALLRYIAAFPVALKCHVIYGSDIADD  238

Query  805   ------ESKIS----------CFHEGISACEQLI--------------------------  858
                   E  +S          C  + IS   QL+                          
Sbjct  239   LRSVVEEDDLSLILKSKHRPRCVIQFISQSLQLLNLDSTKIDTLESKMLQLQEGIGVCDQ  298

Query  859   --GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
               GIPIPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVPATFISAASLFCIE
Sbjct  299   LMGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIE  350



>ref|XP_010512468.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Camelina 
sativa]
Length=418

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 207/332 (62%), Gaps = 68/332 (20%)
 Frame = +1

Query  184   KPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQ  363
             KP++  PP           RV    + N+         +    LR +PDWAD I+E  MQ
Sbjct  39    KPVNLKPP-----------RVSSDPNSNDSGGDKALSEHLISFLRAVPDWADEIKERGMQ  87

Query  364   QKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLH  543
             QKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  FT+VA+++ASYN+AV+L 
Sbjct  88    QKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFFFTTVAVVIASYNTAVALD  147

Query  544   WLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVI  723
              LP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG +D A QVI
Sbjct  148   LLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGTNDLARQVI  207

Query  724   SGVESKSDKL-LKNALLQYIMAFPVALK----------------------------ESKI  816
               V+S  D+L +K+ LL+Y+ AFPVALK                            + + 
Sbjct  208   CSVDSSGDELVIKDLLLRYVAAFPVALKCHVIYGSDVGRDLRNLIEADDLSLILQSKHRP  267

Query  817   SCFHEGISACEQLI----------------------------GIPIPLSYTRLTSRFLVL  912
              C  E IS   QL+                            GIPIPLSYTRLTSRFLV 
Sbjct  268   RCVIEFISQSIQLLKLDDSKRDLLESKMLHLHEGIGVCEQLMGIPIPLSYTRLTSRFLVF  327

Query  913   WHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             WHLTLPIILWD+CHWIVVPATFISAASLFCIE
Sbjct  328   WHLTLPIILWDECHWIVVPATFISAASLFCIE  359



>ref|XP_009142375.1| PREDICTED: UPF0187 protein At2g45870, chloroplastic [Brassica 
rapa]
Length=410

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 201/313 (64%), Gaps = 60/313 (19%)
 Frame = +1

Query  250   CCSSQNNPHPPPTQISN-FPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhl  426
             C SS  N       +S+    +L+ +P+W+D I+E RM+QKR+LY HE+WV HRSSLRHL
Sbjct  39    CVSSDPNSSENSINLSSKLISLLKAVPNWSDGIKERRMRQKRSLYTHENWVRHRSSLRHL  98

Query  427   rhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAP  606
             RH+ +S +SRVILSL+PPV  FT+VA+++A YNSAV    LP FFPVLRAS LPYQLTAP
Sbjct  99    RHVSSSASSRVILSLIPPVFFFTTVAVLIAGYNSAVGSELLPSFFPVLRASPLPYQLTAP  158

Query  607   ALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK---LLKNALLQY  777
             ALALLLVFRTEASYSR EQGR AW K+I G +D A QV+S V   S     ++++ALL+Y
Sbjct  159   ALALLLVFRTEASYSRFEQGRKAWVKIITGTNDLARQVVSSVNGPSGDDEVIIRDALLRY  218

Query  778   IMAFPVALK------------------ESKIS----------CFHEGISACEQLI-----  858
             I AFPVALK                  E  +S          C  + IS   QL+     
Sbjct  219   IAAFPVALKCHVIYGSDIADDLRNVVEEDDLSLILKSKHRPRCVIQFISQSLQLLNLDST  278

Query  859   -----------------------GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP  969
                                    GIPIPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVP
Sbjct  279   KIDTLESKMLQLQEGIGVCDQLMGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVP  338

Query  970   ATFISAASLFCIE  1008
             ATFISAASLFCIE
Sbjct  339   ATFISAASLFCIE  351



>ref|XP_010670570.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=419

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 214/322 (66%), Gaps = 60/322 (19%)
 Frame = +1

Query  214   SSKLKKLSFRVVCCSSQNNPHPP-PTQISNFPWILRVIPDWADAIQENRMQQKRALYKHE  390
             S   KKL  ++    S ++P P  P +  N   IL+ +PDWAD +QE  M++KR LY  +
Sbjct  36    SKPTKKLPLKI---QSLHHPDPQNPRKTLNLISILKSLPDWADEVQEKGMRKKRLLYNQK  92

Query  391   DWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVL  570
             +W  HRSSLRH+RHLL+SL+SRVI+SL+PPV+ FTSVA+ ++ YN+AV+++ LP FFPVL
Sbjct  93    NWAEHRSSLRHVRHLLSSLSSRVIVSLLPPVVFFTSVAVFISVYNTAVTMNLLPGFFPVL  152

Query  571   RASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK  750
             RASSLPYQLTAPALALLLVFRTEASYSR E+GR AWTKVIA  SD A +VI+ V+  +D+
Sbjct  153   RASSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWTKVIARTSDIAREVIACVDDFNDE  212

Query  751   LLKNALLQYIMAFPVALK-----ESKI-----------------------SCFHEGISAC  846
             ++K +LLQYIM+FP+ALK     +S I                        C  + IS  
Sbjct  213   VIKRSLLQYIMSFPIALKCHLLYDSDIRRDLQSLLDADDLAVVLSSKHRPQCIIQFISES  272

Query  847   EQL----------------------------IGIPIPLSYTRLTSRFLVLWHLTLPIILW  942
              QL                            +G PIPLSYTRLTSRFLVLWHLTLP+ILW
Sbjct  273   LQLLNVEEQKRNILDSKLSCFHEGIGICEQIVGTPIPLSYTRLTSRFLVLWHLTLPVILW  332

Query  943   DDCHWIVVPATFISAASLFCIE  1008
             DDCHWIVVPATFISAASLFCIE
Sbjct  333   DDCHWIVVPATFISAASLFCIE  354



>ref|XP_010508100.1| PREDICTED: UPF0187 protein At2g45870, chloroplastic-like [Camelina 
sativa]
Length=414

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 194/287 (68%), Gaps = 58/287 (20%)
 Frame = +1

Query  322   IPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSV  501
             +P+W+D I+E RMQQKR LY HE+WV HRSSLRHLRH+ +S +SRVILSL+PPV  FT+V
Sbjct  69    VPNWSDGIKERRMQQKRTLYSHENWVRHRSSLRHLRHVSSSTSSRVILSLIPPVCFFTTV  128

Query  502   AIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWT  681
             A+++ASYNSAV L+ LP++FPVLRAS LPYQLTAPALALLLVFRTEASYSR EQGR AW 
Sbjct  129   AVLIASYNSAVGLNLLPDYFPVLRASPLPYQLTAPALALLLVFRTEASYSRFEQGRKAWA  188

Query  682   KVIAGASDFAVQVISGVE--SKSDKLLKNALLQYIMAFPVALK-----------------  804
             K+I G +D A  V+S V   S  + ++K++LL+YI AFPVALK                 
Sbjct  189   KIINGTNDLARLVVSSVRHGSADELIIKDSLLRYIAAFPVALKCHVIYGSDIASDLQNVI  248

Query  805   ---------ESKI--SCFHEGISACEQLI----------------------------GIP  867
                      ESK    C  + IS   QL+                            GIP
Sbjct  249   DADDLSLILESKHRPRCVIQFISQSLQLLNLDSTKIDMLESKMMQLQEGIGVCEQLMGIP  308

Query  868   IPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             IPLSYTRLTSRFLVLWHLTLP+ILWDDCHW VVPATFISAASLFCIE
Sbjct  309   IPLSYTRLTSRFLVLWHLTLPVILWDDCHWNVVPATFISAASLFCIE  355



>emb|CDY37072.1| BnaA04g26500D [Brassica napus]
Length=410

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 200/313 (64%), Gaps = 60/313 (19%)
 Frame = +1

Query  250   CCSSQNNPHPPPTQISN-FPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhl  426
             C SS  N       +S+    +L+ +P+W+D I+E RM+QKR+LY HE+WV HRSSLRHL
Sbjct  39    CVSSDPNSSENSINLSSKLISLLKAVPNWSDGIKERRMRQKRSLYTHENWVRHRSSLRHL  98

Query  427   rhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAP  606
             RH+ +S +SRVILSL+PPV  FT+VA+++A YNSAV    LP FFPVLRAS LPYQLTAP
Sbjct  99    RHVSSSASSRVILSLIPPVFFFTTVAVLIAGYNSAVGSELLPSFFPVLRASPLPYQLTAP  158

Query  607   ALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK---LLKNALLQY  777
             ALALLLVFRTEASYSR EQGR AW K+I G +D A QV+S V   S     ++++ALL+Y
Sbjct  159   ALALLLVFRTEASYSRFEQGRKAWVKIITGTNDLARQVVSSVNGPSGDDEVIIRDALLRY  218

Query  778   IMAFPVALK------------------ESKIS----------CFHEGISACEQLI-----  858
             I AFPVALK                  E  +S          C  + IS   QL+     
Sbjct  219   IAAFPVALKCHVIYGSDIADDLRNVVEEDDLSLILKSKHRPRCVIQFISQSLQLLNLDST  278

Query  859   -----------------------GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP  969
                                    GIPIPLSYTRLTSRFLVLWHLTLP+IL DDCHW VVP
Sbjct  279   KIDTLESKMLQLQEGIGVCDQLMGIPIPLSYTRLTSRFLVLWHLTLPVILRDDCHWNVVP  338

Query  970   ATFISAASLFCIE  1008
             ATFISAASLFCIE
Sbjct  339   ATFISAASLFCIE  351



>ref|XP_008338893.1| PREDICTED: uncharacterized protein LOC103401948 [Malus domestica]
Length=778

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 175/289 (61%), Positives = 197/289 (68%), Gaps = 56/289 (19%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             ILR+IPDW D  QE  M+Q R LY HE W+ HRSS RHLRHL +SL+SRVILSL+PPVIA
Sbjct  86    ILRIIPDWXDRTQERGMRQHRXLYDHEKWMHHRSSYRHLRHLXSSLSSRVILSLIPPVIA  145

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT VA+++ASYN+AV+L  LP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR
Sbjct  146   FTLVAVVIASYNTAVALDLLPGIFPLLRSSSLPYQLTAPALALLLVFRTEASYSRFEEGR  205

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK---------------  804
              AWT+VIAGA+DFA Q+IS VE+  D  LK ALLQYI+AFPVALK               
Sbjct  206   KAWTEVIAGANDFARQIISSVETSGDAQLKKALLQYIVAFPVALKCHVIYGSDIXRDLQN  265

Query  805   -------------ESKISCFHEGISACEQL----------------------------IG  861
                          + +  C  + IS   QL                            IG
Sbjct  266   LLEVDDLLVVLNSKHRPGCIIQFISRSLQLLKLEESRRIMLQSKISCFHEGIGICEQLIG  325

Query  862   IPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  326   TPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  374



>ref|XP_004510796.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Cicer 
arietinum]
Length=419

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 162/291 (56%), Positives = 194/291 (67%), Gaps = 58/291 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             ILR IPDWAD +QE  MQ+ R LY H +WV HRSSLRH+RH  +S +SRVILSLVPPV+ 
Sbjct  70    ILRTIPDWADTVQERGMQKNRTLYNHTNWVHHRSSLRHVRHFFSSFSSRVILSLVPPVLF  129

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FTS A ++A+YNSAV LH+ PEFFP+L+ASSLPYQLTAPALALLLVFRTEASY+R  +G+
Sbjct  130   FTSFAAVIAAYNSAVLLHFFPEFFPLLKASSLPYQLTAPALALLLVFRTEASYARFVEGK  189

Query  670   LAWTKVIAGASDFAVQVISGVESKS--DKLLKNALLQYIMAFPVALK-------------  804
              AWT V+A A DFA  V++ V++++  D  +K+ALL+YI+AFP+ LK             
Sbjct  190   KAWTMVVAAAHDFARLVMAVVDTRTSIDFKVKDALLKYIIAFPIVLKCHALSGSDVERDL  249

Query  805   ------------------------------------ESKISCFHEGISACEQLI------  858
                                                 +S+ S     I+   + I      
Sbjct  250   QHLLEVEDIALIMNSKHRPRCIIQFISQSIRLLKLDDSRRSVLDSKITCFHEGIGICEQL  309

Query  859   -GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  310   MGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  360



>gb|KFK37376.1| hypothetical protein AALP_AA4G248600 [Arabis alpina]
Length=400

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 190/285 (67%), Gaps = 57/285 (20%)
 Frame = +1

Query  322   IPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSV  501
             IP+W+D I+E RMQQKR+LY HE WV HRSSLRHLRH+ TSL+SRVILSL+PPV  FT+V
Sbjct  58    IPNWSDGIKERRMQQKRSLYTHEKWVRHRSSLRHLRHVSTSLSSRVILSLIPPVFFFTTV  117

Query  502   AIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWT  681
             +I++A+YNSAV    LP++F VLRAS LPYQLTA ALALLLVFRTEASYSR E+GR AW 
Sbjct  118   SILIATYNSAVDFDLLPDYFHVLRASPLPYQLTASALALLLVFRTEASYSRFEEGRKAWV  177

Query  682   KVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-------------------  804
             K+I G++D A QV++      D ++++ +L+YI AFPVALK                   
Sbjct  178   KIITGSNDLARQVLAA-SGDDDLIIRDMVLRYIAAFPVALKCHVIYGSDIVGDLENVVED  236

Query  805   -------ESKI--SCFHEGISACEQLI----------------------------GIPIP  873
                    ESK    C  + IS   QL+                            GIPIP
Sbjct  237   DDLCLILESKNRPRCVIQFISQSIQLLKLENAKIDMLESKMLQLQEGIGVCEQLMGIPIP  296

Query  874   LSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LSYTRLTSRFLVLWHLTLPIILWDDCHW VVPATFISAASLFCIE
Sbjct  297   LSYTRLTSRFLVLWHLTLPIILWDDCHWNVVPATFISAASLFCIE  341



>ref|XP_010918544.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Elaeis 
guineensis]
Length=409

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 203/313 (65%), Gaps = 68/313 (22%)
 Frame = +1

Query  244   VVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrh  423
             ++C  S N+P P           LR +P+WADA++E  M+++RALY  +DW  HRSS RH
Sbjct  43    ILCSKSANSPSPS----------LRWVPEWADAVKERGMRKRRALYTPDDWRAHRSSSRH  92

Query  424   lrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTA  603
             LRHLL+SL+SRVILSL+PPV + T+VA  +A YNSAVSL WLP+FFP+ RASSLPYQLTA
Sbjct  93    LRHLLSSLSSRVILSLIPPVFSLTAVAAALALYNSAVSLAWLPDFFPLFRASSLPYQLTA  152

Query  604   PALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS--GVESKSDKLLKNALLQY  777
             PALALLLVFRTEASYSR  +GR AW KV+AGA++ A  V+S  G    +D  ++  LL Y
Sbjct  153   PALALLLVFRTEASYSRFVEGRKAWMKVVAGANELAGMVMSVRGNNCGADAGVRRELLNY  212

Query  778   IMAFPVALK------------------ESKIS----------CFHEGIS-----------  840
             IMAFPVALK                  E  +S          C  E IS           
Sbjct  213   IMAFPVALKCHVINGSDIRSDLQNLLEEDDLSVVVRSKHRPRCIIEFISQSLQILHLEEP  272

Query  841   -----------------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP  969
                               CEQL+GIPIPLSYTRLTSRFLVLWHLTLP+ILWDDC+WIVVP
Sbjct  273   KRNSLEMKISCFHEGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPVILWDDCNWIVVP  332

Query  970   ATFISAASLFCIE  1008
             ATFISAASLFCIE
Sbjct  333   ATFISAASLFCIE  345



>ref|XP_008806803.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=408

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 210/339 (62%), Gaps = 75/339 (22%)
 Frame = +1

Query  181   HKPLSFH-----PPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAI  345
               PL FH     PP  S   K L   ++C  S N+P P           LR + +WADA+
Sbjct  18    QNPLKFHYSHSSPP--SHPTKFLLLPILCSKSANSPFPS----------LRWVSEWADAV  65

Query  346   QENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYN  525
             +E  M+++R LY  +DW  HRSS RHLRHLL+SL+SRVILSL+PPV + T+VA  +A YN
Sbjct  66    KERGMRKRRPLYTPDDWRDHRSSSRHLRHLLSSLSSRVILSLIPPVFSLTAVAAALALYN  125

Query  526   SAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASD  705
             SAVSL WLP+FFP+ RASSLPYQLTAPALALLLVFRTEASYSR  +GR AW KV+AGA++
Sbjct  126   SAVSLAWLPDFFPLFRASSLPYQLTAPALALLLVFRTEASYSRFVEGRKAWMKVVAGANE  185

Query  706   FAVQVISGV--ESKSDKLLKNALLQYIMAFPVALK------------------ESKIS--  819
              A  VISG      +D  ++ ALL YIMAFPVALK                  E  +S  
Sbjct  186   LAGMVISGRGHNGGADAGVRRALLNYIMAFPVALKCHVINGSDIRSDLQNLLEEDDLSIV  245

Query  820   --------CFHEGIS----------------------------ACEQLIGIPIPLSYTRL  891
                     C  E IS                             CEQL+G PIPLSYTRL
Sbjct  246   VRSRHRPRCIIEFISQSLQILHLEEPKQNISESKISCFHEGIGVCEQLMGTPIPLSYTRL  305

Query  892   TSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             TSRFLVLWHLTLP+ILWDDC+WIVVPATFISAASLFCIE
Sbjct  306   TSRFLVLWHLTLPVILWDDCNWIVVPATFISAASLFCIE  344



>gb|ABR16579.1| unknown [Picea sitchensis]
Length=423

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 196/305 (64%), Gaps = 56/305 (18%)
 Frame = +1

Query  262   QNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhllt  441
             Q+  H   T+IS+    L  IP+W D I+E  M++ ++LY H +WV HRSS RH+RH+++
Sbjct  47    QHEQHENETKISSVIERLNSIPEWVDGIKEGGMKKPKSLYTHIEWVRHRSSTRHIRHVVS  106

Query  442   slnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALL  621
             SL+SRV +SL+PPV  FT++A+ +A+YN+AV   W P F P+L ASSLPYQLTAPALALL
Sbjct  107   SLSSRVTISLIPPVFIFTAIAVAIAAYNTAVVCEWFPPFMPLLHASSLPYQLTAPALALL  166

Query  622   LVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVAL  801
             LVFRTEASYSR ++GR AWTKVI+ A DFA Q I+ +    +  LK  LLQYIMAFPV L
Sbjct  167   LVFRTEASYSRYDEGRKAWTKVISDAKDFARQSITWIRGADNVHLKARLLQYIMAFPVVL  226

Query  802   K----------------------ESKIS------CFHEGISAC-----------------  846
             K                      E+ +S      C  + +S C                 
Sbjct  227   KCHITHGSDMRHDLGTLLHEDDLETVLSSQHPPFCIIQFMSECLERVHLADSKQNILDSH  286

Query  847   -----------EQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAAS  993
                        E+LIGIPIPLSYTRLTSRFLVLWHLTLPIILWD+C WIVVPATF+SAAS
Sbjct  287   ISQFNDSISVCERLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDECEWIVVPATFVSAAS  346

Query  994   LFCIE  1008
             LFCIE
Sbjct  347   LFCIE  351



>ref|XP_007135048.1| hypothetical protein PHAVU_010G097300g, partial [Phaseolus vulgaris]
 gb|ESW07042.1| hypothetical protein PHAVU_010G097300g, partial [Phaseolus vulgaris]
Length=446

 Score =   236 bits (601),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 195/291 (67%), Gaps = 58/291 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR IPDWAD +QE  MQ+KR+LY H +W  HRSSLRHLRHL++SL+SRVILSLVPPV+ 
Sbjct  97    LLRSIPDWADTVQERGMQKKRSLYTHPNWRDHRSSLRHLRHLVSSLSSRVILSLVPPVLF  156

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  +ASYN A+ LH LP+F P+L +SSLPYQLTAPALALLLVFRTEASY+R  +G+
Sbjct  157   FTAFAAAIASYNQALILHILPDFLPLLHSSSLPYQLTAPALALLLVFRTEASYARFVEGK  216

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL--LKNALLQYIMAFPVALK-------------  804
              AWT VIAG  DFA Q  + ++   +    +K+ALL+YI+AFP+ALK             
Sbjct  217   KAWTNVIAGTHDFARQAAAFLDDVDNVEFSVKHALLKYIIAFPIALKCYVLYGSDIRRDL  276

Query  805   ------------------------------------ESKISCFHEGISA-------CEQL  855
                                                 ES+ +     IS+       CEQL
Sbjct  277   QHLLEVEDLAVVMNSKHQPRCIIEFISQTIRLLKLEESRRNVLESKISSFHEGIGICEQL  336

Query  856   IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             +GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  337   MGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  387



>gb|KEH18868.1| bestrophin-like protein [Medicago truncatula]
Length=334

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 178/275 (65%), Gaps = 58/275 (21%)
 Frame = +1

Query  358   MQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVS  537
             MQ+ R LY H +WV HRSSLRH+RH  +S +SRVILSLVPPV+ FTS A ++A+YNSAV 
Sbjct  1     MQKNRTLYNHTNWVTHRSSLRHVRHFFSSFSSRVILSLVPPVLFFTSFAAVIAAYNSAVW  60

Query  538   LHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQ  717
              H+LPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSR  +G+ AWT VIA ASDFA  
Sbjct  61    FHYLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRFVEGKKAWTAVIAAASDFARL  120

Query  718   VISGVE--SKSDKLLKNALLQYIMAFPVALK-----------------------------  804
             V++ V+   K D  +K  LL YI+AFP+ LK                             
Sbjct  121   VMATVDVSGKGDFQVKKELLNYIIAFPIVLKCHVLYGSDVERDLQHLLEVDDIALIMKSN  180

Query  805   --------------------ESKISCFHEGISACEQLI-------GIPIPLSYTRLTSRF  903
                                 +S+ S     I+   + I       GIPIPLSYTRLTSRF
Sbjct  181   HRPRCTIEFISQSIRLLKLEDSRRSILESKITCFHEGIGLCEQLLGIPIPLSYTRLTSRF  240

Query  904   LVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  241   LVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  275



>ref|XP_003521899.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Glycine 
max]
Length=446

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 194/293 (66%), Gaps = 60/293 (20%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +LR IPDWADA+QE  MQ+KRALY H++W  HRSSLRHLRH+ +SL+SRVILSLVPPV+ 
Sbjct  95    LLRSIPDWADAVQERGMQKKRALYTHQNWRDHRSSLRHLRHVFSSLSSRVILSLVPPVLF  154

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ +  +A+YN A+ LH LPEF P+LR SSLPYQLTAPALALLLVFRTEASYSR  +G+
Sbjct  155   FTAFSAAIAAYNEALLLHLLPEFLPLLRTSSLPYQLTAPALALLLVFRTEASYSRFVEGK  214

Query  670   LAWTKVIAGASDFAVQVISGVESKSDKL----LKNALLQYIMAFPVALK-----------  804
              AWT VIAG  DFA QV + V+          +K+ALL YI+AFP+ALK           
Sbjct  215   KAWTNVIAGTHDFARQVAAIVDDGGGGGNNFAIKHALLHYIIAFPIALKCHVLYGSDVRR  274

Query  805   -----------------ESKISCFHE----------------------------GISACE  849
                              E +  C  E                            GI  C+
Sbjct  275   DLQHLLEVDDLVVVMNSEHRPRCIIEFISQSIRLLKLEESRRNVLESKITCFHEGIGICD  334

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             QL+GIPIPL+YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE
Sbjct  335   QLMGIPIPLAYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  387



>gb|EPS60979.1| hypothetical protein M569_13821 [Genlisea aurea]
Length=512

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 189/291 (65%), Gaps = 56/291 (19%)
 Frame = +1

Query  304   PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPV  483
             P ILR++PDWAD I+E  M+QKR+LY H  W+ HRSS RHLRH+L SL+SRVILSLVPPV
Sbjct  39    PSILRIVPDWADGIKEKGMKQKRSLYDHAKWIEHRSSARHLRHVLNSLSSRVILSLVPPV  98

Query  484   IAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQ  663
             IA T VA++VA YNSAV + WLPEFFPVLRASSL YQL APALALLLVFRTEASYSR E+
Sbjct  99    IACTCVAVLVAGYNSAVWMRWLPEFFPVLRASSLAYQLAAPALALLLVFRTEASYSRFEE  158

Query  664   GRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-------------  804
             G+ AWTKV+A ++D   QVI   E+  D+ + + +++Y++AFP+ALK             
Sbjct  159   GKKAWTKVVAASNDLVTQVIGSAENCVDEKVVSDIVKYVVAFPLALKCHIIHGSDIANDL  218

Query  805   ---------------ESKISCFHEGISACEQLIGI-------------------------  864
                              +  C  E IS   +L+ +                         
Sbjct  219   EHILESDDLSIVVRSNHRPRCVIEFISRSLKLLDLEATKLNMLESKLWCFHEGIEVCEQL  278

Query  865   ---PIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                PIPLSYTRLTSR LVLWHLTLP+ILWDDC WIVVPAT ISAA+LF IE
Sbjct  279   IGIPIPLSYTRLTSRLLVLWHLTLPVILWDDCCWIVVPATLISAAALFGIE  329



>ref|XP_007051826.1| Bestrophin-like protein isoform 2 [Theobroma cacao]
 ref|XP_007051827.1| Bestrophin-like protein isoform 2 [Theobroma cacao]
 gb|EOX95983.1| Bestrophin-like protein isoform 2 [Theobroma cacao]
 gb|EOX95984.1| Bestrophin-like protein isoform 2 [Theobroma cacao]
Length=315

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +1

Query  298  NFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVP  477
            N   +LR IPDWAD IQE  MQQ RALY HE+WV HRSSLRHLRHLL+SL SRVILSLVP
Sbjct  64   NLVSLLRAIPDWADRIQERGMQQNRALYNHENWVYHRSSLRHLRHLLSSLQSRVILSLVP  123

Query  478  PVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRL  657
            PV+AFTSVA+++A YN+AV LHWLP FFPVLRASSLPYQLTAPALALLLVFRTEASYSR 
Sbjct  124  PVLAFTSVAVVIAGYNTAVDLHWLPGFFPVLRASSLPYQLTAPALALLLVFRTEASYSRF  183

Query  658  EQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK  804
            E+GR AWTKVIAG +DFA QVI+GVE+  D+ +KNALL YIMAFPVALK
Sbjct  184  EEGRKAWTKVIAGTNDFARQVIAGVENSGDECMKNALLHYIMAFPVALK  232



>ref|XP_009411529.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 213/350 (61%), Gaps = 65/350 (19%)
 Frame = +1

Query  154   PTNFSCASHHKPLSFHPPLFSSKLKKLSF-----RVVCCSSQNNPHPPPTQISNFPWI--  312
             P +F   +     + +P LFSS++  +         + CS+ N       +    P +  
Sbjct  8     PHSFVSTTSSADSNSNPHLFSSRIPLVPRAPHLPHPILCSNSNPTGAGDGERDGSPSLAR  67

Query  313   -LRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
              LR +PDWADA++E  ++++R LY  +DW  HRSSLRHLRHLL+SL+SRVILSL+PPV A
Sbjct  68    FLRSVPDWADAVKELGVRKRRPLYTPDDWREHRSSLRHLRHLLSSLSSRVILSLIPPVSA  127

Query  490   FTSVAIIVASYNSAVSLHWLP-EFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQG  666
              T+VA  +A YNSAV+  WLP   FP+L ASSLPYQLTAPALALLLVFRTEASYSR E+G
Sbjct  128   LTAVAAALALYNSAVAFAWLPPGLFPLLHASSLPYQLTAPALALLLVFRTEASYSRFEEG  187

Query  667   RLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALKESKIS---------  819
             R AW +V+AGAS+ A  V+S    + D  +K +LL YI++FP+ALK   IS         
Sbjct  188   RKAWMRVMAGASELAGIVMSAKGREDDAGVKRSLLNYIISFPMALKCHVISGSDIKADLQ  247

Query  820   -------------------CFHEGIS----------------------------ACEQLI  858
                                C  E IS                             CEQL+
Sbjct  248   NLLDVDDLTVLMKSKHRPRCVIEFISQSIQILHIEEPKRNLLESKLCCFHEGIGVCEQLM  307

Query  859   GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GIPIPLSYTRLTSRFLVLWHLTLP+ILWDDC WIVVPATFISAASLFCIE
Sbjct  308   GIPIPLSYTRLTSRFLVLWHLTLPVILWDDCKWIVVPATFISAASLFCIE  357



>ref|XP_003529947.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Glycine 
max]
Length=413

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 170/318 (53%), Positives = 203/318 (64%), Gaps = 70/318 (22%)
 Frame = +1

Query  265   NNPHPPPTQISNFP------------WILRVIPDWADAIQENRMQQKRALYKHEDWVIhr  408
             N  + P T +++FP             +LR IPDWADA+QE  MQ+KRALY H++W  HR
Sbjct  37    NKTYKPLTILASFPPGPTSGPAQTLISLLRSIPDWADAVQERGMQKKRALYTHQNWRDHR  96

Query  409   sslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLP  588
             SSLRHLRH+ +SL+SRVILSLVPPV+ FT+ A  +A+YN A+ LH LP+F P+LRASSLP
Sbjct  97    SSLRHLRHVFSSLSSRVILSLVPPVLFFTAFAATIAAYNEALLLHLLPDFLPLLRASSLP  156

Query  589   YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGV--ESKSDKLLKN  762
             YQLTAPALALLLVFRTEASYSR  +G+ AWT VIAG  DFA QV + V  +   +  +K+
Sbjct  157   YQLTAPALALLLVFRTEASYSRFVEGKKAWTIVIAGTHDFARQVAAVVVDDDGGNFAIKH  216

Query  763   ALLQYIMAFPVALK----------------------------ESKISCFHEGISACEQLI  858
             ALL YI+AFP+ALK                            + +  C  E IS   +L+
Sbjct  217   ALLHYIIAFPIALKCHVLYGSDVRSDLQHLLEVDDLAVVMNSKHRPRCIIEFISQSIRLL  276

Query  859   ----------------------------GIPIPLSYTRLTSRFLVLWHLTLPIILWDDCH  954
                                         GIPIPL+YTRLTSRFLVLWHLTLPIILWDDCH
Sbjct  277   KLEESRRNALESKMTCFHEGIGICDQLMGIPIPLAYTRLTSRFLVLWHLTLPIILWDDCH  336

Query  955   WIVVPATFISAASLFCIE  1008
             WIVVPATFISAASLFCIE
Sbjct  337   WIVVPATFISAASLFCIE  354



>ref|XP_001754349.1| predicted protein [Physcomitrella patens]
 gb|EDQ80799.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 167/273 (61%), Gaps = 56/273 (21%)
 Frame = +1

Query  358   MQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVS  537
             M ++R  Y H+DW+ HRSS RH RH  +S +SR ILSL+PPV   T++++ VA YN+ V 
Sbjct  1     MLKRRTFYSHDDWLRHRSSTRHYRHFASSFSSRAILSLIPPVGTMTAISVFVALYNTVVL  60

Query  538   LHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQ  717
               WLP FFP+  ASSL YQLTAPALALLLVFRTEASYSR ++ R  WT+VI+ + D A Q
Sbjct  61    SGWLPSFFPIFHASSLSYQLTAPALALLLVFRTEASYSRYDEARKTWTEVISSSKDMARQ  120

Query  718   VISGVESKSDKLLKNALLQYIMAFPVALK----------------------------ESK  813
              ++  +  +D   K  LL YI+AFPVALK                            E +
Sbjct  121   ALAWSQHPADHRKKKLLLDYILAFPVALKCHLLYDSDIAEELREILEEDDLALVLKAEHR  180

Query  814   ISC-------------FHEG---------------ISACEQLIGIPIPLSYTRLTSRFLV  909
              +C             F +G               IS CE+LI  PIPL+YTRLTSR LV
Sbjct  181   PNCLIQLMTLSLKSIKFEDGEGMQLDANISQFNESISVCERLIRTPIPLAYTRLTSRILV  240

Query  910   LWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LWHL+LP++LWDDCHW+VVPATFISAASLFCIE
Sbjct  241   LWHLSLPVVLWDDCHWVVVPATFISAASLFCIE  273



>ref|XP_001761167.1| predicted protein [Physcomitrella patens]
 gb|EDQ73889.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 177/309 (57%), Gaps = 60/309 (19%)
 Frame = +1

Query  262   QNNPHPPPTQISNF----PWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlr  429
               N +   + ++NF    P+ L  I  WAD + E  M ++R  Y H+DW+ HRSS RH R
Sbjct  16    NKNVNGKLSAVTNFDPRRPFDLTWIGAWADEVSERGMHKRRTFYSHDDWLQHRSSTRHYR  75

Query  430   hlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPA  609
             H  ++L+SRVI+SL+PPV   T++++ ++ YNS V    LP F P+L AS L YQLTAPA
Sbjct  76    HFTSTLSSRVIVSLIPPVGTMTAISVAISIYNSIVLSGCLPSFIPLLHASPLSYQLTAPA  135

Query  610   LALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAF  789
             LALLLVFRTEASYSR ++ R  WTKVI+ + D   Q ++  +   D   K  LL YI+AF
Sbjct  136   LALLLVFRTEASYSRYDEARKTWTKVISSSKDMVRQSMTWAQRPDDNRRKKLLLDYILAF  195

Query  790   PVALK----------------------------ESKISCF--------------------  825
              VALK                            E + +C                     
Sbjct  196   SVALKCHLLYNSDIEEELSEILEKDDLALVLSAEHRPNCLIQLITHSLKCIQLEDGERSL  255

Query  826   --------HEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFI  981
                     +E IS CE++I  PIPL+YTRLTSR LVLWHL LPI+LWDDC W+VVPATFI
Sbjct  256   LDANISQFNESISICERIIRTPIPLAYTRLTSRILVLWHLALPIVLWDDCQWVVVPATFI  315

Query  982   SAASLFCIE  1008
             SAASLFCIE
Sbjct  316   SAASLFCIE  324



>ref|XP_004986072.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Setaria 
italica]
Length=404

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 179/293 (61%), Gaps = 67/293 (23%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADA QE R++ +R LY H  W  HRSS RHLRH LTSL+SRVILSL PPV A
Sbjct  51    LLSAVPDWADAAQERRLRDRRPLYDHATWREHRSSRRHLRHFLTSLSSRVILSLAPPVSA  110

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  +A+YN+ +  H        L ASSLPYQLTAPALALLLVFRTEASY+R ++GR
Sbjct  111   FTAFAAAIATYNTLLPDH-------ALTASSLPYQLTAPALALLLVFRTEASYARFDEGR  163

Query  670   LAWTKVIAGASDFAVQVI----SGVESKSDKLLKNALLQYIMAFPVALK-----ESKISC  822
              AW +V+AGA+D A  V+        +  D+ L+ ALL YI+AFPVALK     +S +  
Sbjct  164   KAWMRVLAGAADLAGMVMHPSPPPAAAADDEPLRRALLNYILAFPVALKCHILCDSDVKT  223

Query  823   FHEG---------------------------------------------------ISACE  849
               EG                                                   I  CE
Sbjct  224   DLEGLLAEDDLNVVLASKHRPRCIIEFISQSLQMLDLDQQKRGIMESKLSCFLEGIGVCE  283

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             QLIGIPIP+SYTRLTSRFLVLWHLTLP+ILW +C WIVVPATFISAASLFCIE
Sbjct  284   QLIGIPIPVSYTRLTSRFLVLWHLTLPVILWAECKWIVVPATFISAASLFCIE  336



>ref|XP_002466026.1| hypothetical protein SORBIDRAFT_01g050290 [Sorghum bicolor]
 gb|EER93024.1| hypothetical protein SORBIDRAFT_01g050290 [Sorghum bicolor]
Length=411

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 185/300 (62%), Gaps = 74/300 (25%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADAIQE R++ +R LY H  W  HR+S RHLRHLLTSL+SR ILSL PPV A
Sbjct  50    LLSAVPDWADAIQERRVRDRRPLYDHAAWREHRTSRRHLRHLLTSLSSRAILSLAPPVSA  109

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  +A+YN+      LP++   L ASSLPYQLTAPALALLLVFRTEASY+R ++GR
Sbjct  110   FTAFAAAIATYNT-----LLPDY--ALTASSLPYQLTAPALALLLVFRTEASYARFDEGR  162

Query  670   LAWTKVIAGASDFAVQVI----------SGVESKSDKL-LKNALLQYIMAFPVALK----  804
              AW +V+AGA+D A  ++           G ++++D   L+ AL+ YI+AFPVALK    
Sbjct  163   KAWMRVLAGAADLAGMLMHHPNNLHTRTGGRQAQADDDPLRRALINYILAFPVALKCHII  222

Query  805   ---------------------------------------------ESKISCFHEGIS---  840
                                                          E K S     +S   
Sbjct  223   FDSDVKGDLQGLLAEDDLNVVLASKHRPRCIIEFISQSLQMLDLDEQKRSIMESKLSCFL  282

Query  841   ----ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                  CEQL+GIPIPLSYTRLTSRFLVLWHLTLP+ILW++C WIVVPATFISAASLFCIE
Sbjct  283   EGIGVCEQLMGIPIPLSYTRLTSRFLVLWHLTLPVILWEECKWIVVPATFISAASLFCIE  342



>ref|XP_006445061.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 ref|XP_006445062.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|ESR58301.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|ESR58302.1| hypothetical protein CICLE_v10020374mg [Citrus clementina]
 gb|KDO86138.1| hypothetical protein CISIN_1g015152mg [Citrus sinensis]
 gb|KDO86139.1| hypothetical protein CISIN_1g015152mg [Citrus sinensis]
Length=312

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 152/192 (79%), Gaps = 4/192 (2%)
 Frame = +1

Query  232  LSFRVVCC-SSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhr  408
            L+F+ + C  SQ+      T+      +LR IPDWAD ++E  ++QKR LY HE WV HR
Sbjct  41   LTFKTLSCLESQSQSE---TKTLTLISVLRAIPDWADRVKERGVKQKRTLYSHEKWVEHR  97

Query  409  sslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLP  588
            SSLRH+RHLL+SL+SRVILSL+PPVIAFT VA+++ASYNSA+  H LP F PVLRASSLP
Sbjct  98   SSLRHVRHLLSSLSSRVILSLIPPVIAFTMVAVVIASYNSALDSHLLPGFLPVLRASSLP  157

Query  589  YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNAL  768
            YQLTAPALALLLVFRTEASYSR   G+ AWT++IAG +DFA  VISG ++ +D+ +K++L
Sbjct  158  YQLTAPALALLLVFRTEASYSRFVDGKKAWTQIIAGTNDFATMVISGTDNSTDECIKDSL  217

Query  769  LQYIMAFPVALK  804
            L+YIMAFPVALK
Sbjct  218  LRYIMAFPVALK  229



>ref|NP_001143185.1| uncharacterized protein LOC100275685 [Zea mays]
 gb|ACG29585.1| hypothetical protein [Zea mays]
Length=421

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 181/306 (59%), Gaps = 80/306 (26%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADAIQE R++ +R LY H  W  HRSS RHLRHLLTSL+SR ILSL PPV A
Sbjct  54    LLSAVPDWADAIQERRVRDRRPLYDHATWRHHRSSRRHLRHLLTSLSSRAILSLAPPVSA  113

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  +A+YN+      LP +   L ASSLPY+LTAPALALLLVFRTEASY+R ++GR
Sbjct  114   FTAFAAAIATYNT-----LLPAY--ALTASSLPYELTAPALALLLVFRTEASYARFDEGR  166

Query  670   LAWTKVIAGASDFAVQVIS-----------------GVESKSDKLLKNALLQYIMAFPVA  798
              AW +V+A A+D A  ++                  G     D+ L+ AL+ Y++AFPVA
Sbjct  167   KAWMRVLASAADLAGMLMRHPPPNNLHTGGAPNPGPGGRQADDEPLRRALVNYVLAFPVA  226

Query  799   LK-----ESKISCFHEG-------------------------------------------  834
             LK     +S +    EG                                           
Sbjct  227   LKCHIICDSDVKGDLEGLLGEDDLSVVLASKHRPRCIIEFIAQSLQMLDLDEQKRSIMVS  286

Query  835   --------ISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
                     I  CEQL+GIPIPL+YTRLTSRFLVLWHLTLPIILW++C WIVVPATFISAA
Sbjct  287   KLSCFLEGIGVCEQLMGIPIPLAYTRLTSRFLVLWHLTLPIILWEECKWIVVPATFISAA  346

Query  991   SLFCIE  1008
             SLFCIE
Sbjct  347   SLFCIE  352



>gb|ACL54730.1| unknown [Zea mays]
 tpg|DAA42827.1| TPA: hypothetical protein ZEAMMB73_156509 [Zea mays]
Length=421

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 181/306 (59%), Gaps = 80/306 (26%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADAIQE R++ +R LY H  W  HRSS RHLRHLLTSL+SR ILSL PPV A
Sbjct  54    LLSAVPDWADAIQERRVRDRRPLYDHATWRHHRSSRRHLRHLLTSLSSRAILSLAPPVSA  113

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  +A+YN+      LP +   L ASSLPY+LTAPALALLLVFRTEASY+R ++GR
Sbjct  114   FTAFAAAIATYNT-----LLPAY--ALTASSLPYELTAPALALLLVFRTEASYARFDEGR  166

Query  670   LAWTKVIAGASDFAVQVIS-----------------GVESKSDKLLKNALLQYIMAFPVA  798
              AW +V+A A+D A  ++                  G     D+ L+ AL+ Y++AFPVA
Sbjct  167   KAWMRVLASAADLAGMLMRHPFPNNLHTGGAPNPGPGGRQADDEPLRRALVNYVLAFPVA  226

Query  799   LK-----ESKISCFHEG-------------------------------------------  834
             LK     +S +    EG                                           
Sbjct  227   LKCHIICDSDVKGDLEGLLGEDDLSVVLASKHRPRCIIEFIAQSLQMLDLDEQKRSIMVS  286

Query  835   --------ISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
                     I  CEQL+GIPIPL+YTRLTSRFLVLWHLTLPIILW++C WIVVPATFISAA
Sbjct  287   KLSCFLEGIGVCEQLMGIPIPLAYTRLTSRFLVLWHLTLPIILWEECKWIVVPATFISAA  346

Query  991   SLFCIE  1008
             SLFCIE
Sbjct  347   SLFCIE  352



>ref|XP_002965156.1| hypothetical protein SELMODRAFT_65241, partial [Selaginella moellendorffii]
 gb|EFJ33994.1| hypothetical protein SELMODRAFT_65241, partial [Selaginella moellendorffii]
Length=309

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 167/285 (59%), Gaps = 63/285 (22%)
 Frame = +1

Query  322   IPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSV  501
             +P+WADA +E  M  +RA Y + DW+ HRSSLRH RH+ ++ +SRVI+SL+PPV   T +
Sbjct  4     VPEWADAQKEQNMPNRRAFYSNNDWLRHRSSLRHARHMASTFSSRVIISLIPPVFTVTGI  63

Query  502   AIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWT  681
             +++V  YN+ V   W P F PVL A SLPY+LTAPALALLLVFRT+ SYSR ++ R  WT
Sbjct  64    SVLVTLYNALVESRWAPGFLPVLHAPSLPYELTAPALALLLVFRTDTSYSRYDEARKTWT  123

Query  682   KVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALK-------------------  804
             +VI+   + A    + + +       + L++YI+AFP+ALK                   
Sbjct  124   EVISSTKNLARLTEAWIHN-------DDLMRYIVAFPLALKCHLIMGSDMEAELRKVLDE  176

Query  805   ------------------------------ESKISCFHEGISA-------CEQLIGIPIP  873
                                           E++    HE IS        CE+LI  PIP
Sbjct  177   RDLAFVLNAKHRPNCLLQMIFQIIDGLSLGETQQVLLHENISTYNRSVSVCERLIRTPIP  236

Query  874   LSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             LSYTRLTSRFL+LWHL LPI LWD C+W+V+P+TF S+A+LFCIE
Sbjct  237   LSYTRLTSRFLILWHLGLPIALWDTCNWLVIPSTFFSSAALFCIE  281



>ref|XP_002962243.1| hypothetical protein SELMODRAFT_65166, partial [Selaginella moellendorffii]
 gb|EFJ37503.1| hypothetical protein SELMODRAFT_65166, partial [Selaginella moellendorffii]
Length=309

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 168/278 (60%), Gaps = 49/278 (18%)
 Frame = +1

Query  322   IPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSV  501
             +P+WADA +E  M  +RA Y + DW+ HRSSLRH RH+ ++ +SRVI+SL+PPV   T +
Sbjct  4     VPEWADAQKEQNMPNRRAFYSNNDWLRHRSSLRHARHMASTFSSRVIISLIPPVFTVTGI  63

Query  502   AIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWT  681
             +++V  YN+ V   W P F PVL A SLPY+LTAPALALLLVFRT+ SYSR ++ R  WT
Sbjct  64    SVLVTLYNALVESGWAPGFLPVLHAPSLPYELTAPALALLLVFRTDTSYSRYDEARKTWT  123

Query  682   KVIAGASDFA------------------------VQVISGVESKSD--KLLK--------  759
             +VI+   + A                          +I G + ++D  K+L         
Sbjct  124   EVISSTKNLARLTEAWIHNDDLMRYIVAFPLALKCHLIMGSDMEADLRKVLDERDLAFVL  183

Query  760   ------NALLQYIMAF--PVALKESKISCFHEGISA-------CEQLIGIPIPLSYTRLT  894
                   N LLQ I      ++L E++    HE IS        CE+LI  PIPLSYTRLT
Sbjct  184   NAKHRPNCLLQMIFQIIDGLSLGETQQVLLHENISTYNRSVSVCERLIRTPIPLSYTRLT  243

Query  895   SRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             SRFL+LWHL LPI LWD C+W+V+P+TF S+A+LFCIE
Sbjct  244   SRFLILWHLGLPIALWDTCNWLVIPSTFFSSAALFCIE  281



>ref|XP_010418596.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Camelina 
sativa]
Length=268

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 150/214 (70%), Gaps = 13/214 (6%)
 Frame = +1

Query  166  SCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAI  345
            +     KP++  PP  SS               +N             +LR +PDWAD I
Sbjct  30   TTTGFRKPVNLKPPRVSS------------GPDSNDSRDKALTEKLITLLRAVPDWADEI  77

Query  346  QENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYN  525
            +E  MQQKR+LY HE WV HRSSLRH+RHLL+S +SRVILSL+PPV  FTSVA+++ASYN
Sbjct  78   KERGMQQKRSLYTHEKWVEHRSSLRHVRHLLSSFSSRVILSLIPPVFFFTSVAVVIASYN  137

Query  526  SAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASD  705
            +AV+L WLP  FP+LR+SSLPYQLTAPALALLLVFRTEASYSR E+GR AW  +IAG +D
Sbjct  138  TAVALDWLPGIFPILRSSSLPYQLTAPALALLLVFRTEASYSRYEEGRKAWVGIIAGTND  197

Query  706  FAVQVISGVESKSDKL-LKNALLQYIMAFPVALK  804
             A QVI  V+S  D+L +K+ LL+Y+ AFPVALK
Sbjct  198  LARQVICSVDSSGDELIIKDLLLRYVAAFPVALK  231



>ref|NP_001048682.1| Os03g0106000 [Oryza sativa Japonica Group]
 gb|AAN60484.1| Unknown protein [Oryza sativa Japonica Group]
 gb|ABF93531.1| Uncharacterised protein family containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10596.1| Os03g0106000 [Oryza sativa Japonica Group]
 gb|EAY88198.1| hypothetical protein OsI_09646 [Oryza sativa Indica Group]
 gb|EAZ25278.1| hypothetical protein OsJ_09088 [Oryza sativa Japonica Group]
 dbj|BAG88655.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 184/307 (60%), Gaps = 69/307 (22%)
 Frame = +1

Query  262   QNNPHPPPTQISNFPWI--LRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhl  435
             ++ P  P T  +  P +  L  +PDWADA+ E R++ +R LY H DW  HRSS RHLRHL
Sbjct  28    RDPPKAPDTNSNTNPLLSLLSAVPDWADAVSERRIRDRRPLYTHADWREHRSSRRHLRHL  87

Query  436   ltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALA  615
             L+SL SRVILSL PPV AFT+ A  +A+YN+      LP +   L ASSLPYQLTAPALA
Sbjct  88    LSSLTSRVILSLAPPVSAFTAFAAAIATYNT-----LLPAY--ALTASSLPYQLTAPALA  140

Query  616   LLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPV  795
             LLLVFRTEASY+R ++GR AW +VIA A+D A   +      + +    ALL YI+AFP+
Sbjct  141   LLLVFRTEASYARFDEGRKAWMRVIAAAADLAGMAMRHHNPPATR----ALLNYILAFPL  196

Query  796   ALK----------------------------ESKISCFHEGIS-----------------  840
             ALK                            + +  C  E IS                 
Sbjct  197   ALKCHIICHSDIKRDLQGLLSEDDLNVVLRSKHRPRCIIEFISQSLYMLDFDENKRNIME  256

Query  841   -----------ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISA  987
                         CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+ILWD+C WIVVPATFISA
Sbjct  257   SKLSCFLEGISVCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVILWDECKWIVVPATFISA  316

Query  988   ASLFCIE  1008
             ASLFCIE
Sbjct  317   ASLFCIE  323



>dbj|BAJ85884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88146.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 183/293 (62%), Gaps = 67/293 (23%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADA+ E R+++ R LY HE W  HRSSLRHLRHLL+SL+SRVILSLVPPV A
Sbjct  54    LLTAVPDWADAVSERRIREPRPLYTHEQWREHRSSLRHLRHLLSSLSSRVILSLVPPVSA  113

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+ A  VA+YN+       P++   L ASSLPYQLTAPALALLLVFRTEASY+R ++GR
Sbjct  114   FTAFAAAVATYNTLA-----PDY--ALTASSLPYQLTAPALALLLVFRTEASYARFDEGR  166

Query  670   LAWTKVIAGASDFAVQVI---SGVESKSDK-LLKNALLQYIMAFPVALK-----ESKISC  822
              AW +V+AGA++ A  V+   +G   + D      AL+ YI+AFPVALK      S I  
Sbjct  167   KAWMRVLAGATELAGMVMHSCAGAGERGDNDTGTGALVNYILAFPVALKCHITSNSDIRK  226

Query  823   FHEGISA---------------------------------------------------CE  849
               EG+ A                                                   CE
Sbjct  227   DLEGLLAEDDLNVIMSSKHRPRCIIEFISQSLQILDFDEHKRSIMESKLSCFLEGICVCE  286

Query  850   QLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             Q+IGIP+PLSYTRLTSRFLVLWHLTLPIILW +C WIVVPATF+SAASLFCIE
Sbjct  287   QIIGIPVPLSYTRLTSRFLVLWHLTLPIILWAECKWIVVPATFVSAASLFCIE  339



>ref|XP_003562221.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Brachypodium 
distachyon]
Length=413

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 178/294 (61%), Gaps = 68/294 (23%)
 Frame = +1

Query  310   ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
             +L  +PDWADA+ E R++  R LY HE W  HRSS RHLRHLL+SL+SRVILSL PPV A
Sbjct  58    LLTAVPDWADAVTERRVRDPRPLYTHEQWREHRSSRRHLRHLLSSLSSRVILSLAPPVSA  117

Query  490   FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
             FT+VA  VA+YN+ V  +        L ASSLPYQLTAPALALLLVFRTEASY+R ++GR
Sbjct  118   FTAVAAAVATYNTLVPAY-------ALTASSLPYQLTAPALALLLVFRTEASYARFDEGR  170

Query  670   LAWTKVIAGASDFAVQVI---SGV--ESKSDKLLKNALLQYIMAFPVALK----------  804
              AW +V+AGA++    V+    GV  +   +   + AL+ YI+AFPVALK          
Sbjct  171   KAWIRVLAGAAELVGMVMHPAGGVAGDGTDEPAGRTALVNYILAFPVALKCHITSNSDIR  230

Query  805   ------------------ESKISCFHEGISACEQL-------------------------  855
                               + +  C  E IS   Q+                         
Sbjct  231   KDLQGLLAEDDLNVVLTSKHRPRCIIEFISQSLQMLDFEEHRRSIMESKLSGFLEGICVC  290

Query  856   ---IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
                IGIP+PLSYTRLTSRFLVLWHLTLP+ILW +C WIVVPATFISAASLFCIE
Sbjct  291   EQIIGIPVPLSYTRLTSRFLVLWHLTLPVILWSECKWIVVPATFISAASLFCIE  344



>ref|XP_008354243.1| PREDICTED: LOW QUALITY PROTEIN: UPF0187 protein At3g61320, chloroplastic-like, 
partial [Malus domestica]
Length=349

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 1/177 (1%)
 Frame = +1

Query  277  PPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsr  456
            P  + +  F  + R+IPDWA+  Q+  M+Q+  LY HE W+ HRSS  HL HLL+SL+S 
Sbjct  2    PSSSPVETFINVFRIIPDWANRTQKGGMRQRITLYDHEKWMQHRSSYHHLHHLLSSLSSI  61

Query  457  VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRT  636
            VILSL+PPVI FT +A+++ASYN+AV    LP FFP+LR+SSLPYQLTA  LALLLVFRT
Sbjct  62   VILSLIPPVIVFTFMAVVIASYNTAVDXDLLPRFFPLLRSSSLPYQLTALTLALLLVFRT  121

Query  637  EASYSRLEQGRLAWTKVIAGASDFAVQVISGVE-SKSDKLLKNALLQYIMAFPVALK  804
            EASYSR E+G+ AW +VIAGA+DF   VIS VE S  D  LK ALLQYIMAFPVALK
Sbjct  122  EASYSRFEEGKKAWAEVIAGANDFTRLVISSVENSGDDAQLKKALLQYIMAFPVALK  178



>ref|XP_001757529.1| predicted protein [Physcomitrella patens]
 gb|EDQ77586.1| predicted protein [Physcomitrella patens]
Length=353

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 140/271 (52%), Gaps = 56/271 (21%)
 Frame = +1

Query  364   QKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLH  543
              +  +Y H +W  H+S  RH RHL +  +S VI +L PPVI  T VA +V+  N  V   
Sbjct  2     HRNTVYGHTEWRRHKSCWRHSRHLSSIFSSGVIFTLGPPVILCTLVATLVSVINHLVQDR  61

Query  544   WLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVI  723
              LP++ P+L  +SLP+ LTAP LALLLVFRT ASYSR ++ R AW   +    D A Q +
Sbjct  62    RLPKWMPLLHVASLPFTLTAPVLALLLVFRTNASYSRFDEARKAWGSNVNRTRDLARQAL  121

Query  724   SGVESKSDKLLKNALLQYIMAFPVALKE------------------SKISC---------  822
             + +    D    + LL++I A+ + LK+                  S++ C         
Sbjct  122   TWIRMPCDAPKLHCLLRHIKAYSLCLKDHMTEDNTLREELTAVLEPSEVDCAMSSQHRPN  181

Query  823   -----------------------------FHEGISACEQLIGIPIPLSYTRLTSRFLVLW  915
                                          FH+ + ACE++   PIPL+YTRLTSR L+ W
Sbjct  182   YILQVMSELISQCQISQWEKITMDKNITAFHDNVGACERIFKTPIPLAYTRLTSRMLMFW  241

Query  916   HLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             HL LP+ LW+ C W+ +P +F+SAA+LF IE
Sbjct  242   HLALPVGLWNTCGWLTIPVSFMSAAALFYIE  272



>ref|XP_006650954.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like, partial 
[Oryza brachyantha]
Length=250

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 105/179 (59%), Gaps = 50/179 (28%)
 Frame = +1

Query  622   LVFRTEASYSRLEQGRLAWTKV-------------------------IAGASDFAVQVIS  726
             LVFRTEASY+R ++GR AW +V                         +A        +I+
Sbjct  1     LVFRTEASYARFDEGRKAWMRVLAAAADLAGMAMRHPAPAPHLINYILAFPVALKCHIIN  60

Query  727   GVESKSD--KLLK----NALLQ----------------YIMAFPVALK---ESKISCFHE  831
               + K+D   LL     N +L+                Y++ F  + +   ESK+SCF E
Sbjct  61    HSDIKNDLQGLLSEDDLNVVLRSKHRPRCIIEFISQSLYMLDFGESKRNIMESKLSCFLE  120

Query  832   GISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             GI+ CEQLIGIPIPLSYTRLTSRFLVLWHLTLP+ILWD+C WIVVPATFISAASLFCIE
Sbjct  121   GIAVCEQLIGIPIPLSYTRLTSRFLVLWHLTLPVILWDECKWIVVPATFISAASLFCIE  179



>ref|XP_001762184.1| predicted protein [Physcomitrella patens]
 gb|EDQ72976.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 139/278 (50%), Gaps = 57/278 (21%)
 Frame = +1

Query  346   QENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYN  525
             +E  +  + ++Y H +W  H+SS RH+RH+ T L+S +I ++ PPV   T V++ VA  N
Sbjct  1     EEAGIMHRNSVYGHGEWKKHKSSWRHVRHVCTILSSGLIRAIGPPVFLCTLVSVFVAVIN  60

Query  526   SAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASD  705
               V    LP +FPVL+ ++LP+ LT+P LALLLVFRT  SY R ++ R AW   +  A D
Sbjct  61    HCVDNGVLPSWFPVLKVATLPFTLTSPVLALLLVFRTNTSYQRFDEARKAWGSNVNRARD  120

Query  706   FAVQVISGVESKSDKLLKNALLQYIMAFPVAL-------------------KESKISC--  822
              A Q ++ + +  D      LL+Y  A+   L                    E ++ C  
Sbjct  121   LARQALTWIRNPGDSKKLQCLLRYTKAYSFCLMHHLREEGCLRKELEATIVNEEEVECVM  180

Query  823   ------------------------------------FHEGISACEQLIGIPIPLSYTRLT  894
                                                 FH+ + ACE++   PIP++YTRLT
Sbjct  181   NSKNRPIWVLQVISDIINECQITPWERIAMDKNITQFHDNVGACERIFKTPIPVAYTRLT  240

Query  895   SRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             SR L LWHL LP  LW+ C W  +  +F+S+A+LF IE
Sbjct  241   SRVLTLWHLVLPFALWETCGWHTITVSFVSSAALFYIE  278



>gb|KHN42212.1| UPF0187 protein, chloroplastic [Glycine soja]
Length=158

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             ESKI+CFHEGI  C+QL+GIPIPL+YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS
Sbjct  32    ESKITCFHEGIGICDQLMGIPIPLAYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  91

Query  985   AASLFCIE  1008
             AASLFCIE
Sbjct  92    AASLFCIE  99



>gb|KHN26978.1| UPF0187 protein, chloroplastic [Glycine soja]
Length=158

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             ESK++CFHEGI  C+QL+GIPIPL+YTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS
Sbjct  32    ESKMTCFHEGIGICDQLMGIPIPLAYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  91

Query  985   AASLFCIE  1008
             AASLFCIE
Sbjct  92    AASLFCIE  99



>ref|XP_006827657.1| hypothetical protein AMTR_s00009p00251540 [Amborella trichopoda]
 gb|ERM95073.1| hypothetical protein AMTR_s00009p00251540 [Amborella trichopoda]
Length=262

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  358  MQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVS  537
            M+++R LY H DW+ HRSSLRH+RHLL+SL+SRV+LSLVPPV+ FT+VA ++ASYN+A+ 
Sbjct  1    MRKERHLYTHNDWIQHRSSLRHVRHLLSSLSSRVVLSLVPPVLFFTTVAAVIASYNTAIL  60

Query  538  LHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQ  717
            ++W+P FFP+LRASSLPYQLTAPALALLLVFRTEASYSR E+GR AW  VI GA++ A  
Sbjct  61   MNWVPSFFPLLRASSLPYQLTAPALALLLVFRTEASYSRFEEGRKAWGTVITGANELARL  120

Query  718  VISGVESKSDKLLKNALLQYIMAFPVALK  804
            V   V    D+ +K+ L++YIMAFPVALK
Sbjct  121  VGVSVREPVDRKMKSVLIRYIMAFPVALK  149



>ref|XP_001785122.1| predicted protein [Physcomitrella patens]
 gb|EDQ50073.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 116/240 (48%), Gaps = 56/240 (23%)
 Frame = +1

Query  457   VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRT  636
             VI S++P V   T ++++V  +N AV    LP + P LR  +LP  LTAP L+LLLVFRT
Sbjct  22    VISSIIPRVFFCTLISVLVTIFNHAVMEGVLPHWVPSLRVPTLPMSLTAPVLSLLLVFRT  81

Query  637   EASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSD--------------------KLL  756
              +SY+RL++ R AW   +    D + Q +S +    D                     L 
Sbjct  82    NSSYNRLDEARKAWGSNVNRTRDVSRQALSWICDPDDADKLQSLLRHIKAFSYCLKDHLT  141

Query  757   KNALLQYIMA-------FPVALKES-----------------------------KISCFH  828
             +  LLQ  +A         + LK S                              I+ FH
Sbjct  142   QENLLQEELARVLEPREVELVLKSSHRPNYVLHVMSDTIKHCRISKWESKSMDRNITQFH  201

Query  829   EGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             + + ACE+L   PIP++YTR+ SRFL +WH  LP+ LW+ C W+ +P TF+S   LFCIE
Sbjct  202   DNVGACERLFKTPIPVAYTRMISRFLSIWHFLLPLALWNSCRWLTIPVTFVSGVGLFCIE  261



>ref|XP_001757527.1| predicted protein [Physcomitrella patens]
 gb|EDQ77584.1| predicted protein, partial [Physcomitrella patens]
Length=290

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 143/270 (53%), Gaps = 56/270 (21%)
 Frame = +1

Query  367   KRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHW  546
             + A+Y H++W  H+S  RH RHL T   SR I++  PPV   T +A+ V  +N +V +  
Sbjct  1     RNAVYGHDEWAKHKSCWRHGRHLKTIFASRPIVATGPPVAFCTLIAVFVVIFNHSVLVGH  60

Query  547   LPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS  726
              P + PV++ +S+P+ LT+  L+LLLVFRT +SY+R ++ R AW   +    D A Q ++
Sbjct  61    FPVWVPVIQVASIPFALTSSVLSLLLVFRTNSSYNRFDEARKAWGSNVNRTRDLARQALT  120

Query  727   GVESKSD--KL-------------LKNALLQ----------------------------Y  777
              + S +D  KL             LK+ L Q                            Y
Sbjct  121   WIRSPADLPKLHCLLRHIKAYSYCLKDHLTQDNTLREELAKVLEPTELELVLSSKHRPNY  180

Query  778   IMAFPVAL-KESKIS------------CFHEGISACEQLIGIPIPLSYTRLTSRFLVLWH  918
             +M     L K+ K+S             FH+ + ACE+L   PIP++YTRLTSR L LWH
Sbjct  181   VMQVMSELIKQCKVSEWESMSMDRNLTQFHDNVGACERLFKTPIPVAYTRLTSRVLSLWH  240

Query  919   LTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             ++LP  LW+ CHW+ +PATF S+A+LF IE
Sbjct  241   ISLPFALWNSCHWLTIPATFFSSAALFYIE  270



>ref|XP_001760828.1| predicted protein [Physcomitrella patens]
 gb|EDQ74217.1| predicted protein [Physcomitrella patens]
Length=353

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 136/271 (50%), Gaps = 56/271 (21%)
 Frame = +1

Query  364   QKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLH  543
              +  +Y H +W  H+SS RH RHL++ L+S VI ++ PPV+A T +A  V  +N  V + 
Sbjct  2     HRNKVYGHAEWAKHKSSWRHGRHLMSILSSGVISAVGPPVLACTLLATFVTVFNYFVKVG  61

Query  544   WLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVI  723
              LP + P+L  SSLP+ LT+  L+LLLVFRT +SY+R ++ R  W   +    D A Q +
Sbjct  62    RLPNWIPILEVSSLPFTLTSSVLSLLLVFRTNSSYNRFDEARKIWGSNVNRTRDLARQAL  121

Query  724   SGVESKSDKLLKNALLQYIMAFPVALKESKISCF--------------------------  825
             S + S +D    + LL++I A+P +LK+     F                          
Sbjct  122   SWIRSPADAYKLSCLLRHIKAYPFSLKDHLTEDFILKDELDQILEPQELEALMATKHRPN  181

Query  826   -----------------------HEGISACEQLIG-------IPIPLSYTRLTSRFLVLW  915
                                     E I+     +G        PIPL+YT +TSRFL+LW
Sbjct  182   YILQVLSELVDKCNLSEWEKMAMDENITTFHDNVGACERILKTPIPLAYTLVTSRFLILW  241

Query  916   HLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             HL LP  LW  CHW+ +P TF++A +LF IE
Sbjct  242   HLVLPFALWATCHWLTIPVTFLTATALFYIE  272



>ref|XP_001763440.1| predicted protein [Physcomitrella patens]
 gb|EDQ71629.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 135/274 (49%), Gaps = 56/274 (20%)
 Frame = +1

Query  355   RMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAV  534
             ++  +  +Y H +W  H+SS RH RH+ + L+S VI ++ PPV+  T     V  +N  V
Sbjct  2     KIMHRNKVYGHLEWARHKSSWRHGRHIFSILSSGVIFAVFPPVLVCTLFGTFVTIFNHFV  61

Query  535   SLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAV  714
                 LP + P+L  +SLP+ LT+  L+LLLVFRT +SY+R E+ R  W   +    D   
Sbjct  62    QNGHLPTWMPILHVASLPFTLTSSVLSLLLVFRTNSSYNRFEEARKFWGSNVNRTRDLVR  121

Query  715   QVISGVES-------------------------KSDKLLKNALL----------------  771
             Q ++ +                             D+ L++ L+                
Sbjct  122   QSLTWISQPGDSLILLSLLRHIKAYSFCLKDHLTEDETLRDDLVGIVEPHELESILSSPH  181

Query  772   --QYIMAFPVAL-------------KESKISCFHEGISACEQLIGIPIPLSYTRLTSRFL  906
                YI+     L              +  I+ FH+ + ACE+++  PIP++YT +TSRFL
Sbjct  182   RPNYILQVLSELINQCHISQWEKMSMDENITTFHDNVGACERILKTPIPIAYTLVTSRFL  241

Query  907   VLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             +LWH  LP+ LW+DC W+ +PATF++  +LF IE
Sbjct  242   ILWHSALPLALWNDCGWLTIPATFLTGMALFYIE  275



>ref|XP_005643731.1| UPF0187-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19187.1| UPF0187-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=435

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/296 (32%), Positives = 141/296 (48%), Gaps = 57/296 (19%)
 Frame = +1

Query  289   QISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILS  468
             Q ++  W+ R      +A +E   + +R  + ++DWV HRS+ R+ RHL   L+SR+   
Sbjct  46    QETDIEWVERAAIQ-REAWKEESRKYRRVTFTYDDWVAHRSTTRYSRHLAGILDSRIFRG  104

Query  469   LVPPVIAFTSVAIIVASYNSAVSLHWL--PEFFPVLRASSLPYQLTAPALALLLVFRTEA  642
             L+P + A   VA  V+ Y +      L   ++  +   +   + LT+ AL+LLLVFRT  
Sbjct  105   LLPTLTAVMMVATFVSVYETLREAGILIPHDWVGLTVEAGQAFNLTSFALSLLLVFRTNE  164

Query  643   SYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK------------------------  750
             SYSR  + R AWT ++  + DFA Q +S +     +                        
Sbjct  165   SYSRWLEARKAWTNIVTRSRDFARQGLSWLSGDKQRESMLERWTIAFIKCTMAHVREECD  224

Query  751   ---LLKNAL----LQYIMA----------------FPVALKESK-------ISCFHEGIS  840
                LL++ L    L+ +MA                +   L E +       ++ F E + 
Sbjct  225   LQSLLEDVLEAHELEQLMAAQHKPNFVLHVLSELVWGANLMEGQAMRMDEALTVFGEQVG  284

Query  841   ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              CE+L+  PIPLSYTR TSRFLV+W   LP  LWD CHW+ +PA+ I A  L  IE
Sbjct  285   TCERLLKTPIPLSYTRHTSRFLVMWLAFLPFSLWDACHWVTIPASGIIAFLLLGIE  340



>ref|XP_008669850.1| PREDICTED: uncharacterized protein LOC100275685 isoform X1 [Zea 
mays]
 gb|ACF84276.1| unknown [Zea mays]
 gb|ACN32083.1| unknown [Zea mays]
 tpg|DAA42826.1| TPA: hypothetical protein ZEAMMB73_156509 [Zea mays]
Length=347

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 128/201 (64%), Gaps = 25/201 (12%)
 Frame = +1

Query  310  ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
            +L  +PDWADAIQE R++ +R LY H  W  HRSS RHLRHLLTSL+SR ILSL PPV A
Sbjct  54   LLSAVPDWADAIQERRVRDRRPLYDHATWRHHRSSRRHLRHLLTSLSSRAILSLAPPVSA  113

Query  490  FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
            FT+ A  +A+YN+      LP +   L ASSLPY+LTAPALALLLVFRTEASY+R ++GR
Sbjct  114  FTAFAAAIATYNT-----LLPAY--ALTASSLPYELTAPALALLLVFRTEASYARFDEGR  166

Query  670  LAWTKVIAGASDFAVQVIS-----------------GVESKSDKLLKNALLQYIMAFPVA  798
             AW +V+A A+D A  ++                  G     D+ L+ AL+ Y++AFPVA
Sbjct  167  KAWMRVLASAADLAGMLMRHPFPNNLHTGGAPNPGPGGRQADDEPLRRALVNYVLAFPVA  226

Query  799  LKESKISCFHEGISACEQLIG  861
            LK   I C  +     E L+G
Sbjct  227  LK-CHIICDSDVKGDLEGLLG  246



>gb|EMT19485.1| hypothetical protein F775_25165 [Aegilops tauschii]
Length=307

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 70/123 (57%), Gaps = 40/123 (33%)
 Frame = +1

Query  760   NALLQYIMAFPVALK----------------------------ESKISCFHEGISACEQL  855
              AL+ YI+AFPVALK                            + +  C  E IS   Q+
Sbjct  114   GALVNYILAFPVALKCHITSNSDIRKDLQGLLAEDDLNVIMSSKHRPRCIIEFISQSLQM  173

Query  856   ------------IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLF  999
                         IGIP+PLSYTRLTSRFLVLWHLTLPIILW +C WIVVPATF+SAASLF
Sbjct  174   LDFEEHKRSIMIIGIPVPLSYTRLTSRFLVLWHLTLPIILWAECKWIVVPATFVSAASLF  233

Query  1000  CIE  1008
             CIE
Sbjct  234   CIE  236



>tpg|DAA42825.1| TPA: hypothetical protein ZEAMMB73_156509 [Zea mays]
Length=262

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 121/182 (66%), Gaps = 24/182 (13%)
 Frame = +1

Query  310  ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
            +L  +PDWADAIQE R++ +R LY H  W  HRSS RHLRHLLTSL+SR ILSL PPV A
Sbjct  54   LLSAVPDWADAIQERRVRDRRPLYDHATWRHHRSSRRHLRHLLTSLSSRAILSLAPPVSA  113

Query  490  FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
            FT+ A  +A+YN+      LP +   L ASSLPY+LTAPALALLLVFRTEASY+R ++GR
Sbjct  114  FTAFAAAIATYNT-----LLPAY--ALTASSLPYELTAPALALLLVFRTEASYARFDEGR  166

Query  670  LAWTKVIAGASDFAVQVIS-----------------GVESKSDKLLKNALLQYIMAFPVA  798
             AW +V+A A+D A  ++                  G     D+ L+ AL+ Y++AFPVA
Sbjct  167  KAWMRVLASAADLAGMLMRHPFPNNLHTGGAPNPGPGGRQADDEPLRRALVNYVLAFPVA  226

Query  799  LK  804
            LK
Sbjct  227  LK  228



>ref|XP_001690694.1| hypothetical protein CHLREDRAFT_180771 [Chlamydomonas reinhardtii]
 gb|EDO96269.1| predicted protein [Chlamydomonas reinhardtii]
Length=329

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 99/190 (52%), Gaps = 9/190 (5%)
 Frame = +1

Query  466   SLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRA-SSLPYQLTAPALALLLVFRTEA  642
              L+ P+      A+ V  Y  A+  H LP   P     S  P+QLT+ AL+L+LVFRT +
Sbjct  56    DLLGPLAVLVGTAVAVGCYEQALQDHLLPGALPSFSGVSDTPFQLTSFALSLMLVFRTNS  115

Query  643   SYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAF----PVALKE-  807
             SY+R    R  W  ++  +  F  QV++ +   S   L++A+ ++ +AF     + L+E 
Sbjct  116   SYARWLDARQQWGLIVNTSRTFIRQVMTTLPESSCSELRDAIARWTIAFVRLSKLHLREH  175

Query  808   SKISCFHEGISACEQL---IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATF  978
               +     G+   E+L   +  PIPLSYTR TSRFLVLW L LPI LW    W VVP   
Sbjct  176   GDVRLEMAGVLRGEELPLILRNPIPLSYTRHTSRFLVLWLLWLPIALWGKVSWGVVPVEA  235

Query  979   ISAASLFCIE  1008
             I    L  I+
Sbjct  236   ILCYLLLGID  245



>gb|EMS56622.1| hypothetical protein TRIUR3_04506 [Triticum urartu]
Length=216

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  853   LIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             +IGIP+PLSYTRLTSRFLVLWHLTLPIILW +C WIVVPATF+SAASLFCIE
Sbjct  94    IIGIPVPLSYTRLTSRFLVLWHLTLPIILWAECKWIVVPATFVSAASLFCIE  145



>ref|XP_005843733.1| hypothetical protein CHLNCDRAFT_9818, partial [Chlorella variabilis]
 gb|EFN51631.1| hypothetical protein CHLNCDRAFT_9818, partial [Chlorella variabilis]
Length=273

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 103/233 (44%), Gaps = 57/233 (24%)
 Frame = +1

Query  457  VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRT  636
            ++  L  P+++  + A IV  Y  A+   WLP F P     SLP+ +TA +L LLLVFRT
Sbjct  29   IVRGLAQPLLSSCATATIVCVYEQALQDGWLPSFLPTFIMPSLPFDITASSLGLLLVFRT  88

Query  637  EASYSRLEQGRLAWTKVIAGASDFAVQVI-------------------------------  723
             +SY R +Q   AW  +   A D   Q++                               
Sbjct  89   NSSYDRWQQAVSAWGDIETRARDTLRQLLAAASHSSAGHGGARQAALWLVAFSRSLKAQL  148

Query  724  ---SGVESKSDKLLKNALLQYIMA------FPVAL-----------------KESKISCF  825
               S V+++  ++L    L  ++       F +A+                  +  +SCF
Sbjct  149  TEDSDVQAELREVLTGQELALLLGAQHRPSFALAVLSELAEAAPLRDAQRVRVDENLSCF  208

Query  826  HEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             +    CE+++  PIPLSYTR +SRF+V+W   LP+ LW  C +  +P T IS
Sbjct  209  QDAAGRCERILRTPIPLSYTRHSSRFMVIWLSALPLGLWSQCGFGTIPLTVIS  261



>ref|XP_001754623.1| predicted protein [Physcomitrella patens]
 gb|EDQ80593.1| predicted protein [Physcomitrella patens]
Length=300

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             ++ ++ FH+ + ACE++   PIP++YTR+TSR L++WHL LP  LW+DC W+ +PATF+S
Sbjct  206   DANLTQFHDNVGACERIFKTPIPIAYTRMTSRMLIMWHLALPYGLWNDCRWLTIPATFMS  265

Query  985   AASLFCIE  1008
             +A+LF IE
Sbjct  266   SAALFYIE  273


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 80/146 (55%), Gaps = 0/146 (0%)
 Frame = +1

Query  367  KRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHW  546
            +  +Y H++W  H+SS RH RH+++   S VI +L PPV+  T  A+ V   N  V    
Sbjct  1    RNTVYGHDEWRRHKSSWRHARHVISIAASGVIAALGPPVLLSTITAVFVTVINHGVQHML  60

Query  547  LPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS  726
            +  + P L+ S +P+   +P LA LLVFRT +SY R ++ R  W   +    D A Q +S
Sbjct  61   VASWVPYLKVSPIPFTFISPVLAFLLVFRTNSSYQRFDEARKVWGSNVNRCRDLARQALS  120

Query  727  GVESKSDKLLKNALLQYIMAFPVALK  804
             +++  D      LL+++ A+P  LK
Sbjct  121  WIKNPEDAARLECLLRFLKAYPYYLK  146



>gb|KFM28033.1| UPF0187 protein, chloroplastic [Auxenochlorella protothecoides]
Length=518

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 117/261 (45%), Gaps = 58/261 (22%)
 Frame = +1

Query  355  RMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAV  534
            R      ++ H DW +HR   R+ RHL     SR+  SL+PP+ A T ++ +V  Y + +
Sbjct  54   RRNSGHRVFTHADWAVHRKPSRYARHLALIFASRIFRSLIPPITAVTLISTLVGVYETLL  113

Query  535  SLHWLPEFFP-VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFA  711
              H LP  +P V  A    +QLTA AL+LLLVFRT ++Y R  + R+ W  +     DF 
Sbjct  114  KEHRLPAQWPHVTLALGQGFQLTAFALSLLLVFRTNSAYGRWWEARMLWGSLTNRTRDFV  173

Query  712  VQVISGVESKSDKLLKNALLQYIMAFPVALK---------ESKIS---------------  819
             Q ++     + +L + A+L + +A P  +K         ES++                
Sbjct  174  RQCLAFFPEDAKRLREAAVL-WTIALPYVVKAHLREGNRLESELEGILTRDEVDALTGAT  232

Query  820  ---CF-----------------------------HEGISACEQLIGIPIPLSYTRLTSRF  903
               CF                              + I  CE+++  PIP SYTR TSRF
Sbjct  233  HRPCFVLAALSQVVAAAGLDPQLRQRLDTNLTAFEDCIGGCERILRTPIPQSYTRHTSRF  292

Query  904  LVLWHLTLPIILWDDCHWIVV  966
            L++W + +P  LW    W+ +
Sbjct  293  LMIWLIMMPFTLWAAYSWVSI  313



>ref|XP_005848889.1| hypothetical protein CHLNCDRAFT_21860, partial [Chlorella variabilis]
 gb|EFN56787.1| hypothetical protein CHLNCDRAFT_21860, partial [Chlorella variabilis]
Length=318

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 102/244 (42%), Gaps = 60/244 (25%)
 Frame = +1

Query  457   VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFP-VLRASSLPYQLTAPALALLLVFR  633
             V   L+ PV+A  ++A+ V  Y + V    LP  +P V  A    + LTA AL+LLLVFR
Sbjct  28    VFRQLLGPVLAVMTIALAVGVYETLVGAGALPGHWPHVTLALGQGFNLTAFALSLLLVFR  87

Query  634   TEASYSRLEQGRLAWTKVIAGASDFAVQVI-SGVE--SKSDKLLKNALLQYIMAFPVAL-  801
             T +SY R  + R  W  V+    D   QV   G+      D  LK  L ++ MAFP  L 
Sbjct  88    TNSSYDRWWEARKLWGGVVNRCRDIVRQVGPQGLVFFRDEDAHLKELLARWTMAFPRVLM  147

Query  802   -------------------KESKISC----------------------------------  822
                                 E  + C                                  
Sbjct  148   CHLREDMDVGKEVAHILTAHEVAVMCAAAHRPNFVLQVMAETVRAARPNELCRMRMDDNL  207

Query  823   --FHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASL  996
               F + + +CE+++  PIPLSYTR TSRFL++W + LP  LW    W  +  + I A  +
Sbjct  208   TFFEDAMGSCERILRTPIPLSYTRHTSRFLLVWLILLPFTLWAAYSWFSILLSGIFAFLM  267

Query  997   FCIE  1008
             F I+
Sbjct  268   FGID  271



>ref|XP_001702034.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO97309.1| predicted protein [Chlamydomonas reinhardtii]
Length=414

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 125/280 (45%), Gaps = 56/280 (20%)
 Frame = +1

Query  337   DAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVA  516
             D  +E     +R  +  +DW  HRSS R+L HL T   S ++  +  PV   T    +VA
Sbjct  79    DHYKEGSRHARRMTFTFDDWKRHRSSNRYLYHLKTLTESGIVRGIWAPVAWVTLFTAVVA  138

Query  517   SYNSAVSLHWLPEFFPVLRASSL-PYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIA  693
             + N A     LP + P +   ++ P QLT+ AL+LLLVFRT ASYSR ++GR ++  +  
Sbjct  139   TLNVAHGAAMLPPWVPAMPQIAIEPVQLTSIALSLLLVFRTNASYSRWDEGRRSFGSITT  198

Query  694   GASDFAVQVIS--------------------------------GVESKSDKLLKNALLQY  777
              + D A Q  +                                 +E +  ++LK A +Q 
Sbjct  199   VSRDIARQAFAWFRPDDYESRVRVGRWLVALGRSTMVHLREEHDMEDELREVLKPAEVQA  258

Query  778   IM--------------------AFPVAL---KESKISCFHEGISACEQLIGIPIPLSYTR  888
             ++                      P  L    +  +S   + +SACE+++  PIPLSYTR
Sbjct  259   VVSAVHAPSFCLQMITLIIRTAGLPQELVIRMDENVSRLTDAVSACERILNTPIPLSYTR  318

Query  889   LTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
              T+RFL+ W   LP  LW  C   +VP   + A  L  IE
Sbjct  319   HTARFLMAWLACLPFCLWTYCGPAMVPIAALVAFVLLGIE  358



>ref|XP_005848510.1| hypothetical protein CHLNCDRAFT_144992 [Chlorella variabilis]
 gb|EFN56408.1| hypothetical protein CHLNCDRAFT_144992 [Chlorella variabilis]
Length=1770

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 128/249 (51%), Gaps = 28/249 (11%)
 Frame = +1

Query  331   WADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAII  510
             ++DA +E + +  R ++ +E W +HRSS R++RH+    +SR++  LV P+     V+  
Sbjct  1484  FSDAWKEAQRKDMRQVFDYERWKMHRSSGRYMRHVAGLADSRIVGGLVKPLAYVAVVSCG  1543

Query  511   VASYNSAVSLHWLPEFFPVLR-ASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKV  687
             V +YN  V    LP  +P+L  A++ P+ LT+ AL+LLLVFR +A    + +G     ++
Sbjct  1544  VMAYNLLVEAGKLP-LWPILNVAANAPFGLTSFALSLLLVFR-KALMCHIREGESLQEEL  1601

Query  688   IAGASDFAVQVISGVESKSDK----------LLKNALL------------QYIMAFPVAL  801
                 S    + ++G+   + +          LL+ A L            +Y  +     
Sbjct  1602  ---RSTLKPEELAGLLGATHRPLYVCQQLTNLLRAAQLAANKARSGEWGGEYAASMAAFR  1658

Query  802   KESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFI  981
              +  +  F +   ACE+L+  PIPLSYTR TSRF+++W   LP  LW  C W ++P T +
Sbjct  1659  MDEGVGTFTDVAGACERLLRTPIPLSYTRHTSRFMMIWLTLLPFTLWTACRWAMLPITLL  1718

Query  982   SAASLFCIE  1008
              A  L  IE
Sbjct  1719  VAFLLLGIE  1727



>ref|XP_006574293.1| PREDICTED: UPF0187 protein At2g45870, chloroplastic-like [Glycine 
max]
Length=168

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +1

Query  310  ILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIA  489
            +LR IPDWA+A+QE  MQ+KRALY H++W  H SSLRHLRH+ +SL+SRVILSLVPPV+ 
Sbjct  66   LLRSIPDWANAVQECDMQKKRALYTHQNWRDHCSSLRHLRHVFSSLSSRVILSLVPPVLF  125

Query  490  FTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQL  597
            FT+ A  + +YN A+ LH LP+F P+LRASSLPYQL
Sbjct  126  FTAFAAAIVAYNEALLLHLLPDFLPLLRASSLPYQL  161



>ref|XP_001697952.1| hypothetical protein CHLREDRAFT_105828 [Chlamydomonas reinhardtii]
 gb|EDO99835.1| predicted protein [Chlamydomonas reinhardtii]
Length=302

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 105/242 (43%), Gaps = 58/242 (24%)
 Frame = +1

Query  457   VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVL--RASSLPY-QLTAPALALLLV  627
             ++ + +P +   T VA +VASY  +   H LP+ FP +   AS   +   T+ AL+LLLV
Sbjct  28    ILQNALPAISWVTLVATLVASYGYSYDQHMLPDVFPSISPNASCTAFISNTSVALSLLLV  87

Query  628   FRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS---------------------------  726
             FRT +SY R ++ R  W  ++  + D   Q  +                           
Sbjct  88    FRTNSSYGRWDEARKMWGGLLNRSRDIMRQGATCFPDDQVEAKKALARWTVAFSRALRIH  147

Query  727   -----GVESKSDKLLK------------------NALLQYIMAFPVA-----LKESKISC  822
                   +ES+   +L                   +A+ Q I + P++        + ++ 
Sbjct  148   FQPEVTIESELQNILTPAELQMLAKSQHRPVRAIHAISQIIQSVPMSSIHQQQMSNNLTF  207

Query  823   FHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFC  1002
             FH+ +  CE+L+  PIP+SYTR T+RFL  W   LP  L+    W VVP     AA L  
Sbjct  208   FHDVLGGCERLLRAPIPVSYTRHTARFLFAWLTLLPFALYPTTGWGVVPVCTGIAAVLCG  267

Query  1003  IE  1008
             IE
Sbjct  268   IE  269



>ref|XP_002957909.1| hypothetical protein VOLCADRAFT_121660 [Volvox carteri f. nagariensis]
 gb|EFJ41045.1| hypothetical protein VOLCADRAFT_121660 [Volvox carteri f. nagariensis]
Length=446

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 106/242 (44%), Gaps = 58/242 (24%)
 Frame = +1

Query  457   VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR---ASSLPYQLTAPALALLLV  627
             ++ + +P +   T VA +VA+Y ++   H LP+ FP +    + S     T+ AL+LLLV
Sbjct  100   ILQNALPAISWVTLVATMVAAYGTSYDQHLLPDGFPSISPNASCSAFVSNTSVALSLLLV  159

Query  628   FRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS-----GVESKS----------------  744
             FRT +SY R ++ R  W  ++  + D   Q  +      VE+K                 
Sbjct  160   FRTNSSYGRWDEARKMWGGLLNRSRDIMRQGATCFPDDQVEAKKALARWVVAFARALRIH  219

Query  745   -------DKLLKN----------------------ALLQYIMAFPVA-----LKESKISC  822
                    +  LKN                      A+ Q I + P++        + ++ 
Sbjct  220   FQPEVTIESELKNILTPAELEMLAKSQHRPVRAIHAISQIIQSVPMSSIHQMQMSNNLTF  279

Query  823   FHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFC  1002
             FH+ +  CE+L+  PIP+SYTR T+RFL  W   LP  L+    W VVP     AA L  
Sbjct  280   FHDVLGGCERLLRAPIPVSYTRHTARFLFAWLTLLPFALYPSAGWGVVPVCTGIAAVLCG  339

Query  1003  IE  1008
             IE
Sbjct  340   IE  341



>ref|XP_002950724.1| hypothetical protein VOLCADRAFT_104839 [Volvox carteri f. nagariensis]
 gb|EFJ48039.1| hypothetical protein VOLCADRAFT_104839 [Volvox carteri f. nagariensis]
Length=403

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 106/242 (44%), Gaps = 58/242 (24%)
 Frame = +1

Query  457   VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR---ASSLPYQLTAPALALLLV  627
             VI + +P ++    V+  +A+Y +A   H LPE FP L    + S     T+ AL+LLLV
Sbjct  106   VIQNALPSILWVGIVSSALAAYMTAHDQHILPEGFPSLSPNASCSAFISNTSVALSLLLV  165

Query  628   FRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS-----GVESKS----------------  744
             FRT +SY R ++ R  W  ++  + D   Q  +      VE+K                 
Sbjct  166   FRTNSSYGRWDEARKMWGGLLNRSRDIMRQGATCFPDDQVEAKKALARWVVAFARALRIH  225

Query  745   -------DKLLKN----------------------ALLQYIMAFPVA-----LKESKISC  822
                    +  LKN                      A+ Q I + P++        + ++ 
Sbjct  226   FQPEVSIESELKNILTPAELEMLAKSQHRPVRAIHAISQIIQSVPMSSIHQMQMSNNLTF  285

Query  823   FHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFC  1002
             FH+ +  CE+L+  PIP+SYTR T+RFL +W   LP  L+  C   VVP     AA L  
Sbjct  286   FHDVLGGCERLLRAPIPVSYTRHTARFLFMWLTLLPFALYGQCGLGVVPVCTGIAAVLCG  345

Query  1003  IE  1008
             IE
Sbjct  346   IE  347



>ref|XP_003059798.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55750.1| predicted protein [Micromonas pusilla CCMP1545]
Length=403

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 86/312 (28%), Positives = 136/312 (44%), Gaps = 81/312 (26%)
 Frame = +1

Query  313   LRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAF  492
             LR+  D      E   + +R +Y+H+DW+ HRSS R   +L  +L S V+ SL+  V A 
Sbjct  52    LRIDTDGDLPYSEASRRYRRTVYRHDDWLTHRSSTRLFGNLSGTLTSGVVRSLLTEVAAV  111

Query  493   TSVAIIVASYNSAVS-------------LHWLPEFFPVLRASSLPYQLTAPALALLLVFR  633
              ++A    ++N+++                 LP F  +++  +LP+ L +PAL LLLVFR
Sbjct  112   ATIATFTCAWNASLLGPVDFRDVARDPLFPTLPRFL-LMQLPALPFTLASPALGLLLVFR  170

Query  634   TEASYSRLEQGRLAWTKV-----------------------IAGASDFAVQV--------  720
             T ASY+R  + R+AW +V                       +AG+ +   +         
Sbjct  171   TNASYARWVESRVAWGRVVSHCRNVMRQSSLWLNVDREPFVVAGSPELRGKAWAFPRCLA  230

Query  721   --ISGVESK---------------SDKLLKN--------ALLQYIMA-FPVALK-----E  807
               +SG E +               + +LL          A L Y M   P+  K     +
Sbjct  231   SHVSGPEDEVALARELRLRLGEKDAARLLTAPNRPLQALADLSYCMNNLPIDEKRRVEMD  290

Query  808   SKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDD-----CHWIVVPA  972
               I    + +  CE++   P+PL YTR T+RFL  W L LP+ LW+       H  ++P+
Sbjct  291   KSIILLGDALETCERIFTSPVPLVYTRHTARFLSFWLLLLPLALWEPFGSSWNHVAMIPS  350

Query  973   TFISAASLFCIE  1008
               + A   F IE
Sbjct  351   ATLVAIFFFGIE  362



>ref|XP_005845811.1| hypothetical protein CHLNCDRAFT_58489 [Chlorella variabilis]
 gb|EFN53709.1| hypothetical protein CHLNCDRAFT_58489 [Chlorella variabilis]
Length=444

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             +  ++ + +    CE+++  P+PLSYTR TSRF+++W   LP  LWD+C W ++P TFI 
Sbjct  299   DENLTVYSDVTGGCERILRTPVPLSYTRHTSRFMMIWLTLLPFTLWDNCGWAMLPITFIV  358

Query  985   AASLFCIE  1008
             +  L  IE
Sbjct  359   SFLLLGIE  366


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 92/159 (58%), Gaps = 2/159 (1%)
 Frame = +1

Query  325  PDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVA  504
            P + D  +E   Q +R ++  E W  HRSS R+LRH+L   +S+++  L  P+    ++A
Sbjct  71   PYFTDEWKEYNRQFQRPVFDFERWKTHRSSSRYLRHVLGMGDSKIVQGLAKPLAYVMTLA  130

Query  505  IIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTK  684
              VA Y++     +L +  P L+A++ P+ LT+ AL+LLLVFRT  SY R ++ R  W  
Sbjct  131  TGVALYHTLAEAGYLTDV-PDLKATNAPFGLTSFALSLLLVFRTNTSYQRWDEARKMWGS  189

Query  685  VIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVAL  801
            ++  + DF  Q + G    S   L++ L+++ +A+P AL
Sbjct  190  MVNRSRDFTRQAL-GYVPYSQPELRSMLVRWSIAYPRAL  227



>ref|XP_005845925.1| hypothetical protein CHLNCDRAFT_32075 [Chlorella variabilis]
 gb|EFN53823.1| hypothetical protein CHLNCDRAFT_32075 [Chlorella variabilis]
Length=433

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             +  ++ + +    CE+++  P+PLSYTR TSRF+++W   LP  LWD+C W ++P TFI 
Sbjct  298   DENLTVYSDVTGGCERILRTPVPLSYTRHTSRFMMIWLTLLPFTLWDNCGWAMLPITFIV  357

Query  985   AASLFCIE  1008
             +  L  IE
Sbjct  358   SFLLLGIE  365


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +1

Query  214  SSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHED  393
            +S+  + + R +  +S +   P     S+         DW    +E   + +R ++  E 
Sbjct  46   TSRCSRAALRTLAVASTDKTEPEHPYFSD---------DW----KEYNRRFQRPVFDFER  92

Query  394  WVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR  573
            W  HRSS R+LRH+L   +S+++  L  P+    ++A  VA Y++     +L +  P L+
Sbjct  93   WKTHRSSSRYLRHVLGIFDSKIVQGLAKPLAYVMTLATGVALYHTLAEAGYLTDV-PDLK  151

Query  574  ASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKL  753
            A++ P+ LT+ AL+LLLVFRT  SY R ++ R  W  ++  + DF  Q + G   +S   
Sbjct  152  ATNAPFGLTSFALSLLLVFRTNTSYQRWDEARKMWGSMVNRSRDFTRQAL-GYVPESQPE  210

Query  754  LKNALLQYIMAFPVAL  801
            L++ L+++ +A+P AL
Sbjct  211  LRSMLVRWSIAYPRAL  226



>ref|WP_011553749.1| membrane protein [Myxococcus xanthus]
 ref|YP_631918.1| hypothetical protein MXAN_3733 [Myxococcus xanthus DK 1622]
 gb|ABF89654.1| hypothetical protein MXAN_3733 [Myxococcus xanthus DK 1622]
Length=326

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/240 (26%), Positives = 94/240 (39%), Gaps = 66/240 (28%)
 Frame = +1

Query  466   SLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
             S+V  ++A   + ++ A   +AV  H  P   P     +  + L   +L+LLLVFRT AS
Sbjct  37    SMVREIVARVLICVLWAVGVTAVHHHTKPLDIP-----ATVHTLAGISLSLLLVFRTNAS  91

Query  646   YSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVA---------  798
             Y R  +GR  W  ++    + A    S V  + D  L   L+++I AFP A         
Sbjct  92    YDRFWEGRKLWGGIVNETRNLARA--SSVFMRRDAGLYGTLVRWISAFPYAAAASLRGER  149

Query  799   ----------------------------------LKESKISCFH----------------  828
                                               L E ++  ++                
Sbjct  150   DLGPVASELPRDEADAVLGSQHVPLAVSQKMSAVLDEGRLRGYYPEHVQMQLDQNVQLLI  209

Query  829   EGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             + I  CE++   P+P +Y     R L+++  TLP  L D   WI VPATF+ A   F IE
Sbjct  210   DYIGGCERIHKTPMPFAYMMHLRRALMVYCYTLPFALVDSFGWITVPATFVVAYVFFGIE  269



>ref|XP_002945729.1| hypothetical protein VOLCADRAFT_85997 [Volvox carteri f. nagariensis]
 gb|EFJ52724.1| hypothetical protein VOLCADRAFT_85997 [Volvox carteri f. nagariensis]
Length=398

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 69/231 (30%), Positives = 103/231 (45%), Gaps = 61/231 (26%)
 Frame = +1

Query  499   VAIIVASYNSAVSLHWLPEFFPVLRASS-LPYQLTAPALALLLVFRTEASYSRLEQGRLA  675
              A+ VASY +A+    LP + P    SS  P+QLT+ AL+L+LVFRT +SY+R    R  
Sbjct  128   AAMTVASYETALQTGLLPRWLPDFGGSSDTPFQLTSFALSLMLVFRTNSSYARWLDARQQ  187

Query  676   WTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAF----PVALKESK----------  813
             W  ++  A  F  QV++ +   S   +++AL ++ +AF     + L+E            
Sbjct  188   WGLIVNTARTFVRQVMTTLPETSCCEVRSALARWTVAFVRLGKLHLREHGDVGAEVQGLL  247

Query  814   --------ISCFHEGISAC--------------------------------------EQL  855
                     ++  H  ++AC                                      E++
Sbjct  248   DGEEVPLVLAASHRPLAACHVMSGLLRSAEGSGQLSEQARMRLEADINLMSQALGACEKI  307

Query  856   IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             +  PIPLSYTR TSRFL+LW L LP+ LW    W VVP   +    L  I+
Sbjct  308   LRNPIPLSYTRHTSRFLILWLLWLPLALWGKVGWCVVPVEAVMTYLLLGID  358



>ref|XP_005845524.1| hypothetical protein CHLNCDRAFT_136634 [Chlorella variabilis]
 gb|EFN53422.1| hypothetical protein CHLNCDRAFT_136634 [Chlorella variabilis]
Length=451

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             +  ++   + + ACE+++  PIPLSYTR TSRF+++W   LP  LWD+C W  VP   I 
Sbjct  305   DENLTAMEDILGACERILRAPIPLSYTRHTSRFMMIWLTLLPFSLWDNCGWASVPLCGII  364

Query  985   AASLFCIE  1008
             A  L  IE
Sbjct  365   AFLLLGIE  372


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 85/156 (54%), Gaps = 4/156 (3%)
 Frame = +1

Query  337  DAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVA  516
            D I+E   + +R +Y  E+W  HRS+ R++RH    L SR+   L  P++   +V+  VA
Sbjct  71   DPIKEGSRKYRRTVYDFENWRQHRSTKRYMRHAKGLLGSRIFRGLASPLLYILAVSASVA  130

Query  517  SYNSAVSLHWLPEFFPVLRASS-LPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIA  693
             +N+ V     P+  P L  S+  P+ LT+ AL+LLLV  T ASY+R    R AW  ++ 
Sbjct  131  VWNTLVETGLAPDVLPELHMSNNGPFGLTSFALSLLLV--TNASYARWLDARKAWGMLVN  188

Query  694  GASDFAVQVISGVESKSDKLLKNALLQYIMAFPVAL  801
             + D   Q ++   + +D+ L + L ++  A+  AL
Sbjct  189  RSRDITRQALTCFPA-ADRPLLDMLCRWTAAYSRAL  223



>ref|XP_005843048.1| hypothetical protein CHLNCDRAFT_141619 [Chlorella variabilis]
 gb|EFN50946.1| hypothetical protein CHLNCDRAFT_141619 [Chlorella variabilis]
Length=456

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 49/97 (51%), Gaps = 0/97 (0%)
 Frame = +1

Query  718   VISGVESKSDKLLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTS  897
             +I   +    K+  N     + A      +  ++ + +    CE+++  P+PLSY+R  S
Sbjct  253   IIRAAQLPGGKVDMNDSFANVKASAAFRMDENLTQYADVTGGCERILRTPVPLSYSRHNS  312

Query  898   RFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             RFL++W   LP  LWD CHW  +P T + A  L  I+
Sbjct  313   RFLIIWLTLLPFTLWDQCHWFTLPVTGLVAFLLLGIK  349



>ref|XP_005849094.1| hypothetical protein CHLNCDRAFT_143620 [Chlorella variabilis]
 gb|EFN56992.1| hypothetical protein CHLNCDRAFT_143620 [Chlorella variabilis]
Length=480

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             +  ++ F +    CE+L+  PIPL+YTR TSRF++ W   LP  LWD C W ++P   I 
Sbjct  329   DENLTVFEDVTGGCERLLRTPIPLAYTRHTSRFMMAWLTILPFALWDTCGWAMLPVMAIV  388

Query  985   AASLFCIE  1008
             A  L  IE
Sbjct  389   AFVLLGIE  396


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 101/201 (50%), Gaps = 14/201 (7%)
 Frame = +1

Query  292  ISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSL  471
            +  +PW        +D  +E   +Q R  +  E W  HRSS R  RH+     S     L
Sbjct  96   LQRYPWH-------SDEWKEEYRKQVRVTFDFERWRTHRSSSRFWRHMAGLAQSNTAQGL  148

Query  472  VPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR-ASSLPYQLTAPALALLLVFRTEASY  648
              P+    +V++ VA+Y+ A +  WLP  +PVL+ A++ P+ LT+ AL+LLLVFRT +SY
Sbjct  149  AQPLAYVMAVSLGVAAYHVAAAAGWLP-LWPVLKLAANAPFGLTSFALSLLLVFRTNSSY  207

Query  649  SRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALKESKISCFH  828
             R ++ R  W  V+  + D   Q +  + +   + L++ L ++++A+   L    +    
Sbjct  208  GRWDEARKMWGLVVNRSRDLTRQALGYIPAHQAE-LQSMLCRWVVAYSRCL----MCHLR  262

Query  829  EGISACEQLIGIPIPLSYTRL  891
            EG     +L G+ +P     L
Sbjct  263  EGEDLEAELRGVLLPEEVAEL  283



>ref|XP_002953907.1| hypothetical protein VOLCADRAFT_106175 [Volvox carteri f. nagariensis]
 gb|EFJ44936.1| hypothetical protein VOLCADRAFT_106175 [Volvox carteri f. nagariensis]
Length=472

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  823   FHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFC  1002
             F+E    CE+++  PIPL+YTR TSRF++++   LP+ L+D C W VVP T + A  L  
Sbjct  249   FNEAACECEKILRFPIPLTYTRHTSRFMLIYLTALPLALYDSCDWAVVPVTLVIAFLLLG  308

Query  1003  IE  1008
             IE
Sbjct  309   IE  310



>ref|XP_002956818.1| hypothetical protein VOLCADRAFT_97891 [Volvox carteri f. nagariensis]
 gb|EFJ42121.1| hypothetical protein VOLCADRAFT_97891 [Volvox carteri f. nagariensis]
Length=389

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 76/183 (42%), Gaps = 55/183 (30%)
 Frame = +1

Query  625   VFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS--------------------------  726
             VFRT ASYSR ++GR ++  +   + D A Q  +                          
Sbjct  153   VFRTNASYSRWDEGRRSFGSITTVSRDIARQAFAWFRTDDMTNRSRLGRWLVALGRVTMV  212

Query  727   ------GVESKSDKLLK----NALLQYIMAFPVALK-------------------ESKIS  819
                   G++ +   +LK    +A+   I A    L+                   +  +S
Sbjct  213   HLREEHGMQEELKGVLKPQEIDAVTSSIHAPSFCLQMITWTIRTAGLPQELVIRMDENVS  272

Query  820   CFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLF  999
                + +SACE+++  PIPLSYTR T+RFL+ W + LP  LW  C   +VP   + A  L 
Sbjct  273   RLTDAVSACERILNTPIPLSYTRHTARFLMAWLVCLPFCLWSYCGLAMVPIAALVAFVLL  332

Query  1000  CIE  1008
              IE
Sbjct  333   GIE  335



>ref|XP_005784966.1| hypothetical protein EMIHUDRAFT_122975 [Emiliania huxleyi CCMP1516]
 gb|EOD32537.1| hypothetical protein EMIHUDRAFT_122975 [Emiliania huxleyi CCMP1516]
Length=297

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 14/144 (10%)
 Frame = +1

Query  349  ENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNS  528
            E   + +R +Y+HEDW+ HRS  R LR+L  +  S V+ SL+  VIA T VA++V  +N+
Sbjct  51   EESRRYRRTIYRHEDWLRHRSETRLLRNLQGTFTSGVVRSLLSEVIAVTLVALLVIVWNA  110

Query  529  AV-------SLHWLPEFF----PVLRASSLP---YQLTAPALALLLVFRTEASYSRLEQG  666
            A+       +    P  F    P    + LP   + L++PAL LLLVFRT  SY R  + 
Sbjct  111  ALFGYDSLGTTTTQPGLFGEEVPAFLRAQLPVSIFTLSSPALGLLLVFRTNTSYQRWLEA  170

Query  667  RLAWTKVIAGASDFAVQVISGVES  738
            R AW ++++   +   Q    +E 
Sbjct  171  RQAWGRIVSHCRNIMRQATLWIEE  194



>ref|XP_005758002.1| hypothetical protein EMIHUDRAFT_107237 [Emiliania huxleyi CCMP1516]
 gb|EOD05573.1| hypothetical protein EMIHUDRAFT_107237 [Emiliania huxleyi CCMP1516]
Length=369

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  811   KISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
             ++    + + +CE L+  P+PLSY+R TSRFL +W  TLP++L D   W+ VPA    + 
Sbjct  247   RVGSLVDALGSCESLLTTPVPLSYSRHTSRFLTIWCGTLPVVLVDALGWMTVPAVAFVSW  306

Query  991   SLFCIE  1008
              LF IE
Sbjct  307   CLFGIE  312



>ref|XP_005760402.1| hypothetical protein EMIHUDRAFT_218002 [Emiliania huxleyi CCMP1516]
 gb|EOD07973.1| hypothetical protein EMIHUDRAFT_218002 [Emiliania huxleyi CCMP1516]
Length=353

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 87/207 (42%), Gaps = 51/207 (25%)
 Frame = +1

Query  532   VSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFA  711
             V LH     FP    S++P+ L    L+LLL FRT  +Y+R   GRL W  V    SD A
Sbjct  93    VLLHRHGLRFPT--GSAMPHTLLGGFLSLLLAFRTNMAYNRFYAGRLNWGVVKNSCSDLA  150

Query  712   VQVISGVESKSDKLLKNALLQYIMAF---------------------------------P  792
             +  ++ V  +S  L +  LL  + +F                                 P
Sbjct  151   LYAVTHVRPRSPALAER-LLALVASFPPALACRCCCDESSAKLPLSQRQALSGAMETAAP  209

Query  793   VALKE------------SKISCFHEGISA---CEQLIGIPIPLSYTRLTSRFLVLWHLTL  927
              AL +            S  +     + A    + L+  P+PLSY+R TSRFL +W  TL
Sbjct  210   HALADVSRRGRLVPHASSAAAVVETQVEAEMLMQSLLTTPVPLSYSRHTSRFLTIWCGTL  269

Query  928   PIILWDDCHWIVVPATFISAASLFCIE  1008
             P++L D   W+ VPA    +  LF IE
Sbjct  270   PVVLVDALGWMTVPAVAFVSWCLFGIE  296



>ref|XP_005756210.1| hypothetical protein EMIHUDRAFT_221952 [Emiliania huxleyi CCMP1516]
 gb|EOD03781.1| hypothetical protein EMIHUDRAFT_221952 [Emiliania huxleyi CCMP1516]
Length=609

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 73/129 (57%), Gaps = 14/129 (11%)
 Frame = +1

Query  349  ENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNS  528
            E   + +R +Y+HEDW+ HRS  R LR+L  +  S V+ SL+  VIA T VA++V  +N+
Sbjct  23   EESRRYRRTIYRHEDWLRHRSETRLLRNLQGTFTSGVVRSLLSEVIAVTLVALLVIVWNA  82

Query  529  AV-------SLHWLPEFF----PVLRASSLP---YQLTAPALALLLVFRTEASYSRLEQG  666
            A+       +    P  F    P    + LP   + L++PAL LLLVFRT  SY R  + 
Sbjct  83   ALFGYDSLGTTTTQPGLFGEEVPAFLRAQLPVSIFTLSSPALGLLLVFRTNTSYQRWLEA  142

Query  667  RLAWTKVIA  693
            R AW ++++
Sbjct  143  RQAWGRIVS  151



>ref|XP_002500465.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61723.1| predicted protein [Micromonas sp. RCC299]
Length=454

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  838  SACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATF  978
               E++I  PIPLSYTR TSR L++W LTLP  LW+  HW  VPA F
Sbjct  355  GGAERIISTPIPLSYTRHTSRSLMIWLLTLPFALWETFHWATVPAVF  401



>ref|XP_002180945.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47597.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=380

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 78/302 (26%), Positives = 126/302 (42%), Gaps = 83/302 (27%)
 Frame = +1

Query  349   ENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTS-VAIIVASYN  525
             E+  Q +R +Y H+DW+ HR+S + +   L  +    I+  +   ++  + +A +V  +N
Sbjct  14    ESSRQYRRTVYTHDDWIAHRNSEQRVYENLQGIFFSGIVRQLKSEVSLVALMATLVVLWN  73

Query  526   SAV------SLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS----------YSRL  657
                      S  W     P+L   +LP+ L++PAL LLLVF+T  S          +S+L
Sbjct  74    GLAVPFLQSSTVWTTSV-PMLMVPALPFTLSSPALGLLLVFKTNTSYARWYEARGTWSKL  132

Query  658   EQGRLAWTKVIAGASDFA-------VQVIS---------------GVESKSDKLLKNA--  765
                 L   ++ +   D A       VQ ++               GV S      K+   
Sbjct  133   TSQSLNLVRMASTFCDMADPVTQTKVQRLATAAWLVCRSVMNELWGVASDEGAYRKDVEQ  192

Query  766   --------LLQYIMAFP----VALKESKISC-------------------FHEGISACEQ  852
                       +++ A P    +AL E+ ++                      +GIS C++
Sbjct  193   AFASDSRLAQRFVDAGPNRVTIALAEASLALDAIPIDEKRRVEMDKSLVLMGDGISVCQR  252

Query  853   LIGIPIPLSYTRLTSRFLVLWHLTLPIILWD---DCHWI-------VVPATFISAASLFC  1002
             +   P+PL YTR TSRFL LW L LP  L++      WI       ++PA  + A  LF 
Sbjct  253   VFASPVPLVYTRHTSRFLSLWMLLLPGALYETFASSSWIPVLPGLGLIPAVSVVALFLFG  312

Query  1003  IE  1008
             IE
Sbjct  313   IE  314



>ref|WP_025646953.1| MULTISPECIES: hypothetical protein [Psychrobacter]
Length=308

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (56%), Gaps = 5/115 (4%)
 Frame = +1

Query  466  SLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
            S++P +     +  ++++  SAV  HW+P  FP   A+  P+ L   AL+L L FR  AS
Sbjct  19   SVIPHIYLQVLLITLLSAVISAVQ-HWIPGSFPSYGAA--PFTLLGIALSLFLGFRNNAS  75

Query  646  YSRLEQGRLAWTKVIAGASDFAVQVISGVESKSD--KLLKNALLQYIMAFPVALK  804
            Y R  +GR  W +++  A  F  QV+S ++  +D  +  + +++Q  +AF  AL+
Sbjct  76   YQRWWEGRCLWGQLVYDARSFTRQVLSFIDDDTDSGQRAQRSMVQLTIAFTHALR  130



>ref|XP_005849238.1| hypothetical protein CHLNCDRAFT_34835 [Chlorella variabilis]
 gb|EFN57136.1| hypothetical protein CHLNCDRAFT_34835 [Chlorella variabilis]
Length=503

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  838   SACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
               CE+++  PIPLSYTR TSRF+++W   +P  LWD   W +VP     A  L  IE
Sbjct  340   GGCERILRTPIPLSYTRHTSRFMMIWLTVMPFTLWDAAGWAMVPLAMTVAFLLLGIE  396


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 68/134 (51%), Gaps = 6/134 (4%)
 Frame = +1

Query  334  ADAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIV  513
             D  +E   +  R ++  + W  HRS  R++RH   +  SR+   L  P++  T ++I V
Sbjct  114  GDEFKEADRKNLRTVFDFDRWKKHRSGSRYMRHARATFTSRITQGLAAPLLYVTGLSIAV  173

Query  514  ASYNSAVSLHWLPEF-----FPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAW  678
            AS+++A  + W          P L+  +  + LT+ AL+LLL +RT A Y R ++ R  W
Sbjct  174  ASWHTAAEVRWAGPMGILSPIPELKIDTT-FSLTSFALSLLLAYRTNAGYGRWDEARKMW  232

Query  679  TKVIAGASDFAVQV  720
              V+  + D   QV
Sbjct  233  GLVVNRSRDMTRQV  246



>ref|XP_005834010.1| hypothetical protein GUITHDRAFT_52696, partial [Guillardia theta 
CCMP2712]
 gb|EKX47030.1| hypothetical protein GUITHDRAFT_52696, partial [Guillardia theta 
CCMP2712]
Length=193

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 78/187 (42%), Gaps = 58/187 (31%)
 Frame = +1

Query  610   LALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAF  789
             L+LLLVFRT ++Y R  + R  W+++I+   + +    S +        +  LLQ + A+
Sbjct  1     LSLLLVFRTNSAYDRFWEARKIWSEMISAVRELSCIAHSSMRGWD----REHLLQLLAAY  56

Query  790   PV-------------------ALKE-----------------------------------  807
             PV                   ALKE                                   
Sbjct  57    PVILLHHLRSGRAQGSKSQKEALKEILSEQDVELIWTSRHRPLAIAVAVADVKQSRGHAE  116

Query  808   SKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISA  987
             + +S     I+  E+++   +PLSY+R TSRFL +W  TLP++L      +++PA  I  
Sbjct  117   NMVSRLIATIANAERIVKTAVPLSYSRHTSRFLSVWCFTLPLVLVHSMKILMIPAVAIIC  176

Query  988   ASLFCIE  1008
              +LF IE
Sbjct  177   WALFAIE  183



>ref|XP_001689657.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09395.1| predicted protein [Chlamydomonas reinhardtii]
Length=408

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  811  KISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVP  969
             ++ F +    CE+++  PIPL+YTR TSRF++L+   LP+ L+D C W  +P
Sbjct  193  DLASFAQAAGQCEKILRFPIPLTYTRHTSRFMLLYLAALPVALYDSCDWATIP  245


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  466  SLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
            +L  P+   + ++ +V  Y + V +  +P++F  +  +  P+QLT+ AL+LLLVFRT+AS
Sbjct  17   NLQAPLSMLSFISCMVVLYRTFVEMEMIPDYFEGVSFTDTPFQLTSFALSLLLVFRTDAS  76

Query  646  YSRLEQGRLAWTKV  687
            YSR      AW+++
Sbjct  77   YSRWCAAMDAWSEL  90



>ref|XP_002180761.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47413.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=519

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 88/363 (24%), Positives = 138/363 (38%), Gaps = 98/363 (27%)
 Frame = +1

Query  163   FSCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADA  342
             F  ++ +K  +F   L SS+    SF         +  P P   S               
Sbjct  18    FLASTANKAAAFQASLVSSRTVSRSFDTAIGPVAKDIEPSPLSYS---------------  62

Query  343   IQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVA------  504
               E     +R  Y H+ W+ HR+  R +  L   L+S V+  L   VI   +VA      
Sbjct  63    --EKSRLYRRDFYDHDSWLKHRAKNRFVGTLSKVLDSGVVRQLADEVILIGAVATFVCVF  120

Query  505   --IIVASYNSAVSLHWLPEF---FPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGR  669
               + V  Y    +LH  P F    P+++    P+ L++PAL+LLLVF+T  SY R ++ R
Sbjct  121   NALCVTGYEDFSNLHHDPIFNFGAPLVKLPGEPFSLSSPALSLLLVFKTNTSYQRWDEAR  180

Query  670   LAWTKVIAGA-------------SDFAVQ-------------------------------  717
              AW  ++  +             SD + +                               
Sbjct  181   KAWGVIVNNSRTVIRETSAWVLQSDLSDEEKYRLIRRVADCVWLFPRSLQRHLLNPAEDE  240

Query  718   --VISGVESKSDKLLKNALLQ---------YIMAFPVA---LKESKISCFHEGIS-----  840
                +  V +K D +L   L+          Y M+  V    L   + S   +G+S     
Sbjct  241   EAYVKDVRAKLDPVLAEDLVSARHRPTRAMYEMSKAVNTLPLDSYQRSTIDQGVSQLCDA  300

Query  841   --ACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDD-----CHWIVVPATFISAASLF  999
                CE++ G P+P  YTR  +RF+ LW   LP+ L+        HW ++P++ I    L 
Sbjct  301   CGGCERIFGSPVPSIYTRHAARFIELWMFFLPLALYSPFSISWNHWFMIPSSMIIGFFLL  360

Query  1000  CIE  1008
              IE
Sbjct  361   GIE  363



>ref|WP_027420594.1| hypothetical protein [Crocinitomix catalasitica]
Length=288

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 68/169 (40%), Gaps = 54/169 (32%)
 Frame = +1

Query  589  YQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDK-LLKNA  765
            Y L    L+LLLVFRT  +Y R  +GR  W +++  +  FA+++ + ++S  DK   K  
Sbjct  60   YSLIGFVLSLLLVFRTNTAYDRWWEGRKKWGELLNNSRSFAIKINAAIDSTEDKTFFKRM  119

Query  766  LLQYIMAFPVALKESK--------------------------------------------  813
            +  Y +A    L+++K                                            
Sbjct  120  ITNYAIALKEHLRDNKSFQLLDLTPEELDKIKSIDHEPNFISNLMYQKLKSIQKRGNLSE  179

Query  814  ---------ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPI  933
                     ++ F + +  CE++   PIP SY+    +F+ ++ +T+P+
Sbjct  180  IDYMILDTNLNSFIDVLGVCERIKNTPIPYSYSNFLKKFIFIYVITIPL  228



>ref|XP_005833734.1| hypothetical protein GUITHDRAFT_107530 [Guillardia theta CCMP2712]
 gb|EKX46754.1| hypothetical protein GUITHDRAFT_107530 [Guillardia theta CCMP2712]
Length=439

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 56/111 (50%), Gaps = 4/111 (4%)
 Frame = +1

Query  676   WTKVIAGASDFAVQVISGVESKSDKLLKNALLQYIMAFPVALKESKISCFHEGISACEQL  855
             +T V A +  F      G   ++    ++ ++Q  +    +  E  ++ F   + ACE++
Sbjct  256   YTDVEAQSKKFG----GGQRGENFTQFESMVVQAALISERSHAEECLTEFSNVMGACERI  311

Query  856   IGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             +   +P SY+R TSRFL +W  TLP++L     W ++P  FI    LF IE
Sbjct  312   VKSSVPTSYSRHTSRFLSIWCFTLPLVLVHSLQWRMIPCVFIMCWMLFVIE  362



>ref|XP_005709103.1| hypothetical protein Gasu_03530 [Galdieria sulphuraria]
 gb|EME32583.1| hypothetical protein Gasu_03530 [Galdieria sulphuraria]
Length=361

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +1

Query  796   ALKESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPAT  975
             A  E ++S   E +S CE++I  P+PL Y+R TSRFL LW  T P+++     ++ VP T
Sbjct  250   AKMEWQLSSLMEVLSGCERIITTPVPLGYSRHTSRFLSLWCFTFPLLVVSHFKFLTVPVT  309

Query  976   FISAASLFCIE  1008
                  SLF IE
Sbjct  310   AFVCWSLFAIE  320



>ref|XP_005763363.1| hypothetical protein EMIHUDRAFT_215245 [Emiliania huxleyi CCMP1516]
 gb|EOD10934.1| hypothetical protein EMIHUDRAFT_215245 [Emiliania huxleyi CCMP1516]
Length=353

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +1

Query  721   ISGVESKSDKLLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTSR  900
             ISGV   SD    +   + +M        S ++     + ACE+L+  P+PL+Y R TSR
Sbjct  205   ISGVSDASDGTFTSR--ERLMGL------SLVNQLGSYVGACERLLQTPVPLNYARHTSR  256

Query  901   FLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             FL LW LTLP+ L      +VVP T      LF I+
Sbjct  257   FLTLWCLTLPVSLVGSMGLLVVPVTAFVTWCLFGIQ  292



>ref|WP_012306097.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001733729.1| hypothetical protein SYNPCC7002_A0465 [Synechococcus sp. PCC 
7002]
 gb|ACA98473.1| Uncharacterised protein family (UPF0187) superfamily [Synechococcus 
sp. PCC 7002]
Length=309

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 98/246 (40%), Gaps = 69/246 (28%)
 Frame = +1

Query  460   ILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR--ASSLPYQLTAPALALLLVFR  633
             +LS++ P I F  +     ++   + L  LP +   L    +++ Y L    L LL+VFR
Sbjct  23    VLSMILPRILFFCILTAALTF---IYLQGLPIYLEKLGDLTTNVIYNLI---LGLLIVFR  76

Query  634   TEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLL--KNALLQYIMAFPVA---  798
             T  SY R  +GR AW  ++    + A +++ G+ + ++K +  K   L  ++AF +A   
Sbjct  77    TNTSYERFWEGRKAWGGIVVNIRNLAQEILIGITTSTEKEIQGKKQALNLLLAFAIATKL  136

Query  799   ----------------------LKESK---------------------------------  813
                                   LK+SK                                 
Sbjct  137   HLRGDQVNDRLEALVEPEQVTQLKDSKNRPLDIQFWLRTYLHQQLKLKNFGDAQLNMTTG  196

Query  814   -ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
              ++   + +S CE+++  PIP++Y     R ++++   LP  L  +  W  +P   + + 
Sbjct  197   MLNNLTDSVSGCERILTTPIPITYRVYLKRLILIYCFGLPFRLVPEMTWWAIPIVAVVSF  256

Query  991   SLFCIE  1008
              L  +E
Sbjct  257   LLLGVE  262



>ref|WP_030007083.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=309

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 98/246 (40%), Gaps = 69/246 (28%)
 Frame = +1

Query  460   ILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR--ASSLPYQLTAPALALLLVFR  633
             +LS++ P I F  +     ++   + L  LP +   L    +++ Y L    L LL+VFR
Sbjct  23    VLSMILPRILFFCILTAALTF---IYLQGLPIYLEKLGDLTTNVIYNLI---LGLLIVFR  76

Query  634   TEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLL--KNALLQYIMAFPVA---  798
             T  SY R  +GR AW  ++    + A +++ G+ + ++K +  K   L  ++AF +A   
Sbjct  77    TNTSYERFWEGRKAWGGIVVNIRNLAQEILIGITTSTEKEIQGKKQALNLLLAFAIATKL  136

Query  799   ----------------------LKESK---------------------------------  813
                                   LK+SK                                 
Sbjct  137   HLRGDQVNDRLEALVEPEQVAQLKDSKNRPLDIQFWLRTYLHQQLKLKNFGDAQLNMTTG  196

Query  814   -ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
              ++   + +S CE+++  PIP++Y     R ++++   LP  L  +  W  +P   + + 
Sbjct  197   MLNNLTDSVSGCERILTTPIPITYRVYLKRLILIYCFGLPFRLVPEMTWWAIPIVAVVSF  256

Query  991   SLFCIE  1008
              L  +E
Sbjct  257   LLLGVE  262



>ref|XP_005773069.1| hypothetical protein EMIHUDRAFT_242012 [Emiliania huxleyi CCMP1516]
 gb|EOD20640.1| hypothetical protein EMIHUDRAFT_242012 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +1

Query  721   ISGVESKSDKLLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTSR  900
             ISGV   SD    +   + +M        S ++     + ACE+L+  P+PL+Y R TSR
Sbjct  311   ISGVSDASDGTFTSR--ERLMGL------SLVNQLGSYVGACERLLQTPVPLNYARHTSR  362

Query  901   FLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             FL LW LTLP+ L      +VVP T      LF I+
Sbjct  363   FLTLWCLTLPVSLVGSMGLLVVPVTAFVTWCLFGIQ  398



>ref|XP_001697963.1| low-CO2-inducible membrane protein [Chlamydomonas reinhardtii]
 gb|EDO99846.1| low-CO2-inducible membrane protein [Chlamydomonas reinhardtii]
Length=250

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +1

Query  760   NALLQYIMAFPVA-----LKESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLT  924
             +A+ Q I + P++        + ++ FH+ +  CE+L+  PIP+SYTR T+RFL  W   
Sbjct  59    HAISQIIQSVPMSSIHQQQMSNNLTFFHDVLGGCERLLRAPIPVSYTRHTARFLFAWLTL  118

Query  925   LPIILWDDCHWIVVPATFISAASLFCIE  1008
             LP  L+  C   V+P     AA L  IE
Sbjct  119   LPFALYGSCGVSVIPVCSGIAAVLCGIE  146



>ref|XP_001697691.1| hypothetical protein CHLREDRAFT_195314 [Chlamydomonas reinhardtii]
 gb|EDO96015.1| predicted protein [Chlamydomonas reinhardtii]
Length=282

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 12/123 (10%)
 Frame = +1

Query  457  VILSLVPPV--IAFTSVAIIVASYNSAVSLHWLPEFFPVLR---ASSLPYQLTAPALALL  621
            VI + +P +  +AFTS    VA+Y      H LPE FP L    A S     T+ AL+LL
Sbjct  130  VIQNALPSIMWVAFTST--CVAAYMYGYDQHMLPEGFPTLAPNAACSAFISNTSVALSLL  187

Query  622  LVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLL--KNALLQYIMAFPV  795
            LVFRT +SY R ++ R  W  ++  + D   Q   G     D  +  K AL ++++AF  
Sbjct  188  LVFRTNSSYGRWDEARKMWGGLLNRSRDIMRQ---GATCFPDDQVEAKKALARWVVAFSR  244

Query  796  ALK  804
            AL+
Sbjct  245  ALR  247



>ref|WP_025650724.1| MULTISPECIES: hypothetical protein [Psychrobacter]
Length=308

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = +1

Query  457  VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRT  636
            VI  + P V+  T ++ I+    SAV  HW P  F    A+  P+ L   AL+L L FR 
Sbjct  20   VIPHIYPQVLLITLLSAII----SAVQ-HWFPSSFSSYGAA--PFTLLGIALSLFLGFRN  72

Query  637  EASYSRLEQGRLAWTKVIAGASDFAVQVISGV--ESKSDKLLKNALLQYIMAFPVALK  804
             ASY R  +GR  W +++  A  F  QV+S +  E+++ +  + +++   +AF  AL+
Sbjct  73   NASYQRWWEGRCLWGQLVYDARSFTRQVLSFIDDETETGRHTQQSMIHLTIAFTHALR  130



>gb|KDD74270.1| bestrophin [Helicosporidium sp. ATCC 50920]
Length=325

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 73/190 (38%), Gaps = 56/190 (29%)
 Frame = +1

Query  607   ALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVI----------SGV--------  732
             AL+LLLVFRT A+Y R  + R  W  ++    DF  Q +          +GV        
Sbjct  44    ALSLLLVFRTNAAYDRWWEARKTWGSLVNRTRDFMRQALTFFPASESAEAGVLLRWTVAL  103

Query  733   -------------------------------ESKSDKLLKNALLQYIMAFPVALKESKIS  819
                                            E      L  AL+  ++     L   +  
Sbjct  104   PRMLLWKLREQAVLEAELQGVLLPAEFSLLRECDHRCALALALMSEVVQRARGLDRGQRR  163

Query  820   CFHEGISA-------CEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATF  978
             C    ++A       CE+++  PIPLSY+R TSR+L++W   LP  LW    W  VP + 
Sbjct  164   CLDANLTALGDTVGVCERILRTPIPLSYSRHTSRWLLVWLAFLPFSLWRLYAWGSVPLSG  223

Query  979   ISAASLFCIE  1008
             + A  +  I+
Sbjct  224   LLAFLMLGID  233



>dbj|GAJ67191.1| hypothetical protein MA13_contig00004-0260 [Edwardsiella piscicida]
Length=213

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 65/148 (44%), Gaps = 19/148 (13%)
 Frame = +1

Query  586  PYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVIS-----GVESKSDK  750
            P+ L   A+A+ L FR  ASY+R  + R+ W  ++        Q IS     G E +   
Sbjct  24   PFSLLGVAIAIFLGFRNNASYARFIEARVLWGSLLITTRSLMRQAISLMPHPGGEHRRRG  83

Query  751  LLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLP  930
             L +   Q I        ++ ++     +  CE++   PIP +Y+ +  R + ++   LP
Sbjct  84   YLSDIDFQTI--------DTNLNQLSVILGGCERISNTPIPFAYSLIVHRTVYVFCALLP  135

Query  931  IILWDDCHW------IVVPATFISAASL  996
              L  D H+      + +  TFI+  +L
Sbjct  136  FALVSDLHYMTPLVSVFISYTFIALDAL  163



>ref|XP_002945810.1| hypothetical protein VOLCADRAFT_102778 [Volvox carteri f. nagariensis]
 gb|EFJ52805.1| hypothetical protein VOLCADRAFT_102778 [Volvox carteri f. nagariensis]
Length=705

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 95/195 (49%), Gaps = 17/195 (9%)
 Frame = +1

Query  223  LKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAIQENRMQQKRALYKHEDWVI  402
            +++ S RV   S    P P   ++SN            D +     Q +R +Y    W  
Sbjct  25   VQRRSLRVDATSGAAPPPPAGKELSN------------DMVTR---QYRRTVYDFSLWAK  69

Query  403  hrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLR-AS  579
            HR   R+L +L T   SR+I +L  P+    + A +   Y + +    LP +FP L   S
Sbjct  70   HRDVNRYLYNLKTIPGSRIIRTLGQPMGIVLAWAAMFGFYETCLESGVLPSYFPKLTLMS  129

Query  580  SLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLLK  759
            + P  LT+ AL+LLLVFRT +SY R ++ R  W  ++  A + A Q ++ + ++ D   +
Sbjct  130  AEPQGLTSFALSLLLVFRTNSSYGRFDEARKIWGGILNRARNIANQAVTFIPAE-DVAGR  188

Query  760  NALLQYIMAFPVALK  804
             A+ ++ + F  AL+
Sbjct  189  EAVGKWAVGFCRALQ  203



>ref|XP_005770556.1| hypothetical protein EMIHUDRAFT_54215, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD18127.1| hypothetical protein EMIHUDRAFT_54215, partial [Emiliania huxleyi 
CCMP1516]
Length=329

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 80/198 (40%), Gaps = 64/198 (32%)
 Frame = +1

Query  607   ALALLLVFRTEASYSRLEQGRLAWTKVIAGASDF---AVQVISGVESK------------  741
             AL LLLVFRT  SY R  + R  W  VI  + D    A+ ++   E K            
Sbjct  102   ALFLLLVFRTNNSYDRWWEARKVWGGVINASRDLARQALALVRDAELKKLMVSQIASYAR  161

Query  742   ------------SDKLLKNALL---------QYIMAF---PVALK---------------  804
                         +  LL+N L+         + IM     P+AL                
Sbjct  162   VLKYHLGPPTPEARDLLRNELVDNRLPADQVRVIMEAKHKPMALLGLVSASLHDSGRTGL  221

Query  805   --------ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDD--CH  954
                     +  +S   + +  CE+++  P+PL YTR T+RFL  W L LP+ L++    +
Sbjct  222   DTVQASKLDQTLSLLTDYLGKCERIVKTPLPLVYTRHTARFLSWWLLFLPVCLYNQLRAN  281

Query  955   WIVVPATFISAASLFCIE  1008
             W++VP + +    L  IE
Sbjct  282   WMIVPVSGLIGFFLVGIE  299



>ref|XP_005785617.1| hypothetical protein EMIHUDRAFT_426591 [Emiliania huxleyi CCMP1516]
 gb|EOD33188.1| hypothetical protein EMIHUDRAFT_426591 [Emiliania huxleyi CCMP1516]
Length=438

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 22/135 (16%)
 Frame = +1

Query  337  DAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVA  516
            D   E   Q +R +Y H++W+ HRSS R  R+++T   S V  +L   ++ FTS+A  V 
Sbjct  51   DTYAEESRQYRRTVYMHDEWIKHRSSDRFFRNMMTIGQSGVTQNLGDELVVFTSIATAVV  110

Query  517  SYNSAVSLH-----------------WLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
              N  +  +                 W P   P     S+P+ +  PAL+LLLVFRT   
Sbjct  111  GANMLLQSYTDLEGVKHAGALAGLWQWGPWSLP-----SMPFTVAMPALSLLLVFRTNTG  165

Query  646  YSRLEQGRLAWTKVI  690
            Y+R  + R  W  V+
Sbjct  166  YARWNEARTLWGGVV  180



>ref|XP_005759737.1| hypothetical protein EMIHUDRAFT_414796 [Emiliania huxleyi CCMP1516]
 gb|EOD07308.1| hypothetical protein EMIHUDRAFT_414796 [Emiliania huxleyi CCMP1516]
Length=438

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 22/135 (16%)
 Frame = +1

Query  337  DAIQENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVA  516
            D   E   Q +R +Y H++W+ HRSS R  R+++T   S V  +L   ++ FTS+A  V 
Sbjct  51   DTYAEESRQYRRTVYMHDEWIKHRSSDRFFRNMMTIGQSGVTQNLGDELVVFTSIATAVV  110

Query  517  SYNSAVSLH-----------------WLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
              N  +  +                 W P   P     S+P+ +  PAL+LLLVFRT   
Sbjct  111  GANMLLQSYTDLEGVKHAGALAGLWQWGPWSLP-----SMPFTVAMPALSLLLVFRTNTG  165

Query  646  YSRLEQGRLAWTKVI  690
            Y+R  + R  W  V+
Sbjct  166  YARWNEARTLWGGVV  180



>ref|XP_002180738.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47390.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=455

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 5/70 (7%)
 Frame = +1

Query  814   ISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDD-----CHWIVVPATF  978
             ++ F + + + E+L+  P+PL Y+R T+RFL  W L LP  LWD       H  ++PAT 
Sbjct  288   VTIFEDNLGSSERLLTSPVPLFYSRHTARFLSFWLLLLPFALWDPFAGTWNHVGMIPATA  347

Query  979   ISAASLFCIE  1008
             + +  LF IE
Sbjct  348   VISIFLFGIE  357



>ref|WP_007393382.1| hypothetical protein [Psychrobacter sp. 1501(2011)]
 gb|EGK15497.1| protein of hypothetical function UPF0187 [Psychrobacter sp. 1501(2011)]
Length=308

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +1

Query  466  SLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRTEAS  645
            S++P +       I++++  SAV  HW+P  F    A+  P  L   AL+L L FR  AS
Sbjct  19   SIIPHIYRQVLFIILMSTIISAVQ-HWIPSSFSSYSAA--PLTLLGIALSLFLGFRNNAS  75

Query  646  YSRLEQGRLAWTKVIAGASDFAVQVISGVESKSDKLL--KNALLQYIMAFPVALK  804
            Y R  + R+ W +++  +  F  QV+S V+ K++  L  +  ++   +AF  AL+
Sbjct  76   YQRWWEARILWGQLVYESRSFTRQVMSFVDDKTEGGLEAQRTMVNLAIAFTHALR  130



>ref|XP_002289965.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93502.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=390

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 5/73 (7%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDD-----CHWIVVP  969
              + +S F + +  CE+L+  P+PL Y+R T+RFL  W L LP  L++       H  ++P
Sbjct  262   NTNLSIFEDTLGGCERLLSSPVPLFYSRHTARFLSTWLLLLPFGLYEQFKDSWNHIAMIP  321

Query  970   ATFISAASLFCIE  1008
             AT   +  LF IE
Sbjct  322   ATAFISVCLFGIE  334



>ref|XP_005828791.1| hypothetical protein GUITHDRAFT_112228 [Guillardia theta CCMP2712]
 gb|EKX41811.1| hypothetical protein GUITHDRAFT_112228 [Guillardia theta CCMP2712]
Length=260

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 4/81 (5%)
 Frame = +1

Query  565  VLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS  744
            VL+    P++L    L++LLVFRT+ +Y R  +GR  W  V A         ++ VE +S
Sbjct  103  VLKVPEWPHELVGGFLSILLVFRTDQAYQRFWEGRERWADVAAHLRTMTRITVTAVEPRS  162

Query  745  DKLLKNALLQYIMAFPVALKE  807
                ++A+L ++ AFP+ LK+
Sbjct  163  ----QDAILSHLCAFPITLKQ  179



>ref|XP_003080595.1| COG3781: Predicted membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL54763.1| Bestrophin/UPF0187 [Ostreococcus tauri]
Length=479

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  832   GISA--CEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCI  1005
             G+S   CE++I  PIPLS+TR T+R LV+W LTLP ++     W+ VP  F  A  +  I
Sbjct  363   GLSGGICERIIATPIPLSFTRHTARSLVIWLLTLPFVIVPTMGWMSVPCIFTLAYLILGI  422

Query  1006  E  1008
             +
Sbjct  423   D  423



>ref|XP_005767452.1| hypothetical protein EMIHUDRAFT_459409 [Emiliania huxleyi CCMP1516]
 gb|EOD15023.1| hypothetical protein EMIHUDRAFT_459409 [Emiliania huxleyi CCMP1516]
Length=521

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDC-----HWIVVP  969
             ++ IS   +   A E++   PIPL YTRL +RFL ++ + +P+ LW        HW  +P
Sbjct  404   DTSISVLVDLTGANERIFKSPIPLMYTRLLARFLSVFLVLMPLGLWQALGESWNHWATIP  463

Query  970   ATFISAASLFCIE  1008
             ATF+ +  LF IE
Sbjct  464   ATFVISFFLFGIE  476



>ref|WP_010199112.1| hypothetical protein [Psychrobacter sp. PAMC 21119]
Length=308

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 4/90 (4%)
 Frame = +1

Query  541  HWLPEFFPVLRASSLPYQLTAPALALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQV  720
            +W P FF     S+ P+ L   AL+L L FR  ASY R  + R  W ++I  A   A QV
Sbjct  43   YWFPGFFSSY--STAPFTLLGVALSLFLGFRNNASYQRWWEARGQWGQLIVDARSLARQV  100

Query  721  ISGV--ESKSDKLLKNALLQYIMAFPVALK  804
            IS +  E+++ +  +  ++   +AF  AL+
Sbjct  101  ISFMDEETETGRQTQRRMIHLTIAFTHALR  130



>emb|CBJ26187.1| conserved unknown protein [Ectocarpus siliculosus]
Length=475

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  835   ISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAASLFCIE  1008
             I  CE+L+  P+PL Y R TSRFL +W   LP+++  +      P  F++  +LF I+
Sbjct  327   IGGCERLVQTPVPLHYVRHTSRFLTIWCFLLPLVIVGEMGMATAPVVFLATWALFGIQ  384



>ref|XP_002507093.1| hypothetical protein MICPUN_54949 [Micromonas sp. RCC299]
 gb|ACO68351.1| hypothetical protein MICPUN_54949 [Micromonas sp. RCC299]
Length=507

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  748  KLLKNALLQYIMAFPVALKESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTL  927
            ++L+ AL++ +     A  E  +      ++  E+++  PIP+S+TR TSR L +W  TL
Sbjct  375  QILQRALMKGMSTQMHAQAEIIVKELSAVLAESEKILYTPIPISFTRHTSRILTMWLFTL  434

Query  928  PIILWDDCHWIVVPATFI  981
            P+ LW    W +VPA F+
Sbjct  435  PLSLWLPLGWCMVPAVFL  452



>ref|WP_022608835.1| putative membrane protein [Rubidibacter lacunae]
 gb|ERN40287.1| putative membrane protein [Rubidibacter lacunae KORDI 51-2]
Length=326

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  610  LALLLVFRTEASYSRLEQGRLAWTKVIAGASDFAVQVISGVESK--SDKLLKNALLQYIM  783
            L LLLVFRT  +Y R  +GR  W ++I    + A Q+   VE +   D+ LK A L+ ++
Sbjct  80   LGLLLVFRTNTAYERFWEGRKLWGQLINTVRNLARQIWVAVEEREEGDRELKVATLRLLV  139

Query  784  AFPVALK  804
            AF VA K
Sbjct  140  AFAVATK  146



>ref|WP_006631076.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK90100.1| hypothetical protein MicvaDRAFT_3910 [Microcoleus vaginatus FGP-2]
Length=301

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 62/118 (53%), Gaps = 11/118 (9%)
 Frame = +1

Query  457  VILSLVPPVIAFTSVAIIVASYNSAVSLHWLPEFFPVLRASSLPYQLTAPALALLLVFRT  636
            VI S++P V+      +++    S +    LP   P+L +S +P    +  L LLLVFRT
Sbjct  19   VIPSILPRVLLCGGFGVLI----SLLHFFKLPVSMPIL-SSIVP----SIVLGLLLVFRT  69

Query  637  EASYSRLEQGRLAWTKVIAGASDFAVQVISGVESKS--DKLLKNALLQYIMAFPVALK  804
              +Y R  +GR  W  ++    + A Q+   +E K   D ++K ++L+ + AF VA+K
Sbjct  70   NTAYERFWEGRKMWGTLVNNVRNLARQIWVAIEEKEPQDIVIKKSVLRLLPAFAVAMK  127



>ref|XP_002178861.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49559.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=374

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 95/232 (41%), Gaps = 44/232 (19%)
 Frame = +1

Query  166  SCASHHKPLSFHPPLFSSKLKKLSFRVVCCSSQNNPHPPPTQISNFPWILRVIPDWADAI  345
            +C+S ++  +F  P  +S    ++ R +         PPP  I               A 
Sbjct  18   ACSSSYRTQAFIVPSGTSSRVSVAVRSL---------PPPRDI---------------AY  53

Query  346  QENRMQQKRALYKHEDWVIhrsslrhlrhlltslnsrVILSLVPPVIAFTSVAIIVASYN  525
             E   + +R +Y H+DWV HRS  R  R+++    S V  +L    IA T+VA  +  YN
Sbjct  54   GEESRKYRRTVYTHDDWVNHRSPDRFWRNIIAMPTSGVYKNLAKECIATTAVATAIVVYN  113

Query  526  SAVSLHWLPEFFPVLRASSL-------------PYQLTAPALALLLVFRTEASYSRLEQG  666
            + V  +   +F  V  A+ L             P+ ++   L  LL+FRT +SY R ++ 
Sbjct  114  ALVGGY--TDFGGVQHAAVLQNELLPKIGMPVSPFTVSGSFLGFLLIFRTNSSYKRWDEA  171

Query  667  RLAWTKVIAGASDF-----AVQVISGVESKSDKLLKNALLQYIMAFPVALKE  807
            R  W   I    D      A    +GV  +  K    AL     +F  A+K 
Sbjct  172  RKNWGMNINHTRDLVRMGTAFYDKTGVTDEQRKKDLQALSLATWSFVRAMKR  223



>ref|XP_005647741.1| UPF0187-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23197.1| UPF0187-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=339

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +1

Query  805   ESKISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFIS  984
             E  I+      S  ++L   PIP+SYTR TSR L+LW LTLP  LW      +VPA F  
Sbjct  231   EDIITELVNAASGADRLFQTPIPVSYTRHTSRSLMLWLLTLPFALWPVMGPSLVPACFFV  290

Query  985   AASLFCIE  1008
             A  L  I+
Sbjct  291   AYVLIGID  298



>ref|XP_002291842.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90693.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=239

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +1

Query  811   KISCFHEGISACEQLIGIPIPLSYTRLTSRFLVLWHLTLPIILWDDCHWIVVPATFISAA  990
             +++   + +S CE+++  P+PLSY+R TSRFL LW   LP  +     W+ +P     + 
Sbjct  113   EVNHLSDALSGCEKIVQTPVPLSYSRHTSRFLTLWCGFLPFAIVSQLGWLSIPVMLTVSW  172

Query  991   SLFCIE  1008
              L+ +E
Sbjct  173   LLYGLE  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2266477593358