BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22381_g1_i3 len=4065 path=[6491:0-207 3114:208-783 3690:784-810
3690:811-837 6788:838-1911 @7862@!:1912-2598 6738:2599-2918
5160:2919-4064]

Length=4065
                                                                      Score     E

ref|XP_006343674.1|  PREDICTED: uncharacterized protein LOC102595293   1041   0.0      
ref|XP_004242571.1|  PREDICTED: uncharacterized protein DDB_G0287625   1011   0.0      
ref|XP_009774126.1|  PREDICTED: uncharacterized protein LOC104224...    971   0.0      
ref|XP_009589662.1|  PREDICTED: uncharacterized protein LOC104086995    958   0.0      
ref|XP_011078593.1|  PREDICTED: FIP1[V]-like protein isoform X2         874   0.0      
ref|XP_011078592.1|  PREDICTED: FIP1[V]-like protein isoform X1         869   0.0      
ref|XP_010656604.1|  PREDICTED: FIP1[V]-like protein                    858   0.0      
ref|XP_006453658.1|  hypothetical protein CICLE_v10007258mg             794   0.0      
ref|XP_006473979.1|  PREDICTED: microtubule-associated protein fu...    800   0.0      
ref|XP_006473981.1|  PREDICTED: microtubule-associated protein fu...    796   0.0      
ref|XP_006453657.1|  hypothetical protein CICLE_v10007258mg             789   0.0      
ref|XP_007204683.1|  hypothetical protein PRUPE_ppa000270mg             778   0.0      
gb|KDP38657.1|  hypothetical protein JCGZ_04010                         768   0.0      
ref|XP_008242955.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    743   0.0      
ref|XP_008443876.1|  PREDICTED: trichohyalin isoform X2                 741   0.0      
ref|XP_008443875.1|  PREDICTED: trichohyalin isoform X1                 741   0.0      
ref|XP_004146694.1|  PREDICTED: uncharacterized protein LOC101212971    738   0.0      
ref|XP_011017996.1|  PREDICTED: FIP1[V]-like protein isoform X2         730   0.0      
gb|KHG13413.1|  Pre-mRNA 3'-end-processing factor FIP1                  735   0.0      
ref|XP_007011968.1|  FIP1, putative isoform 1                           734   0.0      
ref|XP_011017995.1|  PREDICTED: FIP1[V]-like protein isoform X1         733   0.0      
ref|XP_002324551.2|  hypothetical protein POPTR_0018s11860g             728   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009366155.1|  PREDICTED: uncharacterized protein LOC103955965    727   0.0      
gb|KDO59423.1|  hypothetical protein CISIN_1g000758mg                   717   0.0      
ref|XP_008352094.1|  PREDICTED: trichohyalin-like                       723   0.0      
ref|XP_002523498.1|  ATP binding protein, putative                      721   0.0      Ricinus communis
gb|KDO59420.1|  hypothetical protein CISIN_1g000758mg                   712   0.0      
gb|KDO59421.1|  hypothetical protein CISIN_1g000758mg                   709   0.0      
ref|XP_010100240.1|  hypothetical protein L484_005444                   704   0.0      
ref|XP_008384553.1|  PREDICTED: uncharacterized protein LOC103447...    705   0.0      
ref|XP_007138264.1|  hypothetical protein PHAVU_009G194000g             703   0.0      
ref|XP_004287116.1|  PREDICTED: uncharacterized protein LOC101308899    703   0.0      
ref|XP_008384539.1|  PREDICTED: uncharacterized protein LOC103447...    706   0.0      
ref|XP_008384547.1|  PREDICTED: uncharacterized protein LOC103447...    705   0.0      
ref|XP_008384531.1|  PREDICTED: uncharacterized protein LOC103447...    706   0.0      
emb|CAN81922.1|  hypothetical protein VITISV_010335                     711   0.0      Vitis vinifera
ref|XP_007011969.1|  FIP1, putative isoform 2                           689   0.0      
ref|XP_011033462.1|  PREDICTED: FIP1[V]-like protein isoform X1         692   0.0      
ref|XP_010275740.1|  PREDICTED: filaggrin-like                          687   0.0      
ref|XP_004513530.1|  PREDICTED: trichohyalin-like                       680   0.0      
gb|KHG03808.1|  Pre-mRNA 3'-end-processing factor FIP1                  670   0.0      
ref|XP_002309330.1|  hypothetical protein POPTR_0006s20150g             667   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO59422.1|  hypothetical protein CISIN_1g000758mg                   658   0.0      
ref|XP_006587148.1|  PREDICTED: uncharacterized protein LOC100803...    652   0.0      
ref|XP_003535062.1|  PREDICTED: uncharacterized protein LOC100803...    657   0.0      
ref|XP_010687726.1|  PREDICTED: FIP1[V]-like protein                    657   0.0      
ref|XP_006587147.1|  PREDICTED: uncharacterized protein LOC100803...    653   0.0      
ref|XP_010047129.1|  PREDICTED: uncharacterized protein LOC104436...    648   0.0      
gb|KEH37870.1|  Fip1 [V]-like protein                                   646   0.0      
ref|XP_010047128.1|  PREDICTED: zinc finger CCCH domain-containin...    650   0.0      
gb|KCW78928.1|  hypothetical protein EUGRSUZ_C00363                     650   0.0      
ref|XP_011033463.1|  PREDICTED: FIP1[V]-like protein isoform X2         638   0.0      
gb|KEH37869.1|  Fip1 [V]-like protein                                   642   0.0      
gb|KHN35290.1|  Pre-mRNA 3'-end-processing factor FIP1                  634   0.0      
ref|XP_006598040.1|  PREDICTED: uncharacterized protein LOC100799266    621   0.0      
ref|XP_007154905.1|  hypothetical protein PHAVU_003G157600g             589   0.0      
gb|KHN04414.1|  Pre-mRNA 3'-end-processing factor FIP1                  570   1e-178   
emb|CBI36522.3|  unnamed protein product                                559   6e-177   
ref|XP_008790389.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    513   7e-155   
ref|XP_010939301.1|  PREDICTED: FIP1[V]-like protein isoform X3         511   2e-154   
ref|XP_010939298.1|  PREDICTED: FIP1[V]-like protein isoform X1         511   6e-153   
ref|XP_008785688.1|  PREDICTED: uncharacterized protein LOC103704249    509   4e-152   
ref|XP_010936256.1|  PREDICTED: FIP1[V]-like protein                    508   1e-151   
ref|XP_010939299.1|  PREDICTED: FIP1[V]-like protein isoform X2         504   2e-150   
gb|EYU25349.1|  hypothetical protein MIMGU_mgv1a000329mg                498   1e-149   
ref|XP_006857169.1|  hypothetical protein AMTR_s00065p00171490          474   1e-139   
ref|XP_009396447.1|  PREDICTED: uncharacterized protein LOC103981443    454   3e-132   
ref|XP_009411336.1|  PREDICTED: uncharacterized protein LOC103993109    447   8e-130   
ref|XP_004167960.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    405   2e-116   
ref|XP_008336909.1|  PREDICTED: uncharacterized protein LOC103400008    365   2e-107   
gb|KDO59424.1|  hypothetical protein CISIN_1g000758mg                   349   1e-97    
ref|XP_002864546.1|  hypothetical protein ARALYDRAFT_495910             349   6e-97    
ref|NP_200612.2|  FIP1 [V]-like protein                                 348   1e-96    Arabidopsis thaliana [mouse-ear cress]
gb|KGN65237.1|  hypothetical protein Csa_1G268310                       338   5e-96    
gb|KFK27337.1|  hypothetical protein AALP_AA8G370000                    345   1e-95    
ref|XP_010443517.1|  PREDICTED: uncharacterized protein LOC104726372    345   2e-95    
ref|XP_006279559.1|  hypothetical protein CARUB_v10025759mg             343   1e-94    
ref|XP_006401136.1|  hypothetical protein EUTSA_v10012479mg             341   3e-94    
emb|CDY43886.1|  BnaC09g33570D                                          340   5e-94    
ref|XP_009120319.1|  PREDICTED: filaggrin isoform X1                    340   7e-94    
ref|XP_009120320.1|  PREDICTED: filaggrin isoform X2                    339   8e-94    
gb|EPS62002.1|  hypothetical protein M569_12793                         319   4e-93    
dbj|BAB10995.1|  unnamed protein product                                334   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453107.1|  PREDICTED: uncharacterized protein LOC104735083    333   1e-91    
ref|XP_010483368.1|  PREDICTED: uncharacterized protein LOC104761899    326   4e-89    
ref|XP_004172292.1|  PREDICTED: uncharacterized LOC101212971            308   2e-88    
gb|KGN65239.1|  hypothetical protein Csa_1G268330                       308   2e-88    
ref|XP_010539467.1|  PREDICTED: uncharacterized protein LOC104813541    321   1e-87    
emb|CDX88655.1|  BnaA03g09940D                                          313   1e-85    
ref|XP_009132085.1|  PREDICTED: uncharacterized protein LOC103856715    312   2e-85    
ref|XP_010545454.1|  PREDICTED: sarcoplasmic reticulum histidine-...    298   4e-80    
ref|XP_009358572.1|  PREDICTED: uncharacterized protein LOC103949191    290   3e-79    
ref|XP_006651764.1|  PREDICTED: zinc finger CCCH domain-containin...    281   6e-74    
ref|XP_010545460.1|  PREDICTED: uncharacterized protein LOC104817826    263   1e-69    
emb|CDY11833.1|  BnaC03g12590D                                          262   8e-69    
ref|XP_008644546.1|  PREDICTED: zinc finger CCCH domain-containin...    261   8e-68    
ref|XP_003560420.1|  PREDICTED: zinc finger CCCH domain-containin...    261   1e-67    
ref|XP_004981927.1|  PREDICTED: filaggrin-like                          256   3e-66    
gb|AFW67761.1|  hypothetical protein ZEAMMB73_253225                    245   3e-64    
gb|EMS52121.1|  hypothetical protein TRIUR3_15899                       233   3e-59    
gb|EMT14553.1|  hypothetical protein F775_08060                         226   8e-57    
ref|XP_001758120.1|  predicted protein                                  209   3e-51    
ref|XP_002466539.1|  hypothetical protein SORBIDRAFT_01g009630          197   6e-49    Sorghum bicolor [broomcorn]
gb|AAT77079.1|  putative Fip1 motif containing protein                  189   3e-45    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ28430.1|  hypothetical protein OsJ_12413                          188   7e-45    Oryza sativa Japonica Group [Japonica rice]
gb|EEC76101.1|  hypothetical protein OsI_13355                          178   7e-42    Oryza sativa Indica Group [Indian rice]
emb|CDY55018.1|  BnaA10g29420D                                          154   3e-39    
emb|CAN75318.1|  hypothetical protein VITISV_026156                     139   1e-31    Vitis vinifera
ref|XP_006841433.1|  hypothetical protein AMTR_s00003p00049560          141   2e-30    
emb|CAN76673.1|  hypothetical protein VITISV_011790                     135   1e-28    Vitis vinifera
ref|XP_002272609.1|  PREDICTED: FIP1[III]-like protein                  135   2e-28    Vitis vinifera
ref|XP_010921466.1|  PREDICTED: LOW QUALITY PROTEIN: FIP1[V]-like...    132   1e-27    
ref|XP_007035794.1|  Uncharacterized protein isoform 1                  131   3e-27    
ref|XP_010267959.1|  PREDICTED: uncharacterized protein LOC104605053    130   6e-27    
ref|XP_008781139.1|  PREDICTED: uncharacterized protein LOC103700993    129   2e-26    
ref|XP_011010422.1|  PREDICTED: FIP1[III]-like protein isoform X2       122   1e-24    
ref|XP_011010415.1|  PREDICTED: FIP1[III]-like protein isoform X1       122   1e-24    
ref|XP_008340604.1|  PREDICTED: uncharacterized protein LOC103403...    117   4e-23    
ref|XP_008340602.1|  PREDICTED: uncharacterized protein LOC103403...    117   5e-23    
ref|XP_008340603.1|  PREDICTED: uncharacterized protein LOC103403...    117   5e-23    
ref|XP_007035795.1|  Uncharacterized protein isoform 2                  116   8e-23    
ref|XP_008223390.1|  PREDICTED: uncharacterized protein LOC103323193    115   3e-22    
ref|XP_008360248.1|  PREDICTED: uncharacterized protein LOC103423...    114   3e-22    
ref|XP_008360247.1|  PREDICTED: uncharacterized protein LOC103423...    114   3e-22    
ref|XP_008390577.1|  PREDICTED: uncharacterized protein LOC103452819    114   4e-22    
ref|XP_010097780.1|  hypothetical protein L484_004194                   113   7e-22    
ref|XP_002519223.1|  conserved hypothetical protein                     110   4e-21    Ricinus communis
ref|NP_001051127.1|  Os03g0725100                                       108   1e-20    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296247.1|  PREDICTED: uncharacterized protein LOC101314266    108   1e-20    
ref|XP_010064911.1|  PREDICTED: uncharacterized protein LOC104452045    108   3e-20    
ref|XP_006651314.1|  PREDICTED: uncharacterized protein LOC102703384    106   1e-19    
gb|ABF95555.1|  Fip1 motif family protein, expressed                    104   3e-19    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ26675.1|  hypothetical protein OsJ_10579                          104   4e-19    Oryza sativa Japonica Group [Japonica rice]
gb|EAY89720.1|  hypothetical protein OsI_11258                          104   4e-19    Oryza sativa Indica Group [Indian rice]
ref|XP_007147362.1|  hypothetical protein PHAVU_006G117800g             103   6e-19    
ref|XP_006597704.1|  PREDICTED: uncharacterized protein LOC100816...    100   7e-18    
ref|XP_006597702.1|  PREDICTED: uncharacterized protein LOC100816...    100   7e-18    
ref|XP_002970425.1|  hypothetical protein SELMODRAFT_441074             100   8e-18    
gb|EMT27449.1|  Pre-mRNA 3'-end-processing factor FIP1                99.4    2e-17    
ref|XP_010228706.1|  PREDICTED: uncharacterized protein LOC100823950  99.4    2e-17    
gb|EMS57064.1|  hypothetical protein TRIUR3_11958                     99.0    2e-17    
gb|KHN14687.1|  Pre-mRNA 3'-end-processing factor FIP1                99.0    2e-17    
ref|XP_006597703.1|  PREDICTED: uncharacterized protein LOC100816...  99.0    2e-17    
ref|XP_006586891.1|  PREDICTED: uncharacterized protein LOC100816...  99.0    2e-17    
ref|XP_006586892.1|  PREDICTED: uncharacterized protein LOC100816...  99.0    2e-17    
ref|XP_004984604.1|  PREDICTED: uncharacterized protein LOC101781...  98.6    3e-17    
ref|XP_008667405.1|  PREDICTED: hypothetical protein isoform X1       97.4    6e-17    
emb|CDY70580.1|  BnaA10g29090D                                        95.9    8e-17    
ref|XP_004984605.1|  PREDICTED: uncharacterized protein LOC101781...  96.3    1e-16    
ref|XP_010671727.1|  PREDICTED: FIP1[V]-like protein isoform X1       93.6    1e-15    
ref|XP_010671728.1|  PREDICTED: FIP1[V]-like protein isoform X2       93.2    1e-15    
tpg|DAA45033.1|  TPA: hypothetical protein ZEAMMB73_268123            91.7    4e-15    
ref|XP_002978504.1|  hypothetical protein SELMODRAFT_443841           90.5    9e-15    
ref|XP_003284406.1|  hypothetical protein DICPUDRAFT_96691            87.4    2e-14    
gb|KHN12870.1|  Pre-mRNA 3'-end-processing factor FIP1                87.8    6e-14    
gb|ESA00082.1|  hypothetical protein GLOINDRAFT_272533                81.3    6e-13    
ref|XP_636526.1|  cleavage and polyadenylation specificity factor...  81.6    2e-12    Dictyostelium discoideum AX4



>ref|XP_006343674.1| PREDICTED: uncharacterized protein LOC102595293 [Solanum tuberosum]
Length=1380

 Score =  1041 bits (2691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1262 (55%), Positives = 870/1262 (69%), Gaps = 82/1262 (6%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP TAS QS+QPP   +               +A   ++   S  
Sbjct  1     MEDDDEFGDLYTDVLRPLTASFQSQQPPAAQE---------------EAAPKAAGATSRP  45

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQ-PRPNSSDFNLSLN  3589
             ID  ++ DD  I++GA  SN  PN +  SS+  QEKTLA+  + K   R   S+ NL L 
Sbjct  46    IDLNINSDDEEILYGAPNSNSKPNFAGPSSITGQEKTLASPLDVKSGSRLPESNLNLKLG  105

Query  3588  PqsgqsggsigvgvGANESDLGARVFGKS-DGKSRDWAFGDSSFTDEANIdvvveegddk  3412
                    G I    G NESD  ARV  KS D K     F D +F DEANID+VVEE DDK
Sbjct  106   ------AGRIEGLGGINESDSIARVLVKSEDVKLPKTEFQDLNFMDEANIDIVVEETDDK  159

Query  3411  dddlvqkdENI-DKPMGRSE---NCESSVVEAGGSEHMIPGVSIPGVSGVPETCGDRAVd  3244
             DD L+   +N+ + P    +   N  + V+EA G+E +IPG+ IPGVSG     G+  V+
Sbjct  160   DDILMGNHQNVGEDPENLKDGTGNVGNFVIEASGAEQLIPGLEIPGVSGGAGNTGEGNVE  219

Query  3243  eewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEE  3064
             ++WDSDS+DD L+IVLNDN HGPMGM+RMG   +DD+D+  PLVIVA++D PSH PM+EE
Sbjct  220   DDWDSDSEDD-LQIVLNDNTHGPMGMERMGIGEEDDEDED-PLVIVADNDGPSHPPMMEE  277

Query  3063  QEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapip  2890
             Q+WG+E G +A+GERKE  DA KVN  PG A K+GY NH Y+HPYHSQ+KYVRPGA  +P
Sbjct  278   QDWGEEGGPAANGERKEITDALKVNGAPGVAGKVGYPNHAYNHPYHSQYKYVRPGATLMP  337

Query  2889  gappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRG  2710
             G PP GPGG PGQV PPVN   VAGRGRGDWRPPGMKGA  M          G++  G G
Sbjct  338   GVPPSGPGGIPGQVRPPVNAGPVAGRGRGDWRPPGMKGAYGMSG-----WGGGASGRGFG  392

Query  2709  IGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLES  2530
             IGL+FTLPSHKTIFEVDID F+EKPWRL GID++DFFNFGLNE+ WKDYCKQLEQLRLES
Sbjct  393   IGLEFTLPSHKTIFEVDIDGFEEKPWRLPGIDVTDFFNFGLNEDGWKDYCKQLEQLRLES  452

Query  2529  TMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
             TMQG+IRVYESGRTEQEYDP++PPELAAAAG+QDIPSEN N GKT+   NDLARGS+R R
Sbjct  453   TMQGRIRVYESGRTEQEYDPEMPPELAAAAGMQDIPSENLN-GKTDGTANDLARGSMRMR  511

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQG----SADDDNNLEQGNQP  2182
             PPLP GRPIQVE+GSGDRLPSIDTRPPR RDSDAIIEIVCQ     +  D N ++  N P
Sbjct  512   PPLPTGRPIQVETGSGDRLPSIDTRPPRQRDSDAIIEIVCQDDDQYTGIDKNEVQLDNIP  571

Query  2181  SREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVIL  2005
             S E  RG    G L QE +   DGFQH Y   KRE  ++R +F +   D  ++ D V   
Sbjct  572   STEDFRGDARRGPL-QEHVQESDGFQHPYKSHKREANAKRTQFINPIGDHLTKGDGVAPF  630

Query  2004  PSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNR  1825
              SE P  +  DS GQTS Y  +      +   +K  AR RS D+  S S +D+ + VD++
Sbjct  631   SSEAPGQFVSDSGGQTSAYDNKNCVSQQEERGKKVSARDRSPDLTPSNS-RDR-LQVDSQ  688

Query  1824  REDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERT  1648
             +E+S  SV    +P+  SP ++R  QE  +E+ D++ D++V    NS +ER ++++D RT
Sbjct  689   KEESFESVDRTHTPVPPSPTADRPAQEQDMEDRDDIPDQIVEEDTNSEVEREEMTLDART  748

Query  1647  NCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLH  1468
             + + A +D  + +AKK KLSS+ E+ SPQETD GEDSKA RSSENSK +SGSS+ Y KL 
Sbjct  749   DSE-AMNDEFLHSAKKQKLSSRHEQSSPQETDDGEDSKAGRSSENSKVQSGSSRGYRKLQ  807

Query  1467  DGLEEE-VQDKRFAHVDDTRQTGG-EEDRLQRKGRDEKETEKHRMIVKGREDSYMRKGYD  1294
             D ++EE VQ  R   +D+ ++T   +EDR+++K R+EKE EKH ++VKGREDSY RKG D
Sbjct  808   DDMDEEVVQGGRSMRIDNAKKTVARDEDRVRKKARNEKEAEKHSVVVKGREDSYSRKGAD  867

Query  1293  sssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNK  1114
                     +     DRR+ER+YS+  WQ RDDDL GRR+K+E+ RKRE  DEI  +HR+K
Sbjct  868   -------SSSAHYIDRRREREYSEGVWQRRDDDLQGRRAKMEEPRKRELIDEIGIRHRSK  920

Query  1113  IRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRK  934
              R+ + S+RE RHL RKQL+N +LRPD+DKD  +RH  R+RD+LK RYD +DDRH+KRRK
Sbjct  921   AREFEGSDREERHLYRKQLENVTLRPDYDKDMGARH--RDRDELK-RYDTLDDRHNKRRK  977

Query  933   EDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHY  754
             E+ KLSREH+D+EET HS G+  +RRKRERDD SD RKRD++         RLRED+Q Y
Sbjct  978   EEVKLSREHIDKEETFHSHGETMVRRKRERDDASDHRKRDEL--------MRLREDEQLY  1029

Query  753   ARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGL  574
              R+KE+ +FQ ER +R RER+EWYR KQSH+E L KRER+E RGG+R GR +EEK+WAG 
Sbjct  1030  IRHKEDGVFQRERSDRQREREEWYRLKQSHEETLPKREREEIRGGMRAGRVSEEKAWAGQ  1089

Query  573   SRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRA  394
             SRGKDEY+ SD+  HSKD  RH +H++RR+R EN SPSR R+R+           DERRA
Sbjct  1090  SRGKDEYRNSDQ--HSKDV-RHADHIRRRDRVENESPSRLRTRD-----------DERRA  1135

Query  393   RNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
             R++RVS+R+D A   SD+S+V+EK+ K+   K K  E  D NS +  N+NED+ +G  +E
Sbjct  1136  RHDRVSSREDRAPIASDNSRVNEKRHKDYLKKGKEFEG-DHNSQMALNMNEDELNGQKNE  1194

Query  213   TV  208
              V
Sbjct  1195  LV  1196



>ref|XP_004242571.1| PREDICTED: uncharacterized protein DDB_G0287625 [Solanum lycopersicum]
Length=1380

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/1262 (54%), Positives = 859/1262 (68%), Gaps = 80/1262 (6%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP TAS QS+Q P VAQ               +A   ++   S  
Sbjct  1     MEDDDEFGDLYTDVLRPLTASFQSQQQP-VAQ--------------EEAAPKAAGATSRP  45

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNSSDFNLSLNP  3586
             ID  ++ DD  I++GA  SN  PN +  S++  QEKTLA+ P D +      + NL L  
Sbjct  46    IDLNINSDDEEILYGAPNSNSKPNFAGPSAITGQEKTLAS-PLDVKSGSRLPESNLYL--  102

Query  3585  qsgqsggsigvgvGANESDLGARVFGKS-DGKSRDWAFGDSSFTDEANIdvvveegddkd  3409
                   G +    G NESD  ARV  +S D K     F D +F DEANID+VVEE DDKD
Sbjct  103   --KLGAGRMEGLGGINESDSTARVLVESEDVKLAKTEFQDLNFMDEANIDIVVEETDDKD  160

Query  3408  ddlvqkdENI----DKPMGRSENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGDRAVde  3241
             D LV   +N+    +     + N  + V+EA G+E +IPG++IPGVSG     G+    E
Sbjct  161   DILVGNHQNVGEDHENLKDGTGNAGNFVIEASGAEQLIPGLAIPGVSGGAGNTGE-GTFE  219

Query  3240  ewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQ  3061
             +      +DDL+IVLNDN HGPMGM+RMG   +DD+D+  PLVIVA++D PSH PM+EEQ
Sbjct  220   DDWDSDSEDDLQIVLNDNTHGPMGMERMGIGEEDDEDED-PLVIVADNDGPSHPPMMEEQ  278

Query  3060  EWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipg  2887
             +WG+E G +A+GERKE  DA KVN  PG A K+GY NH Y+HPYHSQ+KYVRPGAAP+PG
Sbjct  279   DWGEEGGPAANGERKEILDALKVNGAPGVAGKVGYPNHAYNHPYHSQYKYVRPGAAPMPG  338

Query  2886  appvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGI  2707
              PP GPGG PGQV PPVN   VAGRGRGDWRPPGMKG   M          G++  G GI
Sbjct  339   VPPSGPGGIPGQVRPPVNVGPVAGRGRGDWRPPGMKGGYGMSG-----WGGGASGRGLGI  393

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GL+FTLPSHKTIFEVDID F+EKPWRL GID++DFFNFGLNE+ WKDYCKQLEQLRLEST
Sbjct  394   GLEFTLPSHKTIFEVDIDGFEEKPWRLPGIDITDFFNFGLNEDGWKDYCKQLEQLRLEST  453

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQG+IRVYE+ RTEQEYDP++PPELAAAAG++DIPSEN N GK +   NDL RGS+R RP
Sbjct  454   MQGRIRVYETVRTEQEYDPEMPPELAAAAGMKDIPSENLN-GKIDGTTNDLGRGSMRMRP  512

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQG----SADDDNNLEQGNQPS  2179
             PLP GRPIQVE+GSGDRLPSID RPPR RDSDAIIEIVCQ     + +D N  +  N PS
Sbjct  513   PLPTGRPIQVETGSGDRLPSIDNRPPRQRDSDAIIEIVCQDDDQYTGNDKNEGQLDNIPS  572

Query  2178  REGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILP  2002
              E  RG    G L QE +   DGFQ+ Y   +RE  +RR +F +   D  ++ D VV   
Sbjct  573   TEDFRGDARRGPL-QEHVQESDGFQNPYKSHRREANARRTQFINPIGDHLTKGDGVVPFS  631

Query  2001  SEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRR  1822
              E PD +  DS GQTS Y  +      +   +   A  RS DI +S S +D+ + VD+++
Sbjct  632   PEAPDQFVSDSGGQTSAYDNKNCVSKQEERGKTVSAHDRSPDITSSNS-RDR-LQVDSQK  689

Query  1821  EDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTN  1645
             E+S  SV    +P+ SSP ++R  QE  +E+ D++ D++V A  NS ++  ++++D RT+
Sbjct  690   EESFESVDRTHTPVPSSPTADRPAQEQDMEDRDDIPDQVVGADTNSEVDGEEMTLDARTD  749

Query  1644  CDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
              + A +D  + +AKK KLSS+ E+ SPQETD GEDSKA RSSENSK +SGSS+ Y KL D
Sbjct  750   SE-AMNDEFLHSAKKQKLSSRHEQSSPQETDDGEDSKAGRSSENSKVQSGSSRGYRKLRD  808

Query  1464  GLEEE-VQDKRFAHVDDTRQTGG-EEDRLQRKGRDEKETEKHRMIVKGREDSYMRKGYDs  1291
              ++EE VQ +R   VD+ ++T   +EDR+++K R EKE EKH  +VKGREDSY RKG D 
Sbjct  809   DMDEEVVQGRRSLRVDNAKKTVARDEDRVRKKARYEKEAEKHSGVVKGREDSYPRKGAD-  867

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
                    +     DRR+ER+YS+  WQ RDDDL GRR+K+E+ RKRE  DEI  +HR+K 
Sbjct  868   ------SSSAHYVDRRREREYSEGLWQRRDDDLQGRRAKMEEPRKRELIDEIGIRHRSKA  921

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ + S+RE RHL RKQL+N +LRPD+DKD  +RH  RERD+LK RYD +DDRH+KRRKE
Sbjct  922   REFEGSDREERHLYRKQLENVTLRPDYDKDMGARH--RERDELK-RYDTLDDRHNKRRKE  978

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYA  751
             + KLSREH+D+EET HS G+  +RRKRERDD SD RKRD++         RLRED+Q Y 
Sbjct  979   EVKLSREHIDKEETFHSHGETMVRRKRERDDASDHRKRDEL--------MRLREDEQLYI  1030

Query  750   RYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLS  571
             R+KE+ +FQ ER +R RER+EWYR KQSH+E L KRER+E RGG+R GR  EEK+WA  S
Sbjct  1031  RHKEDGVFQRERNDRQREREEWYRLKQSHEETLPKREREEIRGGMRAGRVPEEKAWAAQS  1090

Query  570   RGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRAR  391
             RGKDEY+ SD+  HSKD  RH +H++RR+R EN SPSR R+RE           DERRAR
Sbjct  1091  RGKDEYRNSDQ--HSKDV-RHADHIRRRDRVENESPSRLRTRE-----------DERRAR  1136

Query  390   NERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
             ++RV++R+D A   SD+S+V+EK+ K+   K K  E SD NS +  N+NED+ +G  +E 
Sbjct  1137  HDRVNSREDRAPIASDNSRVNEKRHKDYLKKGKEFE-SDHNSQMALNMNEDELNGQKNEL  1195

Query  210   VC  205
             V 
Sbjct  1196  VS  1197



>ref|XP_009774126.1| PREDICTED: uncharacterized protein LOC104224220 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009774127.1| PREDICTED: uncharacterized protein LOC104224220 isoform X2 [Nicotiana 
sylvestris]
Length=1380

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1264 (55%), Positives = 863/1264 (68%), Gaps = 84/1264 (7%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVL   TAS QS+Q  P A        A  AA G+  T          
Sbjct  1     MEDDDEFGDLYTDVL---TASFQSQQQQPPAPAPQDEAAAPRAAAGAGPTTRP-------  50

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNV-QEKTLATQPEDKQPRPNSSDFNLSLN  3589
             ID   + DD  I++GA   + +PN ++ +SV    EKTLA   +D Q      +FNL+ N
Sbjct  51    IDLNNNSDDEEILYGAPNPSSNPNFTAPNSVITGNEKTLAPL-QDVQSGSKLPEFNLNFN  109

Query  3588  PqsgqsggsigvgvGANESDLGARVFGKS-DGKSRDWAFGDSSFTDEANIdvvveegddk  3412
                 Q  G +      NESDL  RV  KS D K     F DS+F D+ NID VVEE DDK
Sbjct  110   ----QKAGKLENLSEINESDLIVRVLEKSEDMKLPKVGFQDSNFMDDDNIDFVVEERDDK  165

Query  3411  dddlvqkdENIDKPMGRSENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGDRAVdeewd  3232
             DD L++KD+N+ +    +EN +         E +IPGVSIPGVSG     GD  ++++WD
Sbjct  166   DDILIEKDQNLGE--KNAENLKDGSGNVENFEPLIPGVSIPGVSGGGGNGGDGNLEDDWD  223

Query  3231  sdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMV-EEQEW  3055
             SD  +DDL+IVLNDN HGPMGM+RMG D DD+D +  PLVIVA++D PSH PM+ EEQEW
Sbjct  224   SDDSEDDLQIVLNDNTHGPMGMERMGDDEDDEDGE--PLVIVADNDGPSHPPMIMEEQEW  281

Query  3054  GDELGNSADGERKE--DAAKVNVGPG-YAPKIGYSNHGYHHPYHSQFKYVRpgaapipga  2884
             GDE G + +GERKE  DA KVN  PG  A K+GY+NHGYHHPYHSQ+KYVRPGAAP+PGA
Sbjct  282   GDEGGPAVNGERKEINDALKVNGAPGGVAAKVGYNNHGYHHPYHSQYKYVRPGAAPMPGA  341

Query  2883  ppvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQK---GFPGYNAWGSNPSGR  2713
             P +GPGG PGQV PPVN   V GRGRGDWRP GMKG   M       PG         G 
Sbjct  342   PLLGPGGAPGQVRPPVNVGPVGGRGRGDWRPTGMKGGYGMSGWGGSAPG--------RGF  393

Query  2712  GIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLE  2533
             GIGL+FTLP+HKTIFEVDIDSF+EKPWRL GID++DFFNFGLNEESWKDYCKQLEQLRLE
Sbjct  394   GIGLEFTLPTHKTIFEVDIDSFEEKPWRLPGIDVTDFFNFGLNEESWKDYCKQLEQLRLE  453

Query  2532  STMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRS  2353
             STMQG+IRVYESGRTEQEYDPDLPPELAAAAGIQDIPSEN N GKT+   +D ARGSIR 
Sbjct  454   STMQGRIRVYESGRTEQEYDPDLPPELAAAAGIQDIPSENVNHGKTDGSSSDPARGSIRM  513

Query  2352  RPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQG----SADDDNNLEQGNQ  2185
             RPPLP GRPIQVE+GSGDRLPSIDTRPPR RDSDAIIEIVCQ     S +D N ++ GN 
Sbjct  514   RPPLPTGRPIQVETGSGDRLPSIDTRPPRQRDSDAIIEIVCQDEDQYSGNDKNEVQLGNN  573

Query  2184  PSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVI  2008
              S E  R GD  G   QED    DGFQH+Y   K++  +RR++F +   D  ++ D V  
Sbjct  574   SSIEDFR-GDAKGSPLQED---SDGFQHSYKSHKQDLSTRRSQFMNPVGDHLTKGDGVGP  629

Query  2007  LPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
              PSE P  +   SRG TS +  + + V H+   +KG A   S DI  S   +D+ + VDN
Sbjct  630   FPSEAPGQFVSGSRGHTSAHGSKTNVVQHEEREKKGSAHEGSPDISPSGDSRDR-LQVDN  688

Query  1827  RREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDER  1651
             ++E+S  SV  R SP+  SP ++R  QE  +E+ D++ D+ V A  NS  ER ++++D R
Sbjct  689   QKEESFESVDHRHSPVPPSPTTDRPAQEQDMEDRDDIRDQPVGADTNSEAEREEMALDAR  748

Query  1650  TNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKL  1471
              + +   D+ +   +KK KLSS+ E+ SPQETDGGEDSKA RSSENSK +SGSS+DY KL
Sbjct  749   ADSEAMNDEFL--HSKKQKLSSRREQSSPQETDGGEDSKAGRSSENSKAQSGSSRDYRKL  806

Query  1470  HDGLEEE-VQDKRFAHVDDTRQ-TGGEEDRLQRKGRDEKETEKHRMIVKGREDSYMRKGY  1297
              D +EEE VQD R   +D+ ++    +EDR +R+  +EKE EKHR +VKGREDSY RKG 
Sbjct  807   RDDVEEEVVQDGRPMRMDNAKKAVARDEDRGRRRVYNEKEAEKHRGVVKGREDSYSRKGI  866

Query  1296  DsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRN  1117
             D        +     DRR+ER+YS+  WQ RD+DL GRR+KVE+ RKRE  DE  S+HR+
Sbjct  867   D-------SSSAHYIDRRREREYSEAVWQRRDEDLPGRRTKVEEPRKRELIDETGSRHRS  919

Query  1116  KIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRR  937
             K+R+ D S+RE RHL RKQL++ +LRPD+DKD  +  R+R+RD+LK RYD +DDRH+KRR
Sbjct  920   KVREFDGSDREERHLHRKQLESITLRPDYDKDMGA--RQRDRDELK-RYDTLDDRHNKRR  976

Query  936   KEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQH  757
             KE+TKLSREH D+EE+ H  G+  +RRKRERDD SD RKRD++         RLR+D+QH
Sbjct  977   KEETKLSREHADKEESFHPHGENMVRRKRERDDTSDHRKRDEL--------LRLRDDEQH  1028

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
             Y R+KE+ +FQ ER +R RER+EWYR KQS +E LSKRER+E RGG+R GR AEEK+WAG
Sbjct  1029  YIRHKEDGVFQRERTDRQREREEWYRLKQSQEEALSKREREEIRGGMRAGRVAEEKAWAG  1088

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              SRGKDE + SD+  H KD  RH +H++RR+R EN SPSR R+RE           DERR
Sbjct  1089  HSRGKDENRNSDQ--HLKDV-RHADHIRRRDRAENESPSRLRTRE-----------DERR  1134

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             AR +RVS R+D A +  D+S+V+EK+ KE   K K  E  D NS + SN+NED+ +G  +
Sbjct  1135  ARPDRVSAREDRAPHAPDNSRVNEKRHKEYLKKGKEFEG-DHNSQIASNMNEDELNGRRN  1193

Query  216   ETVC  205
             E + 
Sbjct  1194  EMMS  1197



>ref|XP_009589662.1| PREDICTED: uncharacterized protein LOC104086995 [Nicotiana tomentosiformis]
Length=1374

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/1265 (54%), Positives = 863/1265 (68%), Gaps = 92/1265 (7%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPP-PVAQNLgggggaaaaAEGSKATETSSVFQSP  3769
             MEDDDEFGDLYTDVL   TAS QS+QPP P  Q+      AAA A  +            
Sbjct  1     MEDDDEFGDLYTDVL---TASFQSQQPPAPAPQDKAAASKAAAGAGPTTRP---------  48

Query  3768  RIDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNV-QEKTLATQPEDKQPRPNSSDFNLSL  3592
              ID  ++ DD  I++GA   N +P  ++ +S+    EKTLA  P D Q   N  +FNL+ 
Sbjct  49    -IDLNINSDDEEILYGAPNPNLNPKFTAPNSIITGNEKTLAALP-DVQSGSNLPEFNLNF  106

Query  3591  NPqsgqsggsigvgvGANESDLGARVFGKS-DGKSRDWAFGDSSFTDEANIdvvveegdd  3415
             N    Q  G +      NESD  ARV  KS D K     F DS+F DE NID VVEE DD
Sbjct  107   N----QKAGKLEDLSDINESDSSARVLEKSEDVKLPKGGFQDSNFMDEDNIDFVVEERDD  162

Query  3414  kdddlvqkdENIDKPMGRSENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGDRAVdeew  3235
             KDD L++KD+N+ +    +E  +         E +IPG+SIPGVSG     GD  ++++W
Sbjct  163   KDDILIEKDQNLGE--RNNEILKDGSENVQNFEPLIPGLSIPGVSGGGGNGGDGNLEDDW  220

Query  3234  dsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEW  3055
             DSD  +DDL+IVLNDN HGPMGM+RMG D DD+D +  PLVIVA++D PSH PM+ E++ 
Sbjct  221   DSDDSEDDLQIVLNDNTHGPMGMERMGDDEDDEDGE--PLVIVADNDGPSHPPMIMEEQE  278

Query  3054  GDELGN-SADGERKE--DAAKVNVGPG-YAPKIGYSNHGYHHPYHSQFKYVRpgaapipg  2887
               E G  +A+GERKE  DA KVN  PG    K+GY+NHGYHHPYHSQ+KYVRPGAAP+PG
Sbjct  279   WGEEGGPAANGERKEINDALKVNGAPGGVVAKVGYNNHGYHHPYHSQYKYVRPGAAPMPG  338

Query  2886  appvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQK---GFPGYNAWGSNPSG  2716
             AP +GPGG PGQV PPVN   V GRGRGDWRP GMKG   M       PG         G
Sbjct  339   APLLGPGGAPGQVRPPVNVGPVGGRGRGDWRPTGMKGGYGMSGWGGSAPG--------RG  390

Query  2715  RGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRL  2536
              GIGL+FTLPSHKTIFEVDID F+EKPWRL GID++DFFNFGLNE+ WKDYCKQLEQLRL
Sbjct  391   FGIGLEFTLPSHKTIFEVDIDGFEEKPWRLPGIDVTDFFNFGLNEDIWKDYCKQLEQLRL  450

Query  2535  ESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
             ESTMQG+IRVYESGRTEQEYDPDLPPELAAAAGIQDIPSEN N GKT+   +DLARGSIR
Sbjct  451   ESTMQGRIRVYESGRTEQEYDPDLPPELAAAAGIQDIPSENVNHGKTDGTSSDLARGSIR  510

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQG----SADDDNNLEQGN  2188
              RPPLP GRPIQVE+GSGDRLPSIDTRPPR RDSDAIIEIVCQ     S +D N ++ GN
Sbjct  511   MRPPLPTGRPIQVETGSGDRLPSIDTRPPRQRDSDAIIEIVCQDDDQYSGNDKNEVQLGN  570

Query  2187  QPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVV  2011
                 +  RG    G LQ++     DGFQH+Y   K++  +RR++F +   D+ ++ D V 
Sbjct  571   NSPTDDFRGDARGGPLQEDS----DGFQHSYKSHKQDLSTRRSQFMNPVGDRLTKGDGVG  626

Query  2010  ILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVD  1831
               PSE P  +  DSRGQTS   G K  V  ++   KG AR  S DI  S   +D+ + VD
Sbjct  627   PFPSEAPGQFVSDSRGQTSAC-GSKTNVEREN---KGSAREGSPDISPSGDSRDR-LQVD  681

Query  1830  NRREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDE  1654
             N+RE+S+ SV  R SP+  SP ++R  QE  +E+ DN+ D+ V A  NS + R +++ D 
Sbjct  682   NQREESVESVDHRHSPVPPSPTTDRPAQEQDMEDRDNIPDQPVGADTNSEVVREEMAFDA  741

Query  1653  RTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHK  1474
             R++ +   D+ +   +KK KLSS+ E+ SPQETDGGEDSKA RSSENSK +SGSS+DY K
Sbjct  742   RSDSEAMNDEFL--HSKKQKLSSRREQSSPQETDGGEDSKAGRSSENSKAQSGSSRDYRK  799

Query  1473  LHDGLEEE-VQDKRFAHVDDTRQ-TGGEEDRLQRKGRDEKETEKHRMIVKGREDSYMRKG  1300
             L D +EEE VQD R   +D+ ++    +EDR++R+  +EKE EKHR +VKGREDSY RKG
Sbjct  800   LRDDVEEEVVQDGRSMRMDNAKKAVARDEDRVRRRAYNEKEAEKHRGVVKGREDSYSRKG  859

Query  1299  YDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHR  1120
              D        +     DRR+ER+YS+  WQ RD+DL GRR+KVE+ RKRE  DE  S+HR
Sbjct  860   VD-------SSSAHYIDRRREREYSEAVWQRRDEDLPGRRTKVEEPRKRELIDETGSRHR  912

Query  1119  NKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKR  940
             +K+R+ D S+RE RHL RKQL++ +LRPD+DKD  +  R+R+RD+LK RYD +DDRH+KR
Sbjct  913   SKVREFDGSDREERHLHRKQLESITLRPDYDKDMGA--RQRDRDELK-RYDTLDDRHNKR  969

Query  939   RKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQ  760
             RKE+TKLSREH D+E++ H  G+  + RKR+RDD SD RKRD++         RLR+D+Q
Sbjct  970   RKEETKLSREHADKEDSFHPHGENMVHRKRDRDDTSDHRKRDEL--------LRLRDDEQ  1021

Query  759   HYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWA  580
             HY R+KE+ +FQ ER +R RER+EWYR KQS +E LSKRER+E RGG+R GR AEEK+WA
Sbjct  1022  HYIRHKEDGVFQRERSDRQREREEWYRLKQSQEEALSKREREEIRGGMRAGRVAEEKAWA  1081

Query  579   GLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDER  400
             G SRGKDE++ SD+  H KD  RH +H++RR+R EN SPSR R+RE           DER
Sbjct  1082  GHSRGKDEHRNSDQ--HLKDV-RHADHIRRRDRAENESPSRLRTRE-----------DER  1127

Query  399   RARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
             RAR +RVS R+D A +  D+S+V+EK+ KE   K K  E  D NS + SN+NED+ +G  
Sbjct  1128  RARPDRVSAREDRALHAPDNSRVNEKRHKEYLKKGKEFEG-DHNSQIASNMNEDELNGRR  1186

Query  219   SETVC  205
             +E V 
Sbjct  1187  NEMVS  1191



>ref|XP_011078593.1| PREDICTED: FIP1[V]-like protein isoform X2 [Sesamum indicum]
Length=1396

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1298 (48%), Positives = 799/1298 (62%), Gaps = 132/1298 (10%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP TAS+QS QP  +                    +  +  QS  
Sbjct  1     MEDDDEFGDLYTDVLRPLTASVQS-QPGKI--------------------DAPATSQSRP  39

Query  3765  IDPKVDEDDRGIIFGAQK-SNCDPNLSSGSSVN--VQEKTLATQPE----------DKQP  3625
             IDP ++ DD  I++GA    N   N   G  +N  +QEKTL    E          +K+ 
Sbjct  40    IDPSINSDDEEILYGASDLKNLVSNSGIGLKLNASIQEKTLPQTGERGGFDLNLYSNKEA  99

Query  3624  RPNSSDFNLSLNPqsgqsggsigvgvGANESDLGARVFGKSDGKSRDWAFGDSSFTDEAN  3445
                +    L + P     G   G      E D    V  + + K  +    D +F D+  
Sbjct  100   SRIAGADRLEIEPMGLGKGEGSGGVNFMEEDDDLNIVLEERENKDDELVEKDVNFVDKP-  158

Query  3444  IdvvveegddkdddlvqkdENIDKPMGRSENCESSVVEAG-------GSEHMIPGVSIPG  3286
                                   D     +E  E++V   G       GSE MIPG+S   
Sbjct  159   ----------------------DNVYSSAERNETTVNFTGPGAVGEMGSEQMIPGLS---  193

Query  3285  VSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIV  3106
               G  E  G   +++EW+SD  +DDL+IVLNDNNHGPMGM+RM G  D+DD+DG+PLVIV
Sbjct  194   --GKMENHGGSNLEDEWESDESEDDLQIVLNDNNHGPMGMERMPGGDDEDDEDGEPLVIV  251

Query  3105  ANSDDPSHQPMVEEQE------WGDELGNSADGERKE--------DAAKVNVGPGYAPKI  2968
             A++ D  H    ++         G+E G  ADGERKE                    PKI
Sbjct  252   ADNGDVGHHHHHQQMMMEEQEYAGEEGGPGADGERKELGDTAKASGVGGAAAPAAVQPKI  311

Query  2967  GYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPP  2788
             GYSNH YHHP+HSQFKYVRPGAAPIPGA PV PGG  GQV PPV    VAGRGRGDWRP 
Sbjct  312   GYSNHVYHHPFHSQFKYVRPGAAPIPGAAPVTPGGIQGQVRPPVTMGAVAGRGRGDWRPA  371

Query  2787  GMKGALTMQKGFPGYN--AWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQG  2620
             G+KGA  MQKGFPGY   AWG+N +GRG G  LDFTLPSHKTIFEVDID F+EKPWRL G
Sbjct  372   GIKGAAPMQKGFPGYGMPAWGANAAGRGYGSGLDFTLPSHKTIFEVDIDGFEEKPWRLPG  431

Query  2619  IDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaA  2440
             IDMSDFFNFGLNE+SWKDYCK+LEQLRLE++MQ KIRVYESGR EQ+YDPDLPPELAAA 
Sbjct  432   IDMSDFFNFGLNEDSWKDYCKRLEQLRLETSMQSKIRVYESGRAEQDYDPDLPPELAAAV  491

Query  2439  GIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVR  2260
             GIQ+ PSENAN GK + G  DLAR S R RPP+P GRPI VE+GSGDRLPSIDTR PR+ 
Sbjct  492   GIQETPSENANPGKLDAGPTDLARASARGRPPVPIGRPIPVETGSGDRLPSIDTRRPRMH  551

Query  2259  DSDAIIEIVCQGSADDDNNLEQG-NQPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWK  2083
             DSDAIIEIVCQ S +DD   EQ  N P+ E + G DE+ D++Q+D   +  F HAYNG  
Sbjct  552   DSDAIIEIVCQSSPEDDEMAEQQINDPAAEDLGGVDEVDDIKQDDADRIGRFSHAYNGQN  611

Query  2082  REFGSRRAEFNSGPYDKSRSDRVVI-------LPSEEPDSYHPDSRGQTSVYPGRKHAVA  1924
             RE  ++RA+       KS + R  I         SE P  YHPD          R+  ++
Sbjct  612   REVVAKRAQV------KSSTSRAEIGREDDLHFASEAPVQYHPD----------REIGIS  655

Query  1923  H---DSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsV  1753
             H   D    KGR   +S  + ASE+ ++KQI VD++ E   S         SS  +  S 
Sbjct  656   HEESDRRSTKGRGHVKSPKMNASENNREKQI-VDDQNE---SFDSEDGKQKSSSRAIESD  711

Query  1752  QESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEE  1573
              E  V   D  +DE V   +NS ME+ +++VD  TN D   D  ++ +  K K++S L E
Sbjct  712   GEQVVTAGDEANDESVLDDKNSDMEKEEMAVDAPTN-DALGDGKLMHSTNKQKINS-LVE  769

Query  1572  PSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGE  1396
             P  QE D GEDSK ARSS+NSK RSGSSKD+ K  D  E+EV QD+  A   + ++   +
Sbjct  770   PLSQEHDDGEDSKTARSSDNSKARSGSSKDHRKFQDSFEDEVLQDRHHARTGNIKRAVAD  829

Query  1395  EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDV  1219
             ED  +RK R E+ E  +H + VKGREDS+ R+  D +S+ H H K   AD RKE D S+ 
Sbjct  830   EDTARRKSRHERDEPGRHHIAVKGREDSHSRRSGDVTSSVHRHMKGENADWRKESDISEG  889

Query  1218  AWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLR  1039
             +W+ RD+DLHGRR++VED+RKREHG EI S++R K+R+ +RS R+  H  RKQ+DNGS R
Sbjct  890   SWRRRDEDLHGRRARVEDTRKREHGGEIGSRNRAKVRESERSARDEHHQSRKQVDNGSWR  949

Query  1038  -PDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTL  862
               ++++D  SR R+R+ D+LK+R + +DD H+KRRKE   ++ +H ++E+  ++  + + 
Sbjct  950   GANNNQDMGSRQRDRD-DNLKTRNEKVDDPHNKRRKEGAHINWDHAEKEDITYNHRESSS  1008

Query  861   RRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWY  682
              RKRE+DD SDQ KRD+ +        ++++DD HYAR KE+   + ERGER R+ DE +
Sbjct  1009  SRKREKDDSSDQWKRDEHA--------KVKDDDMHYARQKEDGSLKKERGERQRDGDERH  1060

Query  681   RPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVE  502
             R K+SH+EILS+RER+E R  +R GR AE+K+W+  SRGKDEYKGS REYH KD GRH +
Sbjct  1061  RLKESHEEILSRREREETRPVMRSGRPAEDKTWSSHSRGKDEYKGSGREYHPKDVGRHSD  1120

Query  501   HLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEK  322
              LKRR+R EN S  ++R  ED + RG+Q S D++R R E+  T  +   Y SD+S++HE 
Sbjct  1121  QLKRRDRVENESFLQNRGHEDMHARGNQVSNDKKRTRYEKSGTSDERVVYASDTSRLHEP  1180

Query  321   KRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETV  208
             ++KE+S K K  E+ D+ SL+PS  N+D+ SG  SETV
Sbjct  1181  RQKESSRKSKESESGDRGSLIPSKRNQDEHSGQISETV  1218



>ref|XP_011078592.1| PREDICTED: FIP1[V]-like protein isoform X1 [Sesamum indicum]
Length=1397

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1299 (48%), Positives = 799/1299 (62%), Gaps = 133/1299 (10%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP TAS+QS QP  +                    +  +  QS  
Sbjct  1     MEDDDEFGDLYTDVLRPLTASVQS-QPGKI--------------------DAPATSQSRP  39

Query  3765  IDPKVDEDDRGIIFGAQK-SNCDPNLSSGSSVN--VQEKTLATQPE----------DKQP  3625
             IDP ++ DD  I++GA    N   N   G  +N  +QEKTL    E          +K+ 
Sbjct  40    IDPSINSDDEEILYGASDLKNLVSNSGIGLKLNASIQEKTLPQTGERGGFDLNLYSNKEA  99

Query  3624  RPNSSDFNLSLNPqsgqsggsigvgvGANESDLGARVFGKSDGKSRDWAFGDSSFTDEAN  3445
                +    L + P     G   G      E D    V  + + K  +    D +F D+  
Sbjct  100   SRIAGADRLEIEPMGLGKGEGSGGVNFMEEDDDLNIVLEERENKDDELVEKDVNFVDKP-  158

Query  3444  IdvvveegddkdddlvqkdENIDKPMGRSENCESSVVEAG-------GSEHMIPGVSIPG  3286
                                   D     +E  E++V   G       GSE MIPG+S   
Sbjct  159   ----------------------DNVYSSAERNETTVNFTGPGAVGEMGSEQMIPGLS---  193

Query  3285  VSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIV  3106
               G  E  G   +++EW+SD  +DDL+IVLNDNNHGPMGM+RM G  D+DD+DG+PLVIV
Sbjct  194   --GKMENHGGSNLEDEWESDESEDDLQIVLNDNNHGPMGMERMPGGDDEDDEDGEPLVIV  251

Query  3105  ANSDDPSHQPMVEEQE------WGDELGNSADGERKE--------DAAKVNVGPGYAPKI  2968
             A++ D  H    ++         G+E G  ADGERKE                    PKI
Sbjct  252   ADNGDVGHHHHHQQMMMEEQEYAGEEGGPGADGERKELGDTAKASGVGGAAAPAAVQPKI  311

Query  2967  GYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPP  2788
             GYSNH YHHP+HSQFKYVRPGAAPIPGA PV PGG  GQV PPV    VAGRGRGDWRP 
Sbjct  312   GYSNHVYHHPFHSQFKYVRPGAAPIPGAAPVTPGGIQGQVRPPVTMGAVAGRGRGDWRPA  371

Query  2787  GMKGALTMQKGFPGYN--AWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQG  2620
             G+KGA  MQKGFPGY   AWG+N +GRG G  LDFTLPSHKTIFEVDID F+EKPWRL G
Sbjct  372   GIKGAAPMQKGFPGYGMPAWGANAAGRGYGSGLDFTLPSHKTIFEVDIDGFEEKPWRLPG  431

Query  2619  IDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaA  2440
             IDMSDFFNFGLNE+SWKDYCK+LEQLRLE++MQ KIRVYESGR EQ+YDPDLPPELAAA 
Sbjct  432   IDMSDFFNFGLNEDSWKDYCKRLEQLRLETSMQSKIRVYESGRAEQDYDPDLPPELAAAV  491

Query  2439  GIQDIPSENANLGKTEVGQNDLARGSIRSRPPL-PAGRPIQVESGSGDRLPSIDTRPPRV  2263
             GIQ+ PSENAN GK + G  DLAR S R RPP+ P GRPI VE+GSGDRLPSIDTR PR+
Sbjct  492   GIQETPSENANPGKLDAGPTDLARASARGRPPVQPIGRPIPVETGSGDRLPSIDTRRPRM  551

Query  2262  RDSDAIIEIVCQGSADDDNNLEQG-NQPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGW  2086
              DSDAIIEIVCQ S +DD   EQ  N P+ E + G DE+ D++Q+D   +  F HAYNG 
Sbjct  552   HDSDAIIEIVCQSSPEDDEMAEQQINDPAAEDLGGVDEVDDIKQDDADRIGRFSHAYNGQ  611

Query  2085  KREFGSRRAEFNSGPYDKSRSDRVVI-------LPSEEPDSYHPDSRGQTSVYPGRKHAV  1927
              RE  ++RA+       KS + R  I         SE P  YHPD          R+  +
Sbjct  612   NREVVAKRAQV------KSSTSRAEIGREDDLHFASEAPVQYHPD----------REIGI  655

Query  1926  AH---DSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrs  1756
             +H   D    KGR   +S  + ASE+ ++KQI VD++ E   S         SS  +  S
Sbjct  656   SHEESDRRSTKGRGHVKSPKMNASENNREKQI-VDDQNE---SFDSEDGKQKSSSRAIES  711

Query  1755  VQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLE  1576
               E  V   D  +DE V   +NS ME+ +++VD  TN D   D  ++ +  K K++S L 
Sbjct  712   DGEQVVTAGDEANDESVLDDKNSDMEKEEMAVDAPTN-DALGDGKLMHSTNKQKINS-LV  769

Query  1575  EPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGG  1399
             EP  QE D GEDSK ARSS+NSK RSGSSKD+ K  D  E+EV QD+  A   + ++   
Sbjct  770   EPLSQEHDDGEDSKTARSSDNSKARSGSSKDHRKFQDSFEDEVLQDRHHARTGNIKRAVA  829

Query  1398  EEDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSD  1222
             +ED  +RK R E+ E  +H + VKGREDS+ R+  D +S+ H H K   AD RKE D S+
Sbjct  830   DEDTARRKSRHERDEPGRHHIAVKGREDSHSRRSGDVTSSVHRHMKGENADWRKESDISE  889

Query  1221  VAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSL  1042
              +W+ RD+DLHGRR++VED+RKREHG EI S++R K+R+ +RS R+  H  RKQ+DNGS 
Sbjct  890   GSWRRRDEDLHGRRARVEDTRKREHGGEIGSRNRAKVRESERSARDEHHQSRKQVDNGSW  949

Query  1041  R-PDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGT  865
             R  ++++D  SR R+R+ D+LK+R + +DD H+KRRKE   ++ +H ++E+  ++  + +
Sbjct  950   RGANNNQDMGSRQRDRD-DNLKTRNEKVDDPHNKRRKEGAHINWDHAEKEDITYNHRESS  1008

Query  864   LRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEW  685
               RKRE+DD SDQ KRD+ +        ++++DD HYAR KE+   + ERGER R+ DE 
Sbjct  1009  SSRKREKDDSSDQWKRDEHA--------KVKDDDMHYARQKEDGSLKKERGERQRDGDER  1060

Query  684   YRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHV  505
             +R K+SH+EILS+RER+E R  +R GR AE+K+W+  SRGKDEYKGS REYH KD GRH 
Sbjct  1061  HRLKESHEEILSRREREETRPVMRSGRPAEDKTWSSHSRGKDEYKGSGREYHPKDVGRHS  1120

Query  504   EHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHE  325
             + LKRR+R EN S  ++R  ED + RG+Q S D++R R E+  T  +   Y SD+S++HE
Sbjct  1121  DQLKRRDRVENESFLQNRGHEDMHARGNQVSNDKKRTRYEKSGTSDERVVYASDTSRLHE  1180

Query  324   KKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETV  208
              ++KE+S K K  E+ D+ SL+PS  N+D+ SG  SETV
Sbjct  1181  PRQKESSRKSKESESGDRGSLIPSKRNQDEHSGQISETV  1219



>ref|XP_010656604.1| PREDICTED: FIP1[V]-like protein [Vitis vinifera]
Length=1474

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/1130 (52%), Positives = 725/1130 (64%), Gaps = 101/1130 (9%)
 Frame = -1

Query  3333  EAG--GSEHMIPGVS----IPGVSGVPETCG----------DRAVdeewdsdsdddDLRI  3202
             EAG  G + +IPG+S    IP +    E             D +V  +      +DDL+I
Sbjct  175   EAGDVGLDPIIPGLSAAPAIPSLDAPVEPQNREKTNVVARDDASVQGDDWDSDSEDDLQI  234

Query  3201  VLNDNNHGPmgmdrm-ggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADG  3025
             VLNDNNHGPM  +R      DD+D+DGDPLVIVA+ D  +H P+ EEQEWG++   + DG
Sbjct  235   VLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THPPL-EEQEWGED--TAVDG  290

Query  3024  ERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgq  2851
             ERKE  DAAKVN      PKIGYS+HGYH P+HSQFKYVRPGAAPIPGA  V PGGTPGQ
Sbjct  291   ERKEGADAAKVNGAIAGPPKIGYSSHGYH-PFHSQFKYVRPGAAPIPGAAAVVPGGTPGQ  349

Query  2850  vhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---GYNAWGSNPSGRGIG--LDFTLP  2686
             V P  N   V GRGRGDWRP G+K A  MQK F    G  AWG N +GRG G  L+FTLP
Sbjct  350   VRPLANIGPVPGRGRGDWRPAGIKNAPPMQKNFHSGFGAPAWGGNMAGRGFGGGLEFTLP  409

Query  2685  SHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRV  2506
             SHKTIF+VDIDSF+EKPWR  G+D+SDFFNFG NEESWK YCKQLEQLRLE+TMQ KIRV
Sbjct  410   SHKTIFDVDIDSFEEKPWRHPGVDISDFFNFGFNEESWKQYCKQLEQLRLEATMQTKIRV  469

Query  2505  YESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRP  2326
             YESGRTEQEYDPDLPPELAAA GI D+ +EN NLG+ +VG +DLA+ S R RPP+P GR 
Sbjct  470   YESGRTEQEYDPDLPPELAAAVGIHDVSAENGNLGRADVGPSDLAKASARVRPPIPTGRA  529

Query  2325  IQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSREGIR  2164
             IQVE G G+RLPS+DTRPPRVRDSDAIIEI  QGS DDD+    G      N   RE +R
Sbjct  530   IQVEGGCGERLPSVDTRPPRVRDSDAIIEITLQGSLDDDSPTGNGAPEPPDNDLPREDLR  589

Query  2163  GGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEP  1990
              G+E+  D  QED  + D F   Y+G  RE   R A F NS   D    D ++  P E P
Sbjct  590   VGNEVEDDAAQEDTEYFDSFSTTYSGRNRELVGRSAPFMNSLRDDMPGGDGILPFPPEAP  649

Query  1989  DSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSL  1810
               Y P SRGQ  V+PG      H+  R +GRA  +S  +   +S +D +  +D+++E+S+
Sbjct  650   VQYRPGSRGQDPVHPGGNFGTPHEDRRIRGRAHGKSPHMTPIQSTRDNRF-LDSQKEESV  708

Query  1809  SVGDrrsplssspvsnrsVQESAVENNDNLHDE---------------------------  1711
                D    ++SSPV     +E +VE  D +HDE                           
Sbjct  709   ESMD-VKGMTSSPVRVAPPREPSVEKKDAVHDEIELADGMEREELTSDIIVTTDTSKVGN  767

Query  1710  -------------------------LVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTA  1606
                                      +V A   SGMER +++ +  T+ D  KD+++I   
Sbjct  768   SVQSGKKQKLSSRVEQPPPQELDGGIVLADGTSGMEREELTSNTMTSTDALKDENLIPFG  827

Query  1605  KKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA  1429
             KK KLSS++E+P PQE DG ED KA RSSENSK RS SS+D  K HDG EEEV +D    
Sbjct  828   KKQKLSSRVEQPPPQELDGDEDLKATRSSENSKARSESSRDLQKWHDGGEEEVIEDGSSV  887

Query  1428  HVDDT-RQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSI  1255
              + ++ R    +E   +RK RD  +E E+ RM+VKGRED+Y  + +DS   HHSH KT  
Sbjct  888   RMGNSKRHLDEDEQSFRRKDRDGRQEMERSRMVVKGREDTYPHRDWDSIPNHHSHVKTDS  947

Query  1254  ADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRH  1075
              DRRKERD SD  WQ RDDDLHGRR + ED+RK+E GDE+ S+HR+K+R+ +RS ++   
Sbjct  948   FDRRKERDSSDGGWQRRDDDLHGRRIRPEDARKQERGDEMGSRHRSKVRESERSNKDELL  1007

Query  1074  LLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDRE  895
               RK LDNGS R   DKD  SRHRER+ D+LKSRY N+DD H KRRK++  L R+H ++E
Sbjct  1008  HSRKLLDNGSWRGHQDKDMGSRHRERD-DNLKSRYGNLDDLHGKRRKDEEYLRRDHAEKE  1066

Query  894   ETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSER  715
             ETLHS  +   RRKRERDD+ DQRKRDD    R RD+     DD H  R+K+E   Q ER
Sbjct  1067  ETLHSHRESASRRKRERDDVLDQRKRDD--QPRIRDNL----DDHHSVRHKDEGWMQRER  1120

Query  714   GERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDRE  535
             GER RER+EW+R +Q H+E LSKRER+EGRG +R GR AE+K+W   +RGKDEYKGSD++
Sbjct  1121  GERQREREEWHRLRQPHEENLSKREREEGRGAVRSGRGAEDKAWVSHARGKDEYKGSDKD  1180

Query  534   YHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAA  355
             Y  KD GRH E  KRR+R E+ S S HR RED Y RG Q S +ERR+R ER S R DH++
Sbjct  1181  YQYKDTGRHSEQPKRRDRVEDESFSHHRGREDVYARGSQFSNEERRSRQERSSARNDHSS  1240

Query  354   YESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
               SD  +VH+KK KEN+ K+K  E +D ++L PS  N++D +   +ETV 
Sbjct  1241  NASDHQRVHDKKHKENTRKNKESEGADISTLGPSKRNQEDHNSQRNETVI  1290



>ref|XP_006453658.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
 gb|ESR66898.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
Length=1171

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/1036 (52%), Positives = 684/1036 (66%), Gaps = 53/1036 (5%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  3034
             L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153   LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  3033  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaa  2899
             A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFKYVRPGAA
Sbjct  209   APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAA  268

Query  2898  pipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNP  2722
             PIPG+      G PGQV P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  
Sbjct  269   PIPGSATAVAAGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGV  328

Query  2721  SGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQL  2542
             +  G GL+FTLPSHKTIFEVDID F+EKPW+   +D++DFFNFGLNEESWKDYCKQLEQ 
Sbjct  329   NMAGRGLEFTLPSHKTIFEVDIDGFEEKPWKYPSVDITDFFNFGLNEESWKDYCKQLEQH  388

Query  2541  RLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGS  2362
             RLE+TMQ KIRVYESGR +QEYDPDLPPELAAA GI D+P++N NLGK ++GQ+DL +G 
Sbjct  389   RLETTMQSKIRVYESGR-DQEYDPDLPPELAAATGILDVPADNTNLGKPDIGQSDLTKGP  447

Query  2361  IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---  2191
              R RPP+P GR IQVE GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   
Sbjct  448   ARVRPPIPTGRAIQVEGGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRD  507

Query  2190  NQPSREGIRGG-----DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-S  2029
             N   RE  RG      DE+G +   D  + DGF+ AY+   RE     A F +  +D   
Sbjct  508   NDLPREDRRGENDGAEDEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIP  564

Query  2028  RSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKD  1849
               + ++  P E P  Y P SRG T   PG     +H+  R  GR   RS  +  S+SP+ 
Sbjct  565   EGNGLLPFPPEAPIRYRPGSRGPTPKCPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQI  624

Query  1848  KQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGK  1669
             ++   DN+ E+S+   + +    SSPV  R  +E +VE+ D +HDELV    +S +E  K
Sbjct  625   RKFH-DNQDEESVESMEGKHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--K  681

Query  1668  ISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSS  1489
                +  T  D  KD   + + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS
Sbjct  682   EETNAVTTSDSRKDGKALYSLKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSS  741

Query  1488  KDYHKLHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDS  1315
             +D  K  +G EE +QD+R   +   ++   E E   +RK R+  +E E++RM+  GRE S
Sbjct  742   RDNKKWREGDEEVMQDRRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGS  801

Query  1314  YMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGD  1141
             + R+ +D S  H    K    DRRKER+ SD  WQ RD++ + R++++ED+RKRE  H D
Sbjct  802   HPRRDFDPSLTHDMQMKPEGFDRRKERENSDGVWQRRDEEPYSRKNRIEDTRKREREHLD  861

Query  1140  EIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNI  961
             EI ++HR K R+ +R +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +
Sbjct  862   EIGARHRGKARESERIDRDEFLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMV  920

Query  960   DDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ  781
             DD  SKRRK+D  + R+H +++E LH   D T RRKRERDDI DQR+R+D         Q
Sbjct  921   DDYISKRRKDDEYVRRDHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQ  972

Query  780   RLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVG  607
             R+RE  DD H  R+K+E   Q ERGER RER++W+R K  H+EILSKRER+EGRG +R G
Sbjct  973   RIRENFDDHHPVRHKDENWSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSG  1031

Query  606   RAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGR  427
             R++E+++W G +R KDEYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y R
Sbjct  1032  RSSEDRAWVGHARVKDEYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYAR  1091

Query  426   GHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNL  247
             G+Q S ++R++R ER   R D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  
Sbjct  1092  GNQISNEDRKSRQERSGPRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKR  1151

Query  246   NEDDRSGNASETVC*I  199
             N++D+SG+ SE VC I
Sbjct  1152  NQEDQSGHVSEMVCSI  1167



>ref|XP_006473979.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X1 [Citrus sinensis]
 ref|XP_006473980.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X2 [Citrus sinensis]
Length=1346

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/1076 (51%), Positives = 703/1076 (65%), Gaps = 66/1076 (6%)
 Frame = -1

Query  3309  IPGVSIPGVS--GVPET---------CGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmd  3163
             +PG+ IPG+S  GV  +          G+ A  E+      +DDL+IVLN++NH PM +D
Sbjct  111   VPGIEIPGISQNGVENSGRQNRNEGEVGEEA--EDDWESDSEDDLQIVLNEDNHRPMLID  168

Query  3162  rmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGP  2986
               GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G 
Sbjct  169   GGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAAAQMGEGGAEKKEGT  224

Query  2985  G--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaapipgappvgpggtpgq  2851
             G               A KIGYSNH  YH+PYHSQFKYVRPGAAPIPG+      G PGQ
Sbjct  225   GERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAAPIPGSATAVAAGGPGQ  284

Query  2850  vhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKT  2674
             V P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  +  G GL+FTLPSHKT
Sbjct  285   VRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGVNMAGRGLEFTLPSHKT  344

Query  2673  IFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESG  2494
             IF+VDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESG
Sbjct  345   IFDVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESG  404

Query  2493  RTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVE  2314
             R +QEYDPDLPPELAAA GI D+P++N NLGK ++GQ+DL +G  R RPP+P GR IQVE
Sbjct  405   R-DQEYDPDLPPELAAATGILDVPADNTNLGKPDIGQSDLTKGPARVRPPIPTGRAIQVE  463

Query  2313  SGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---NQPSREGIRGG-----  2158
              GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   N   +E  RG      
Sbjct  464   GGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRDNDLPKEDRRGENDGAE  523

Query  2157  DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILPSEEPDSY  1981
             DE+G +   D  + DGF+ AY+   RE     A F +  +D     + ++  P E P  Y
Sbjct  524   DEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPFPPEAPLRY  580

Query  1980  HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVG  1801
              P SRG T  YPG     +H+  R  GR   RS  +  S+SP+ ++   DN+ E+S+   
Sbjct  581   RPGSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQIRKFH-DNQDEESVESM  639

Query  1800  DrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDS  1621
             + +    SSPV  R  +E +VE+ D +HDELV    +S +E  K   +  T  D  KD  
Sbjct  640   EGKHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--KEETNAVTTSDSRKDGK  697

Query  1620  VIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQD  1441
              + + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS+D  K  +G EE +QD
Sbjct  698   ALYSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSSRDNKKWREGDEEVMQD  757

Query  1440  KRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHT  1267
             +R   +   ++   E E   +RK R+  +E E++RM   GRE SY R+ +D S  H    
Sbjct  758   RRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMAAIGREGSYPRRDFDPSLTHDMQM  817

Query  1266  KTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGDEIESKHRNKIRDIDRS  1093
             K    DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H DEI ++HR K R+ +R 
Sbjct  818   KPEGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHRGKARESERI  877

Query  1092  EREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSR  913
             +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKRRK+D  + R
Sbjct  878   DRDEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKRRKDDEYVRR  936

Query  912   EHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARYKE  739
             +H +++E LH   D T RRKRERDDI DQR+R+D         QR+RE  DD H  R+K+
Sbjct  937   DHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQRIRENFDDHHPVRHKD  988

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             E   Q ERGER RER+EW+RPK  H+EIL KRER+EGRG +R GR++E+++W G +R KD
Sbjct  989   ENWSQRERGERQREREEWHRPK-PHEEILLKREREEGRGAVRSGRSSEDRAWVGHARVKD  1047

Query  558   EYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERV  379
             EYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y RG+Q S ++R++R ER 
Sbjct  1048  EYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYARGNQISNEDRKSRQERS  1107

Query  378   STRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
              TR D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG+ SE 
Sbjct  1108  GTRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSGHVSEM  1163



>ref|XP_006473981.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X3 [Citrus sinensis]
Length=1342

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/1073 (51%), Positives = 701/1073 (65%), Gaps = 66/1073 (6%)
 Frame = -1

Query  3309  IPGVSIPGVS--GVPET---------CGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmd  3163
             +PG+ IPG+S  GV  +          G+ A  E+      +DDL+IVLN++NH PM +D
Sbjct  111   VPGIEIPGISQNGVENSGRQNRNEGEVGEEA--EDDWESDSEDDLQIVLNEDNHRPMLID  168

Query  3162  rmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGP  2986
               GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G 
Sbjct  169   GGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAAAQMGEGGAEKKEGT  224

Query  2985  G--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaapipgappvgpggtpgq  2851
             G               A KIGYSNH  YH+PYHSQFKYVRPGAAPIPG+      G PGQ
Sbjct  225   GERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAAPIPGSATAVAAGGPGQ  284

Query  2850  vhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKT  2674
             V P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  +  G GL+FTLPSHKT
Sbjct  285   VRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGVNMAGRGLEFTLPSHKT  344

Query  2673  IFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESG  2494
             IF+VDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESG
Sbjct  345   IFDVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESG  404

Query  2493  RTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVE  2314
             R +QEYDPDLPPELAAA GI D+P++N NLGK ++GQ+DL +G  R RPP+P GR IQVE
Sbjct  405   R-DQEYDPDLPPELAAATGILDVPADNTNLGKPDIGQSDLTKGPARVRPPIPTGRAIQVE  463

Query  2313  SGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---NQPSREGIRGG-----  2158
              GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   N   +E  RG      
Sbjct  464   GGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRDNDLPKEDRRGENDGAE  523

Query  2157  DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILPSEEPDSY  1981
             DE+G +   D  + DGF+ AY+   RE     A F +  +D     + ++  P E P  Y
Sbjct  524   DEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPFPPEAPLRY  580

Query  1980  HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVG  1801
              P SRG T  YPG     +H+  R  GR   RS  +  S+SP+ ++   DN+ E+S+   
Sbjct  581   RPGSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQIRKFH-DNQDEESVESM  639

Query  1800  DrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDS  1621
             + +    SSPV  R  +E +VE+ D +HDELV    +S +E  K   +  T  D  KD  
Sbjct  640   EGKHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--KEETNAVTTSDSRKDGK  697

Query  1620  VIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQD  1441
              + + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS+D  K  +G EE +QD
Sbjct  698   ALYSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSSRDNKKWREGDEEVMQD  757

Query  1440  KRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHT  1267
             +R   +   ++   E E   +RK R+  +E E++RM   GRE SY R+ +D S  H    
Sbjct  758   RRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMAAIGREGSYPRRDFDPSLTHDMQM  817

Query  1266  KTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGDEIESKHRNKIRDIDRS  1093
             K    DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H DEI ++HR K R+ +R 
Sbjct  818   KPEGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHRGKARESERI  877

Query  1092  EREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSR  913
             +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKRRK+D  + R
Sbjct  878   DRDEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKRRKDDEYVRR  936

Query  912   EHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARYKE  739
             +H +++E LH   D T RRKRERDDI DQR+R+D         QR+RE  DD H  R+K+
Sbjct  937   DHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQRIRENFDDHHPVRHKD  988

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             E   Q ERGER RER+EW+RPK  H+EIL KRER+EGRG +R GR++E+++W G +R KD
Sbjct  989   ENWSQRERGERQREREEWHRPK-PHEEILLKREREEGRGAVRSGRSSEDRAWVGHARVKD  1047

Query  558   EYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERV  379
             EYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y RG+Q S ++R++R ER 
Sbjct  1048  EYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYARGNQISNEDRKSRQERS  1107

Query  378   STRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
              TR D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG+ 
Sbjct  1108  GTRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSGHG  1160



>ref|XP_006453657.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
 gb|ESR66897.1| hypothetical protein CICLE_v10007258mg [Citrus clementina]
Length=1346

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/1032 (51%), Positives = 681/1032 (66%), Gaps = 53/1032 (5%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  3034
             L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153   LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  3033  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaa  2899
             A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFKYVRPGAA
Sbjct  209   APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAA  268

Query  2898  pipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNP  2722
             PIPG+      G PGQV P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  
Sbjct  269   PIPGSATAVAAGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGV  328

Query  2721  SGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQL  2542
             +  G GL+FTLPSHKTIFEVDID F+EKPW+   +D++DFFNFGLNEESWKDYCKQLEQ 
Sbjct  329   NMAGRGLEFTLPSHKTIFEVDIDGFEEKPWKYPSVDITDFFNFGLNEESWKDYCKQLEQH  388

Query  2541  RLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGS  2362
             RLE+TMQ KIRVYESGR +QEYDPDLPPELAAA GI D+P++N NLGK ++GQ+DL +G 
Sbjct  389   RLETTMQSKIRVYESGR-DQEYDPDLPPELAAATGILDVPADNTNLGKPDIGQSDLTKGP  447

Query  2361  IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---  2191
              R RPP+P GR IQVE GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   
Sbjct  448   ARVRPPIPTGRAIQVEGGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRD  507

Query  2190  NQPSREGIRGG-----DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-S  2029
             N   RE  RG      DE+G +   D  + DGF+ AY+   RE     A F +  +D   
Sbjct  508   NDLPREDRRGENDGAEDEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIP  564

Query  2028  RSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKD  1849
               + ++  P E P  Y P SRG T   PG     +H+  R  GR   RS  +  S+SP+ 
Sbjct  565   EGNGLLPFPPEAPIRYRPGSRGPTPKCPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQI  624

Query  1848  KQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGK  1669
             ++   DN+ E+S+   + +    SSPV  R  +E +VE+ D +HDELV    +S +E  K
Sbjct  625   RKFH-DNQDEESVESMEGKHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--K  681

Query  1668  ISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSS  1489
                +  T  D  KD   + + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS
Sbjct  682   EETNAVTTSDSRKDGKALYSLKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSS  741

Query  1488  KDYHKLHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDS  1315
             +D  K  +G EE +QD+R   +   ++   E E   +RK R+  +E E++RM+  GRE S
Sbjct  742   RDNKKWREGDEEVMQDRRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGS  801

Query  1314  YMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGD  1141
             + R+ +D S  H    K    DRRKER+ SD  WQ RD++ + R++++ED+RKRE  H D
Sbjct  802   HPRRDFDPSLTHDMQMKPEGFDRRKERENSDGVWQRRDEEPYSRKNRIEDTRKREREHLD  861

Query  1140  EIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNI  961
             EI ++HR K R+ +R +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +
Sbjct  862   EIGARHRGKARESERIDRDEFLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMV  920

Query  960   DDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ  781
             DD  SKRRK+D  + R+H +++E LH   D T RRKRERDDI DQR+R+D         Q
Sbjct  921   DDYISKRRKDDEYVRRDHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQ  972

Query  780   RLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVG  607
             R+RE  DD H  R+K+E   Q ERGER RER++W+R K  H+EILSKRER+EGRG +R G
Sbjct  973   RIRENFDDHHPVRHKDENWSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSG  1031

Query  606   RAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGR  427
             R++E+++W G +R KDEYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y R
Sbjct  1032  RSSEDRAWVGHARVKDEYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYAR  1091

Query  426   GHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNL  247
             G+Q S ++R++R ER   R D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  
Sbjct  1092  GNQISNEDRKSRQERSGPRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKR  1151

Query  246   NEDDRSGNASET  211
             N++D+SG+ SE 
Sbjct  1152  NQEDQSGHVSEM  1163



>ref|XP_007204683.1| hypothetical protein PRUPE_ppa000270mg [Prunus persica]
 gb|EMJ05882.1| hypothetical protein PRUPE_ppa000270mg [Prunus persica]
Length=1369

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/1027 (52%), Positives = 680/1027 (66%), Gaps = 62/1027 (6%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmd----rmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDEL  3043
             L+IVLNDN+HGPM M+        +G DDDDD D LVIVA+ +   +QPM EEQEWG++ 
Sbjct  187   LQIVLNDNDHGPMAMERGGIGGNAEGGDDDDDEDGLVIVADGE--LNQPM-EEQEWGEDG  243

Query  3042  GNSADGERKE--DAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgapp  2878
               +A+GERKE  +A K  VG G     PK+GYSNHGYH P+HSQFKYVRPGA P+ G   
Sbjct  244   AQAAEGERKEMGEAGKA-VGGGSVVAPPKVGYSNHGYH-PFHSQFKYVRPGAVPMTGPAT  301

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSG  2716
               PGG PGQV P VN   VAGRGRGDWRP G+K A  +QK F      PG+        G
Sbjct  302   SSPGGVPGQVRPLVNVGPVAGRGRGDWRPTGLKNATPLQKNFHSGFGMPGWGN-NMGGRG  360

Query  2715  RGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRL  2536
              G GL+FTLPSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNEESWKDYCKQLEQLRL
Sbjct  361   FGGGLEFTLPSHKTIFDVDIDGFEEKPWKYPGVDTSDFFNFGLNEESWKDYCKQLEQLRL  420

Query  2535  ESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
             ESTMQ KIRVYESGRTEQEYDPDLPPELAAA GI D P+ENAN GK++VGQ+DL +GS R
Sbjct  421   ESTMQSKIRVYESGRTEQEYDPDLPPELAAATGIHDFPAENANPGKSDVGQSDLVKGSAR  480

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG-----  2191
              RPP+P GR IQVE G G+RLPSIDTRPPR+RDSDAIIEIV Q S DDD++   G     
Sbjct  481   LRPPIPTGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVLQDSLDDDSSAGNGIPEKT  540

Query  2190  --NQPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSD  2020
               ++P  +  R     GDL Q D  + DGF  +YN  KRE   R+  F +S P ++    
Sbjct  541   ENDRPREDFGRSAVGEGDLAQVDSVYFDGFPASYNDRKREPVGRKIPFHDSIPEEEG---  597

Query  2019  RVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQI  1840
              ++  P E P  Y   S G+T  YPG       +    +GRAR RS  +  S + +DK+ 
Sbjct  598   -ILPFPPEAPVPYT-GSGGETPSYPGGSFGSTFEERGTQGRARDRSPRVTPSRNTRDKKF  655

Query  1839  DVDNRREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKIS  1663
              +DN++E+S+ S+  +RSP  SSPV+NR   ES+VE  D+  DE V A  +SGME+ +++
Sbjct  656   -LDNQKEESVESMDGKRSPQISSPVTNRGAHESSVECRDSDQDEPVLADGSSGMEKEEMA  714

Query  1662  VDERTNCDKAKDDSVIDTAKKH-KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
                        +D + D   KH KLSS++E+ + +E D GEDSKAARSS+NSK RSGSSK
Sbjct  715   T-------VTVNDELQDGPPKHKKLSSRVEQSADEELDDGEDSKAARSSDNSKARSGSSK  767

Query  1485  DYHKLHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSY  1312
             DY K  DG+EEEV   R  H+   ++   E E   QRK RD  +E ++   +VKGRE SY
Sbjct  768   DYQKWRDGVEEEVIQGRSTHMGGIKRHLNENEQGFQRKNRDGRQEPDRSHTVVKGREGSY  827

Query  1311  MRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIE  1132
               + +D+SSAH    K     RRKERD  D  WQ RDD+ +GRR + E++RKRE GDE+ 
Sbjct  828   PYRDWDTSSAHPLQLKNDGLHRRKERDNLDGPWQRRDDEPYGRRIRTEETRKRERGDEMG  887

Query  1131  SKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDR  952
             S+HR+K R+ +RS+++     RKQLDNGS R  HDKD  SR RERE          IDD 
Sbjct  888   SRHRSKARESERSDKDEHLQSRKQLDNGSYRVYHDKDVGSRPRERE-----GSLKGIDDY  942

Query  951   HSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLR  772
             H KRRK++  + R+H+D+E+ +H   +   RRKRERD+I DQRKRDD   QR RD+    
Sbjct  943   HGKRRKDEEYMRRDHIDKEDFVHGHRESASRRKRERDEILDQRKRDD--QQRVRDNL---  997

Query  771   EDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEE  592
              DD H  R+K+E   Q ERG+R RER+EW+R KQSH+E + KRERDEGR  +R GR AE+
Sbjct  998   -DDPHSVRHKDESWLQRERGDRQREREEWHRVKQSHEENIPKRERDEGRASIRGGRGAED  1056

Query  591   KSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPS  412
             K+W G +R KDE KGSD+E+  KD  RH E  KRR+R E  S S HR RED YGRG+Q +
Sbjct  1057  KAWVGHTRAKDESKGSDKEHQYKDTVRHSEPSKRRDRVEEES-SNHRGREDVYGRGNQLN  1115

Query  411   TDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDR  232
              DE+R+  ER STR + A    D+ K+H+++ K+N+ K+K  E +D ++ + S  +++D+
Sbjct  1116  NDEKRSGKERSSTRNERA----DNQKLHDRRPKDNTRKNKESEIADNSTTVTSKRHQEDQ  1171

Query  231   SGNASET  211
             SG++ E 
Sbjct  1172  SGHSKEM  1178



>gb|KDP38657.1| hypothetical protein JCGZ_04010 [Jatropha curcas]
Length=1372

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/1022 (52%), Positives = 690/1022 (68%), Gaps = 44/1022 (4%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgm---drmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWG---D  3049
             L+IVLNDNNHGPMGM        D DDDD+DGDPLVIVA+ D   +QPM EEQ+WG   D
Sbjct  184   LQIVLNDNNHGPMGMERGMMGDADDDDDDEDGDPLVIVADGD--PNQPM-EEQDWGVGED  240

Query  3048  ELGN-SADGERKEDAAKVNVGPGYA-PKIGYSNHGYHHPYHSQFKYVRpgaapipgappv  2875
                   A+GERKE +     G   A PK+GYSNHGYHHP+HSQFKYVRPGAAP+PGA  +
Sbjct  241   AAATVGAEGERKEGSEAAGKGSAVAGPKVGYSNHGYHHPFHSQFKYVRPGAAPMPGATTI  300

Query  2874  gpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYN--AWGSNPSGRGIG  2704
             GPGG PGQ+ PP+N + +AGRGRGDWRP G+K A +MQKG  PG+    WG+N +GRG G
Sbjct  301   GPGGVPGQIRPPINMAPIAGRGRGDWRPVGIKSAPSMQKGHHPGFGMPVWGNNMAGRGFG  360

Query  2703  --LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLES  2530
               L+FTLPSHKT+F+VDIDSF+EKPW+  G+D+SDFFNFGLNEESWKDYCKQLEQ RLE+
Sbjct  361   GGLEFTLPSHKTVFDVDIDSFEEKPWKYPGVDISDFFNFGLNEESWKDYCKQLEQHRLET  420

Query  2529  TMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
             TMQ KIRVYESGR EQEYDPD+PPELAAAAGI DIP +N++LGK+EVGQ+D+ +G  R R
Sbjct  421   TMQSKIRVYESGRAEQEYDPDMPPELAAAAGIHDIPVDNSSLGKSEVGQSDIMKGPSRVR  480

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------N  2188
             PPLP GR IQVE G G+RLPSIDTRPPR+RDSDAIIEIV Q S DDD++   G      N
Sbjct  481   PPLPTGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVLQDSLDDDSSTGHGGLDVANN  540

Query  2187  QPSREGIRGGD--EIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDR  2017
                R+  RG    E G  Q E   + D F   Y+  K   G RRA F +SG  +    D 
Sbjct  541   DAPRDDPRGTHVPEDGTAQME-TEYYDDFPQGYDNRK---GGRRAPFVDSGRANVPEGDG  596

Query  2016  VVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQID  1837
             ++    E P  Y P SRG + +  G     +H+  R +GR R RS     +++ +DK+  
Sbjct  597   ILSFRPEAPSQYRPSSRG-SPMLSGGDIEPSHEERRVQGRTRDRSPHFTPNQNKRDKRY-  654

Query  1836  VDNRREDSLSV--GDrrsplssspvsnrsVQESAVENND-NLHDELVPAQRNSGMERGKI  1666
             +DN  E+S     G     ++S          S  E+ D  +HDE V A+ +SGME+G++
Sbjct  655   LDNAEEESNESMDGKNSPLVASPAAVMDGTGLSIEEDKDVTVHDERVLAEGSSGMEKGEM  714

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             + +E T  D  KD++V  + KK KLSS++E  + QE D G DSKAARSSENSK RSGSSK
Sbjct  715   TENEVTTNDSTKDENVHRSTKKQKLSSRVELSATQELDDGGDSKAARSSENSKARSGSSK  774

Query  1485  DYHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDS  1315
             D  K  DG+EEE VQ  R       +   GE E   +RK RD + E E++ +++KGRE S
Sbjct  775   DCQKWQDGVEEEVVQGGRARRTGSVKGHLGENEQNFRRKERDARQEMERNHVVIKGREGS  834

Query  1314  YMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEI  1135
             Y ++ +D    HH H ++   DRRKER+  D AWQ R++D H R+S+ ED+RKRE GDE+
Sbjct  835   YPQRDFDPGLVHHLHMRSEGYDRRKERENLDGAWQRREEDPHSRKSRTEDTRKRERGDEM  894

Query  1134  ESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDD  955
              S+HR+K+R+ +R+++E     RKQLDNGS R  +DKD+ S+HRER +++LK RYD +DD
Sbjct  895   GSRHRSKVRESERTDKEEHLHSRKQLDNGSYRMHYDKDSSSQHRER-KENLKGRYDMVDD  953

Query  954   RHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRL  775
              HSKRRK++  L REH D+EE L +  + T RR+RERDD+ D RKR+D   QR RD+   
Sbjct  954   YHSKRRKDEEYLRREHNDKEEILLAHRETTSRRRRERDDVLDPRKRED--QQRIRDNL--  1009

Query  774   REDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAE  595
               DD H  R K+E   Q +RGER RER+E YR KQSH+E LSKR++++ RG +R GR  +
Sbjct  1010  --DDYHSVRQKDEVWLQRDRGERPREREELYRLKQSHEESLSKRDKEDARGSMRTGRGVD  1067

Query  594   EKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQP  415
             +KSW G +R KDEY+ SD+EY  KD+ R+ E  KRR+R E+ + S HR R+D Y RG+Q 
Sbjct  1068  DKSWIGHARMKDEYRVSDKEYQLKDSVRNSEQQKRRDRMEDENYSHHRRRDDVYARGNQL  1127

Query  414   STDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDD  235
             ST+ERR+R ER S R D A    D+ ++H++K K+N+ K+K  E  D N+L  S  N+DD
Sbjct  1128  STEERRSRQERSSNRIDRAVDTPDNQRMHDRKHKDNTRKNKESEGGDHNTLGSSRRNQDD  1187

Query  234   RS  229
              +
Sbjct  1188  HT  1189



>ref|XP_008242955.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103341244 
[Prunus mume]
Length=1343

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/1023 (50%), Positives = 664/1023 (65%), Gaps = 80/1023 (8%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+ + DD D   +V  +D   +QPM EEQEWG++   +A
Sbjct  187   LQIVLNDNNHGPMAMERGGIGGNAEGDDDDEDGLVIVADGELNQPM-EEQEWGEDGAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpg  2866
             +GERKE  +A K  VG G     PK+GYSNHGYH P+HSQFKYVRPGA P+ G    GPG
Sbjct  246   EGERKEMGEAGKA-VGGGSVVAPPKVGYSNHGYH-PFHSQFKYVRPGAVPMSGPATSGPG  303

Query  2865  gtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSGRGIG  2704
             G PGQV P VN   VAGRGRGDWRP G+K A  +QK F      PG+        G G G
Sbjct  304   GVPGQVRPLVNVGPVAGRGRGDWRPTGLKNATPLQKNFHSGFGMPGWGN-NMGGRGFGGG  362

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
             L+FTLPSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNEESWKDYCKQLEQLRLESTM
Sbjct  363   LEFTLPSHKTIFDVDIDGFEEKPWKYPGVDTSDFFNFGLNEESWKDYCKQLEQLRLESTM  422

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPP  2344
             Q KIRVYESGRTEQEYDPDLPPELAAA G   +   NAN GK++VGQ+DL +GS R RPP
Sbjct  423   QSKIRVYESGRTEQEYDPDLPPELAAATGXSRL---NANPGKSDVGQSDLVKGSARLRPP  479

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG-------NQ  2185
             +P GR IQVE G G+RLPSIDTRPPR+RDSDAIIEIV Q S DDD++   G       ++
Sbjct  480   IPTGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVLQDSLDDDSSAGNGIPEKTETDR  539

Query  2184  PSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVI  2008
             P  +  R     GDL Q +  + DGF  +YN  KRE   R+  F +S P ++     ++ 
Sbjct  540   PREDFGRSAVGEGDLAQVESVYFDGFPASYNDQKREPVGRKIPFHDSIPEEEG----ILP  595

Query  2007  LPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
              P E P  Y   S G+T  YPG       +    +G+AR RS  +  S + +DK+  +DN
Sbjct  596   FPPEAPVPYT-GSGGETPSYPGGSFGSTFEERGTQGKARDRSPRVTPSRNTRDKKF-LDN  653

Query  1827  RREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDER  1651
             ++E+S+ S+  +RS L SSP++NR   ES+VE  D+  DE V A  +SGME+ +++    
Sbjct  654   QKEESVESMDGKRSSLISSPITNRGAHESSVEYRDSDQDEPVLADGSSGMEKEEMAT---  710

Query  1650  TNCDKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHK  1474
                    +D + D   KHK LSS++E+ + +E D GEDSKAARSS+NSK RSGSSKDY K
Sbjct  711   ----VTVNDELQDGPPKHKKLSSRVEQSADEELDDGEDSKAARSSDNSKARSGSSKDYQK  766

Query  1473  LHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKG  1300
               DG+EEEV   R  H+   ++   E E   QRK RD  +E ++   +VKGREDSY  + 
Sbjct  767   WRDGVEEEVIQGRSTHMGGIKRHLDENEQGFQRKNRDGRQEPDRSHTVVKGREDSYPYRD  826

Query  1299  YDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHR  1120
             +D SSAH    K+    RRKERD  D  WQ RDD+ + RR + E++RKRE GDE+ S+HR
Sbjct  827   WDPSSAHPLQLKSDGLHRRKERDNLDGPWQRRDDEPYVRRIRTEETRKRERGDEMGSRHR  886

Query  1119  NKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKR  940
             +K R+ +RS+++     RKQLDNGS                           IDD H KR
Sbjct  887   SKARESERSDKDEHLQSRKQLDNGSY--------------------------IDDYHGKR  920

Query  939   RKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQ  760
             RK++  + R+H+D+E+ +H   + T RRKRERD+I DQRKRDD   QR RD+     DD 
Sbjct  921   RKDEEYMRRDHIDKEDFVHGHRESTSRRKRERDEILDQRKRDD--QQRVRDNL----DDP  974

Query  759   HYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWA  580
             H  R+K+E   Q ERG+R RER+EW+R KQSH+E + KRERDEGR  +R GR AE+K+W 
Sbjct  975   HSVRHKDESWLQRERGDRQREREEWHRVKQSHEENVPKRERDEGRASIRGGRGAEDKAWV  1034

Query  579   GLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDER  400
             G +R KDE KGSD+E+  KD  RH E  KRR+R E  S S HR RED YGRG+Q + DE+
Sbjct  1035  GHTRAKDESKGSDKEHQYKDTVRHSEPSKRRDRVEEES-SNHRGREDVYGRGNQSNNDEK  1093

Query  399   RARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
             R+  ER STR + A    D+ K+H+++ KEN+ K+K  E +D ++ + S  +++D+SG++
Sbjct  1094  RSGKERSSTRNERA----DNQKLHDRRPKENTRKNKESEIADNSTTVTSKRHQEDQSGHS  1149

Query  219   SET  211
              E 
Sbjct  1150  KEM  1152



>ref|XP_008443876.1| PREDICTED: trichohyalin isoform X2 [Cucumis melo]
Length=1395

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1302 (44%), Positives = 768/1302 (59%), Gaps = 142/1302 (11%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTA---------SLQSEQPPPVAQNLgggggaaaaAEGSKATE  3793
             MEDDDEFGDLYTDVLRPF +          L S  PPP+ ++                  
Sbjct  1     MEDDDEFGDLYTDVLRPFASPSSSSVPQHQLSSSAPPPLQRS------------------  42

Query  3792  TSSVFQSPRIDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNS  3613
                      ID     DD    FGA  SN      S   +   ++T   QP  ++  P +
Sbjct  43    ---------IDLNRHHDDENPSFGASYSN------SRVPLQFSKETPPLQPP-RESTPVA  86

Query  3612  SDFNLSLNPqsgqsggsigvgvGANESDLGARVFGKSDGKSRDW-----AFGDSSFTDEA  3448
               F   LN                N+ D G+RV G  D  S D         D +F  E+
Sbjct  87    GSFGFVLN------------LAARNDGD-GSRVKGSEDFTSVDVELPNRGLEDRNFGVES  133

Query  3447  NIdvvveegddkdddlvqkdENIDKPMGRS-ENCESSVVEAGGSEHMIPG------VSIP  3289
              I   +E+  +           +DK +    E   + V +  G E +IPG      +SI 
Sbjct  134   GIVGGLEKDVNL----------MDKDVKFDIEEGNAGVEDDVGVEPIIPGLSPSVGISIH  183

Query  3288  GVSGVPETC-GDRA--------VdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddd  3136
             G SG  E   G R            +      +DDL+I+LND++ GPM M+R G  GDD+
Sbjct  184   GTSGNLENAEGFRMNDASRDRGDGGDDWDSDSEDDLQILLNDSDRGPMAMERGGLVGDDE  243

Query  3135  dddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGY  2962
             D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE  +AAK + G   APK+GY
Sbjct  244   DEP--PLVILGDND---QNQVMEEQEWGDDAVPTADGERKETGEAAKSSAGMVVAPKLGY  298

Query  2961  SNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGM  2782
             SN+GY  P+HSQ+KYVRPGAAP PG    GPGGTP QV P VN   V GRGRGDWRP G 
Sbjct  299   SNYGYR-PFHSQYKYVRPGAAPFPGTSASGPGGTPNQVRPLVNMGPVGGRGRGDWRPAGP  357

Query  2781  KGALTMQKGFP---GYNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGID  2614
             K   ++QKGF    G   W +N  GR  G L+FTLPSHKTIFEVDIDSF+EKPW+  G+D
Sbjct  358   KDPASVQKGFHSGFGMPGWSNNMGGRSFGGLEFTLPSHKTIFEVDIDSFEEKPWKSTGVD  417

Query  2613  MSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGI  2434
             +SDFFNFGLNE+SWK+YCKQLEQLRLE+TMQ KIRVYESGRTEQ YDPDLPPELAAAAGI
Sbjct  418   ISDFFNFGLNEDSWKEYCKQLEQLRLEATMQSKIRVYESGRTEQGYDPDLPPELAAAAGI  477

Query  2433  QDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDS  2254
              DIP+E+  LGK++  QND+ +G  R RPPLPAGR IQVE G G+RLPSIDTRPPR+RDS
Sbjct  478   HDIPNEHT-LGKSDALQNDVGKGVARVRPPLPAGRAIQVEGGYGERLPSIDTRPPRIRDS  536

Query  2253  DAIIEIVCQGSADDDNNL------EQGNQPSREGIRGGDEIGDLQQE-DIHHVDGFQHAY  2095
             DAIIEIV Q S DD+++       E  + PS +  +   E  D Q E D  + D F   +
Sbjct  537   DAIIEIVLQDSLDDNSSTGNCTPNEHNDDPSGKDFKVQAEDDDAQIESDTEYPDNFSETH  596

Query  2094  NGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS  1915
             N    E   RR    + P D +R D  +   SE P  +HP SRG T  Y  +   +  + 
Sbjct  597   NSELMEKVGRRKTSMNSPSDNTREDVNLAFNSERP-GHHPASRGNTPAYSAQSLGIIEE-  654

Query  1914  TREKGRARCRSADIGASESPKDKQID---VDNRREDSL-SVGDrrsplssspvsnrsVQE  1747
              R +GR   +S       SP+    D    D+R E S  S+ D+RSP  SSP    + QE
Sbjct  655   RRSQGRTYNKSP-----HSPRQNLQDRKSSDSREEGSAGSMDDKRSPQMSSPAMVEATQE  709

Query  1746  SAVENN------DNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSS  1585
              + E+       D  HDEL+ A +N  ++R  ++    +N  K + D   +     KLS 
Sbjct  710   YSAEDKDAEHDEDAEHDELIEADKNPEIDRENVNFISTSNTRKNESDDE-EMENNEKLSP  768

Query  1584  QLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQ  1408
              +E    +E D  EDSKAA SSEN KTRSGSS+DY K  DG+EEEV Q++R + +   ++
Sbjct  769   IVEALMVKEDD-DEDSKAA-SSENRKTRSGSSRDYQKWQDGVEEEVFQNRRSSSMGSVKK  826

Query  1407  TGGE-EDRLQRKGRDEKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERD  1231
                E E   +RK  D+K+ E++R+ VKGR+D+Y  + +D S  H    KT   DRRKER 
Sbjct  827   YMDENEQNFRRKDSDDKQDERNRIDVKGRKDAYAYRDWDPSLPHQHPLKTDGFDRRKERS  886

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
              ++  WQ RDDD + R+++ +++RKRE+ DE  S+HR+KIR+I+RS+++ RHL +K LDN
Sbjct  887   NAEATWQRRDDDPYYRKTRTDETRKREYDDETGSRHRSKIREIERSDKDERHLTKK-LDN  945

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGD  871
             GS R  +DK A SRHRER+ D LKSRY+N+D  ++K+RK++  L REHV++EE LH + +
Sbjct  946   GSYRAHYDKGASSRHRERD-DSLKSRYENVDSYYNKKRKDEEHLRREHVEKEEILHGKRE  1004

Query  870   GTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERD  691
             G   RKRERD++ + +KRD++   R RD+      D H   +KEE L Q ER +R R+++
Sbjct  1005  GKSHRKRERDEVFEPQKRDEL--LRVRDNL----GDHHIVGHKEEWL-QRERSDRPRDKE  1057

Query  690   EWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGR  511
             +W+RPKQS +E LSKR+RDEGR  +R G  AEEK+W    R KDE K S++EY  KD  R
Sbjct  1058  DWHRPKQSREENLSKRDRDEGRSSIRSGHGAEEKAWGSHVRVKDENKVSEKEYPGKDV-R  1116

Query  510   HVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKV  331
             H E  KRR+R E    +  R RED Y R + PST++RR+R E+ S+ + HAA   D+ ++
Sbjct  1117  HSEQNKRRDRME--EENSRRGREDAYSRRNPPSTEDRRSRLEKSSSER-HAANAFDNQRI  1173

Query  330   HEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
             H+K+ K++  K++  + SD N+L PS  ++++++   S+ V 
Sbjct  1174  HDKRHKDSKMKNREVDGSDHNALGPSKKSQENQNSYRSQMVL  1215



>ref|XP_008443875.1| PREDICTED: trichohyalin isoform X1 [Cucumis melo]
Length=1397

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1302 (44%), Positives = 768/1302 (59%), Gaps = 142/1302 (11%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTA---------SLQSEQPPPVAQNLgggggaaaaAEGSKATE  3793
             MEDDDEFGDLYTDVLRPF +          L S  PPP+ ++                  
Sbjct  1     MEDDDEFGDLYTDVLRPFASPSSSSVPQHQLSSSAPPPLQRS------------------  42

Query  3792  TSSVFQSPRIDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNS  3613
                      ID     DD    FGA  SN      S   +   ++T   QP  ++  P +
Sbjct  43    ---------IDLNRHHDDENPSFGASYSN------SRVPLQFSKETPPLQPP-RESTPVA  86

Query  3612  SDFNLSLNPqsgqsggsigvgvGANESDLGARVFGKSDGKSRDW-----AFGDSSFTDEA  3448
               F   LN                N+ D G+RV G  D  S D         D +F  E+
Sbjct  87    GSFGFVLN------------LAARNDGD-GSRVKGSEDFTSVDVELPNRGLEDRNFGVES  133

Query  3447  NIdvvveegddkdddlvqkdENIDKPMGRS-ENCESSVVEAGGSEHMIPG------VSIP  3289
              I   +E+  +           +DK +    E   + V +  G E +IPG      +SI 
Sbjct  134   GIVGGLEKDVNL----------MDKDVKFDIEEGNAGVEDDVGVEPIIPGLSPSVGISIH  183

Query  3288  GVSGVPETC-GDRA--------VdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddd  3136
             G SG  E   G R            +      +DDL+I+LND++ GPM M+R G  GDD+
Sbjct  184   GTSGNLENAEGFRMNDASRDRGDGGDDWDSDSEDDLQILLNDSDRGPMAMERGGLVGDDE  243

Query  3135  dddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGY  2962
             D+   PLVI+ ++D      ++EEQEWGD+   +ADGERKE  +AAK + G   APK+GY
Sbjct  244   DEP--PLVILGDND---QNQVMEEQEWGDDAVPTADGERKETGEAAKSSAGMVVAPKLGY  298

Query  2961  SNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGM  2782
             SN+GY  P+HSQ+KYVRPGAAP PG    GPGGTP QV P VN   V GRGRGDWRP G 
Sbjct  299   SNYGYR-PFHSQYKYVRPGAAPFPGTSASGPGGTPNQVRPLVNMGPVGGRGRGDWRPAGP  357

Query  2781  KGALTMQKGFP---GYNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGID  2614
             K   ++QKGF    G   W +N  GR  G L+FTLPSHKTIFEVDIDSF+EKPW+  G+D
Sbjct  358   KDPASVQKGFHSGFGMPGWSNNMGGRSFGGLEFTLPSHKTIFEVDIDSFEEKPWKSTGVD  417

Query  2613  MSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGI  2434
             +SDFFNFGLNE+SWK+YCKQLEQLRLE+TMQ KIRVYESGRTEQ YDPDLPPELAAAAGI
Sbjct  418   ISDFFNFGLNEDSWKEYCKQLEQLRLEATMQSKIRVYESGRTEQGYDPDLPPELAAAAGI  477

Query  2433  QDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDS  2254
              DIP+E+  LGK++  QND+ +G  R RPPLPAGR IQVE G G+RLPSIDTRPPR+RDS
Sbjct  478   HDIPNEHT-LGKSDALQNDVGKGVARVRPPLPAGRAIQVEGGYGERLPSIDTRPPRIRDS  536

Query  2253  DAIIEIVCQGSADDDNNL------EQGNQPSREGIRGGDEIGDLQQE-DIHHVDGFQHAY  2095
             DAIIEIV Q S DD+++       E  + PS +  +   E  D Q E D  + D F   +
Sbjct  537   DAIIEIVLQDSLDDNSSTGNCTPNEHNDDPSGKDFKVQAEDDDAQIESDTEYPDNFSETH  596

Query  2094  NGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS  1915
             N    E   RR    + P D +R D  +   SE P  +HP SRG T  Y  +   +  + 
Sbjct  597   NSELMEKVGRRKTSMNSPSDNTREDVNLAFNSERP-GHHPASRGNTPAYSAQSLGIIEE-  654

Query  1914  TREKGRARCRSADIGASESPKDKQID---VDNRREDSL-SVGDrrsplssspvsnrsVQE  1747
              R +GR   +S       SP+    D    D+R E S  S+ D+RSP  SSP    + QE
Sbjct  655   RRSQGRTYNKSP-----HSPRQNLQDRKSSDSREEGSAGSMDDKRSPQMSSPAMVEATQE  709

Query  1746  SAVENN------DNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSS  1585
              + E+       D  HDEL+ A +N  ++R  ++    +N  K + D   +     KLS 
Sbjct  710   YSAEDKDAEHDEDAEHDELIEADKNPEIDRENVNFISTSNTRKNESDDE-EMENNEKLSP  768

Query  1584  QLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQ  1408
              +E    +E D  EDSKAA SSEN KTRSGSS+DY K  DG+EEEV Q++R + +   ++
Sbjct  769   IVEALMVKEDD-DEDSKAA-SSENRKTRSGSSRDYQKWQDGVEEEVFQNRRSSSMGSVKK  826

Query  1407  TGGE-EDRLQRKGRDEKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERD  1231
                E E   +RK  D+K+ E++R+ VKGR+D+Y  + +D S  H    KT   DRRKER 
Sbjct  827   YMDENEQNFRRKDSDDKQDERNRIDVKGRKDAYAYRDWDPSLPHQHPLKTDGFDRRKERS  886

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
              ++  WQ RDDD + R+++ +++RKRE+ DE  S+HR+KIR+I+RS+++ RHL +K LDN
Sbjct  887   NAEATWQRRDDDPYYRKTRTDETRKREYDDETGSRHRSKIREIERSDKDERHLTKK-LDN  945

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGD  871
             GS R  +DK A SRHRER+ D LKSRY+N+D  ++K+RK++  L REHV++EE LH + +
Sbjct  946   GSYRAHYDKGASSRHRERD-DSLKSRYENVDSYYNKKRKDEEHLRREHVEKEEILHGKRE  1004

Query  870   GTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERD  691
             G   RKRERD++ + +KRD++   R RD+      D H   +KEE L Q ER +R R+++
Sbjct  1005  GKSHRKRERDEVFEPQKRDEL--LRVRDNL----GDHHIVGHKEEWL-QRERSDRPRDKE  1057

Query  690   EWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGR  511
             +W+RPKQS +E LSKR+RDEGR  +R G  AEEK+W    R KDE K S++EY  KD  R
Sbjct  1058  DWHRPKQSREENLSKRDRDEGRSSIRSGHGAEEKAWGSHVRVKDENKVSEKEYPGKDV-R  1116

Query  510   HVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKV  331
             H E  KRR+R E    +  R RED Y R + PST++RR+R E+ S+ + HAA   D+ ++
Sbjct  1117  HSEQNKRRDRME--EENSRRGREDAYSRRNPPSTEDRRSRLEKSSSER-HAANAFDNQRI  1173

Query  330   HEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
             H+K+ K++  K++  + SD N+L PS  ++++++   S+ V 
Sbjct  1174  HDKRHKDSKMKNREVDGSDHNALGPSKKSQENQNSYRSQMVL  1215



>ref|XP_004146694.1| PREDICTED: uncharacterized protein LOC101212971 [Cucumis sativus]
Length=1399

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1297 (44%), Positives = 769/1297 (59%), Gaps = 130/1297 (10%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRPF +S  S  P P                   ++      Q P 
Sbjct  1     MEDDDEFGDLYTDVLRPFASSSSSSVPQPQL-----------------SSSAPPPLQRP-  42

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNSSDFNLSLNP  3586
             ID     DD    FGA  SN      S   +   ++T   QP  ++  P +  F   LN 
Sbjct  43    IDLNRHHDDENPPFGASYSN------SRVPLQFPKETPPLQPP-RESTPVAGSFGFVLN-  94

Query  3585  qsgqsggsigvgvGANESDLGARVFGKSDGKSRDW-----AFGDSSFTDEANIdvvveeg  3421
                            N+ D G+RV G  D  S D         D +F  E+ I   +E+ 
Sbjct  95    -----------LAARNDGD-GSRVKGSEDFASVDVELPNRGLEDRNFGVESGIVGGLEKD  142

Query  3420  ddkdddlvqkdENIDKPMGRS-ENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGD----  3256
              +           +DK +    E   + V +  G E +IPG+S  G   +  T G+    
Sbjct  143   VNL----------MDKDVKFDIEEGNAGVEDDVGGEPIIPGLSPSGGISIHGTSGNLENP  192

Query  3255  -----------RAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVI  3109
                        R    +      +DDL+I+LND++ GPM M+R G  GDD+D+   PLVI
Sbjct  193   EGFRMNDASRDRGDGGDDWDSDSEDDLQILLNDSDRGPMAMERGGLVGDDEDEP--PLVI  250

Query  3108  VANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPY  2935
             + ++D      ++EEQEWGD+   +ADGERKE  +AAK + G   APK+GYSN+GY  P+
Sbjct  251   LGDND---QNQVMEEQEWGDDTVPTADGERKETGEAAKSSAGMVVAPKLGYSNYGYR-PF  306

Query  2934  HSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKG  2755
             HSQ+KYVRPGAAP PG    GPGGTP QV P VN   V GRGRGDWRP G K   ++QKG
Sbjct  307   HSQYKYVRPGAAPFPGTSASGPGGTPTQVRPLVNMGPVGGRGRGDWRPTGPKDPASVQKG  366

Query  2754  FP---GYNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGL  2587
             F    G   W +N  GR  G L+FTLPSHKTIFEVDIDSF+EKPW+  G+D+SDFFNFGL
Sbjct  367   FHSGFGMPGWSNNMGGRSFGGLEFTLPSHKTIFEVDIDSFEEKPWKSTGVDVSDFFNFGL  426

Query  2586  NEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENAN  2407
             NE+SWK+YCKQLEQLRLE+TMQ KIRVYESGRTEQ YDPDLPPELAAAAGI DIP+E+  
Sbjct  427   NEDSWKEYCKQLEQLRLEATMQSKIRVYESGRTEQGYDPDLPPELAAAAGIHDIPNEHT-  485

Query  2406  LGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
             LGK++  QND+ +G  R RPPLPAGR IQVE G G+RLPSIDTRPPR+RDSDAIIEIV Q
Sbjct  486   LGKSDGLQNDVGKGVPRVRPPLPAGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVLQ  545

Query  2226  GSADDDNNL------EQGNQPSREGIRGGDEIGD---LQQEDIHHVDGFQHAYNGWKREF  2074
              S DD+++       E  + PS +  +   E  D     + D  + D F   +N    E 
Sbjct  546   DSLDDNSSTGNCTPNEPNDDPSGKDFKEIHEAEDDDAQIESDTEYPDDFSETHNSELTEK  605

Query  2073  GSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRA  1894
               RR    + P D +R D  +   SE P  +HP SRG T  Y  +   +  +  R +GR 
Sbjct  606   VGRRKTSMNSPSDNTREDVNLAFTSEGP-GHHPTSRGNTPAYSAQNLGIVEE-RRSQGRT  663

Query  1893  RCRSADIGASESPKDKQID---VDNRREDSL-SVGDrrsplssspvsnrsVQESAVENN-  1729
               +S       SP+    D    D++ E S+ S+ D+RSP  SSP    + QE + E+  
Sbjct  664   YNKSP-----HSPRQNLQDRKSPDSQEEGSVESMDDKRSPQVSSPAIVEATQEYSAEDKD  718

Query  1728  -----DNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSP  1564
                  D  HDEL+ A +N+ ++R  ++    +N  K + D   +     KLS  +E    
Sbjct  719   AEHDEDAEHDELIEADKNTEIDRENVNFISTSNTRKIESDDE-EMENNEKLSPIVEALML  777

Query  1563  QETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGE-ED  1390
             +E DG EDSKAA SSEN KTRSGSS+DY K  DG+EEEV Q++R + +   ++   E E 
Sbjct  778   KE-DGDEDSKAA-SSENRKTRSGSSRDYPKWQDGVEEEVFQNRRSSSMGSVKKYMDENEQ  835

Query  1389  RLQRKGRDEKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQ  1210
               +RK  D+K+ E++RM VKGR+D+Y  + +D S AH    KT   DRRKER  ++  WQ
Sbjct  836   NFRRKDSDDKQDERNRMDVKGRKDAYAYRDWDPSLAHQHPLKTDGFDRRKERSNAEATWQ  895

Query  1209  HRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDH  1030
              RDDD + R+++ E++RKRE+ DE  S+HR+KIR+I+RS+++ RHL +K LDNGS R  +
Sbjct  896   RRDDDPYYRKTRTEETRKREYDDETGSRHRSKIREIERSDKDERHLTKK-LDNGSYRAHY  954

Query  1029  DKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKR  850
             DK A SRHRER+ D LKSRY+N D  ++K+RK++  L REHV++EE LH + +G   RKR
Sbjct  955   DKGASSRHRERD-DSLKSRYENADSYYNKKRKDEEHLRREHVEKEEILHGKREGKSHRKR  1013

Query  849   ERDDISDQRKRDDISDQRKRDDQRLRED--DQHYARYKEEPLFQSERGERHRERDEWYRP  676
             ERD++ + +KRD++         R+R++  D H   +KEE   Q ER +R R++++W+RP
Sbjct  1014  ERDEVFEPQKRDEL--------LRVRDNIGDHHIVGHKEE-WLQRERSDRPRDKEDWHRP  1064

Query  675   KQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHL  496
             KQS +E LSKR+RDEGR  +R G  AEEK+W    R KDE K S++EY  KD  RH E  
Sbjct  1065  KQSREENLSKRDRDEGRSSIRSGHGAEEKAWGSHVRVKDENKVSEKEYPGKDV-RHSEQN  1123

Query  495   KRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKR  316
             KRR+R E    S  R RED Y R + PST++RR+R E+ S+ + HAA   D+ ++H+K+ 
Sbjct  1124  KRRDRME--EESSRRGREDSYSRRNPPSTEDRRSRLEKSSSER-HAANAFDNQRIHDKRH  1180

Query  315   KENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
             K++  K++  + SD N+L PS  ++++++   S+ V 
Sbjct  1181  KDSKMKNREVDGSDHNALGPSKKSQENQNSYRSQMVL  1217



>ref|XP_011017996.1| PREDICTED: FIP1[V]-like protein isoform X2 [Populus euphratica]
Length=1159

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/1024 (50%), Positives = 673/1024 (66%), Gaps = 53/1024 (5%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGD----  3049
             L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  158   LKIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  215

Query  3048  --ELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGYHH-PYHSQFKYVRpgaapipgapp  2878
                +G  A+GERKE  A         PKIGY+NHGYHH P+HSQFKYVRPGAAP+P AP 
Sbjct  216   VAAVGGGAEGERKEGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVRPGAAPMPAAPI  275

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYN--AWGSNPSGRGI  2707
             VGPGG PGQV PP+N S +AGRGRGDWRP G+KG    QK F PG+   AWG+   G G 
Sbjct  276   VGPGGAPGQVRPPMNMSTIAGRGRGDWRPVGIKGG--PQKNFHPGFGGPAWGAG-RGFGS  332

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GL+F LPSHKTIF+VDID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+T
Sbjct  333   GLEFMLPSHKTIFDVDIDGFEEKPWKYSGVDVSDYFNFGLNEESWKDYCKQLEQYRLETT  392

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQ KIRVYESGR EQE+DPDLPPELAAA G +D P++N+N GK++  QND  +GS R R 
Sbjct  393   MQSKIRVYESGRAEQEFDPDLPPELAAATGFRDAPADNSNAGKSDNAQNDWTKGSARFRA  452

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLE-----QGNQP  2182
              +P+GR IQVE+G G+R+PSI+ R PR+RDSDAIIEI+CQ S DD +  +       ++P
Sbjct  453   QIPSGRAIQVETGHGERIPSIEGRAPRLRDSDAIIEIICQDSVDDSSTGDGVQDAANDEP  512

Query  2181  SREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVIL  2005
              R+  RG D    D+ + +  +      AYN  K   G R    NS   +    D V   
Sbjct  513   QRDDFRGSDVAEDDMAETENEYAGDLPQAYNDQK---GGRTPHMNSA-RNMPEGDGVSPF  568

Query  2004  PSEEPDSY-HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
               E    Y H   RG    YPGR      +  + +GR+R RS  +  ++S +DK+  +DN
Sbjct  569   HPEASAPYPHAGPRGHPPSYPGRDFGTPREERQMQGRSRDRSPQLTPAQSSRDKKF-IDN  627

Query  1827  RREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDER  1651
               E+S  S+  +     SSP++ +  +E + E  D+   E + A+ +S + R ++  +E 
Sbjct  628   TEEESTESMVGKHGLRVSSPITVQDARELSSEKKDDA--EPLQAEGSSRLGRDEMGENEE  685

Query  1650  TNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKL  1471
             T  D  KD +V+ + +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RS SSKDY K 
Sbjct  686   TTNDTPKDGNVLHSTRKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSSSSKDYRKW  745

Query  1470  HDGLEEE--VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRK  1303
              DG+EEE  VQ +R       R+   E E   +R+ RD + E E+  +I++GREDSY R+
Sbjct  746   KDGVEEEEVVQGRRSTRSGSIRRHLDENEQNFRRRDRDVRHEMERSHVIIRGREDSYPRR  805

Query  1302  GYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKH  1123
               D S  HH H K    DRRKE++ SD++WQ R++D H  + + ED RKRE GDE+ S+H
Sbjct  806   DLDPSLHHHLHMKHEGYDRRKEQENSDISWQQREEDPHSSKHRTED-RKRELGDEMGSRH  864

Query  1122  RNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSK  943
             R+KIR+ +RS+++     RKQL+NGS R  H+KD  S+HRER+ D LKSR++ +DD HSK
Sbjct  865   RSKIRETERSDKDEHLHPRKQLENGSYRIHHEKDGSSQHRERD-DSLKSRFETVDDFHSK  923

Query  942   RRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDD  763
             RRK++  + RE+ D+EE LH   + T RR+RERDD   Q  RD++             DD
Sbjct  924   RRKDEEYMKREYADKEEILHVHRENTSRRQRERDD--QQWIRDNL-------------DD  968

Query  762   QHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSW  583
              H  R+K+E  FQ ERGER RER++ YR KQS++E L +RER+EGR   R GR  ++K+W
Sbjct  969   YHSVRHKDEVWFQRERGERPREREDLYRLKQSNEENLPRREREEGRASARSGRGVDDKAW  1028

Query  582   AGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDE  403
             AG +RGKDEYK SD++YH KDA R+ EH KRR+R E+ S S HR R+  Y RG+Q S+DE
Sbjct  1029  AGHARGKDEYKVSDKDYHLKDAVRNSEHQKRRDRMEDESLSHHRVRDAVYARGNQFSSDE  1088

Query  402   RRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGN  223
             RR+R ER STR D     SD+ +VHEKK KEN+ K+K  +  D  +  PS  N++D+SG+
Sbjct  1089  RRSRQERSSTRIDRTLDTSDNQRVHEKKHKENTRKNKESDGGDHGTSGPSRRNQEDQSGH  1148

Query  222   ASET  211
             + E 
Sbjct  1149  SDEM  1152



>gb|KHG13413.1| Pre-mRNA 3'-end-processing factor FIP1 [Gossypium arboreum]
Length=1339

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1024 (50%), Positives = 666/1024 (65%), Gaps = 64/1024 (6%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLNDNNHGP+ M+   M G+ DDDD+DGDPLVI+A+ D  ++Q   E QEWG+E G 
Sbjct  177   LQIVLNDNNHGPVAMETGGMIGEDDDDDEDGDPLVILADGD--ANQGTAE-QEWGEERGQ  233

Query  3036  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpgg  2863
             +ADGE+KE  +A KV  G   APKIGYS+H YH P+HSQFKYVRPGA P+PGA   G GG
Sbjct  234   AADGEKKEGGEAGKVTSGSVLAPKIGYSSHLYH-PFHSQFKYVRPGATPMPGATAGGSGG  292

Query  2862  tpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNA--WGSNPSGRGIG--LD  2698
              PGQV P +    +AGRGRGDWRP GMK    MQKGF P + A  WG+N +GRG G  L+
Sbjct  293   APGQVSPIMGA--MAGRGRGDWRPSGMKAGPPMQKGFHPSFGAPGWGNNTAGRGFGGGLE  350

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+VDIDSF+EKPW+  G+D+SDFFNFGLNEESWKDYCKQLEQ RLE+TMQ 
Sbjct  351   FTLPSHKTIFDVDIDSFEEKPWKYPGVDLSDFFNFGLNEESWKDYCKQLEQHRLETTMQS  410

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGRTEQ YDPDLPPELAAA   Q +P+  ANL K++ GQND+ +G+ R RPPLP
Sbjct  411   KIRVYESGRTEQGYDPDLPPELAAATA-QVVPAA-ANLVKSDGGQNDMTKGAGRVRPPLP  468

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GRPIQVE GSG+RLPSIDTRPPRVRDSDA+IEIVC+ + DDD++   G      N    
Sbjct  469   TGRPIQVEGGSGERLPSIDTRPPRVRDSDAVIEIVCEDTLDDDSSTGNGVEGRAENDLPM  528

Query  2175  EGIRG--GDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVI-L  2005
             E +RG    E   +  ED  + D    A    K+E   R   F     D  R D  V+  
Sbjct  529   EDLRGDLASEAA-IAHEDTEYFDDSADACKSRKKELVGRTVNF---ARDNVREDNGVLPF  584

Query  2004  PSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNR  1825
             P E    Y P  R Q+ + P        D    +GR   +S  I      +D   D D  
Sbjct  585   PVEASRPYGPGPRVQSPMGPSENSGSPPDERHRQGRVCRKSPCITPIHGERDNFNDTD--  642

Query  1824  REDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTN  1645
             RE+S+   D +SP           +ES+VE+ D++ DEL PA  +   E+     DE  N
Sbjct  643   REESVERMDGKSPCVVRDP-----RESSVEHKDHVDDELEPADGSPVTEK-----DELIN  692

Query  1644  CDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
                 KD++ ++  +  K+SSQ E+   +E D  EDS+AARSSENSK RSGSS+DY K  D
Sbjct  693   G-THKDENSLNPMRNEKISSQAEQWKLRERDDDEDSRAARSSENSKARSGSSRDYQKWRD  751

Query  1464  GLEEEV-QDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGYD  1294
             G EEEV Q +R + +   ++   E D+  +RK RD + E E++ M+ K  EDSY  +  D
Sbjct  752   GAEEEVVQGERSSCIGIVKKHLDENDQNFRRKDRDGRLEIERNCMVGKPGEDSYPLRDVD  811

Query  1293  sssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNK  1114
             +S +H+   K     RR+E D  D  WQ R+DD +GR+ + E+ RKR+H +E+ S++R K
Sbjct  812   ASLSHNLPVKKEGFGRRRESDNPDGTWQWREDDPYGRKERTEELRKRDHDNEMGSRNRAK  871

Query  1113  IRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRK  934
             +R+ +RS+++  +  RKQLDNG+      KD  +RHRER+ D+LKSRY+  DD  SKRRK
Sbjct  872   VRESERSDKDD-YPSRKQLDNGNY-----KDVSARHRERD-DNLKSRYEAADDYPSKRRK  924

Query  933   EDTKLSREHVDREETLHSRGDGT-LRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DD  763
             ++  L R+  ++EE L  R + +  RRKRERD+I D RKRD+         +R RE  D+
Sbjct  925   DEEYLRRDQSNKEELLQGRRESSGSRRKRERDEILDPRKRDE--------QRRTRENFDE  976

Query  762   QHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSW  583
              H AR+K+E     E+ ER RERDEW+R KQSHD  LSKRER+EGRG +R GR +E+K+W
Sbjct  977   HHSARHKDEVWLNREKVERLRERDEWHRLKQSHDGSLSKREREEGRGIVRSGRGSEDKAW  1036

Query  582   AGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDE  403
              G +RGKDEYK S++EY  K+  RH E +KRR+R+++ S SRHR RED Y RGHQ S DE
Sbjct  1037  GGHTRGKDEYKVSEKEYQLKETVRHSEQVKRRDRNDDESSSRHRGREDLYARGHQFSNDE  1096

Query  402   RRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGN  223
             R++R ER STR DH    SDS K HEKK KEN+ K++  E  ++ +L  +  +++D SG+
Sbjct  1097  RKSRPERSSTRSDHGVDASDSQKGHEKKHKENTRKNRESEGGNQTTLGSAKKSQEDLSGH  1156

Query  222   ASET  211
              +ET
Sbjct  1157  NNET  1160



>ref|XP_007011968.1| FIP1, putative isoform 1 [Theobroma cacao]
 gb|EOY29587.1| FIP1, putative isoform 1 [Theobroma cacao]
Length=1356

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/1025 (51%), Positives = 678/1025 (66%), Gaps = 61/1025 (6%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDD+DGD LVIVA+ D        E  E G ++   A
Sbjct  186   LQIVLNDNNHGPMAMERGGMMGEDDDEDGDALVIVADGDANQGVEEQEWGEEGGQV---A  242

Query  3030  DGERKEDAAKVNVGPGYA-------PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvg  2872
             DGERKE      VG G +       PK+GYSNHGYH P+HSQFKYVRPGAAP+PGA   G
Sbjct  243   DGERKEGGEAGKVGGGASGGGSVVPPKVGYSNHGYH-PFHSQFKYVRPGAAPMPGATTGG  301

Query  2871  pggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---GYNAWGSNPSGRGIG-  2704
             PGG PGQV P      ++GRGRGDWRPPGMK A  MQKGF    G   WG+N +GRG G 
Sbjct  302   PGGAPGQVRPL--MGAMSGRGRGDWRPPGMKAAPPMQKGFHTSFGMPGWGNNMAGRGFGG  359

Query  2703  -LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
              L+FTLPSHKTIF+VDIDSF+EKPW+  G+D+SDFFNFGLNEESWKDYCKQLEQ RLE+T
Sbjct  360   GLEFTLPSHKTIFDVDIDSFEEKPWKYPGVDLSDFFNFGLNEESWKDYCKQLEQHRLETT  419

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQ KIRVYESGRTEQ+YDPDLPPELAAA G Q++P++ ANL K++ GQ+D+ +G+ R RP
Sbjct  420   MQSKIRVYESGRTEQDYDPDLPPELAAATG-QEVPADAANLAKSDGGQHDMTKGTARVRP  478

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQ  2185
             P+P GR IQVE G G+RLPSIDTRPPR+RDSDAIIEIVCQ + DDD+++      +  N 
Sbjct  479   PVPTGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVCQDTLDDDSSIGNVVVDQTEND  538

Query  2184  PSREGIRGG-DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVI  2008
               R  +RG      D+ +ED  + DGF  AYN  KRE   RR   NS   ++   D ++ 
Sbjct  539   LPRGDLRGDLASEADVAREDAEYFDGFPDAYNSQKREVVGRRT-LNSVQSNEP-EDGILP  596

Query  2007  LPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
              P+E    Y P SRGQ+ +Y     +   D   ++GRA  RS  +   +  ++K  D   
Sbjct  597   FPAEASLPYGPGSRGQSPMYSSGNFSSPCDERHQQGRAHERSPRMTPIQGRREKFSDA--  654

Query  1827  RREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERT  1648
             ++E+S+   D +SP +         +E +VE  D++ DEL PA  N   E+     DE+ 
Sbjct  655   QKEESVESMDAKSPDA---------REISVERKDDVDDELDPADGNPVTEK-----DEQI  700

Query  1647  NCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLH  1468
             N     ++S  +  K  K SS  E+   QE D  EDS+AARSSENSK RSGSS+DY K  
Sbjct  701   NETHEVENSP-NPMKNEKRSSHGEQRMLQELDDDEDSRAARSSENSKARSGSSRDYQKWR  759

Query  1467  DGLEEEV-QDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGY  1297
             DG EEEV Q  R + +   ++   E D+  +RK R+ + E E++RM+ K  EDSY  + +
Sbjct  760   DGAEEEVVQGGRLSRMGIVKKHLDEHDQNFRRKDREGRHEIERNRMVGKPGEDSYPLRDF  819

Query  1296  DsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRN  1117
             D+S +H+ HTK    DRR+ERD  D  WQ R+DDL+ R+S+ ED RKRE  DE+ S++R 
Sbjct  820   DASLSHNLHTKAEGFDRRRERDNPDGTWQRREDDLYNRKSRTEDLRKRERDDEMGSRNRA  879

Query  1116  KIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRR  937
             KIR+ +RS+++     RKQLDNGS +  HDKD  +RHRER+ D+LKSRY+  DD  SKRR
Sbjct  880   KIRESERSDKDDYPHSRKQLDNGSFKVHHDKDVSARHRERD-DNLKSRYEAADDYQSKRR  938

Query  936   KEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ-RLRE--D  766
             K++  L R+H D+EE LH   + +  R+        +R+RD+I+DQRKR+++ R+R+  D
Sbjct  939   KDEEYLRRDHADKEEILHGHRESSSSRR--------KRERDEITDQRKRNERPRIRDNFD  990

Query  765   DQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKS  586
             + H  R+K+E     ER ER RERDEW+R KQSHDE L KRER+E RG +R GR +E+K+
Sbjct  991   EHHSVRHKDEVWLHRERVERQRERDEWHRLKQSHDESLPKREREEVRGIVRSGRGSEDKA  1050

Query  585   WAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTD  406
             W   +R KDEYKGS++EY  K+  RH E +KRRER+++ S SRHR RED Y RGHQ   +
Sbjct  1051  WVAHTRAKDEYKGSEKEYQLKETVRHSEQVKRRERNDDESFSRHRGREDSYARGHQFGNE  1110

Query  405   ERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSG  226
             ERR+R ER STR DHAA  SDS +  EKK KEN+ KD+  E  D  +L  +  N++D SG
Sbjct  1111  ERRSRQERSSTRNDHAANASDSQR-GEKKHKENTRKDRESEGGDPITLGSAKRNQEDLSG  1169

Query  225   NASET  211
               +ET
Sbjct  1170  QNNET  1174



>ref|XP_011017995.1| PREDICTED: FIP1[V]-like protein isoform X1 [Populus euphratica]
Length=1343

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/1026 (50%), Positives = 674/1026 (66%), Gaps = 53/1026 (5%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGD----  3049
             L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  158   LKIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  215

Query  3048  --ELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGYHH-PYHSQFKYVRpgaapipgapp  2878
                +G  A+GERKE  A         PKIGY+NHGYHH P+HSQFKYVRPGAAP+P AP 
Sbjct  216   VAAVGGGAEGERKEGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVRPGAAPMPAAPI  275

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYN--AWGSNPSGRGI  2707
             VGPGG PGQV PP+N S +AGRGRGDWRP G+KG    QK F PG+   AWG+   G G 
Sbjct  276   VGPGGAPGQVRPPMNMSTIAGRGRGDWRPVGIKGG--PQKNFHPGFGGPAWGAG-RGFGS  332

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GL+F LPSHKTIF+VDID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+T
Sbjct  333   GLEFMLPSHKTIFDVDIDGFEEKPWKYSGVDVSDYFNFGLNEESWKDYCKQLEQYRLETT  392

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQ KIRVYESGR EQE+DPDLPPELAAA G +D P++N+N GK++  QND  +GS R R 
Sbjct  393   MQSKIRVYESGRAEQEFDPDLPPELAAATGFRDAPADNSNAGKSDNAQNDWTKGSARFRA  452

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLE-----QGNQP  2182
              +P+GR IQVE+G G+R+PSI+ R PR+RDSDAIIEI+CQ S DD +  +       ++P
Sbjct  453   QIPSGRAIQVETGHGERIPSIEGRAPRLRDSDAIIEIICQDSVDDSSTGDGVQDAANDEP  512

Query  2181  SREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVIL  2005
              R+  RG D    D+ + +  +      AYN  K   G R    NS   +    D V   
Sbjct  513   QRDDFRGSDVAEDDMAETENEYAGDLPQAYNDQK---GGRTPHMNSA-RNMPEGDGVSPF  568

Query  2004  PSEEPDSY-HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
               E    Y H   RG    YPGR      +  + +GR+R RS  +  ++S +DK+  +DN
Sbjct  569   HPEASAPYPHAGPRGHPPSYPGRDFGTPREERQMQGRSRDRSPQLTPAQSSRDKKF-IDN  627

Query  1827  RREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDER  1651
               E+S  S+  +     SSP++ +  +E + E  D+   E + A+ +S + R ++  +E 
Sbjct  628   TEEESTESMVGKHGLRVSSPITVQDARELSSEKKDDA--EPLQAEGSSRLGRDEMGENEE  685

Query  1650  TNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKL  1471
             T  D  KD +V+ + +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RS SSKDY K 
Sbjct  686   TTNDTPKDGNVLHSTRKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSSSSKDYRKW  745

Query  1470  HDGLEEE--VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRK  1303
              DG+EEE  VQ +R       R+   E E   +R+ RD + E E+  +I++GREDSY R+
Sbjct  746   KDGVEEEEVVQGRRSTRSGSIRRHLDENEQNFRRRDRDVRHEMERSHVIIRGREDSYPRR  805

Query  1302  GYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKH  1123
               D S  HH H K    DRRKE++ SD++WQ R++D H  + + ED RKRE GDE+ S+H
Sbjct  806   DLDPSLHHHLHMKHEGYDRRKEQENSDISWQQREEDPHSSKHRTED-RKRELGDEMGSRH  864

Query  1122  RNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSK  943
             R+KIR+ +RS+++     RKQL+NGS R  H+KD  S+HRER+ D LKSR++ +DD HSK
Sbjct  865   RSKIRETERSDKDEHLHPRKQLENGSYRIHHEKDGSSQHRERD-DSLKSRFETVDDFHSK  923

Query  942   RRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDD  763
             RRK++  + RE+ D+EE LH   + T RR+RERDD   Q  RD++             DD
Sbjct  924   RRKDEEYMKREYADKEEILHVHRENTSRRQRERDD--QQWIRDNL-------------DD  968

Query  762   QHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSW  583
              H  R+K+E  FQ ERGER RER++ YR KQS++E L +RER+EGR   R GR  ++K+W
Sbjct  969   YHSVRHKDEVWFQRERGERPREREDLYRLKQSNEENLPRREREEGRASARSGRGVDDKAW  1028

Query  582   AGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDE  403
             AG +RGKDEYK SD++YH KDA R+ EH KRR+R E+ S S HR R+  Y RG+Q S+DE
Sbjct  1029  AGHARGKDEYKVSDKDYHLKDAVRNSEHQKRRDRMEDESLSHHRVRDAVYARGNQFSSDE  1088

Query  402   RRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGN  223
             RR+R ER STR D     SD+ +VHEKK KEN+ K+K  +  D  +  PS  N++D+SG+
Sbjct  1089  RRSRQERSSTRIDRTLDTSDNQRVHEKKHKENTRKNKESDGGDHGTSGPSRRNQEDQSGH  1148

Query  222   ASETVC  205
             + E + 
Sbjct  1149  SDEMIL  1154



>ref|XP_002324551.2| hypothetical protein POPTR_0018s11860g [Populus trichocarpa]
 gb|EEF03116.2| hypothetical protein POPTR_0018s11860g [Populus trichocarpa]
Length=1347

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/1027 (50%), Positives = 670/1027 (65%), Gaps = 55/1027 (5%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGD----  3049
             L+IVLNDN+H  GPMG+DR  GD DDDD+DGDPLVIV + D P+    +EE++WG     
Sbjct  157   LQIVLNDNSHPGGPMGIDREIGDDDDDDEDGDPLVIVTDGDGPNQ--AIEEKDWGGGEDG  214

Query  3048  --ELGNSADGERKEDAAKVNVGPGYA-PKIGYSNHGYHH-PYHSQFKYVRpgaapipgap  2881
                +G  A+GERKE       G     PKIGY+NHGYHH P+HSQFKYVRPGAA +P AP
Sbjct  215   VAAVGGGAEGERKEGGEATGKGNAVVGPKIGYNNHGYHHHPFHSQFKYVRPGAALMPAAP  274

Query  2880  pvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYN--AWGSNPSGRG  2710
              VGPGGTPGQV PP+N S +AGRGRGDWRP G+KG    QK F PG+   AWG+   G G
Sbjct  275   IVGPGGTPGQVRPPMNMSTIAGRGRGDWRPVGIKGG--PQKNFHPGFGGPAWGAG-RGFG  331

Query  2709  IGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLES  2530
              GL+F LPSHK IF+VDID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+
Sbjct  332   SGLEFMLPSHKMIFDVDIDGFEEKPWKYSGVDVSDYFNFGLNEESWKDYCKQLEQYRLET  391

Query  2529  TMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
             TMQ KIRVYESGR EQE+DPDLPPELAAA G +D P++N+N GK++  Q+D  +GS R R
Sbjct  392   TMQSKIRVYESGRAEQEFDPDLPPELAAATGFRDAPADNSNAGKSDNAQSDWTKGSARFR  451

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLE-----QGNQ  2185
               +P GR IQVE+G G+R+PSI+ R PR+RDSDAIIEI+CQ S DD +  +       ++
Sbjct  452   AQIPTGRAIQVETGHGERIPSIEGRAPRLRDSDAIIEIICQDSLDDSSTGDGVQDAANDE  511

Query  2184  PSREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVI  2008
             P R+  RG D    D+ + +  +   F  AYN  K   G R    NS   +    D V  
Sbjct  512   PQRDDFRGSDVAEDDMAETENEYAGDFPQAYNDRK---GGRTPHMNSA-RNMPEGDGVSP  567

Query  2007  LPSEEPDSY-HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVD  1831
                E    Y H  SRG    YPGR      +  + +GR+R RS  +  ++S  DK+  VD
Sbjct  568   FHPEATAPYPHAGSRGHPPSYPGRDFGTPREERQMQGRSRDRSPHLTPAQSSCDKKF-VD  626

Query  1830  NRREDSLS--VGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVD  1657
             N  E+S    VG     +SS      + + S+ + +D    E + A+ +S + R ++S +
Sbjct  627   NAEEESTESMVGKHSLRVSSPITVQDARELSSEKKDD---PEPLQAEGSSRLGRDEMSEN  683

Query  1656  ERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYH  1477
             E T  D  KD ++  + +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RSGSSKDY 
Sbjct  684   EETTNDTPKDGNMHHSTRKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSGSSKDYQ  743

Query  1476  KLHDGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMR  1306
             K  DG+EEE VQ  R       R+   E E   +RK RD + E E+ R+I++GREDSY R
Sbjct  744   KWKDGVEEEVVQGGRSTRSGSIRRHLDENEQNFRRKDRDVRHEMERSRVIIRGREDSYPR  803

Query  1305  KGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESK  1126
             +  D S  HH H K    DRRKER+ SD++WQ RD+D H  + + ED RKRE GDE+ S+
Sbjct  804   RDLDPSLPHHLHMKHEGYDRRKERENSDISWQQRDEDPHSSKHRTED-RKRELGDEMGSR  862

Query  1125  HRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHS  946
             HR+KIR+ +RS+++     RKQL+NGS R  HDKD  S+HRER+ D LKSR++ +DD HS
Sbjct  863   HRSKIRETERSDKDEHLHPRKQLENGSYRIHHDKDGSSQHRERD-DSLKSRFEMVDDYHS  921

Query  945   KRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRED  766
             KRRK++  + RE+ D+EE LH   + T RR+RERDD   Q  RD++             D
Sbjct  922   KRRKDEEYMKREYADKEEILHGHRENTSRRRRERDD--QQWIRDNL-------------D  966

Query  765   DQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKS  586
             D H  R+K+E  FQ ERGER RER++ YR KQS++E L +RER+EGR   R GR  ++K+
Sbjct  967   DYHSVRHKDEVWFQRERGERPREREDLYRLKQSNEENLPRREREEGRASARSGRGVDDKA  1026

Query  585   WAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTD  406
             WAG  RGKDEYK SD++Y  KDA R  EH KRR+R E+ S S HR R+D Y RG+Q S+D
Sbjct  1027  WAGHPRGKDEYKVSDKDYQLKDAVRSSEHQKRRDRMEDESLSHHRVRDDVYARGNQFSSD  1086

Query  405   ERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSG  226
             ERR+R ER STR D     SD+ +VHEKK KEN+ K+K  +  D  +L PS  N++D+SG
Sbjct  1087  ERRSRQERSSTRIDRTLDTSDNQRVHEKKHKENTRKNKESDGGDHGTLGPSRRNQEDQSG  1146

Query  225   NASETVC  205
             ++ E + 
Sbjct  1147  HSDEMIL  1153



>ref|XP_009366155.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
 ref|XP_009366156.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
 ref|XP_009366157.1| PREDICTED: uncharacterized protein LOC103955965 [Pyrus x bretschneideri]
Length=1372

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/1018 (51%), Positives = 676/1018 (66%), Gaps = 74/1018 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190   LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
             +GERKE  +A K   G    PK+GYS+HGYH P+HSQFKYVRPGA P+PG    GPGG P
Sbjct  246   EGERKEMAEAGKTAGGVVVPPKVGYSSHGYH-PFHSQFKYVRPGAVPMPGPTTSGPGGVP  304

Query  2856  gqvhppVNTSLVAGRGRGDWRPPGMKGALTMQK-GFPGYNA--WGSN--PSGRGIGLDFT  2692
             GQV P VN    AGRGRGDWRP GMK    +QK   PG+    W +N    G G GL+FT
Sbjct  305   GQVRPLVNMGPGAGRGRGDWRPTGMKNGTPLQKNSHPGFGTPGWSNNMGGRGFGGGLEFT  364

Query  2691  LPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKI  2512
             LPSHKTIF++DID F+EKPW+  G+D SDFFNFGLNE+SW+DYCKQLEQLRLESTMQ KI
Sbjct  365   LPSHKTIFDIDIDGFEEKPWKYPGVDTSDFFNFGLNEDSWRDYCKQLEQLRLESTMQSKI  424

Query  2511  RVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAG  2332
             RVYESGR EQEYDPDLPPELAAA GI D+P+ENAN GK++V Q+DLA+GS R RPP+P G
Sbjct  425   RVYESGRAEQEYDPDLPPELAAATGIHDLPAENANPGKSDVVQSDLAKGSARLRPPIPTG  484

Query  2331  RPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSREG  2170
             R IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   REG
Sbjct  485   RAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDRPREG  544

Query  2169  IRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEP  1990
                G+  GDL Q +  + DGF  A N  K   G +    ++ P + +       LPS  P
Sbjct  545   FGRGE--GDLAQVESEYFDGFPQANNDQK--VGRKMPFHDNIPEEGN-------LPS-PP  592

Query  1989  DSYHP--DSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRRED  1816
             +   P   S G+T  Y  RK          + RAR RS  +  S + +DK+  ++N++E+
Sbjct  593   EVAVPYTGSGGETPSYQERK---------TQRRARDRSPHVTPSRNTRDKKF-LENQKEE  642

Query  1815  SL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKIS-VDERTNC  1642
             S+ S+  +RS   SSPV+NR+ QES+ E  D+  DE V A  +S M + + S VDE    
Sbjct  643   SIESMDGKRSLGISSPVTNRAAQESSAEYRDSDQDEPVLADGSSEMGKRETSMVDE----  698

Query  1641  DKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
                 +D++ D A KHK L S++E+ + +E D GEDSKAARSS+NSK RSGSS+DY K  D
Sbjct  699   ----NDALQDGAPKHKQLVSRVEQSADEELDDGEDSKAARSSDNSKARSGSSRDYPKWRD  754

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R  H+   ++   E ++  QRK  D + E ++  M+VKGRE SY  + +D 
Sbjct  755   GVEEEVIQGRSTHMGGIKRHLNENEKGFQRKNHDARQEPDRSHMVVKGREGSYPYRDWDP  814

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K     RRKERD  D  WQ R++D + +R + E++RKRE  DE+ S+HR+K+
Sbjct  815   SSAHQLQLKNDGLHRRKERDNLDGPWQRRENDPYSKRIRPEETRKRERSDEMGSRHRSKV  874

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DR+E++     RKQ+DNGS R  HDKD  SR RERE   LK+RY++++D H KRRK+
Sbjct  875   RESDRNEKDEHLQSRKQVDNGSYRVYHDKDVGSRPRERE-GSLKARYEHVEDYHGKRRKD  933

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDD-QRLRE--DDQ  760
             +  + R+H+D+E+ LH   D + RRKRERD+I DQ        QRKRD+ QR+RE  DD 
Sbjct  934   EEYMKRDHIDKEDFLHGHRDNSSRRKRERDEILDQ--------QRKRDEQQRVRENLDDL  985

Query  759   HYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWA  580
             H  R+K++   Q ERG+R RE+++W+R KQSH+E + KRERDEGR  +R GR AE+K+W 
Sbjct  986   HPVRHKDDGWSQRERGDRQREKEDWHRVKQSHEENIPKRERDEGRVAIRGGRGAEDKAWV  1045

Query  579   GLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDER  400
             G +R KDE KGSD+E+  K+  RH E  KRR+R E  S S  R RED +GRG+Q + DE+
Sbjct  1046  GHTRAKDENKGSDKEHQYKETARHSEPSKRRDRVEEES-SHRRGREDVHGRGNQINNDEK  1104

Query  399   RARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSG  226
             R+  ER ST  + A    D+ KVH++K KENS K K  E+   N+   S   ++D+SG
Sbjct  1105  RSGKERSSTHNERA----DNQKVHDRKHKENSRKTK--ESEIANNSTTSKRRQEDQSG  1156



>gb|KDO59423.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1124

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/1036 (49%), Positives = 647/1036 (62%), Gaps = 100/1036 (10%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  3034
             L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153   LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  3033  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaa  2899
             A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFKYVRPGAA
Sbjct  209   APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAA  268

Query  2898  pipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNP  2722
             PIPG+      G PGQV P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  
Sbjct  269   PIPGSATAVAAGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGV  328

Query  2721  SGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQL  2542
             +  G GL+FTLPSHKTIFEVDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ 
Sbjct  329   NMAGRGLEFTLPSHKTIFEVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQH  388

Query  2541  RLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGS  2362
             RLE+TMQ KIRVYESGR +                                         
Sbjct  389   RLETTMQSKIRVYESGRDQ-----------------------------------------  407

Query  2361  IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---  2191
                    P GR IQVE GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   
Sbjct  408   -------PTGRAIQVEGGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRD  460

Query  2190  NQPSREGIRGG-----DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-S  2029
             N   RE  RG      DE+G +   D  + DGF+ AY+   RE     A F +  +D   
Sbjct  461   NDLPREDRRGENDGAEDEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIP  517

Query  2028  RSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKD  1849
               + ++  P E P  Y P SRG T  YPG     +H+  R  GR   RS  +  S+SP+ 
Sbjct  518   EGNGLLPFPPEAPLRYRPGSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQI  577

Query  1848  KQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGK  1669
             ++   DN+ E+S+   + +    SSPV  R  +E +VE+ D +HDELV    +S +E  K
Sbjct  578   RKFH-DNQDEESVESMEGKHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--K  634

Query  1668  ISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSS  1489
                +  T  D  KD   + + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS
Sbjct  635   EETNAVTTSDSRKDGKALYSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSS  694

Query  1488  KDYHKLHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDS  1315
             +D  K  +G EE +QD+R   +   ++   E E   +RK R+  +E E++RM+  GRE S
Sbjct  695   RDNKKWREGDEEVMQDRRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGS  754

Query  1314  YMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGD  1141
             + R+ +D S  H    K    DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H D
Sbjct  755   HPRRDFDPSLTHDMQMKPEGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLD  814

Query  1140  EIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNI  961
             EI ++HR K R+ +R +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +
Sbjct  815   EIGARHRGKARESERIDRDEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMV  873

Query  960   DDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ  781
             DD  SKRRK+D  + R+H +++E LH   D T RRKRERDDI DQR+R+D         Q
Sbjct  874   DDYISKRRKDDEYVRRDHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQ  925

Query  780   RLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVG  607
             R+RE  DD H  R+K+E   Q ERGER RER++W+R K  H+EILSKRER+EGRG +R G
Sbjct  926   RIRENFDDHHPVRHKDENWSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSG  984

Query  606   RAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGR  427
             R++E+++W G +R KDEYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y R
Sbjct  985   RSSEDRAWVGHARVKDEYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYAR  1044

Query  426   GHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNL  247
             G+Q S ++R++R ER  TR D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  
Sbjct  1045  GNQISNEDRKSRQERSGTRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKR  1104

Query  246   NEDDRSGNASETVC*I  199
             N++D+SG+ SE VC I
Sbjct  1105  NQEDQSGHVSEMVCSI  1120



>ref|XP_008352094.1| PREDICTED: trichohyalin-like [Malus domestica]
Length=1355

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/1022 (51%), Positives = 665/1022 (65%), Gaps = 69/1022 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHG M M+R G  G+D+DDD   LVIVA+ +   +QPM ++QEWG+E   + 
Sbjct  191   LQIVLNDNNHGAMAMERGGMGGEDEDDDDG-LVIVADGE--PNQPM-DDQEWGEESAXTV  246

Query  3030  DGERKEDAAKVNVGPG---YAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggt  2860
             +GERKE       G G     PK+GYS+HGYH P+HSQFKYVRPGA P+PG    GPGG 
Sbjct  247   EGERKEMGEAGKTGAGSVVVPPKVGYSSHGYH-PFHSQFKYVRPGAVPMPGPTTSGPGGV  305

Query  2859  pgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSGRGIGLD  2698
             PGQV P +N   V GRGRGDWRP GM+    +QK F      PG+    +   G G GL+
Sbjct  306   PGQVRPLLNMGPVPGRGRGDWRPTGMRDGTPLQKNFHSGFGTPGWGN-NTGGRGFGGGLE  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLE LRLESTMQ 
Sbjct  365   FTLPSHKTIFDVDIDGFEEKPWKYPGVDASDFFNFGLNEDSWKDYCKQLELLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGRTEQEYDPDLPPELAAA GI ++P ENAN GK++V Q+DL +G+ R RPP+P
Sbjct  425   KIRVYESGRTEQEYDPDLPPELAAATGIHELPPENANPGKSDV-QSDLVKGTARLRPPIP  483

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  484   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDHPR  543

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSG-PYDKSRSDRVVILPS  1999
             EG   G+  G L Q +    DG   A N  KRE   R+  F+   P +K      +  P 
Sbjct  544   EGFGRGE--GHLAQVESECFDGLPQASNDRKRELVGRKMPFHDNIPEEKGN----LPFPP  597

Query  1998  EEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRRE  1819
             + P  Y   S G+T  Y  RK  +         RAR  S  +    + +DK+  V+N++E
Sbjct  598   DVPVPYT-GSGGETPTYQERKTQL---------RARDGSPHVAPCRNTRDKKY-VENQKE  646

Query  1818  DSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNC  1642
             +S+ SV  +RSP +SSPV+NR+ +ES+ E  D+  DE V A  +S M + + +       
Sbjct  647   ESIESVDGKRSPGTSSPVTNRAARESSAEYRDSDQDEPVLADGSSEMGKEETAT------  700

Query  1641  DKAKDDSVIDTAKKH-KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
               A++D++ D A KH KL S++E  + +E D GEDSKAARSS+NSK RSGSS+DY K  D
Sbjct  701   -VAENDALQDGAPKHKKLVSRVEHSADEELDDGEDSKAARSSDNSKARSGSSRDYQKWRD  759

Query  1464  GLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R  H+   ++   E E   QRK RD  +E ++  ++VKGRE SY  + +D 
Sbjct  760   GVEEEVIQGRSMHMGGIKRHLDENEQGFQRKNRDGRQEPDRSHVVVKGREGSYPYRDWDP  819

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K     RRKER+  D AWQ R+DD + RR + E++RKRE GDE+ S+HR+K 
Sbjct  820   SSAHQLQLKNDGLHRRKERENLDGAWQRREDDPYSRRIRPEETRKRERGDEMGSRHRSKG  879

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DRS+++     RKQLDNGS R  HDKD  SR RERE   LK RY++++D H KRRK+
Sbjct  880   RESDRSDKDEHLQSRKQLDNGSYRAYHDKDVGSRPRERE-GSLKGRYEHVEDYHGKRRKD  938

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQH  757
             +  + R+H+D+E+ LH   D T RRKRERD+I D RKRD        + QR+RE  DD H
Sbjct  939   EEYIKRDHIDKEDFLHGHRDNTTRRKRERDEILDPRKRD--------EQQRVRENXDDLH  990

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
               R+K++   Q ERG+R RER+EW R KQSH+E + KRERDEGR  +R GR AE+K+W G
Sbjct  991   SVRHKDDSWSQRERGDRQREREEWPRVKQSHEENIPKRERDEGRVAIRGGRGAEDKAWVG  1050

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              +R K+E KGSD+E+  K+  RH E  KRR+R E  S S HR R+D +GRG+Q + DE+R
Sbjct  1051  HTRAKEENKGSDKEHQYKETXRHSEPSKRRDRVEEES-SHHRGRDDVHGRGNQITNDEKR  1109

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             +  ER STR + A    D+ KVH++K KE+S K K  E+   N+   S   ++D+SG   
Sbjct  1110  SGKERSSTRNERA----DNQKVHDRKHKESSRKTK--ESEIANNSTTSKRRQEDQSGQNK  1163

Query  216   ET  211
             E 
Sbjct  1164  EM  1165



>ref|XP_002523498.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF38837.1| ATP binding protein, putative [Ricinus communis]
Length=1365

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/1006 (50%), Positives = 645/1006 (64%), Gaps = 69/1006 (7%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGD-----------ELGNSADGERKEDAAKVNVGPGYAP  2974
             PLVIVA+ D  ++Q M+EEQ+WG            E      G         NV  G  P
Sbjct  208   PLVIVADGD--ANQAMMEEQDWGSVGEDAAAATGAEGERKEGGGETAGGKGGNVIAG--P  263

Query  2973  KIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWR  2794
             KIGYSNH YHHP+HSQFKYVRPGAAPIPGA   GPGG PGQV PP+N + +AGRGRGDWR
Sbjct  264   KIGYSNHVYHHPFHSQFKYVRPGAAPIPGATTAGPGGAPGQVRPPINMAPIAGRGRGDWR  323

Query  2793  PPGMKGALTMQKGF-PGYNA-WGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRL  2626
             P GMK    MQKG+ PG+   WG+N +GRG G  L+FTLPSHKTIF+VDIDSF+EKPW+ 
Sbjct  324   PAGMKNGPPMQKGYHPGFGMPWGNNMAGRGFGGGLEFTLPSHKTIFDVDIDSFEEKPWKY  383

Query  2625  QGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaa  2446
              G+DMSDFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGR EQEYDPDLPPELAA
Sbjct  384   PGVDMSDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESGRAEQEYDPDLPPELAA  443

Query  2445  aAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPR  2266
             AAG+ D+P+EN+NLGK++VGQ+DL +G  R RPPLP GR IQVE G G+RLPSIDTRPPR
Sbjct  444   AAGMHDVPAENSNLGKSDVGQSDLTKGPARMRPPLPTGRAIQVEGGYGERLPSIDTRPPR  503

Query  2265  VRDSDAIIEIVCQGSADDDNNL-------EQGNQPS---REGIRGGDEIGDLQQEDIHHV  2116
              RD D IIEIV Q S DDD++        E G+ PS   RE     DE+  +Q E  H+ 
Sbjct  504   TRDCDVIIEIVLQDSLDDDSSSGNGGLDGENGDPPSDDFRESHVHDDEM--VQIETDHYD  561

Query  2115  DGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRK  1936
             +     Y+G  R+ G +    +SG  +    D ++      P    P SRGQ     G  
Sbjct  562   NDLSQGYDG--RKDGRKAPVVDSGRINIPEGDGMLPFRHGSPSQNRPGSRGQRVSLSGGD  619

Query  1935  HAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSV--GDrrsplssspvsn  1762
                  + +         S D   S+  +DK+  +DN  E+S+    G     +SS     
Sbjct  620   FCPPDEES---------SPDSTPSQITRDKRF-LDNVEEESVESMDGKHSPLVSSPTAVR  669

Query  1761  rsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQ  1582
              +   SA + +  +  E V A+ +SGMER +++ +E T  D  KD  V  + KK KL+S 
Sbjct  670   DARDLSAEDKDVAVSGEPVLAEVSSGMERDEMNENEVTTKDSIKDGDVCHSTKKQKLNSH  729

Query  1581  LEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQT  1405
             + + + QE D GEDSKAARSSENSK RSGSSKDY K  D +EEEV QD R      TR +
Sbjct  730   VGQSALQEVDDGEDSKAARSSENSKARSGSSKDYQKWQDSVEEEVMQDGR------TRDS  783

Query  1404  GG-------EEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIAD  1249
             G         E  ++RK RD  +E E++ M  KGRE SY ++  D++ AHH H +    D
Sbjct  784   GTIKRPVEENESSIRRKERDVRQEMERNHMARKGREGSYPQRDLDTTLAHHPHVRNEGYD  843

Query  1248  RRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLL  1069
             R KER+  D AW  R++D   R+S+ E+SRKRE G+E+ S+HR+KIR+ +RS++E     
Sbjct  844   RHKERENPDGAWLRREEDQQSRKSRPEESRKRERGEEMASRHRSKIREGERSDKEEHLHS  903

Query  1068  RKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREET  889
             RKQLDNG+ R  +DKD  SRHRERE D LK RYD +DD HSKRRK++  + R+H D+EE 
Sbjct  904   RKQLDNGNYRIHYDKDGSSRHRERE-DTLKIRYDIVDDYHSKRRKDEEYVRRDHTDKEEM  962

Query  888   LHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGE  709
             LH   + T RR+RERD++ D RKR+D   QR RD      DD H  R+K+E   Q ERG+
Sbjct  963   LHGHRETTSRRRRERDEVLDPRKRED--QQRVRDSL----DDYHSVRHKDELWPQRERGD  1016

Query  708   RHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYH  529
             R RER+E YR KQSH+E LSKRE++EGRG  R GR A++K+W   +R KDE++GS++EY 
Sbjct  1017  RQREREELYRLKQSHEENLSKREKEEGRGTARTGRGADDKAWINYAR-KDEFRGSEKEYQ  1075

Query  528   SKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYE  349
              KDA R+ E  KRR+R E+   S HR+R+D Y R +Q   +ERR+R ER S R D A + 
Sbjct  1076  LKDAARNSEQQKRRDRVEDEGYSHHRARDDVYARTNQ-LNEERRSRQERSSIRIDRAVHT  1134

Query  348   SDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
              D  +V+++K K+N  K+K  E  D+++L PS  N++D+SG+  E 
Sbjct  1135  PDKQRVNDRKHKDNMRKNKESEGGDRSTLGPSKRNQEDQSGHTGEM  1180



>gb|KDO59420.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1299

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/1074 (48%), Positives = 659/1074 (61%), Gaps = 109/1074 (10%)
 Frame = -1

Query  3309  IPGVSIPGVSGVPETCGD---------RAVdeewdsdsdddDLRIVLNDNNHGPmgmdrm  3157
             +PG+ IPG+S       +             E+      +DDL+IVLN++NH PM +D  
Sbjct  111   VPGIEIPGISQNSVENSEHQNRNEGEAGEEAEDDWESDSEDDLQIVLNEDNHRPMLIDGG  170

Query  3156  ggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGPG-  2983
             GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G G 
Sbjct  171   GGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAPAQMGEGGAEKKEGTGE  226

Query  2982  -------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvh  2845
                           A KIGYSNH  YH+PYHSQFKYVRPGAAPIPG+      G PGQV 
Sbjct  227   RANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAAPIPGSATAVAAGGPGQVR  286

Query  2844  ppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIF  2668
             P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  +  G GL+FTLPSHKTIF
Sbjct  287   PLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGVNMAGRGLEFTLPSHKTIF  346

Query  2667  EVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRT  2488
             EVDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGR 
Sbjct  347   EVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESGRD  406

Query  2487  EQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
             +                                                P GR IQVE G
Sbjct  407   Q------------------------------------------------PTGRAIQVEGG  418

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---NQPSREGIRGG-----DE  2152
             SG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   N   RE  RG      DE
Sbjct  419   SGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRDNDLPREDRRGENDGAEDE  478

Query  2151  IGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILPSEEPDSYHP  1975
             +G +   D  + DGF+ AY+   RE     A F +  +D     + ++  P E P  Y P
Sbjct  479   MGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPFPPEAPLRYRP  535

Query  1974  DSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDr  1795
              SRG T  YPG     +H+  R  GR   RS  +  S+SP+ ++   DN+ E+S+   + 
Sbjct  536   GSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQIRKFH-DNQDEESVESMEG  594

Query  1794  rsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVI  1615
             +    SSPV  R  +E +VE+ D +HDELV    +S +E  K   +  T  D  KD   +
Sbjct  595   KHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--KEETNAVTTSDSRKDGKAL  652

Query  1614  DTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKR  1435
              + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS+D  K  +G EE +QD+R
Sbjct  653   YSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSSRDNKKWREGDEEVMQDRR  712

Query  1434  FAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKT  1261
                +   ++   E E   +RK R+  +E E++RM+  GRE S+ R+ +D S  H    K 
Sbjct  713   STRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGSHPRRDFDPSLTHDMQMKP  772

Query  1260  SIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGDEIESKHRNKIRDIDRSER  1087
                DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H DEI ++HR K R+ +R +R
Sbjct  773   EGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHRGKARESERIDR  832

Query  1086  EGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREH  907
             +     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKRRK+D  + R+H
Sbjct  833   DEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKRRKDDEYVRRDH  891

Query  906   VDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARYKEEP  733
              +++E LH   D T RRKRERDDI DQR+R+D         QR+RE  DD H  R+K+E 
Sbjct  892   AEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQRIRENFDDHHPVRHKDEN  943

Query  732   LFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEY  553
               Q ERGER RER++W+R K  H+EILSKRER+EGRG +R GR++E+++W G +R KDEY
Sbjct  944   WSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSGRSSEDRAWVGHARVKDEY  1002

Query  552   KGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVST  373
             KGSD+EY  KD  RH E LKRRER E+ S   HR RED Y RG+Q S ++R++R ER  T
Sbjct  1003  KGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYARGNQISNEDRKSRQERSGT  1062

Query  372   RQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
             R D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG+ SE 
Sbjct  1063  RNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSGHVSEM  1116



>gb|KDO59421.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1295

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1071 (48%), Positives = 657/1071 (61%), Gaps = 109/1071 (10%)
 Frame = -1

Query  3309  IPGVSIPGVSGVPETCGD---------RAVdeewdsdsdddDLRIVLNDNNHGPmgmdrm  3157
             +PG+ IPG+S       +             E+      +DDL+IVLN++NH PM +D  
Sbjct  111   VPGIEIPGISQNSVENSEHQNRNEGEAGEEAEDDWESDSEDDLQIVLNEDNHRPMLIDGG  170

Query  3156  ggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGPG-  2983
             GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G G 
Sbjct  171   GGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAPAQMGEGGAEKKEGTGE  226

Query  2982  -------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvh  2845
                           A KIGYSNH  YH+PYHSQFKYVRPGAAPIPG+      G PGQV 
Sbjct  227   RANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAAPIPGSATAVAAGGPGQVR  286

Query  2844  ppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIF  2668
             P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  +  G GL+FTLPSHKTIF
Sbjct  287   PLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGVNMAGRGLEFTLPSHKTIF  346

Query  2667  EVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRT  2488
             EVDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGR 
Sbjct  347   EVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESGRD  406

Query  2487  EQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
             +                                                P GR IQVE G
Sbjct  407   Q------------------------------------------------PTGRAIQVEGG  418

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---NQPSREGIRGG-----DE  2152
             SG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   N   RE  RG      DE
Sbjct  419   SGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRDNDLPREDRRGENDGAEDE  478

Query  2151  IGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILPSEEPDSYHP  1975
             +G +   D  + DGF+ AY+   RE     A F +  +D     + ++  P E P  Y P
Sbjct  479   MGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPFPPEAPLRYRP  535

Query  1974  DSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDr  1795
              SRG T  YPG     +H+  R  GR   RS  +  S+SP+ ++   DN+ E+S+   + 
Sbjct  536   GSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQIRKFH-DNQDEESVESMEG  594

Query  1794  rsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVI  1615
             +    SSPV  R  +E +VE+ D +HDELV    +S +E  K   +  T  D  KD   +
Sbjct  595   KHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--KEETNAVTTSDSRKDGKAL  652

Query  1614  DTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKR  1435
              + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS+D  K  +G EE +QD+R
Sbjct  653   YSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSSRDNKKWREGDEEVMQDRR  712

Query  1434  FAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKT  1261
                +   ++   E E   +RK R+  +E E++RM+  GRE S+ R+ +D S  H    K 
Sbjct  713   STRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGSHPRRDFDPSLTHDMQMKP  772

Query  1260  SIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGDEIESKHRNKIRDIDRSER  1087
                DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H DEI ++HR K R+ +R +R
Sbjct  773   EGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHRGKARESERIDR  832

Query  1086  EGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREH  907
             +     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKRRK+D  + R+H
Sbjct  833   DEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKRRKDDEYVRRDH  891

Query  906   VDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARYKEEP  733
              +++E LH   D T RRKRERDDI DQR+R+D         QR+RE  DD H  R+K+E 
Sbjct  892   AEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQRIRENFDDHHPVRHKDEN  943

Query  732   LFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEY  553
               Q ERGER RER++W+R K  H+EILSKRER+EGRG +R GR++E+++W G +R KDEY
Sbjct  944   WSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSGRSSEDRAWVGHARVKDEY  1002

Query  552   KGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVST  373
             KGSD+EY  KD  RH E LKRRER E+ S   HR RED Y RG+Q S ++R++R ER  T
Sbjct  1003  KGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYARGNQISNEDRKSRQERSGT  1062

Query  372   RQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
             R D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG+ 
Sbjct  1063  RNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSGHG  1113



>ref|XP_010100240.1| hypothetical protein L484_005444 [Morus notabilis]
 gb|EXB82160.1| hypothetical protein L484_005444 [Morus notabilis]
Length=1337

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/1020 (51%), Positives = 654/1020 (64%), Gaps = 67/1020 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdr--mggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLNDNNHG MGM+R  M G  DDDD+D D LVIVA+ D   +Q M EEQ+WG++   
Sbjct  183   LQIVLNDNNHGHMGMERGRMAGGDDDDDEDEDGLVIVADGD--PNQAM-EEQDWGEDAAQ  239

Query  3036  SADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpgg  2863
             +ADGERKE  +A K  VG   A KIGYSNHG+H P+HSQFKYVRPGAAPIPGA   GPGG
Sbjct  240   AADGERKEMGEAGKPGVGGAMASKIGYSNHGFH-PFHSQFKYVRPGAAPIPGATTSGPGG  298

Query  2862  tpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIG--LDFTL  2689
              PGQV P VN   +AGRGR                      AWG N SGRG G  L+FTL
Sbjct  299   VPGQVRPLVNMGPMAGRGR----------------------AWGGNASGRGFGSGLEFTL  336

Query  2688  PSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIR  2509
             PSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLEQLRLESTMQ KIR
Sbjct  337   PSHKTIFDVDIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLEQLRLESTMQSKIR  396

Query  2508  VYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGR  2329
             VYESGR EQEYDPDLPPELAAA GIQ++PSENAN  K EV Q D+ +GS R RPPLP GR
Sbjct  397   VYESGRAEQEYDPDLPPELAAATGIQEVPSENANSIKPEVAQGDIQKGSARVRPPLPTGR  456

Query  2328  PIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNN----LEQGNQPSREGIRG  2161
              IQVE G G+RLPSIDTRPPR+RDSDAIIE     +A + NN    L+  N   +E   G
Sbjct  457   AIQVEGGYGERLPSIDTRPPRIRDSDAIIEDSLDDNASEGNNDPNRLDNDNDTPKEDFGG  516

Query  2160  GDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSY  1981
                  D    D  + D F  AY+  KRE    RA F     D+   DRV+  PS EP   
Sbjct  517   NVAEEDSTVVDSEYADKFPQAYSDQKREPLGPRAPFCDDIPDR---DRVLPFPS-EPQVR  572

Query  1980  HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVG  1801
                     SV+P  + +  +D  + +GR   RS  +  S + ++K+  ++N  EDS+   
Sbjct  573   TAGFCAHVSVHPDGELSARYDERQTQGRVCDRSPRMTRSRNSREKKY-INNEPEDSVESM  631

Query  1800  DrrsplssspvsnrsVQESAVENND-NLHDELVPAQRNSGMERGKISVDERTNCDKAKDD  1624
             D +    SSP + R   ES+VE  D + HDELVPA  +  ME+     D+  +   A  D
Sbjct  632   DSKQSPLSSPATFRDAHESSVEPRDVDDHDELVPADGSPIMEK-----DDTISNTIAVSD  686

Query  1623  SVID-TAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV  1447
             ++ D T KK K+ SQ+E+ S +E D G+DSKAARSS+NS+ RSGSS+D  K  DG+EEEV
Sbjct  687   TLEDGTTKKQKIISQVEQSSNKEPDDGDDSKAARSSDNSRARSGSSRDCPKRWDGIEEEV  746

Query  1446  ---QDKRFAHVDDTRQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssah  1279
                   R  +V   R    +E  + RK RD  ++ E++RM+ KGRED Y  K +D  S+ 
Sbjct  747   IQGHSTRMGNV--KRHFDEKEQGIHRKIRDGRQDLERNRMVGKGREDYYPYKEFD-PSSV  803

Query  1278  hsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDID  1099
             H H ++   +RRKERD  D AWQ RDDD H RR + E++RKRE GDE+ S+HR+K+R+ D
Sbjct  804   HLHMRSDGFERRKERDNPDGAWQRRDDDSHNRRIRTEETRKRERGDEVGSRHRSKVRESD  863

Query  1098  RSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKL  919
             RS+++     RKQ+DNGS R  +DKD V R+R R+ D+LK RY+++DD HSKR+K++  L
Sbjct  864   RSDKDELIHSRKQMDNGSHRAHYDKDVVPRYRGRD-DNLKGRYEHMDDYHSKRKKDEEHL  922

Query  918   SREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARY  745
              R+H ++EE +H + + T RRKRERD++ DQRKRD          QRLR+  DD H  R+
Sbjct  923   RRDHANKEEMMHGQRENTNRRKRERDEVLDQRKRD--------GQQRLRDGLDDHHSVRH  974

Query  744   KEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRG  565
             K+E   Q ER ER RER+EW R KQ H++   KRERDEGR   R GR++E+K W G  + 
Sbjct  975   KDESWLQRERSERQREREEWQRLKQPHEDNKPKRERDEGRSVTRGGRSSEDKGWVGHPKI  1034

Query  564   KDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNE  385
              DE KG D+EY  K+  RH E  KRR+R E+ S SRH  RED Y RG+Q S  ERR+R E
Sbjct  1035  MDESKGPDKEYQYKETIRHGEPSKRRDRTEDES-SRHGGREDAYARGNQVSNGERRSRLE  1093

Query  384   RVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
             R S R D +   SD  KV +KK KEN+ +++  E  D  +L  S  N++D  G ++ETV 
Sbjct  1094  RPSVRNDRSVNASDDLKVQDKKHKENAKRNRESEGGDYITLASSKRNQEDHGGQSNETVL  1153



>ref|XP_008384553.1| PREDICTED: uncharacterized protein LOC103447129 isoform X4 [Malus 
domestica]
Length=1368

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1022 (50%), Positives = 660/1022 (65%), Gaps = 71/1022 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190   LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
             +GERKE  +A K   G    PK+GYS+HGY HP+HSQFKYVRPGA P+PG P  G GG P
Sbjct  246   EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVRPGAVPMPGPPTSGXGGVP  304

Query  2856  gqvhppVNTSL--VAGRGRGDWRPPGMKGALTMQK-GFPGYNA--WGSN--PSGRGIGLD  2698
                      +L   AGRGRGDWRP GMK    +QK   PG+    W +N    G G GLD
Sbjct  305   LPGQVRPLVNLGPGAGRGRGDWRPTGMKNGTPLQKNSHPGFGTPGWSNNMGGRGFGGGLD  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+V ID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLEQLRLESTMQ 
Sbjct  365   FTLPSHKTIFDVVIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLEQLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGR EQEYDPDLPPELAAA GI D P+EN N GK++V Q+DLA+GS R RPP+P
Sbjct  425   KIRVYESGRAEQEYDPDLPPELAAATGIHDFPAENVNPGKSDVVQSDLAKGSARLRPPIP  484

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  485   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDRPR  544

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSE  1996
             EG   G+  GDL Q +  + DG   AYN  K   G +    ++ P + +       LPS 
Sbjct  545   EGFGRGE--GDLPQVESEYFDGSPQAYNDQK--VGRKMPFHDNIPEEGN-------LPS-  592

Query  1995  EPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARC-RSADIGASESPKDKQIDVDNRRE  1819
              P+   P        Y G          R+  R  C RS  +  S +  DK+  ++N++E
Sbjct  593   PPEVAVP--------YTGSGXETPSYQERKTQRRACDRSPHVTPSRNIGDKKC-LENQKE  643

Query  1818  DSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNC  1642
             +S+ S+  + SP  SSPV+NR+ +ES+ +  D+  DE V A  +S M + + S       
Sbjct  644   ESIESMDGKHSPGISSPVTNRAARESSADYRDSDQDEPVLADGSSEMGKEETST------  697

Query  1641  DKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
               A++D++ D A KHK L S++E+ + +E D GEDSKAA+SS+NSK RSGSS+DY K  D
Sbjct  698   -VAENDALQDGAPKHKRLVSRVEQSADEELDDGEDSKAAKSSDNSKARSGSSRDYXKWRD  756

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRKGRD-EKETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R   +   ++   E ++  QRK RD  +E ++  M+VKGRE SY  + +D 
Sbjct  757   GVEEEVIQGRSTXMGGIKRHLDENEKGFQRKNRDGRQEPDRSHMVVKGREGSYPYRDWDP  816

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K      RKERD  DV WQ R++D   RR + E++RKRE  DE+ S+HR+K+
Sbjct  817   SSAHQLQLKNDGLHGRKERDNLDVPWQRRENDPCSRRIRPEETRKRERSDEMGSRHRSKV  876

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DR++++     RKQ+DNGS R  HDKD  SR RERE   LK+RY++++D H KRRK+
Sbjct  877   REGDRNDKDEHLQSRKQVDNGSYRVCHDKDVGSRPRERE-GSLKARYEHVEDYHGKRRKD  935

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQH  757
             +  + R+H+D+E+ LH   D + RRKRERD+I DQRKRD        + QR+R   DD H
Sbjct  936   EEYMKRDHIDKEDFLHGHRDNSTRRKRERDEILDQRKRD--------EQQRVRXNLDDLH  987

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
              AR+K++     ERG+R RE++EW+R KQS +E + KRE DEGR  +R GR AE+K+W G
Sbjct  988   PARHKDDGWSHRERGDRQREKEEWHRVKQSQEENIPKREXDEGRVAIRGGRGAEDKAWVG  1047

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              +R KDE KG+D+E+  K+  RH E  KRR+R E  S S  R R D +GRG+Q + DE+R
Sbjct  1048  HTRAKDENKGADKEHQYKETARHSEPSKRRDRVEEES-SHRRGRXDVHGRGNQINNDEKR  1106

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             +  ER STR + A    DS KVH++K KENS K K  E+   N+   S  +++D+SG+  
Sbjct  1107  SGKERSSTRNERA----DSQKVHDRKHKENSRKSK--ESEIANNSTTSKRHQEDQSGHNK  1160

Query  216   ET  211
             E 
Sbjct  1161  EM  1162



>ref|XP_007138264.1| hypothetical protein PHAVU_009G194000g [Phaseolus vulgaris]
 gb|ESW10258.1| hypothetical protein PHAVU_009G194000g [Phaseolus vulgaris]
Length=1323

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/1056 (48%), Positives = 665/1056 (63%), Gaps = 74/1056 (7%)
 Frame = -1

Query  3294  IPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPL  3115
             IPG++G  E   +   + +      +DDL+IVLN+NNH  M    M    + ++D  + L
Sbjct  125   IPGLAG--EAPAEEGGEGDDWDTDSEDDLKIVLNENNHMAMERGGMVEGDEGEEDGDEEL  182

Query  3114  VIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDAAKV-NVGPGYAPKIGYSNHGYHH  2941
             VIVA  D P+    VEEQEWG+    +A +GERK+ A ++   G   APKIGYSNHGYH 
Sbjct  183   VIVAGGD-PNQG--VEEQEWGENAAVAAGEGERKDAAGELAKAGGAVAPKIGYSNHGYH-  238

Query  2940  PYHSQFKY--VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             P+HSQFKY  VRPGAA +PGA    PGG PGQ+ P VN   +AGRGRGDWRPPG+KG   
Sbjct  239   PFHSQFKYQYVRPGAALMPGATSSTPGGPPGQIRPLVN---MAGRGRGDWRPPGLKGPTA  295

Query  2766  MQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDF  2602
             MQKGF   PG  +WGS  +GRG G  L+FTLPSHKTIF+VDI++F+EKPW+   +D SDF
Sbjct  296   MQKGFHGGPGLPSWGSATAGRGFGGGLEFTLPSHKTIFDVDIENFEEKPWKYPSVDTSDF  355

Query  2601  FNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIP  2422
             FNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPELAAA GI D+P
Sbjct  356   FNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPELAAATGIHDVP  415

Query  2421  SENANLGKTEVGQNDL-ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
              ENAN  K+++ Q+ +   G+ R RPPLP GR IQVE G GDRLPSIDTRPPR+RDSDAI
Sbjct  416   VENANSHKSDIRQDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDTRPPRIRDSDAI  475

Query  2244  IEIVCQGSADDDNNL------EQGNQPSREGIR----GGDEIGDLQQEDIHHVDGFQHAY  2095
             IEIV Q + DD ++        +G +P RE  R     GDEI  L+ E   + DGF   Y
Sbjct  476   IEIVLQDTEDDHSSAGFAQDPPEGGEPHREDFREDHVAGDEIPRLEPE---YFDGFSQDY  532

Query  2094  NGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHD  1918
             +G K+    RR  F NS P + +  D  ++ P EE   Y   SRGQ     G   + + D
Sbjct  533   SGRKKVLPGRRKPFINSSPANTANGDEKLLFPQEESIEYS-GSRGQNHRSYGGNFSSSQD  591

Query  1917  STREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAV  1738
               + + R R +S  I    +P  +    +N++E+S+   + R     S    + V+ES+V
Sbjct  592   ERKMQRRVRGQSPPI----TPIQELAADNNKKEESVESMEGRHDTPVSSPVIKDVRESSV  647

Query  1737  ENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAK--DDSVIDTAKKHKLSSQLEEPSP  1564
               + +   E      ++G   G   +++    DK    DD V   AK+ KL+S++E+   
Sbjct  648   VEDKDTELE------DTGTADGSSKLEKEDTVDKVDILDDGV---AKRQKLTSRVEQHLL  698

Query  1563  QETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-ED  1390
              E D  EDSKAA+SS+NSK RS SS+D HK  +G EEE VQD R AH+   RQ   E E 
Sbjct  699   DELDDFEDSKAAKSSDNSKARSASSRDNHKRREGFEEEVVQDPRSAHLSSIRQHPDEIEQ  758

Query  1389  RLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAW  1213
                R+  D K E E++R I+KGRE  Y  K    S A   HT T   D +KERD SD+ W
Sbjct  759   GFYRREHDAKQEPERNRTIIKGRERPYTYKDRHLSLAPQLHTNTDGFDGQKERDNSDMDW  818

Query  1212  QHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNG-SLRP  1036
               RDDDL+ RR + ++ RKR+         R K+R+ +R+++E     RK +DNG S R 
Sbjct  819   ARRDDDLYNRRVRNDEPRKRD---------RAKVRENERNDKEDNLHSRKLMDNGSSYRV  869

Query  1035  DHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTL  862
              +DKD  SR  R RERDD L+ RY+ ++D H KRRK++  L REH+D+EE LH   +   
Sbjct  870   SYDKDVGSRDSRHRERDDGLRMRYEAVEDYHGKRRKDEEYLRREHIDKEEILHGYRENAS  929

Query  861   RRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWY  682
             RR+RERD++ D RKRDD+  QR RD+     DDQ+ AR K+E     ERG+R R+R+EW+
Sbjct  930   RRRRERDEVLDPRKRDDL--QRTRDNP----DDQYAARQKDEAWVLRERGDRQRDREEWH  983

Query  681   RPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVE  502
             R KQSH+E+L KRER++GR  +R GR AEEKSW G  R KDE+K S++EY S++A RH +
Sbjct  984   RMKQSHEELLPKREREDGRSSVRSGRGAEEKSWVGHVRAKDEHKISEKEYQSREAMRHND  1043

Query  501   HLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEK  322
              LKRR+R ++ SP  H+ R+D   RG+Q  T+ERR+R ER S+R D  A  SD+ KV   
Sbjct  1044  QLKRRDRIQDESP-HHKGRDDASARGNQYPTEERRSRQERSSSRSDRVANASDNQKV---  1099

Query  321   KRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
             + +E S K K  + SD NSL  S  N++++SG  +E
Sbjct  1100  RHREGSRKSKERDVSDLNSLGVSKRNQENQSGPTNE  1135



>ref|XP_004287116.1| PREDICTED: uncharacterized protein LOC101308899 [Fragaria vesca 
subsp. vesca]
Length=1310

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/1074 (48%), Positives = 673/1074 (63%), Gaps = 89/1074 (8%)
 Frame = -1

Query  3321  SEHMIPGVS----IPGVSGV----------PETCGDRAVdeewdsdsdddDLRIVLNDNN  3184
             S + IPG+     IPG+SG           PE    R   ++WDSD  +DDL+IVLNDNN
Sbjct  108   STNEIPGMGLDAVIPGLSGAAPVRNTENNNPEGS-RRDGGDDWDSDDSEDDLQIVLNDNN  166

Query  3183  HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE---  3013
                         G+ ++DD D LVI+A S+  +H     E     +   +ADGERKE   
Sbjct  167   ------AMGMERGNGEEDDDDGLVIMAESE-LNHAGEEPEWGEEGQ--QAADGERKEMGE  217

Query  3012  ---DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhp  2842
                       GP  APKIGYSNHGYH P+HSQFKYVRPGA P+PG    GPG        
Sbjct  218   AGRGGGGGGGGPMVAPKIGYSNHGYH-PFHSQFKYVRPGAVPMPGPTNSGPGVPGQVRPL  276

Query  2841  pVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSGRGIGLDFTLPSH  2680
               N     GRGRGDWRP G+K    MQK F      PG+        G G GL+FTLPSH
Sbjct  277   V-NMGPTPGRGRGDWRPTGLKNGTPMQKNFHSGFGTPGWGN-NMGGRGFGGGLEFTLPSH  334

Query  2679  KTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYE  2500
             KTIF+VDID F+EKPW+  G D SD+FNFGLN++SW+DYCKQLEQLRLESTMQ KIRVYE
Sbjct  335   KTIFDVDIDGFEEKPWKYPGADTSDYFNFGLNDDSWRDYCKQLEQLRLESTMQSKIRVYE  394

Query  2499  SGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQ  2320
             SGRTEQEYDPDLPPELAAA G+ D P+ N NLGK+E GQ+D A+GS R RPP+P GR IQ
Sbjct  395   SGRTEQEYDPDLPPELAAATGMHDFPTANTNLGKSEGGQSDFAKGSARMRPPIPTGRAIQ  454

Query  2319  VESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD----NNLEQG--NQPSREGIRGG  2158
             VESG G+R PS + RP R+RDSDA+IEIV Q S DDD    N++  G  N PS+E     
Sbjct  455   VESGYGERFPSCENRPQRMRDSDAVIEIVLQDSLDDDSSARNDIPDGTENDPSKEDGSAI  514

Query  2157  DEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFN-SGPYDKSRSDRVVILPSEEPDSY  1981
              E GDL+Q+D  + +GF HA+N  K +   R+  FN S P D      V  LP      +
Sbjct  515   GE-GDLRQDDKTYSNGFPHAHNNRKSDSLGRKRPFNGSVPED------VESLP------F  561

Query  1980  HPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSL-SV  1804
              P+   Q +   G +   +   +  + R   R A   +  S +D +   DN++E S+ SV
Sbjct  562   RPEGPVQRAGS-GDQTPSSTGGSFGENRGTQRRARDRSPRSTRDMKF-PDNQKEGSVESV  619

Query  1803  GDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDD  1624
               RRSPL SSPVS+ + +ES V++     DE +P   NSGME+ +++ +           
Sbjct  620   AGRRSPLISSPVSHGAARESNVQHRSGDQDEPLPGDENSGMEKEEMAAN-----------  668

Query  1623  SVIDTAKKH-KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV  1447
              V D    H KL+S++E+ + +E D GEDSKAARSS+NSK RSGSS+DY K  DG+EEEV
Sbjct  669   -VNDGVPNHQKLTSRVEQSADEELDDGEDSKAARSSDNSKARSGSSRDYQKWRDGVEEEV  727

Query  1446  QDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhs  1273
                R +H    +    E+++  QRKGRD + E ++++M++KGRE SY  + +D SS HHS
Sbjct  728   IQGRSSHSGGIKSHLDEKEQGFQRKGRDGRPEPDRNQMLLKGREGSYPYRDWDPSSVHHS  787

Query  1272  HTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRS  1093
               K     RRKER+  D AWQ RDDD + RR + E+ RKRE GDE+ S+HR+KIR+ +RS
Sbjct  788   QFKNDALHRRKEREILDGAWQRRDDDPYSRRIRTEEPRKRERGDEMGSRHRSKIRESERS  847

Query  1092  EREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSR  913
             +++     RKQLDNGS R  +DKD  SR RERE D LK RY++IDD H KRRK++  + R
Sbjct  848   DKDEYMQSRKQLDNGSYRVFYDKDVGSRPRERE-DSLKGRYEHIDDYHGKRRKDEEYMRR  906

Query  912   EHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEP  733
             + +D+EE L    D T RRKRERD++ DQRKRDD   Q+ RD+     DD H  R+K+E 
Sbjct  907   DQIDKEELLQGHRDTTTRRKRERDEVLDQRKRDD--QQKVRDNP----DDHHSVRHKDES  960

Query  732   LFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEY  553
               Q ERG+R RER+EW+R KQSH+E L KRERD+GR  +R GR +E+K+W G +R KDE 
Sbjct  961   WLQRERGDRQREREEWHRLKQSHEENLPKRERDDGRVSVRGGRVSEDKAWVGHARAKDEN  1020

Query  552   KGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVST  373
             KGSD+E+ +K+  RH E  KRR+R E  S S HR RED + RG+Q + DERR+  ER ST
Sbjct  1021  KGSDKEHQNKETVRHGEQSKRRDRVEEES-SHHRGREDAHARGNQMNIDERRSGKERSST  1079

Query  372   RQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
             R +      DS KVH++K KENS ++K  E +D ++ + S  ++DD+SG + E 
Sbjct  1080  RNERV----DSQKVHDRKHKENSRRNKEIEIADISTSITSKRHQDDQSGRSKEM  1129



>ref|XP_008384539.1| PREDICTED: uncharacterized protein LOC103447129 isoform X2 [Malus 
domestica]
Length=1422

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1022 (50%), Positives = 660/1022 (65%), Gaps = 71/1022 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190   LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
             +GERKE  +A K   G    PK+GYS+HGY HP+HSQFKYVRPGA P+PG P  G GG P
Sbjct  246   EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVRPGAVPMPGPPTSGXGGVP  304

Query  2856  gqvhppVNTSL--VAGRGRGDWRPPGMKGALTMQK-GFPGYNA--WGSN--PSGRGIGLD  2698
                      +L   AGRGRGDWRP GMK    +QK   PG+    W +N    G G GLD
Sbjct  305   LPGQVRPLVNLGPGAGRGRGDWRPTGMKNGTPLQKNSHPGFGTPGWSNNMGGRGFGGGLD  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+V ID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLEQLRLESTMQ 
Sbjct  365   FTLPSHKTIFDVVIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLEQLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGR EQEYDPDLPPELAAA GI D P+EN N GK++V Q+DLA+GS R RPP+P
Sbjct  425   KIRVYESGRAEQEYDPDLPPELAAATGIHDFPAENVNPGKSDVVQSDLAKGSARLRPPIP  484

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  485   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDRPR  544

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSE  1996
             EG   G+  GDL Q +  + DG   AYN  K   G +    ++ P + +       LPS 
Sbjct  545   EGFGRGE--GDLPQVESEYFDGSPQAYNDQK--VGRKMPFHDNIPEEGN-------LPS-  592

Query  1995  EPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARC-RSADIGASESPKDKQIDVDNRRE  1819
              P+   P        Y G          R+  R  C RS  +  S +  DK+  ++N++E
Sbjct  593   PPEVAVP--------YTGSGXETPSYQERKTQRRACDRSPHVTPSRNIGDKKC-LENQKE  643

Query  1818  DSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNC  1642
             +S+ S+  + SP  SSPV+NR+ +ES+ +  D+  DE V A  +S M + + S       
Sbjct  644   ESIESMDGKHSPGISSPVTNRAARESSADYRDSDQDEPVLADGSSEMGKEETST------  697

Query  1641  DKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
               A++D++ D A KHK L S++E+ + +E D GEDSKAA+SS+NSK RSGSS+DY K  D
Sbjct  698   -VAENDALQDGAPKHKRLVSRVEQSADEELDDGEDSKAAKSSDNSKARSGSSRDYXKWRD  756

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRKGRD-EKETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R   +   ++   E ++  QRK RD  +E ++  M+VKGRE SY  + +D 
Sbjct  757   GVEEEVIQGRSTXMGGIKRHLDENEKGFQRKNRDGRQEPDRSHMVVKGREGSYPYRDWDP  816

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K      RKERD  DV WQ R++D   RR + E++RKRE  DE+ S+HR+K+
Sbjct  817   SSAHQLQLKNDGLHGRKERDNLDVPWQRRENDPCSRRIRPEETRKRERSDEMGSRHRSKV  876

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DR++++     RKQ+DNGS R  HDKD  SR RERE   LK+RY++++D H KRRK+
Sbjct  877   REGDRNDKDEHLQSRKQVDNGSYRVCHDKDVGSRPRERE-GSLKARYEHVEDYHGKRRKD  935

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQH  757
             +  + R+H+D+E+ LH   D + RRKRERD+I DQRKRD        + QR+R   DD H
Sbjct  936   EEYMKRDHIDKEDFLHGHRDNSTRRKRERDEILDQRKRD--------EQQRVRXNLDDLH  987

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
              AR+K++     ERG+R RE++EW+R KQS +E + KRE DEGR  +R GR AE+K+W G
Sbjct  988   PARHKDDGWSHRERGDRQREKEEWHRVKQSQEENIPKREXDEGRVAIRGGRGAEDKAWVG  1047

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              +R KDE KG+D+E+  K+  RH E  KRR+R E  S S  R R D +GRG+Q + DE+R
Sbjct  1048  HTRAKDENKGADKEHQYKETARHSEPSKRRDRVEEES-SHRRGRXDVHGRGNQINNDEKR  1106

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             +  ER STR + A    DS KVH++K KENS K K  E+   N+   S  +++D+SG+  
Sbjct  1107  SGKERSSTRNERA----DSQKVHDRKHKENSRKSK--ESEIANNSTTSKRHQEDQSGHNK  1160

Query  216   ET  211
             E 
Sbjct  1161  EM  1162



>ref|XP_008384547.1| PREDICTED: uncharacterized protein LOC103447129 isoform X3 [Malus 
domestica]
Length=1389

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1022 (50%), Positives = 660/1022 (65%), Gaps = 71/1022 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190   LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
             +GERKE  +A K   G    PK+GYS+HGY HP+HSQFKYVRPGA P+PG P  G GG P
Sbjct  246   EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVRPGAVPMPGPPTSGXGGVP  304

Query  2856  gqvhppVNTSL--VAGRGRGDWRPPGMKGALTMQK-GFPGYNA--WGSN--PSGRGIGLD  2698
                      +L   AGRGRGDWRP GMK    +QK   PG+    W +N    G G GLD
Sbjct  305   LPGQVRPLVNLGPGAGRGRGDWRPTGMKNGTPLQKNSHPGFGTPGWSNNMGGRGFGGGLD  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+V ID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLEQLRLESTMQ 
Sbjct  365   FTLPSHKTIFDVVIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLEQLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGR EQEYDPDLPPELAAA GI D P+EN N GK++V Q+DLA+GS R RPP+P
Sbjct  425   KIRVYESGRAEQEYDPDLPPELAAATGIHDFPAENVNPGKSDVVQSDLAKGSARLRPPIP  484

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  485   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDRPR  544

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSE  1996
             EG   G+  GDL Q +  + DG   AYN  K   G +    ++ P + +       LPS 
Sbjct  545   EGFGRGE--GDLPQVESEYFDGSPQAYNDQK--VGRKMPFHDNIPEEGN-------LPS-  592

Query  1995  EPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARC-RSADIGASESPKDKQIDVDNRRE  1819
              P+   P        Y G          R+  R  C RS  +  S +  DK+  ++N++E
Sbjct  593   PPEVAVP--------YTGSGXETPSYQERKTQRRACDRSPHVTPSRNIGDKKC-LENQKE  643

Query  1818  DSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNC  1642
             +S+ S+  + SP  SSPV+NR+ +ES+ +  D+  DE V A  +S M + + S       
Sbjct  644   ESIESMDGKHSPGISSPVTNRAARESSADYRDSDQDEPVLADGSSEMGKEETST------  697

Query  1641  DKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
               A++D++ D A KHK L S++E+ + +E D GEDSKAA+SS+NSK RSGSS+DY K  D
Sbjct  698   -VAENDALQDGAPKHKRLVSRVEQSADEELDDGEDSKAAKSSDNSKARSGSSRDYXKWRD  756

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRKGRD-EKETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R   +   ++   E ++  QRK RD  +E ++  M+VKGRE SY  + +D 
Sbjct  757   GVEEEVIQGRSTXMGGIKRHLDENEKGFQRKNRDGRQEPDRSHMVVKGREGSYPYRDWDP  816

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K      RKERD  DV WQ R++D   RR + E++RKRE  DE+ S+HR+K+
Sbjct  817   SSAHQLQLKNDGLHGRKERDNLDVPWQRRENDPCSRRIRPEETRKRERSDEMGSRHRSKV  876

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DR++++     RKQ+DNGS R  HDKD  SR RERE   LK+RY++++D H KRRK+
Sbjct  877   REGDRNDKDEHLQSRKQVDNGSYRVCHDKDVGSRPRERE-GSLKARYEHVEDYHGKRRKD  935

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQH  757
             +  + R+H+D+E+ LH   D + RRKRERD+I DQRKRD        + QR+R   DD H
Sbjct  936   EEYMKRDHIDKEDFLHGHRDNSTRRKRERDEILDQRKRD--------EQQRVRXNLDDLH  987

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
              AR+K++     ERG+R RE++EW+R KQS +E + KRE DEGR  +R GR AE+K+W G
Sbjct  988   PARHKDDGWSHRERGDRQREKEEWHRVKQSQEENIPKREXDEGRVAIRGGRGAEDKAWVG  1047

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              +R KDE KG+D+E+  K+  RH E  KRR+R E  S S  R R D +GRG+Q + DE+R
Sbjct  1048  HTRAKDENKGADKEHQYKETARHSEPSKRRDRVEEES-SHRRGRXDVHGRGNQINNDEKR  1106

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             +  ER STR + A    DS KVH++K KENS K K  E+   N+   S  +++D+SG+  
Sbjct  1107  SGKERSSTRNERA----DSQKVHDRKHKENSRKSK--ESEIANNSTTSKRHQEDQSGHNK  1160

Query  216   ET  211
             E 
Sbjct  1161  EM  1162



>ref|XP_008384531.1| PREDICTED: uncharacterized protein LOC103447129 isoform X1 [Malus 
domestica]
Length=1437

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1022 (50%), Positives = 660/1022 (65%), Gaps = 71/1022 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G  G+DDDDD   LVIVA+S+   +QPM ++QEW +E   +A
Sbjct  190   LQIVLNDNNHGPMDMERGGMGGEDDDDDDG-LVIVADSE--PNQPM-DDQEWVEESAQAA  245

Query  3030  DGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
             +GERKE  +A K   G    PK+GYS+HGY HP+HSQFKYVRPGA P+PG P  G GG P
Sbjct  246   EGERKEMAEAGKTAGGVVVPPKVGYSSHGY-HPFHSQFKYVRPGAVPMPGPPTSGXGGVP  304

Query  2856  gqvhppVNTSL--VAGRGRGDWRPPGMKGALTMQK-GFPGYNA--WGSN--PSGRGIGLD  2698
                      +L   AGRGRGDWRP GMK    +QK   PG+    W +N    G G GLD
Sbjct  305   LPGQVRPLVNLGPGAGRGRGDWRPTGMKNGTPLQKNSHPGFGTPGWSNNMGGRGFGGGLD  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+V ID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLEQLRLESTMQ 
Sbjct  365   FTLPSHKTIFDVVIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLEQLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGR EQEYDPDLPPELAAA GI D P+EN N GK++V Q+DLA+GS R RPP+P
Sbjct  425   KIRVYESGRAEQEYDPDLPPELAAATGIHDFPAENVNPGKSDVVQSDLAKGSARLRPPIP  484

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  485   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDRPR  544

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSE  1996
             EG   G+  GDL Q +  + DG   AYN  K   G +    ++ P + +       LPS 
Sbjct  545   EGFGRGE--GDLPQVESEYFDGSPQAYNDQK--VGRKMPFHDNIPEEGN-------LPS-  592

Query  1995  EPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARC-RSADIGASESPKDKQIDVDNRRE  1819
              P+   P        Y G          R+  R  C RS  +  S +  DK+  ++N++E
Sbjct  593   PPEVAVP--------YTGSGXETPSYQERKTQRRACDRSPHVTPSRNIGDKKC-LENQKE  643

Query  1818  DSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNC  1642
             +S+ S+  + SP  SSPV+NR+ +ES+ +  D+  DE V A  +S M + + S       
Sbjct  644   ESIESMDGKHSPGISSPVTNRAARESSADYRDSDQDEPVLADGSSEMGKEETST------  697

Query  1641  DKAKDDSVIDTAKKHK-LSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
               A++D++ D A KHK L S++E+ + +E D GEDSKAA+SS+NSK RSGSS+DY K  D
Sbjct  698   -VAENDALQDGAPKHKRLVSRVEQSADEELDDGEDSKAAKSSDNSKARSGSSRDYXKWRD  756

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRKGRD-EKETEKHRMIVKGREDSYMRKGYDs  1291
             G+EEEV   R   +   ++   E ++  QRK RD  +E ++  M+VKGRE SY  + +D 
Sbjct  757   GVEEEVIQGRSTXMGGIKRHLDENEKGFQRKNRDGRQEPDRSHMVVKGREGSYPYRDWDP  816

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
             SSAH    K      RKERD  DV WQ R++D   RR + E++RKRE  DE+ S+HR+K+
Sbjct  817   SSAHQLQLKNDGLHGRKERDNLDVPWQRRENDPCSRRIRPEETRKRERSDEMGSRHRSKV  876

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R+ DR++++     RKQ+DNGS R  HDKD  SR RERE   LK+RY++++D H KRRK+
Sbjct  877   REGDRNDKDEHLQSRKQVDNGSYRVCHDKDVGSRPRERE-GSLKARYEHVEDYHGKRRKD  935

Query  930   DTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQH  757
             +  + R+H+D+E+ LH   D + RRKRERD+I DQRKRD        + QR+R   DD H
Sbjct  936   EEYMKRDHIDKEDFLHGHRDNSTRRKRERDEILDQRKRD--------EQQRVRXNLDDLH  987

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
              AR+K++     ERG+R RE++EW+R KQS +E + KRE DEGR  +R GR AE+K+W G
Sbjct  988   PARHKDDGWSHRERGDRQREKEEWHRVKQSQEENIPKREXDEGRVAIRGGRGAEDKAWVG  1047

Query  576   LSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERR  397
              +R KDE KG+D+E+  K+  RH E  KRR+R E  S S  R R D +GRG+Q + DE+R
Sbjct  1048  HTRAKDENKGADKEHQYKETARHSEPSKRRDRVEEES-SHRRGRXDVHGRGNQINNDEKR  1106

Query  396   ARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNAS  217
             +  ER STR + A    DS KVH++K KENS K K  E+   N+   S  +++D+SG+  
Sbjct  1107  SGKERSSTRNERA----DSQKVHDRKHKENSRKSK--ESEIANNSTTSKRHQEDQSGHNK  1160

Query  216   ET  211
             E 
Sbjct  1161  EM  1162



>emb|CAN81922.1| hypothetical protein VITISV_010335 [Vitis vinifera]
Length=1798

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/893 (51%), Positives = 571/893 (64%), Gaps = 76/893 (9%)
 Frame = -1

Query  2700  DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQ  2521
             D TL    TIF+VDIDSF+EKPWR  G+D+SDFFNFG NEESWK YCKQLEQLRLE+TMQ
Sbjct  58    DVTL----TIFDVDIDSFEEKPWRHPGVDISDFFNFGFNEESWKQYCKQLEQLRLEATMQ  113

Query  2520  GKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
              KIRVYESGRTEQEYDPDLPPELAAA GI D+ +EN NLG+ +VG +DLA+ S R RPP+
Sbjct  114   TKIRVYESGRTEQEYDPDLPPELAAAVGIHDVSAENGNLGRADVGPSDLAKASARVRPPI  173

Query  2340  PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPS  2179
             P GR IQVE G G+RLPS+DTRPPRVRDSDAIIEI  QGS DDD+    G      N   
Sbjct  174   PTGRAIQVEGGCGERLPSVDTRPPRVRDSDAIIEITLQGSLDDDSPTGNGAPEPPDNDLP  233

Query  2178  REGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVIL  2005
             RE +R G+E+  D  QED  + D F   Y+G  RE   R A F NS   D    D ++  
Sbjct  234   REDLRVGNEVEDDAAQEDTEYFDSFSTTYSGRNRELVGRSAPFMNSLRDDMPGGDGILPF  293

Query  2004  PSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNR  1825
             P E P  Y P SRGQ  V+PG      H+  R +GRA  +S  +   +S +D +  +D++
Sbjct  294   PPEAPVQYRPGSRGQDPVHPGGNFGTPHEDRRIRGRAHGKSPHMTPIQSTRDNRF-LDSQ  352

Query  1824  REDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDE----------------------  1711
             +E+S+   D    ++SSPV     +E +VE  D +HDE                      
Sbjct  353   KEESVESMD-VKGMTSSPVRVAPPREPSVEKKDAVHDEIELADGMEREELTSDIIVTTDT  411

Query  1710  ------------------------------LVPAQRNSGMERGKISVDERTNCDKAKDDS  1621
                                           +V A   SGMER +++ +  T+ D  KD++
Sbjct  412   SKVGNSVQSGKKQKLSSRVEQPPPQELDGGIVLADGTSGMEREELTSNTMTSTDALKDEN  471

Query  1620  VIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-Q  1444
             +I   KK KLSS++E+P PQE DG ED KA RSSENSK RS SS+D  K HDG EEEV +
Sbjct  472   LIPFGKKQKLSSRVEQPPPQELDGDEDLKATRSSENSKARSESSRDLQKWHDGGEEEVIE  531

Query  1443  DKRFAHVDDT-RQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsH  1270
             D     + ++ R    +E   +RK RD  +E E+ RM+VKGRED+Y  + +DS   HHSH
Sbjct  532   DGSSVRMGNSKRHLDEDEQSFRRKDRDGRQEMERSRMVVKGREDTYPHRDWDSIPNHHSH  591

Query  1269  TKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSE  1090
              KT   DRRKERD SD  WQ RDDDLHGRR + ED+RK+E GDE+ S+HR+K+R+ +RS 
Sbjct  592   VKTDSFDRRKERDSSDGGWQRRDDDLHGRRIRPEDARKQERGDEMGSRHRSKVRESERSN  651

Query  1089  REGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSRE  910
             ++     RK LDNGS R   DKD  SRHRER+ D+LKSRY N+DD H KRRK++  L R+
Sbjct  652   KDELLHSRKLLDNGSWRGHQDKDMGSRHRERD-DNLKSRYGNLDDLHGKRRKDEEYLRRD  710

Query  909   HVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPL  730
             H ++EETLHS  +   RRKRERDD+ DQRKRDD    R RD+     DD H  R+K+E  
Sbjct  711   HAEKEETLHSHRESASRRKRERDDVLDQRKRDD--QPRIRDNL----DDHHSVRHKDEGW  764

Query  729   FQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK  550
              Q ERGER RER+EW+R +Q H+E LSKRER+EGRG +R GR AE+K+W   +RGKDEYK
Sbjct  765   MQRERGERQREREEWHRLRQPHEENLSKREREEGRGAVRSGRGAEDKAWVSHARGKDEYK  824

Query  549   GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTR  370
             GSD++Y  KD GRH E  KRR+R E+ S S HR RED Y RG Q S +ERR+R ER S R
Sbjct  825   GSDKDYQYKDTGRHSEQPKRRDRVEDESFSHHRGREDVYARGSQFSNEERRSRQERSSAR  884

Query  369   QDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
              DH+A  SD  +VH+KK KEN+ K+K  E +D ++L PS  N++D +   +ET
Sbjct  885   NDHSANASDHQRVHDKKHKENTRKNKESEGADISTLGPSKRNQEDHNSQRNET  937



>ref|XP_007011969.1| FIP1, putative isoform 2 [Theobroma cacao]
 gb|EOY29588.1| FIP1, putative isoform 2 [Theobroma cacao]
Length=1063

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/889 (50%), Positives = 588/889 (66%), Gaps = 48/889 (5%)
 Frame = -1

Query  2823  VAGRGRGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVD  2659
             ++GRGRGDWRPPGMK A  MQKGF    G   WG+N +GRG G  L+FTLPSHKTIF+VD
Sbjct  23    MSGRGRGDWRPPGMKAAPPMQKGFHTSFGMPGWGNNMAGRGFGGGLEFTLPSHKTIFDVD  82

Query  2658  IDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQE  2479
             IDSF+EKPW+  G+D+SDFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGRTEQ+
Sbjct  83    IDSFEEKPWKYPGVDLSDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESGRTEQD  142

Query  2478  YDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGD  2299
             YDPDLPPELAAA G Q++P++ ANL K++ GQ+D+ +G+ R RPP+P GR IQVE G G+
Sbjct  143   YDPDLPPELAAATG-QEVPADAANLAKSDGGQHDMTKGTARVRPPVPTGRAIQVEGGYGE  201

Query  2298  RLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQPSREGIRGG-DEIGDL  2140
             RLPSIDTRPPR+RDSDAIIEIVCQ + DDD+++      +  N   R  +RG      D+
Sbjct  202   RLPSIDTRPPRIRDSDAIIEIVCQDTLDDDSSIGNVVVDQTENDLPRGDLRGDLASEADV  261

Query  2139  QQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQ  1960
              +ED  + DGF  AYN  KRE   RR   NS   ++   D ++  P+E    Y P SRGQ
Sbjct  262   AREDAEYFDGFPDAYNSQKREVVGRRT-LNSVQSNEP-EDGILPFPAEASLPYGPGSRGQ  319

Query  1959  TSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrspls  1780
             + +Y     +   D   ++GRA  RS  +   +  ++K  D   ++E+S+   D +SP +
Sbjct  320   SPMYSSGNFSSPCDERHQQGRAHERSPRMTPIQGRREKFSDA--QKEESVESMDAKSPDA  377

Query  1779  sspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKK  1600
                      +E +VE  D++ DEL PA  N   E+     DE+ N     ++S  +  K 
Sbjct  378   ---------REISVERKDDVDDELDPADGNPVTEK-----DEQINETHEVENSP-NPMKN  422

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHV  1423
              K SS  E+   QE D  EDS+AARSSENSK RSGSS+DY K  DG EEEV Q  R + +
Sbjct  423   EKRSSHGEQRMLQELDDDEDSRAARSSENSKARSGSSRDYQKWRDGAEEEVVQGGRLSRM  482

Query  1422  DDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIAD  1249
                ++   E D+  +RK R+ + E E++RM+ K  EDSY  + +D+S +H+ HTK    D
Sbjct  483   GIVKKHLDEHDQNFRRKDREGRHEIERNRMVGKPGEDSYPLRDFDASLSHNLHTKAEGFD  542

Query  1248  RRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLL  1069
             RR+ERD  D  WQ R+DDL+ R+S+ ED RKRE  DE+ S++R KIR+ +RS+++     
Sbjct  543   RRRERDNPDGTWQRREDDLYNRKSRTEDLRKRERDDEMGSRNRAKIRESERSDKDDYPHS  602

Query  1068  RKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREET  889
             RKQLDNGS +  HDKD  +RHRER+ D+LKSRY+  DD  SKRRK++  L R+H D+EE 
Sbjct  603   RKQLDNGSFKVHHDKDVSARHRERD-DNLKSRYEAADDYQSKRRKDEEYLRRDHADKEEI  661

Query  888   LHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ-RLRE--DDQHYARYKEEPLFQSE  718
             LH   + +            +R+RD+I+DQRKR+++ R+R+  D+ H  R+K+E     E
Sbjct  662   LHGHRESSSS--------RRKRERDEITDQRKRNERPRIRDNFDEHHSVRHKDEVWLHRE  713

Query  717   RGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDR  538
             R ER RERDEW+R KQSHDE L KRER+E RG +R GR +E+K+W   +R KDEYKGS++
Sbjct  714   RVERQRERDEWHRLKQSHDESLPKREREEVRGIVRSGRGSEDKAWVAHTRAKDEYKGSEK  773

Query  537   EYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHA  358
             EY  K+  RH E +KRRER+++ S SRHR RED Y RGHQ   +ERR+R ER STR DHA
Sbjct  774   EYQLKETVRHSEQVKRRERNDDESFSRHRGREDSYARGHQFGNEERRSRQERSSTRNDHA  833

Query  357   AYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASET  211
             A  SDS +  EKK KEN+ KD+  E  D  +L  +  N++D SG  +ET
Sbjct  834   ANASDSQR-GEKKHKENTRKDRESEGGDPITLGSAKRNQEDLSGQNNET  881



>ref|XP_011033462.1| PREDICTED: FIP1[V]-like protein isoform X1 [Populus euphratica]
Length=1336

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/1025 (50%), Positives = 659/1025 (64%), Gaps = 55/1025 (5%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLNDN H  G MG+DR  GD DDDD+DGDPLVIVA+ D P+    +EEQ+WG     
Sbjct  152   LQIVLNDNTHPGGTMGIDREIGDDDDDDEDGDPLVIVADGDRPNQ--AMEEQDWGGGEDG  209

Query  3036  SADGE------RKEDAAKVNVGPGYA-PKIGYSNHGYHH-PYHSQFKYVRpgaapipgap  2881
              A         RKE    V  G     PKIGYSNH YHH P+HSQFKYVRPGAAP+P A 
Sbjct  210   VAAAGGGAEGERKEGGEAVGKGNAVVGPKIGYSNHVYHHHPFHSQFKYVRPGAAPMPAAT  269

Query  2880  pvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGY--NAWGSNPSGRG  2710
              VGPGGTPGQV PP+N   +AGRGRGDWRP G+KGA   QK F PG+  +AWG+   G G
Sbjct  270   SVGPGGTPGQVRPPMNMGAIAGRGRGDWRPVGIKGA--PQKNFHPGFGGSAWGAG-RGFG  326

Query  2709  IGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLES  2530
              G++FTLPSHKTIF+VDID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+
Sbjct  327   SGMEFTLPSHKTIFDVDIDGFEEKPWKYPGVDISDYFNFGLNEESWKDYCKQLEQYRLET  386

Query  2529  TMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
             TMQ KIRVYESGR EQEYDPDLPPELAAA G     ++N+N GK+++GQ+DL +GS R R
Sbjct  387   TMQSKIRVYESGRAEQEYDPDLPPELAAATGFH-ASADNSNAGKSDIGQSDLTKGSARMR  445

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD---NNLEQG--NQ  2185
             P +P GR IQVE+G G+R+PSI+ R PR+RDSDAIIEIVCQGS DD    + ++ G  N 
Sbjct  446   PQIPTGRAIQVETGYGERIPSIEGRAPRLRDSDAIIEIVCQGSLDDSPPRDGVQDGAHND  505

Query  2184  PSREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVI  2008
             P ++  +  D    D++Q +  +  GF  AYNG K   G RR  + +   + S  D +  
Sbjct  506   PQKDDFKVSDASEDDMEQTENEYAGGFPQAYNGRK---GGRRTPYLNSARNMSGGDVLPF  562

Query  2007  LPSEEPDSYH-PDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVD  1831
              P + P  YH   SRG    YPGR     H+  + +GR+   S  +  S++ +DK+   D
Sbjct  563   HP-KAPAPYHQTGSRGHHPSYPGRDSGTPHEERQMQGRSCDSSPHLTPSQNSQDKKFVDD  621

Query  1830  NRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDER  1651
                E + S+ D+ SP  +SP++ R  +E + E  D++     P Q       G+  + E 
Sbjct  622   VEEESTESMDDKLSPRVTSPITVRDARELSSEEKDDVE----PLQTEGSSRLGRDEMTEN  677

Query  1650  TNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKL  1471
                   KD +V  + +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RSGSSKDY K 
Sbjct  678   EEITNDKDGNVHHSTRKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSGSSKDYQKW  737

Query  1470  HDGLEEEV-QDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKG  1300
              DG+EEEV QD+R       RQ   E E   QRK RD  +E E++  +++GREDSY  + 
Sbjct  738   QDGVEEEVVQDRRSTRSGSIRQHLDENEQNFQRKDRDVRREMERNCGVIRGREDSYPHRD  797

Query  1299  YDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHR  1120
              D S + H H K    DRRKER+  D++WQ RD+D H R+ + ED RKREHGDE+ S+HR
Sbjct  798   LDPSLSRHLHMKHESYDRRKERENPDISWQQRDEDPHSRKHRTED-RKREHGDEMGSRHR  856

Query  1119  NKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKR  940
              KIR+ +RS+++     RKQL NGS R  HDKD  SRHRER+ D+LKSR++ +DD HSKR
Sbjct  857   GKIRETERSDKDEHLHSRKQL-NGSYRIHHDKDGSSRHRERD-DNLKSRFEMVDDYHSKR  914

Query  939   RKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQ  760
             RK++  + RE+ D+EE LH   + T  R+ ERDD   QR RD++             D  
Sbjct  915   RKDEEYVKREYADKEEILHGHRENTSSRRHERDD--QQRIRDNL-------------DGY  959

Query  759   HYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWA  580
             H  ++K+E   Q ERGER RER+E YR KQS +E L KRER+EGR   R GR  ++K+WA
Sbjct  960   HSVKHKDEVWIQRERGERQREREELYRVKQSSEENLPKREREEGRASARSGRLVDDKAWA  1019

Query  579   GLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDER  400
             G +  KDEYK SD+EY  KD  R  EH KRR+R ++ S S HR  +D Y RG+Q S +ER
Sbjct  1020  GHAWAKDEYKVSDKEYQLKDTVRISEHQKRRDRMKDESLSHHRGHDDVYARGNQFSNEER  1079

Query  399   RARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
             R+R ER S+R D     S S +VHEKK KEN  K+K  +  D  +  PS  N+++ +G+ 
Sbjct  1080  RSRQERSSSRVDRTVDTSVSQRVHEKKHKENPRKNKESDGGDHGTWGPSKRNQENLNGHG  1139

Query  219   SETVC  205
              ETV 
Sbjct  1140  EETVL  1144



>ref|XP_010275740.1| PREDICTED: filaggrin-like [Nelumbo nucifera]
Length=1492

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/1319 (43%), Positives = 778/1319 (59%), Gaps = 118/1319 (9%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP ++S       P +Q                +  ++S    P 
Sbjct  1     MEDDDEFGDLYTDVLRPISSSSG-----PQSQLFS-------------SGASASAKHPPD  42

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSS----VNVQEKTLATQPEDKQPRPNSSDFNL  3598
             ++ + D++D  +++GA     DP+ +  S       ++ KT A         PNS   + 
Sbjct  43    LNLQSDDED--VLYGA----PDPSFTIPSQRPHLEPIKTKTDAIPDYRTDAAPNSKVIDR  96

Query  3597  SLNPqsgqsggsigvgvGANESDLGA------RVFGKSDGKSRDWAFGDSSFTDEANIdv  3436
              +  +         V   ++   L +      RV G  DG+ +    G++   + A    
Sbjct  97    VMKQEVKVEEEEEVVARVSHVRVLDSIKVEETRVPGTGDGELQ--QAGEARVLETAEPLE  154

Query  3435  vveegddkdddlvqkdENIDK--PMGRSENCESSVVEAG----GSEHMIPGVSI-PGVSG  3277
                 G+ + +   +   N++K     R E  E   ++ G     SE +IPG+S  P + G
Sbjct  155   KPGIGEVQSEKDAKDKINLEKDNIFAREEEGEGLDIDVGIGDLDSEPIIPGLSSGPFIPG  214

Query  3276  VPETCG-----------DRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddd  3130
             V E+ G           D     +      +DDL+IVLNDN              DD+D+
Sbjct  215   VLESQGNEEDMKASRRDDSGGAGDDWDSDSEDDLQIVLNDNVGPLGVDRNEAMGSDDEDE  274

Query  3129  dgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAP--KIGY  2962
             DG+ LVIVA+ D   HQP VEEQEWGD+   + DGERKE  +A+KVN G   A   +IGY
Sbjct  275   DGEDLVIVADGDQ-HHQP-VEEQEWGDDTAQAPDGERKEIGEASKVNGGMVNAAGARIGY  332

Query  2961  SNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGM  2782
             S HGYH P+HSQFKYVRPGAA IPG   VGPGG PGQV PP+N   +AGRGRGDWRP G+
Sbjct  333   SGHGYH-PHHSQFKYVRPGAAAIPGGAIVGPGGAPGQVRPPMNIGPIAGRGRGDWRPVGV  391

Query  2781  KGALTMQKGFP---GYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGI  2617
             K A   QK F    G   W S  SGRG G  L+FTLPSHKT+F+VDID+F EKPW+  G+
Sbjct  392   KTAPGAQKSFQSGFGVPIWASGSSGRGFGSGLEFTLPSHKTVFDVDIDNFSEKPWKHPGV  451

Query  2616  DMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAG  2437
             D+SDFFNFGL+EESWKDYCKQLEQ+RLE+TMQ KIRVYESGR+EQ+YDPDLPPELAAAAG
Sbjct  452   DVSDFFNFGLDEESWKDYCKQLEQMRLEATMQSKIRVYESGRSEQDYDPDLPPELAAAAG  511

Query  2436  IQDIPSENANLGKTEVGQNDL-ARGSI-RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRV  2263
             I D+ +ENA++GKT+ GQ DL  +G + R RPP+P GR IQVE G G+RLPS+DTRPPR+
Sbjct  512   IHDVSAENAHIGKTDGGQGDLMGQGRVARPRPPIPTGRAIQVEGGYGERLPSVDTRPPRI  571

Query  2262  RDSDAIIEIVCQGSADDDNNLEQG------NQPSREGIRGGDE----IGDLQQEDIHHVD  2113
             RDSDAIIEIV Q SADDD+  + G      N    EG++G  E    IG  Q E  ++ D
Sbjct  572   RDSDAIIEIVLQDSADDDSVTDTGTLKQQDNDSQGEGLKGHREAEEDIG--QTETEYYDD  629

Query  2112  GFQHAYNGWKREFGSRRAEFNSGPYDKSR-SDRVVILPSEEPDSYHPDSRGQTSVYPGRK  1936
              F  +YN  KRE  +RRA +    ++     D ++  P++ P  YHP S+G+T VYPG  
Sbjct  630   RFPESYNDRKRETVARRASYMGSVHNTMHEGDGILPYPADAPVQYHPGSKGRTPVYPGSV  689

Query  1935  HAVAHDSTREKGRARCRSADIGASESP-KDKQIDVDNRREDSL------SVGDrrsplss  1777
              +  H+    +G AR R   +   +      Q D  NR  DS       S+  ++SP SS
Sbjct  690   FSTPHEERWPQGTARDRYPHLTTKDGKVTPSQSDQLNRSHDSQKEKSGGSIDGKQSPDSS  749

Query  1776  spvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKH  1597
             SP++  +V+E +VE  DN +D+LV   +N+ +E  +++ D     D   D +V+ + KK 
Sbjct  750   SPITIEAVREPSVEQKDNANDDLVLPDKNNEVEGDEMASDTIVPSDNLDDGTVLHSVKKQ  809

Query  1596  KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKRFAHVDD  1417
             KLSS +E+P+ QE   G+D +AARSS+NSK RSGSS++Y K H+G EE VQD +  H  D
Sbjct  810   KLSSLVEQPAVQEHGEGDDLRAARSSDNSKARSGSSREYQKRHEGDEEVVQDGQPRHTRD  869

Query  1416  TRQTGGEEDRLQRK----GRDEK-ETEKHRMIVKGREDSYMRKGY---DsssahhsHTKT  1261
              ++   E D   R+    G+D + + +++  +VKGREDSY   G+   D +S H+SH K+
Sbjct  870   MKRHYNEHDISFRRRNDHGQDVRSDVDRNHTVVKGREDSYRSYGHRERDLNSPHYSHMKS  929

Query  1260  SIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREG  1081
                +R KERD S  A Q RD++ HGRR K ED+RKRE  +E+ S+ R+K+R+ +R+E++ 
Sbjct  930   EGFERAKERDSSLGALQRRDEETHGRRLKEEDTRKRERVEEVVSRQRSKVRESERNEKDE  989

Query  1080  RHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVD  901
                 RK++DNG  R  HDK+   RHRER+ D+L S ++N+D  H+KRRK++    RE  D
Sbjct  990   HLHSRKRVDNGDWRDRHDKEVGPRHRERD-DNLMSHHENMDSSHTKRRKDEEYQRREQAD  1048

Query  900   REETLHS---RGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPL  730
             +EE +HS   R D T RRKRERDD+ +QR+RDD +  R RD    + DD H  R++++  
Sbjct  1049  KEELVHSYRTRED-TSRRKRERDDVLEQRRRDDQA--RLRD----KPDDYHSTRHRDDSW  1101

Query  729   FQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDE--  556
              Q ER +R        R KQSH++ +SKRER+EGR  +R GR  ++K WAG  R KD+  
Sbjct  1102  RQRERDDR-------QRLKQSHEDTMSKREREEGRTTVRSGRGVDDKQWAGNVRAKDDSS  1154

Query  555   YKG--SDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNER  382
              KG  SD+EY  KD  +H E  KRRER E  S S+HR RED Y R +Q   ++R +R ER
Sbjct  1155  SKGLSSDKEYQFKDKRQHSEQPKRRERLEEESLSQHRGREDSYARDNQLIGEDRNSRRER  1214

Query  381   VSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
              S+  D     SD   +H+ + KEN+ K K    SD+N+L P    ++D   + SE + 
Sbjct  1215  SSSHNDRPTRGSDGQWMHKDRHKENARKSKESAGSDQNTLGPVKRKQEDYDSHRSEKIS  1273



>ref|XP_004513530.1| PREDICTED: trichohyalin-like [Cicer arietinum]
Length=1335

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/1057 (46%), Positives = 633/1057 (60%), Gaps = 80/1057 (8%)
 Frame = -1

Query  3333  EAGGSEHMIPGVSIPGVSGVPETC-------GDRAVdeewdsdsdddDLRIVLNDNNHGP  3175
             + GGSE +IPG+S  G  GV E         G      +      DDDL+IVLND+NH  
Sbjct  123   DGGGSEPIIPGLS--GGEGVDEAFRRADEGGGGFDGGNDDWDSDSDDDLQIVLNDDNHM-  179

Query  3174  mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKEDA--AK  3001
             +       D DD++D+   LVIVA   +P+    +EEQEWG+     ADGERK+ A   K
Sbjct  180   VMEKGGVVDDDDNEDEDGGLVIVAG--EPNQG--LEEQEWGETANVLADGERKDAAEPGK  235

Query  3000  VNVGPG---YAPKIGYSNHGY-HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVN  2833
                GPG     PKIGY NH + +HP+HSQFKY+RPGA           G           
Sbjct  236   AVTGPGGVPVVPKIGYGNHVHGYHPFHSQFKYIRPGATLPGATVAAQGGPPGQIRP----  291

Query  2832  TSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVD  2659
              + + GRGRGDWRPPG+KGA+ MQ+  PG  +WG+N +GRG G  L+FTLPSHKTIF+VD
Sbjct  292   LANMIGRGRGDWRPPGIKGAIGMQRP-PGLPSWGNNATGRGFGGGLEFTLPSHKTIFDVD  350

Query  2658  IDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQE  2479
             I+SF+EKPW+   +D+SDFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGR E E
Sbjct  351   IESFEEKPWKYPSVDVSDFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRAEHE  410

Query  2478  YDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGD  2299
             YDPDLPPELAAA G+ D P ENAN  K+ VGQ+D+ +GS   RPP+P GR IQVE G G+
Sbjct  411   YDPDLPPELAAATGLHDTPVENANSLKSNVGQSDVMKGSGHGRPPIPTGRAIQVEGGYGE  470

Query  2298  RLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQ-------PSREGIR----GGDE  2152
             RLPSIDTRPPR+RDSDAIIEIV Q + DDD+++  G Q       P  E  R     GDE
Sbjct  471   RLPSIDTRPPRMRDSDAIIEIVLQDTEDDDSSVGVGVQDQPEDGEPQSENFREDHVAGDE  530

Query  2151  IGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHP  1975
             I  L+ E   + DG    YN  K+E G RR  F NS   +    D     P +EP  Y  
Sbjct  531   IPSLEPE---YSDGILQDYNRQKKELGGRRMPFLNSVSSNVPNEDESSFFPQDEPIEYS-  586

Query  1974  DSRGQTS-VYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGD  1798
              SRGQ    Y G   +   +   +KG    RS       SP  K    DNR+EDS+   +
Sbjct  587   GSRGQNPRSYGGNFSSSPEERKMQKG---VRSQ---FPISPIRKLNTDDNRKEDSVESME  640

Query  1797  rrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSV  1618
              R          + V+ES++EN D   ++   A  +  + + +I ++     D  KD   
Sbjct  641   GRDSTHLPSPVIKDVRESSLENKDAELEDTGTADGSPRLGKEEIDLNTVDKVDALKD---  697

Query  1617  IDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQD  1441
                 K+  L+SQ+E+P   E D  ED KAARSS+NSK RS SS+D  K  +GLEEE VQD
Sbjct  698   -GIEKQQNLTSQVEQPLHDEVDDWEDLKAARSSDNSKARSASSRDNQKRQEGLEEEVVQD  756

Query  1440  KRFAHVDDTRQTGGEEDR-LQRKGRDEKE-TEKHRMIVKGREDSYMRKGYDsssahhsHT  1267
              R  H+   RQ   E D+   RK  D K+  E++R++++GRE SY  K     S+H  + 
Sbjct  757   PRSTHLGSIRQHPDENDQGFYRKEHDGKQDPERNRIVLRGREGSYPYKDRHRGSSHQLNA  816

Query  1266  KTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSER  1087
                  DR+K+RD SD+ W  RDDD++ R+ +  + RKR+         R K+R+I+R ++
Sbjct  817   NIDGFDRQKDRDSSDMDWARRDDDVYSRKVRTNEPRKRD---------RAKVREIERIDK  867

Query  1086  EGRHLLRKQLDNGSLRPDHDKDAVSRH-RERERDD-LKSRYDNIDDRHSKRRKEDTKLSR  913
             E     RKQLDNGS R  +DKD  +R  R R RD+ ++ RY+ ++D H KRRK++  L R
Sbjct  868   EDSLHSRKQLDNGSYRIPYDKDVGARDPRHRGRDEGMRVRYETVEDYHIKRRKDEEYLRR  927

Query  912   EHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEP  733
             EH+D EE  H+      RR+RERD++ D RKRDD+  QR RD      DDQ+  R K++ 
Sbjct  928   EHIDHEEISHAS-----RRRRERDEVLDPRKRDDL--QRSRD----YPDDQYTTRQKDDA  976

Query  732   LFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEY  553
                 ERG+R R+R+EW+R KQSHD  + KRER+EGR   R  R AEEK+W      KDE+
Sbjct  977   WLLRERGDRQRDREEWHRMKQSHDGHIPKREREEGRSSGRSVRGAEEKAWVSHVSAKDEH  1036

Query  552   KGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVST  373
             K S++EY S++A RH + LKRR+R + GSP  H+ R+D Y RG+Q   DERR+R ER S+
Sbjct  1037  KLSEKEYQSREAVRHNDQLKRRDRIQEGSP-HHKGRDDAYARGNQYMADERRSRQERSSS  1095

Query  372   RQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSL  262
             R D  A  S+S ++ E+K KE STK K  E  D NSL
Sbjct  1096  RSDRVANASNSQRLQERKHKEGSTKSKEREIGDLNSL  1132



>gb|KHG03808.1| Pre-mRNA 3'-end-processing factor FIP1 [Gossypium arboreum]
Length=1265

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/1032 (47%), Positives = 637/1032 (62%), Gaps = 74/1032 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmgg--dgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+I+LNDNNHG M M+R G   + DDDD+D DPLVIVA++D        EE EWG+E   
Sbjct  136   LQILLNDNNHGLMDMERRGMIGEDDDDDEDEDPLVIVADAD---ANQGTEEHEWGEEGCQ  192

Query  3036  SADGERKE--DAAKVNVGPG-----YAPKIGYSNHGYHHPYHSQFKYVRpgaapipgapp  2878
             +ADGE+KE  +AAKV    G      APKIGYS+HGYH P+HSQFKYVRPGAA +PG   
Sbjct  193   AADGEKKEGGEAAKVGTACGGGGSVVAPKIGYSDHGYH-PFHSQFKYVRPGAASMPGTIA  251

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWG--SNPSGRGI  2707
              GPG  P QV P    S+ AGRGRGDWRP GMK    MQK F P +   G  +N +GRG 
Sbjct  252   SGPGSAPAQVRPI--MSVTAGRGRGDWRPHGMKTGTPMQKCFHPSFGMPGGVNNMAGRG-  308

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GL+FTLPSHKTIF VDIDSF++KPW+  G+D+SDFFNFGLNEE WKDYCKQLEQ RLE+T
Sbjct  309   GLEFTLPSHKTIFNVDIDSFEDKPWKHSGVDLSDFFNFGLNEEGWKDYCKQLEQHRLETT  368

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQ KI VYESGRTEQ YDPDLPPELAAA G Q++ +  ANLGK + GQND+ +G+ R RP
Sbjct  369   MQSKIHVYESGRTEQGYDPDLPPELAAATG-QEVRAGAANLGKLDGGQNDVTKGTARIRP  427

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQ  2185
             PLP GR IQVE G G+RLPSIDTRPPR+RDSDAIIEI+CQ + D+D++ + G      N+
Sbjct  428   PLPTGRAIQVEGGCGERLPSIDTRPPRLRDSDAIIEIICQDTLDNDSSTQNGVEDQTENE  487

Query  2184  PSREGIRGGDEIGDL------QQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRS  2023
              SRE +     IGDL        ED    DGF  +YN  KR+   +RA  NS   +    
Sbjct  488   LSREYL-----IGDLVSEAEVAHEDNECFDGFPDSYNSRKRKLIGKRA-INSAQSNVPED  541

Query  2022  DRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQ  1843
             D+++  P+E      P SRGQ+ ++P     V  +  + +GRA           SP + +
Sbjct  542   DKILPFPAEALRPDGPGSRGQSPMHPSGNFEVPPEERQRRGRA--------GEISPHETR  593

Query  1842  IDVDNRREDSLSVGDrrsplssspvsn----rsVQESAVENNDNLHDELVPAQRNSGMER  1675
             I     ++D+ S G     + S    +    R  +E +VE  D + DEL P   +     
Sbjct  594   I---QGKQDNFSDGHEEESVESMDGKSPFLVRDAREISVERMDGVDDELEPTDGS-----  645

Query  1674  GKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSG  1495
                 V++       KD S ++     K   QLE+      D GEDS+AARSSE+SKTRSG
Sbjct  646   ---PVEKELLNGTYKDGSSLNPLNNGKNRFQLEQRKLHNADDGEDSRAARSSEHSKTRSG  702

Query  1494  SSKDYHKLHDGLEEE-VQDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGR  1324
             SS+DY K  +  EEE VQ    + V + R+   E D   QRK  D + E E++RM     
Sbjct  703   SSRDYQKRPESAEEEVVQGGYSSRVGNVRKNLDEHDHSSQRKYCDGRLEIERNRMTGTLG  762

Query  1323  EDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHG  1144
             EDSY  + + ++ +H    KT   DRR+E D +D  WQ  +DDL+ R+++ ED  KR H 
Sbjct  763   EDSYPLRDFGANLSHDFPIKTEGFDRRRECDNTDGTWQWGEDDLYSRKNRSEDF-KRGHD  821

Query  1143  DEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDN  964
             DE+ S++R K+R  +R+ER+G    RKQ  NGS +   DKD  +R RER+ D+LKSRY  
Sbjct  822   DEMGSRNRTKVRGNERTERDGYPPSRKQFVNGSYKVHRDKDVSTRLRERD-DNLKSRYHA  880

Query  963   IDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLR-RKRERDDISDQRKRDDISDQRKRD  787
              DD H+KRRK++  L R + D+EE LH + + + R +K+ERD+I DQRKRD+   QR RD
Sbjct  881   ADDYHNKRRKDEDYLRRVNADKEEILHGQRESSSRCKKQERDEILDQRKRDE--QQRIRD  938

Query  786   DQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVG  607
             +     D+ H  R+K E     ER E+  ERDEW++ KQSHD+ LS +E+ E RG +R G
Sbjct  939   NF----DEHHSVRHKGEVWLHRERVEKRMERDEWHKLKQSHDKSLSTQEK-EVRGTVRSG  993

Query  606   RAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGR  427
                E+K+W G +R KDE++ S++EY  K+A R+ E +KRR+ +++   S HR  ED Y +
Sbjct  994   CGLEDKAWVGHTREKDEHRVSEKEYQLKEAVRNSEQVKRRDPNDDEGYSHHRGHEDPYSQ  1053

Query  426   GHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNL  247
             GHQ S DE ++R ER STR DHA   SDS + HEKKRKEN  K +        +   +  
Sbjct  1054  GHQFSNDEIKSRQERSSTRSDHAVNGSDSRRGHEKKRKENVRKTRESAGGGPITFGSAKR  1113

Query  246   NEDDRSGNASET  211
             + +D SG  +ET
Sbjct  1114  SNEDLSGLNNET  1125



>ref|XP_002309330.1| hypothetical protein POPTR_0006s20150g [Populus trichocarpa]
 gb|EEE92853.1| hypothetical protein POPTR_0006s20150g [Populus trichocarpa]
Length=1336

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/1028 (49%), Positives = 663/1028 (64%), Gaps = 63/1028 (6%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLNDN H  G MG+DR  GD DDDD+DGDPLVIVA+ D P+    +EEQ+WG     
Sbjct  154   LQIVLNDNTHPGGTMGIDREIGDDDDDDEDGDPLVIVADGDGPNQ--AIEEQDWGGGEDG  211

Query  3036  SADGE------RKEDAAKVNVGPGYA-PKIGYSNHGYHHPYHSQFKYVRpgaapipgapp  2878
              A         RKE    V  G     PKIG +         +  KYVRPGAAP+P A  
Sbjct  212   VAAAGGGAEGERKEGGEAVGKGNAVVGPKIGGNA-----VVGTAEKYVRPGAAPMPAATS  266

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGY--NAWGSNPSGRGI  2707
             VGPGGTPGQV PP+N   +AGRGRGDWRP G+KGA   QK F PG+  +AWG+   G G 
Sbjct  267   VGPGGTPGQVRPPMNMGAMAGRGRGDWRPVGIKGA--PQKNFHPGFGGSAWGAG-RGFGS  323

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             G++FTLPSHKTIF+ DID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+T
Sbjct  324   GMEFTLPSHKTIFDFDIDGFEEKPWKYPGVDISDYFNFGLNEESWKDYCKQLEQYRLETT  383

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             MQ KIRVYESGR EQEYDPDLPPELAAA G     ++N+N GK+++GQ+DLA+GS R RP
Sbjct  384   MQSKIRVYESGRAEQEYDPDLPPELAAATGFHAT-ADNSNAGKSDIGQSDLAKGSARMRP  442

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD---NNLEQG--NQP  2182
              +P GR IQVE+G G+R+PSI+ R PR+RDSDAIIEIVCQGS +D    + ++ G  N P
Sbjct  443   QIPTGRAIQVETGYGERIPSIEGRAPRLRDSDAIIEIVCQGSLEDSPPRDGVQDGAHNDP  502

Query  2181  SREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVIL  2005
              ++  +  D    D++Q +  +  GF  AYNG K   G RR  + +  ++ S  D + I 
Sbjct  503   QKDDFKVSDASEDDMEQTENEYAGGFPQAYNGRK---GGRRTPYMNSAHNMSEGDVLPIH  559

Query  2004  PSEEPDSYH-PDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN  1828
             P + P  YH   SRG    YPGR+    H+  R +GR+   S  +  S++ +DK+   D 
Sbjct  560   P-KAPAPYHQTGSRGHPPSYPGRESGTPHEERRMQGRSCDSSPHLTPSQNSRDKKFLDDV  618

Query  1827  RREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERT  1648
               E + S+ D+ SP  SSP++ R  +E + E  D++  E + A+ +S + R +++ +E T
Sbjct  619   EEESTESMDDKLSPRISSPITVRDARELSSEEKDDV--EPLQAEESSRLGRDEMTENEET  676

Query  1647  NCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLH  1468
               D  KD +V  + +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RSGSSKDY K  
Sbjct  677   AND--KDGNVHHSTRKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSGSSKDYQKWQ  734

Query  1467  DGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGY  1297
             DG+EEE VQD+R       R+   E E   QRK RD  +E E++R +++GREDSY  +  
Sbjct  735   DGVEEEVVQDRRSTRSGSIRRHLDENEQNFQRKDRDVRREMERNRGVIRGREDSYPHRDL  794

Query  1296  DsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRN  1117
             D S  HH H K    D+RKER+  D++WQ RD+D H R+ + ED RKREHGDE+ S+HR 
Sbjct  795   DPSLPHHLHMKHESYDKRKERENPDISWQQRDEDPHSRKHRTED-RKREHGDEMGSRHRG  853

Query  1116  KIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRR  937
             KIR+ +RS+++     RKQL+NGS R  HDKD  SRHRER+ D+LKSR++ +DD HSKRR
Sbjct  854   KIRETERSDKDEHLHSRKQLENGSYRIHHDKDGSSRHRERD-DNLKSRFEMVDDYHSKRR  912

Query  936   KEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQH  757
             K++  + RE+ D+EE LH   + T RR+ ERDD   QR RD++             D  H
Sbjct  913   KDEEYVKREYADKEEILHGHRENTSRRRHERDD--QQRIRDNL-------------DGYH  957

Query  756   YARYKEEPLF----QSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEK  589
               ++K+E          + +R RER+E YR KQS +E L KRER+EGR   R GR  ++K
Sbjct  958   SVKHKDEVWLQRERGERQRQREREREELYRVKQSSEENLPKREREEGRASARSGRVVDDK  1017

Query  588   SWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPST  409
             +WAG + GKDEYK SD+EY  KD  R  EH KRR+R E+ S S HR ++D Y RG+Q S 
Sbjct  1018  AWAGHAWGKDEYKVSDKEYQLKDTVRISEHQKRRDRMEDESLSHHRGQDDVYARGNQFSN  1077

Query  408   DERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRS  229
             +ERR+R ER S+R D     S S +VHEKK KEN  K+K  +  D  +  PS  N+D+ +
Sbjct  1078  EERRSRQERSSSRVDRTVDTSVSQRVHEKKHKENPRKNKESDG-DHGTWGPSKRNQDNLN  1136

Query  228   GNASETVC  205
             G++ ETV 
Sbjct  1137  GHSDETVL  1144



>gb|KDO59422.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1258

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/1071 (46%), Positives = 633/1071 (59%), Gaps = 146/1071 (14%)
 Frame = -1

Query  3309  IPGVSIPGVSGVPETCGDR---------AVdeewdsdsdddDLRIVLNDNNHGPmgmdrm  3157
             +PG+ IPG+S       +             E+      +DDL+IVLN++NH PM +D  
Sbjct  111   VPGIEIPGISQNSVENSEHQNRNEGEAGEEAEDDWESDSEDDLQIVLNEDNHRPMLIDGG  170

Query  3156  ggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNSADGERKEDAAKVNVGPG-  2983
             GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ A  +  E  A+   G G 
Sbjct  171   GGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDDAPAQMGEGGAEKKEGTGE  226

Query  2982  -------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvh  2845
                           A KIGYSNH  YH+PYHSQFKYVRPGAAPIPG+      G PGQV 
Sbjct  227   RANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAAPIPGSATAVAAGGPGQVR  286

Query  2844  ppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIF  2668
             P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  +  G GL+FTLPSHKTIF
Sbjct  287   PLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGVNMAGRGLEFTLPSHKTIF  346

Query  2667  EVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRT  2488
             EVDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGR 
Sbjct  347   EVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQHRLETTMQSKIRVYESGRD  406

Query  2487  EQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
             +                                                P GR IQVE G
Sbjct  407   Q------------------------------------------------PTGRAIQVEGG  418

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---NQPSREGIRG-----GDE  2152
             SG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   N   RE  RG      DE
Sbjct  419   SGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRDNDLPREDRRGENDGAEDE  478

Query  2151  IGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-SRSDRVVILPSEEPDSYHP  1975
             +G +   D  + DGF+ AY+   RE     A F +  +D     + ++  P E P  Y P
Sbjct  479   MGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIPEGNGLLPFPPEAPLRYRP  535

Query  1974  DSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDr  1795
              SRG T  YPG     +H+  R  GR   RS  +  S+SP+ ++   DN+ E+S+   + 
Sbjct  536   GSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQIRKFH-DNQDEESVESMEG  594

Query  1794  rsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVI  1615
             +    SSPV  R  +E +VE+ D +HDELV    +S +E  K   +  T  D  KD   +
Sbjct  595   KHSPLSSPVIVRDARELSVEHKDAVHDELVLGDGSSAVE--KEETNAVTTSDSRKDGKAL  652

Query  1614  DTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKR  1435
              + K  K++SQ+E+P  QE D  EDS+AARSSENSK RSGSS+D  K  +G EE +QD+R
Sbjct  653   YSPKTKKINSQVEQPELQEFDEEEDSRAARSSENSKARSGSSRDNKKWREGDEEVMQDRR  712

Query  1434  FAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKT  1261
                +   ++   E E   +RK R+  +E E++RM+  GRE S+ R+ +D S  H    K 
Sbjct  713   STRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGSHPRRDFDPSLTHDMQMKP  772

Query  1260  SIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRK--REHGDEIESKHRNKIRDIDRSER  1087
                DRRKER+ SD  WQ R+D+ + R++++ED+RK  REH DEI ++HR K R+ +R +R
Sbjct  773   EGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHRGKARESERIDR  832

Query  1086  EGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREH  907
             +     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKRRK+D  + R+H
Sbjct  833   DEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKRRKDDEYVRRDH  891

Query  906   VDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--DDQHYARYKEEP  733
              +++E LH   D T RRKRERDDI DQR+R+        D QR+RE  DD H  R+K+E 
Sbjct  892   AEKDEILHGHRDLTSRRKRERDDILDQRRRE--------DQQRIRENFDDHHPVRHKDEN  943

Query  732   LFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEY  553
               Q ERGER RER++W+R K  H+EILSKRER+EGRG +R GR++E+++W G +R KDEY
Sbjct  944   WSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSGRSSEDRAWVGHARVKDEY  1002

Query  552   KGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVST  373
             KGSD+EY  KD                                      +R++R ER  T
Sbjct  1003  KGSDKEYQVKDT-------------------------------------DRKSRQERSGT  1025

Query  372   RQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNA  220
             R D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG+ 
Sbjct  1026  RNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSGHG  1076



>ref|XP_006587148.1| PREDICTED: uncharacterized protein LOC100803769 isoform X3 [Glycine 
max]
Length=1132

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/1072 (46%), Positives = 652/1072 (61%), Gaps = 108/1072 (10%)
 Frame = -1

Query  3318  EHMIPGVSIPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  3139
             E +IPG+S    + VP        + +      +DDL+IVLN+NNH  M    +    ++
Sbjct  131   ETVIPGLSGEAAAAVPPEG-----EGDDWDSDSEDDLKIVLNENNHMAMERGGVADGDEE  185

Query  3138  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  2971
             ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186   EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  2970  IGYSNHGYHHPYHSQFKY--VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDW  2797
             IGYSNHGYH P+HS FKY  VRPGAA +PGA    PGG PGQ+ P  N   +AGRGRG+W
Sbjct  242   IGYSNHGYH-PFHSPFKYQYVRPGAALMPGAAASAPGGPPGQIRPLAN---MAGRGRGEW  297

Query  2796  RPPGMKGALTMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPW  2632
             RPPG+KG   MQKGF   PG   WGS+ +GRG G  L+FTLPSHKTIF+V+I++F+EKPW
Sbjct  298   RPPGIKGGAAMQKGFHAGPGLPGWGSSAAGRGFGGGLEFTLPSHKTIFDVEIENFEEKPW  357

Query  2631  RLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPEL  2452
             +   +D+SDFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPEL
Sbjct  358   KYPNVDISDFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPEL  417

Query  2451  aaaAGIQDIPSENANLGKTEVGQNDLARGS--IRSRPPLPAGRPIQVESGSGDRLPSIDT  2278
             AAA GI D+P E+ N  K++VGQ+D+ +GS   R RPPLP GR IQVE G GDRLPSIDT
Sbjct  418   AAATGIHDVPGEHTNSLKSDVGQSDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDT  477

Query  2277  RPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQPSREGIR----GGDEIGDLQQED  2128
             RPPR+RDSDAIIEIV Q + DD+++        +   P RE  R     GDEI  L+ + 
Sbjct  478   RPPRIRDSDAIIEIVLQDTEDDESSAGIAQDPPESGDPHREDFREDHVAGDEIPRLEPK-  536

Query  2127  IHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSV  1951
               + DGF   YNG K+E   RR  F NS   +    D  +  P EEP  Y   SRGQ   
Sbjct  537   --YFDGFPQDYNGRKKEIAGRRMPFINSCAANMPNGDEKLFFPQEEPIEYS-GSRGQNRR  593

Query  1950  YPGRKHAVAHDSTREKGRARCRSADI------GASESPKDKQID-VDNRREDSLSVGDrr  1792
               G   + +HD  + + R R +S  I          S K++  + ++ R   S +V D  
Sbjct  594   NYGGNFSSSHDERQMQRRVRGQSPPIIPIQELATDNSQKEESAESMEGRHRSSPAVKDVG  653

Query  1791  splssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVID  1612
                           ES+VE  D   ++   A  +S +E+ + +VD     D  +D     
Sbjct  654   --------------ESSVEYKDIELEDTETADGSSRLEKEE-TVD---RVDTLED----G  691

Query  1611  TAKKHKLSSQLEEPSPQET-DGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDK  1438
              AK+ K++SQ+E P P E  D  EDSKAA+SS+NSK RS SS+D  K  +G EEE VQD 
Sbjct  692   VAKRQKVTSQVEPPLPDEVDDDWEDSKAAKSSDNSKARSASSRDNQKRQEGFEEEVVQDP  751

Query  1437  RFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTK  1264
             + AH+   RQ   E E    ++  D K E E++RM++KGRE SY  K    SSA   H  
Sbjct  752   QSAHLGSIRQHPDEIEPGFYKREHDAKQEPERNRMMLKGRERSYPYKDRHPSSAPQLHAN  811

Query  1263  TSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSERE  1084
             T   D +KERD S++ W  RDDDL+ RR + ++ RKR+         R K+R+ +R+++E
Sbjct  812   TDGFDGQKERDNSEMDWARRDDDLYNRRVRNDEPRKRD---------RAKVRENERNDKE  862

Query  1083  GRHLLRKQLDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSRE  910
                  RKQLDNGS R  ++KD  SR  R RERD+ L+ RY+ ++D   KRRK++  L RE
Sbjct  863   DSLHSRKQLDNGSYRVLYEKDVGSRDSRHRERDEGLRIRYEAVEDYRGKRRKDEEYLRRE  922

Query  909   HVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPL  730
             H+D+EE LH   +   RR+RERD++ D RKRDD+  QR RD+     DDQ+  R K++  
Sbjct  923   HIDKEEVLHGYRENASRRRRERDEVLDPRKRDDL--QRARDNP----DDQYATRQKDDAW  976

Query  729   FQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK  550
                ERG+R R+R+EW+R KQSH+E L KRER+EGR  +R GR A             E+K
Sbjct  977   VPRERGDRQRDREEWHRMKQSHEEHLPKREREEGRSSVRSGRGA-------------EHK  1023

Query  549   GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTR  370
              S++EY S++A R  + LKRR+R ++ SP  H+ R+D   RG+Q +T+ERR+R ER S+R
Sbjct  1024  LSEKEYQSREAMRQNDQLKRRDRIQDESP-HHKGRDDASARGNQYTTEERRSRQERSSSR  1082

Query  369   QDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
              D  A  SD+ KV   K +E S K K  + SD NSL  S  +++++ G  +E
Sbjct  1083  SDRVANFSDNQKV---KHREGSRKSKERDVSDLNSLGLSKRSQENQIGPTNE  1131



>ref|XP_003535062.1| PREDICTED: uncharacterized protein LOC100803769 isoform X1 [Glycine 
max]
Length=1316

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/1064 (47%), Positives = 655/1064 (62%), Gaps = 94/1064 (9%)
 Frame = -1

Query  3318  EHMIPGVSIPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  3139
             E +IPG+S    + VP        + +      +DDL+IVLN+NNH  M    +    ++
Sbjct  131   ETVIPGLSGEAAAAVPPEG-----EGDDWDSDSEDDLKIVLNENNHMAMERGGVADGDEE  185

Query  3138  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  2971
             ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186   EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  2970  IGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRP  2791
             IGYSNHGYH P+HS FKYVRPGAA +PGA    PGG PGQ+ P  N   +AGRGRG+WRP
Sbjct  242   IGYSNHGYH-PFHSPFKYVRPGAALMPGAAASAPGGPPGQIRPLAN---MAGRGRGEWRP  297

Query  2790  PGMKGALTMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRL  2626
             PG+KG   MQKGF   PG   WGS+ +GRG G  L+FTLPSHKTIF+V+I++F+EKPW+ 
Sbjct  298   PGIKGGAAMQKGFHAGPGLPGWGSSAAGRGFGGGLEFTLPSHKTIFDVEIENFEEKPWKY  357

Query  2625  QGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaa  2446
               +D+SDFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPELAA
Sbjct  358   PNVDISDFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPELAA  417

Query  2445  aAGIQDIPSENANLGKTEVGQNDLARGS--IRSRPPLPAGRPIQVESGSGDRLPSIDTRP  2272
             A GI D+P E+ N  K++VGQ+D+ +GS   R RPPLP GR IQVE G GDRLPSIDTRP
Sbjct  418   ATGIHDVPGEHTNSLKSDVGQSDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDTRP  477

Query  2271  PRVRDSDAIIEIVCQGSADDDNNL------EQGNQPSREGIR----GGDEIGDLQQEDIH  2122
             PR+RDSDAIIEIV Q + DD+++        +   P RE  R     GDEI  L+ +   
Sbjct  478   PRIRDSDAIIEIVLQDTEDDESSAGIAQDPPESGDPHREDFREDHVAGDEIPRLEPK---  534

Query  2121  HVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYP  1945
             + DGF   YNG K+E   RR  F NS   +    D  +  P EEP  Y   SRGQ     
Sbjct  535   YFDGFPQDYNGRKKEIAGRRMPFINSCAANMPNGDEKLFFPQEEPIEYS-GSRGQNRRNY  593

Query  1944  GRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN-RREDSLSVGDrrsplssspv  1768
             G   + +HD  + + R R +S  I   +     ++  DN ++E+S    +       S  
Sbjct  594   GGNFSSSHDERQMQRRVRGQSPPIIPIQ-----ELATDNSQKEES---AESMEGRHRSSP  645

Query  1767  snrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLS  1588
             + + V ES+VE  D   ++   A  +S +E+ + +VD     D  +D      AK+ K++
Sbjct  646   AVKDVGESSVEYKDIELEDTETADGSSRLEKEE-TVD---RVDTLED----GVAKRQKVT  697

Query  1587  SQLEEPSPQET-DGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDT  1414
             SQ+E P P E  D  EDSKAA+SS+NSK RS SS+D  K  +G EEE VQD + AH+   
Sbjct  698   SQVEPPLPDEVDDDWEDSKAAKSSDNSKARSASSRDNQKRQEGFEEEVVQDPQSAHLGSI  757

Query  1413  RQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRK  1240
             RQ   E E    ++  D K E E++RM++KGRE SY  K    SSA   H  T   D +K
Sbjct  758   RQHPDEIEPGFYKREHDAKQEPERNRMMLKGRERSYPYKDRHPSSAPQLHANTDGFDGQK  817

Query  1239  ERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQ  1060
             ERD S++ W  RDDDL+ RR + ++ RKR+         R K+R+ +R+++E     RKQ
Sbjct  818   ERDNSEMDWARRDDDLYNRRVRNDEPRKRD---------RAKVRENERNDKEDSLHSRKQ  868

Query  1059  LDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSREHVDREETL  886
             LDNGS R  ++KD  SR  R RERD+ L+ RY+ ++D   KRRK++  L REH+D+EE L
Sbjct  869   LDNGSYRVLYEKDVGSRDSRHRERDEGLRIRYEAVEDYRGKRRKDEEYLRREHIDKEEVL  928

Query  885   HSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGER  706
             H   +   RR+RERD++ D RKRDD+  QR RD+     DDQ+  R K++     ERG+R
Sbjct  929   HGYRENASRRRRERDEVLDPRKRDDL--QRARDNP----DDQYATRQKDDAWVPRERGDR  982

Query  705   HRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHS  526
              R+R+EW+R KQSH+E L KRER+EGR  +R GR A             E+K S++EY S
Sbjct  983   QRDREEWHRMKQSHEEHLPKREREEGRSSVRSGRGA-------------EHKLSEKEYQS  1029

Query  525   KDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYES  346
             ++A R  + LKRR+R ++ SP  H+ R+D   RG+Q +T+ERR+R ER S+R D  A  S
Sbjct  1030  REAMRQNDQLKRRDRIQDESP-HHKGRDDASARGNQYTTEERRSRQERSSSRSDRVANFS  1088

Query  345   DSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
             D+ KV   K +E S K K  + SD NSL  S  +++++ G  +E
Sbjct  1089  DNQKV---KHREGSRKSKERDVSDLNSLGLSKRSQENQIGPTNE  1129



>ref|XP_010687726.1| PREDICTED: FIP1[V]-like protein [Beta vulgaris subsp. vulgaris]
Length=1398

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/989 (49%), Positives = 620/989 (63%), Gaps = 79/989 (8%)
 Frame = -1

Query  3120  PLVIVAN--------SDDPSHQPMVEEQEWGDELGNSADGERKEDAAKVNVGPGYAPKIG  2965
             PLVIVA+        +     QP VE+QEWGDE G SA+G+   DAAK N G   APK G
Sbjct  226   PLVIVADDHTAAVAAAAAGGVQP-VEDQEWGDEAGQSAEGKDNADAAKANAGLATAPKSG  284

Query  2964  YSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPG  2785
             Y+ +GYH P+HSQFKYVRPGA P+PG PPVG GG PGQV PP N S + GRGRGDWRPPG
Sbjct  285   YAPYGYH-PFHSQFKYVRPGAVPLPGGPPVGSGGAPGQVRPPANMSPMVGRGRGDWRPPG  343

Query  2784  MKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMS  2608
             MKG   MQKGF PG+  WGSN  GRG  L+FTLPSHKTIF+VDIDSF+EKPW+  G+D+S
Sbjct  344   MKGP-AMQKGFHPGF--WGSNQPGRG--LEFTLPSHKTIFDVDIDSFEEKPWKYPGVDVS  398

Query  2607  DFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQD  2428
             DFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGR EQEYDPD+PPELAAAAG+ D
Sbjct  399   DFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRAEQEYDPDMPPELAAAAGMHD  458

Query  2427  IPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDA  2248
               +EN +  + + G  DLA+ S R RPPLP GR IQVE+G G+RLPS+DTRPPRVRDSDA
Sbjct  459   -SAENVDATRADGGLGDLAKASARVRPPLPTGRAIQVETGCGERLPSVDTRPPRVRDSDA  517

Query  2247  IIEIVCQGSADDD---NNLEQGNQPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKRE  2077
             +IEIV Q   D +   N+ E     +       +  G+  +   +  D  +H  N   RE
Sbjct  518   VIEIVLQDFVDAESTGNDAESAGNDAESAGNDAESAGNDAESAGN--DAGEHPDNDSARE  575

Query  2076  -----------FGSRRAEFNSGP--YDKSRSD----RVVI------LPSEEPDSYHPDSR  1966
                          SR   F+S P  YD ++ D    R  +      +  +E D   P   
Sbjct  576   EDQVDVVDEDGPQSRDVCFDSRPQGYDVTKEDGSRKRSPVKNSHAEIDDDEGDRSSPQRA  635

Query  1965  GQTSVYPGRKHAVAHDS--------TREKGRARCRSADIGASESPKDKQIDVDNRREDSL  1810
                     R HA + ++        T+EK   R RS  + + ES  D++  VD +REDS+
Sbjct  636   LSDHHLGSRDHASSDNAGSPYEERWTKEK--TRQRSPHMSSGESALDRR-SVDYQREDSV  692

Query  1809  -SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKA  1633
              S+  + SP SSS       +E ++E       E VP     G  +   ++   +N  K 
Sbjct  693   ESMEAKHSPESSSATPIEHAREGSLERK-IAEAEDVPDDIEPGKSKEDTNLVASSNTSK-  750

Query  1632  KDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEE  1453
               D  I   K+ KLS Q+E P+ +E D G D K +RSS+NSK  +GSS+D+ K  +G++E
Sbjct  751   --DKHIHPKKQQKLSHQVELPASKEFDEGGDFKISRSSDNSKG-TGSSRDHPKWREGVDE  807

Query  1452  E-VQDKRFAHVDDTRQTGGEEDR-LQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssa  1282
             E VQ+ R  ++ D ++  G+    L+RK RD + E E++ M+ KGRED Y  + +D  + 
Sbjct  808   EVVQNGRSTYLGDVKRNHGDSGHDLRRKDRDGRMEPERNYMVAKGREDHYSHRDWDPHAT  867

Query  1281  hhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDI  1102
             +H HTK+  +DRRKERDY+DV+WQ RD+D HGRR + ED RK+E  DE+ S+ R K+R++
Sbjct  868   NHFHTKSESSDRRKERDYTDVSWQRRDEDPHGRRIRAEDIRKQERADEMVSRRRGKVREV  927

Query  1101  DRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTK  922
             DRS+++     RK LDNG  R  HDKDA  R+RE++ D  KSR++  DD HSKRRK+D  
Sbjct  928   DRSDKDEYVQPRKVLDNGIWRGYHDKDAGLRYREKD-DVSKSRFEIFDDHHSKRRKDDEH  986

Query  921   LSREHVDREETLHS-RGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARY  745
               R+HV++E+ L S R   + RRKRERD I + RKR+D    R RD+     DD H  R 
Sbjct  987   ARRDHVEKEDILLSHRDSSSTRRKRERDGILNLRKRED--QPRIRDNM----DDHHSVRL  1040

Query  744   KEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRG  565
             K+E   Q ER E+ R+RDEWYR KQS++EILS+RER++GR  +R  R  EEK+W G SRG
Sbjct  1041  KDEVWVQRERAEQQRDRDEWYRGKQSYEEILSRREREDGRAPIRSSRNVEEKTWVGHSRG  1100

Query  564   KDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNE  385
              +EYKG     H KDAGRH + LKRRER E     +HR  ED Y RG Q + + +R+R E
Sbjct  1101  GEEYKG-----HDKDAGRHGDQLKRRERLEEDPSLQHRGGEDVYARGSQFANEGKRSRQE  1155

Query  384   RVSTRQDHAAYESDSSKVHEKKRKENSTK  298
             R STR   A   S++ ++HE+K KEN  K
Sbjct  1156  RSSTRNSRADA-SENQRLHERKHKENVKK  1183



>ref|XP_006587147.1| PREDICTED: uncharacterized protein LOC100803769 isoform X2 [Glycine 
max]
Length=1318

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/1066 (47%), Positives = 655/1066 (61%), Gaps = 96/1066 (9%)
 Frame = -1

Query  3318  EHMIPGVSIPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgdd  3139
             E +IPG+S    + VP        + +      +DDL+IVLN+NNH  M    +    ++
Sbjct  131   ETVIPGLSGEAAAAVPPEG-----EGDDWDSDSEDDLKIVLNENNHMAMERGGVADGDEE  185

Query  3138  ddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPK  2971
             ++D  + LVIVA  D       VEE EWG+    +A DG+RK+ A   AKV  G    PK
Sbjct  186   EEDGDEELVIVAGGD---LNQGVEEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPK  241

Query  2970  IGYSNHGYHHPYHSQFKY--VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDW  2797
             IGYSNHGYH P+HS FKY  VRPGAA +PGA    PGG PGQ+ P  N   +AGRGRG+W
Sbjct  242   IGYSNHGYH-PFHSPFKYQYVRPGAALMPGAAASAPGGPPGQIRPLAN---MAGRGRGEW  297

Query  2796  RPPGMKGALTMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPW  2632
             RPPG+KG   MQKGF   PG   WGS+ +GRG G  L+FTLPSHKTIF+V+I++F+EKPW
Sbjct  298   RPPGIKGGAAMQKGFHAGPGLPGWGSSAAGRGFGGGLEFTLPSHKTIFDVEIENFEEKPW  357

Query  2631  RLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPEL  2452
             +   +D+SDFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPEL
Sbjct  358   KYPNVDISDFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPEL  417

Query  2451  aaaAGIQDIPSENANLGKTEVGQNDLARGS--IRSRPPLPAGRPIQVESGSGDRLPSIDT  2278
             AAA GI D+P E+ N  K++VGQ+D+ +GS   R RPPLP GR IQVE G GDRLPSIDT
Sbjct  418   AAATGIHDVPGEHTNSLKSDVGQSDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDT  477

Query  2277  RPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQPSREGIR----GGDEIGDLQQED  2128
             RPPR+RDSDAIIEIV Q + DD+++        +   P RE  R     GDEI  L+ + 
Sbjct  478   RPPRIRDSDAIIEIVLQDTEDDESSAGIAQDPPESGDPHREDFREDHVAGDEIPRLEPK-  536

Query  2127  IHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSV  1951
               + DGF   YNG K+E   RR  F NS   +    D  +  P EEP  Y   SRGQ   
Sbjct  537   --YFDGFPQDYNGRKKEIAGRRMPFINSCAANMPNGDEKLFFPQEEPIEYS-GSRGQNRR  593

Query  1950  YPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDN-RREDSLSVGDrrsplsss  1774
               G   + +HD  + + R R +S  I   +     ++  DN ++E+S    +       S
Sbjct  594   NYGGNFSSSHDERQMQRRVRGQSPPIIPIQ-----ELATDNSQKEES---AESMEGRHRS  645

Query  1773  pvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHK  1594
               + + V ES+VE  D   ++   A  +S +E+ + +VD     D  +D      AK+ K
Sbjct  646   SPAVKDVGESSVEYKDIELEDTETADGSSRLEKEE-TVD---RVDTLED----GVAKRQK  697

Query  1593  LSSQLEEPSPQET-DGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVD  1420
             ++SQ+E P P E  D  EDSKAA+SS+NSK RS SS+D  K  +G EEE VQD + AH+ 
Sbjct  698   VTSQVEPPLPDEVDDDWEDSKAAKSSDNSKARSASSRDNQKRQEGFEEEVVQDPQSAHLG  757

Query  1419  DTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADR  1246
               RQ   E E    ++  D K E E++RM++KGRE SY  K    SSA   H  T   D 
Sbjct  758   SIRQHPDEIEPGFYKREHDAKQEPERNRMMLKGRERSYPYKDRHPSSAPQLHANTDGFDG  817

Query  1245  RKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLR  1066
             +KERD S++ W  RDDDL+ RR + ++ RKR+         R K+R+ +R+++E     R
Sbjct  818   QKERDNSEMDWARRDDDLYNRRVRNDEPRKRD---------RAKVRENERNDKEDSLHSR  868

Query  1065  KQLDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSREHVDREE  892
             KQLDNGS R  ++KD  SR  R RERD+ L+ RY+ ++D   KRRK++  L REH+D+EE
Sbjct  869   KQLDNGSYRVLYEKDVGSRDSRHRERDEGLRIRYEAVEDYRGKRRKDEEYLRREHIDKEE  928

Query  891   TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERG  712
              LH   +   RR+RERD++ D RKRDD+  QR RD+     DDQ+  R K++     ERG
Sbjct  929   VLHGYRENASRRRRERDEVLDPRKRDDL--QRARDNP----DDQYATRQKDDAWVPRERG  982

Query  711   ERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREY  532
             +R R+R+EW+R KQSH+E L KRER+EGR  +R GR A             E+K S++EY
Sbjct  983   DRQRDREEWHRMKQSHEEHLPKREREEGRSSVRSGRGA-------------EHKLSEKEY  1029

Query  531   HSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAY  352
              S++A R  + LKRR+R ++ SP  H+ R+D   RG+Q +T+ERR+R ER S+R D  A 
Sbjct  1030  QSREAMRQNDQLKRRDRIQDESP-HHKGRDDASARGNQYTTEERRSRQERSSSRSDRVAN  1088

Query  351   ESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
              SD+ KV   K +E S K K  + SD NSL  S  +++++ G  +E
Sbjct  1089  FSDNQKV---KHREGSRKSKERDVSDLNSLGLSKRSQENQIGPTNE  1131



>ref|XP_010047129.1| PREDICTED: uncharacterized protein LOC104436103 isoform X2 [Eucalyptus 
grandis]
Length=1178

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/1054 (47%), Positives = 657/1054 (62%), Gaps = 81/1054 (8%)
 Frame = -1

Query  3300  VSIPGVSGVPE-TCGDRAVdeewdsdsdddDLRIVLNDN--NHGPmgmdrmggdgddddd  3130
             + IPG+SG  E + G      +      +DDL+IVLNDN  +HGP+G+    G  +DDD+
Sbjct  155   LVIPGLSGPREPSGGRDGNGGDDWDSDSEDDLQIVLNDNAAHHGPVGVIGDAGGEEDDDE  214

Query  3129  dgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKE-----DAAKVNVGPGYAPKI  2968
             DGDPLVIVA+ D PS QP+VE QEWG++   +  +GERKE     + AK N G G APKI
Sbjct  215   DGDPLVIVADGD-PS-QPLVE-QEWGEDTAEAGPEGERKEGGGSSELAKANGGVGVAPKI  271

Query  2967  GYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPP  2788
             GYSN GYH P+HSQFKYVRPGA+P+PG+    P G PGQV PPVN   +AGRGRGDWR  
Sbjct  272   GYSNLGYH-PFHSQFKYVRPGASPMPGSSVAAPVGAPGQVRPPVNMGPLAGRGRGDWRLA  330

Query  2787  GMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDM  2611
             GMKGA ++QK F PG   WGS   G G GL+F+LPSHKTIFEVDIDSF+EKPWR  G+D 
Sbjct  331   GMKGASSLQKNFHPGSTPWGSG-RGYGGGLEFSLPSHKTIFEVDIDSFEEKPWRYPGVDS  389

Query  2610  SDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQ  2431
             +DFFNFGLNEESWK+YCKQLE LRLESTMQ KI VYESGR +QE+DPDLPPELAAA+GI 
Sbjct  390   TDFFNFGLNEESWKEYCKQLETLRLESTMQSKIHVYESGRKKQEFDPDLPPELAAASGI-  448

Query  2430  DIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSD  2251
             DI +ENA  GK + GQ D+ + S   RPPLP GR IQVESG G+RLPSIDTRPPR+RDSD
Sbjct  449   DITAENATNGKLDAGQRDI-KASAHVRPPLPTGRAIQVESGYGERLPSIDTRPPRIRDSD  507

Query  2250  AIIEIVCQGSADDDNNLEQG-------NQPSREGIRGGDEIGD-LQQEDIHHVDGFQHAY  2095
             AIIEIVCQ S DDD++ E G       N P+ E +R  ++  D + QE+    D F   Y
Sbjct  508   AIIEIVCQDSVDDDSSTENGLADKVDNNDPTSEELRVAEKAEDRVAQEEAESFDRFSETY  567

Query  2094  NGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS  1915
             +   RE   +     SG  D    +       E    +HP S+ QTS Y  RK A+ H+ 
Sbjct  568   SDQNREVVEKAQLVESGQDDLPEGEESSPSRREGSIQHHPSSKEQTSGYTSRKAAITHND  627

Query  1914  TREKGRARCRSADIGASESPKDKQIDVDNR---------REDSLSVGDrrsplssspvsn  1762
                  R R +S ++  + S ++++   DN+          E++L+V              
Sbjct  628   R----RTRDQSPNVSPNHSTEEEKKTFDNQGPQMVDSVESEEALNV--------------  669

Query  1761  rsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQ  1582
                  S++++ D L  + +P  R+S  ER ++  D     +K     ++   +K K +S+
Sbjct  670   -----SSMDHKDALAGKSLPGDRSSEPERNEVPSDASKAGEK-----LLHPRRKDKFNSR  719

Query  1581  LEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQT  1405
              E+ +  E D GED +AARSSENSK RSGSS+D  K  D  EEE VQ     H+ D+R+ 
Sbjct  720   GEQVALDEFDEGEDFRAARSSENSKARSGSSRDSQKWRDSTEEEVVQAGLPTHMGDSRRH  779

Query  1404  GGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERD  1231
               E E + +RK  D + ETEK R +VK + D Y  +  D SS H+   K+   DRRKER+
Sbjct  780   LDENEHKFRRKDHDRRQETEKSRTVVKDKVDPY--RDRDPSSVHNLPVKSDNFDRRKERE  837

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
             YSD A + RDD+   RR ++EDSRKRE  DE+ S+HR++ R+ +R+++E  H  +KQLDN
Sbjct  838   YSDGARRLRDDEPSSRRLRLEDSRKRERSDEVGSRHRSRGRETERNDKEEYHSSKKQLDN  897

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSRE--HVDREETLHSR  877
             G  + ++DK+   R RER+ D L+SRY+  D+   KR+K D    RE  H+D+EE L  +
Sbjct  898   GMHKVNYDKEVALRGRERD-DSLRSRYEAADEYRGKRKKADEYFPRERDHIDKEEILREQ  956

Query  876   GDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRE  697
              D + RRKR+RDD +DQR+R+D S  R RD      DD H +R+K+E     E+ E+ R 
Sbjct  957   RDNSGRRKRDRDDNNDQRQREDQS--RVRDSV----DDHHSSRHKDESWSHREKIEKPRG  1010

Query  696   RDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDA  517
             R+EW++ KQ H+E   KRER+E R  +R GR  E+K+WAG  R +D+ + S R+Y  KD 
Sbjct  1011  REEWHKAKQGHEENRLKREREEERATIRGGRGGEDKTWAGQDRPRDDRRASGRDYQFKDT  1070

Query  516   GRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSS  337
              R  E  KRRE  E+ S  ++R  E+ + RG+Q   +E+R+R E+ STR +  A  SD+ 
Sbjct  1071  ARQNEDAKRREHQEDESFLQYRGHEEIHARGNQNKNEEKRSRFEKSSTRNEKPANVSDNQ  1130

Query  336   KVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDD  235
             ++HEK  K +  K+K PE  D ++   S  N+DD
Sbjct  1131  RMHEK--KHSHRKNKEPEGGDHHT---SKRNQDD  1159



>gb|KEH37870.1| Fip1 [V]-like protein [Medicago truncatula]
Length=1152

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/1035 (46%), Positives = 633/1035 (61%), Gaps = 71/1035 (7%)
 Frame = -1

Query  3210  LRIVLNDNNH---GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  3040
             L+IVLND+NH          +G D D+DDD+   LVIVA   +P+    +E+QEWG+   
Sbjct  157   LQIVLNDDNHMAMAMEKGGVVGDDDDEDDDEDGGLVIVAG--EPNQG--LEDQEWGESAN  212

Query  3039  NSADGERKE--DAAKVNVGPG-----YAPKIGYSNHGY-HHPYHSQFKYVRpgaapipga  2884
                DGERK+  +  K   GP        PK+GY NH + +HP+HSQFKY+RPGA  IPGA
Sbjct  213   IPVDGERKDAVEPGKPVAGPAAGGIPVVPKVGYGNHAHGYHPFHSQFKYIRPGATTIPGA  272

Query  2883  ppvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGR  2713
             P    GG PGQ+ P  N   + GRGRGDWRPPG+KGA+ MQKGF   PG  +WG+N +GR
Sbjct  273   PGAAQGGPPGQIRPLAN---MIGRGRGDWRPPGIKGAIGMQKGFHTGPGQPSWGNNAAGR  329

Query  2712  GIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLR  2539
             G G  L+FTLPSHKTIF+VDI+SF+EK W+   +D SDFFNFGLNEE+WKDYCKQLEQLR
Sbjct  330   GFGGGLEFTLPSHKTIFDVDIESFEEKLWKYPNVDASDFFNFGLNEETWKDYCKQLEQLR  389

Query  2538  LESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSI  2359
             LESTMQ KIRVYESGRTE +YDPDLPPELAAA G+ D   ENAN  K++VGQ+D+ +GS 
Sbjct  390   LESTMQSKIRVYESGRTEHDYDPDLPPELAAATGLHDGAVENANSVKSDVGQSDVMKGSG  449

Query  2358  RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQ--  2185
             R RPP+P GR IQVE G G+RLP+IDTRPPR+RDSDAIIEIV QG+ DDD+++  G Q  
Sbjct  450   RMRPPMPTGRAIQVEGGYGERLPTIDTRPPRLRDSDAIIEIVLQGAEDDDSSVGIGVQDQ  509

Query  2184  -----PSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRS  2023
                  P RE  R   E GD    +  + DG    YN  K+E   R+  F  S   + +  
Sbjct  510   SEDGEPQRESFREDVEAGDEPSLEPEYSDGIPQDYNRRKKEHAGRKMPFATSVSSNVANE  569

Query  2022  DRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQ  1843
             D  + +  +EP  Y   SRGQ     G   + + +  + +   R +S       SP  K 
Sbjct  570   DESLFVSQDEPIEYS-GSRGQNPRSYGGNSSSSQEERKMQKTVRSQSP-----ISPIRKL  623

Query  1842  IDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKIS  1663
                DN++EDS+   + +    SS      V++S++E+ D   ++   A  +  + + +  
Sbjct  624   NTDDNKKEDSVESMEVKDTTLSSSPVIEDVKQSSLEDKDGELEDTGTADGSPRLGKKETD  683

Query  1662  VDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKD  1483
             ++     D  KD   ID  KK  L+SQ+E+P   E+D  ED KAARSS+NSK RS SS+D
Sbjct  684   LNAVDKVDVLKDG--ID--KKQNLTSQVEQPLLDESDDWEDIKAARSSDNSKARSASSRD  739

Query  1482  YHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEKE-TEKHRMIVKGREDSY  1312
               K  +GL+EE VQD R   +   RQ   E E    RK  D K+  E++ M+++GRE SY
Sbjct  740   NQKRREGLDEEVVQDPRSTRLASIRQHPDENEQGFYRKEHDGKQDPERNHMVLRGREGSY  799

Query  1311  MRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIE  1132
               K    S AH  HT T   DR+K+RD SD+ W  RDDD++ R+ +  + RKR+      
Sbjct  800   PYKDRHRSLAHQLHTNTDGFDRQKDRDSSDMDWARRDDDVYNRKVRTNEPRKRD------  853

Query  1131  SKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNID  958
                R K+R+ +R+++E     RKQLDNGS R  ++KD  SR  R RERD+ ++ RY+ ++
Sbjct  854   ---RAKLRENERNDKEDSFHSRKQLDNGSYRIPYEKDVGSRDSRHRERDEGVRVRYEAVE  910

Query  957   DRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQR  778
             D H KRRK++  L REH+D+EE  H   +   RR+RERD++  QR RD            
Sbjct  911   DYHIKRRKDEEYLRREHMDKEEIPHGYRENASRRRRERDEV--QRSRD------------  956

Query  777   LREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAA  598
                DDQ+  R K++     ERG+R R+R+EW+R K SHD  L KRER+EGR   R  R A
Sbjct  957   -YPDDQYTNRQKDDAWLMQERGDRQRDREEWHRLKLSHDGPLPKREREEGRSSGRNVRGA  1015

Query  597   EEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQ  418
             EEK+W G    KDE+K S+++Y S+++ RH + LKRR+R    S S H+ R+D Y RG+Q
Sbjct  1016  EEKAWVGRVSAKDEHKLSEKDYQSRESVRHNDQLKRRDRIPEES-SHHKGRDDAYSRGNQ  1074

Query  417   PSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNED  238
              + +ERR+R ER S+R D  A  SD+ ++HE+K KE S K K  + SD NSL  S  + +
Sbjct  1075  YTAEERRSRQERSSSRSDRVANASDNQRLHERKHKEGSRKSKERDISDLNSLGLSKKSLE  1134

Query  237   DRSGNASETVC*IFA  193
             + +G ++E VC   A
Sbjct  1135  NPNGPSNEKVCITVA  1149



>ref|XP_010047128.1| PREDICTED: zinc finger CCCH domain-containing protein 13 isoform 
X1 [Eucalyptus grandis]
Length=1351

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/1054 (47%), Positives = 657/1054 (62%), Gaps = 81/1054 (8%)
 Frame = -1

Query  3300  VSIPGVSGVPE-TCGDRAVdeewdsdsdddDLRIVLNDN--NHGPmgmdrmggdgddddd  3130
             + IPG+SG  E + G      +      +DDL+IVLNDN  +HGP+G+    G  +DDD+
Sbjct  155   LVIPGLSGPREPSGGRDGNGGDDWDSDSEDDLQIVLNDNAAHHGPVGVIGDAGGEEDDDE  214

Query  3129  dgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKE-----DAAKVNVGPGYAPKI  2968
             DGDPLVIVA+ D PS QP+VE QEWG++   +  +GERKE     + AK N G G APKI
Sbjct  215   DGDPLVIVADGD-PS-QPLVE-QEWGEDTAEAGPEGERKEGGGSSELAKANGGVGVAPKI  271

Query  2967  GYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPP  2788
             GYSN GYH P+HSQFKYVRPGA+P+PG+    P G PGQV PPVN   +AGRGRGDWR  
Sbjct  272   GYSNLGYH-PFHSQFKYVRPGASPMPGSSVAAPVGAPGQVRPPVNMGPLAGRGRGDWRLA  330

Query  2787  GMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDM  2611
             GMKGA ++QK F PG   WGS   G G GL+F+LPSHKTIFEVDIDSF+EKPWR  G+D 
Sbjct  331   GMKGASSLQKNFHPGSTPWGSG-RGYGGGLEFSLPSHKTIFEVDIDSFEEKPWRYPGVDS  389

Query  2610  SDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQ  2431
             +DFFNFGLNEESWK+YCKQLE LRLESTMQ KI VYESGR +QE+DPDLPPELAAA+GI 
Sbjct  390   TDFFNFGLNEESWKEYCKQLETLRLESTMQSKIHVYESGRKKQEFDPDLPPELAAASGI-  448

Query  2430  DIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSD  2251
             DI +ENA  GK + GQ D+ + S   RPPLP GR IQVESG G+RLPSIDTRPPR+RDSD
Sbjct  449   DITAENATNGKLDAGQRDI-KASAHVRPPLPTGRAIQVESGYGERLPSIDTRPPRIRDSD  507

Query  2250  AIIEIVCQGSADDDNNLEQG-------NQPSREGIRGGDEIGD-LQQEDIHHVDGFQHAY  2095
             AIIEIVCQ S DDD++ E G       N P+ E +R  ++  D + QE+    D F   Y
Sbjct  508   AIIEIVCQDSVDDDSSTENGLADKVDNNDPTSEELRVAEKAEDRVAQEEAESFDRFSETY  567

Query  2094  NGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS  1915
             +   RE   +     SG  D    +       E    +HP S+ QTS Y  RK A+ H+ 
Sbjct  568   SDQNREVVEKAQLVESGQDDLPEGEESSPSRREGSIQHHPSSKEQTSGYTSRKAAITHND  627

Query  1914  TREKGRARCRSADIGASESPKDKQIDVDNR---------REDSLSVGDrrsplssspvsn  1762
                  R R +S ++  + S ++++   DN+          E++L+V              
Sbjct  628   R----RTRDQSPNVSPNHSTEEEKKTFDNQGPQMVDSVESEEALNV--------------  669

Query  1761  rsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQ  1582
                  S++++ D L  + +P  R+S  ER ++  D     +K     ++   +K K +S+
Sbjct  670   -----SSMDHKDALAGKSLPGDRSSEPERNEVPSDASKAGEK-----LLHPRRKDKFNSR  719

Query  1581  LEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQT  1405
              E+ +  E D GED +AARSSENSK RSGSS+D  K  D  EEE VQ     H+ D+R+ 
Sbjct  720   GEQVALDEFDEGEDFRAARSSENSKARSGSSRDSQKWRDSTEEEVVQAGLPTHMGDSRRH  779

Query  1404  GGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERD  1231
               E E + +RK  D + ETEK R +VK + D Y  +  D SS H+   K+   DRRKER+
Sbjct  780   LDENEHKFRRKDHDRRQETEKSRTVVKDKVDPY--RDRDPSSVHNLPVKSDNFDRRKERE  837

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
             YSD A + RDD+   RR ++EDSRKRE  DE+ S+HR++ R+ +R+++E  H  +KQLDN
Sbjct  838   YSDGARRLRDDEPSSRRLRLEDSRKRERSDEVGSRHRSRGRETERNDKEEYHSSKKQLDN  897

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSRE--HVDREETLHSR  877
             G  + ++DK+   R RER+ D L+SRY+  D+   KR+K D    RE  H+D+EE L  +
Sbjct  898   GMHKVNYDKEVALRGRERD-DSLRSRYEAADEYRGKRKKADEYFPRERDHIDKEEILREQ  956

Query  876   GDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRE  697
              D + RRKR+RDD +DQR+R+D S  R RD      DD H +R+K+E     E+ E+ R 
Sbjct  957   RDNSGRRKRDRDDNNDQRQREDQS--RVRDSV----DDHHSSRHKDESWSHREKIEKPRG  1010

Query  696   RDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDA  517
             R+EW++ KQ H+E   KRER+E R  +R GR  E+K+WAG  R +D+ + S R+Y  KD 
Sbjct  1011  REEWHKAKQGHEENRLKREREEERATIRGGRGGEDKTWAGQDRPRDDRRASGRDYQFKDT  1070

Query  516   GRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSS  337
              R  E  KRRE  E+ S  ++R  E+ + RG+Q   +E+R+R E+ STR +  A  SD+ 
Sbjct  1071  ARQNEDAKRREHQEDESFLQYRGHEEIHARGNQNKNEEKRSRFEKSSTRNEKPANVSDNQ  1130

Query  336   KVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDD  235
             ++HEK  K +  K+K PE  D ++   S  N+DD
Sbjct  1131  RMHEK--KHSHRKNKEPEGGDHHT---SKRNQDD  1159



>gb|KCW78928.1| hypothetical protein EUGRSUZ_C00363 [Eucalyptus grandis]
Length=1347

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/1054 (47%), Positives = 657/1054 (62%), Gaps = 81/1054 (8%)
 Frame = -1

Query  3300  VSIPGVSGVPE-TCGDRAVdeewdsdsdddDLRIVLNDN--NHGPmgmdrmggdgddddd  3130
             + IPG+SG  E + G      +      +DDL+IVLNDN  +HGP+G+    G  +DDD+
Sbjct  155   LVIPGLSGPREPSGGRDGNGGDDWDSDSEDDLQIVLNDNAAHHGPVGVIGDAGGEEDDDE  214

Query  3129  dgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKE-----DAAKVNVGPGYAPKI  2968
             DGDPLVIVA+ D PS QP+VE QEWG++   +  +GERKE     + AK N G G APKI
Sbjct  215   DGDPLVIVADGD-PS-QPLVE-QEWGEDTAEAGPEGERKEGGGSSELAKANGGVGVAPKI  271

Query  2967  GYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPP  2788
             GYSN GYH P+HSQFKYVRPGA+P+PG+    P G PGQV PPVN   +AGRGRGDWR  
Sbjct  272   GYSNLGYH-PFHSQFKYVRPGASPMPGSSVAAPVGAPGQVRPPVNMGPLAGRGRGDWRLA  330

Query  2787  GMKGALTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDM  2611
             GMKGA ++QK F PG   WGS   G G GL+F+LPSHKTIFEVDIDSF+EKPWR  G+D 
Sbjct  331   GMKGASSLQKNFHPGSTPWGSG-RGYGGGLEFSLPSHKTIFEVDIDSFEEKPWRYPGVDS  389

Query  2610  SDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQ  2431
             +DFFNFGLNEESWK+YCKQLE LRLESTMQ KI VYESGR +QE+DPDLPPELAAA+GI 
Sbjct  390   TDFFNFGLNEESWKEYCKQLETLRLESTMQSKIHVYESGRKKQEFDPDLPPELAAASGI-  448

Query  2430  DIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSD  2251
             DI +ENA  GK + GQ D+ + S   RPPLP GR IQVESG G+RLPSIDTRPPR+RDSD
Sbjct  449   DITAENATNGKLDAGQRDI-KASAHVRPPLPTGRAIQVESGYGERLPSIDTRPPRIRDSD  507

Query  2250  AIIEIVCQGSADDDNNLEQG-------NQPSREGIRGGDEIGD-LQQEDIHHVDGFQHAY  2095
             AIIEIVCQ S DDD++ E G       N P+ E +R  ++  D + QE+    D F   Y
Sbjct  508   AIIEIVCQDSVDDDSSTENGLADKVDNNDPTSEELRVAEKAEDRVAQEEAESFDRFSETY  567

Query  2094  NGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS  1915
             +   RE   +     SG  D    +       E    +HP S+ QTS Y  RK A+ H+ 
Sbjct  568   SDQNREVVEKAQLVESGQDDLPEGEESSPSRREGSIQHHPSSKEQTSGYTSRKAAITHND  627

Query  1914  TREKGRARCRSADIGASESPKDKQIDVDNR---------REDSLSVGDrrsplssspvsn  1762
                  R R +S ++  + S ++++   DN+          E++L+V              
Sbjct  628   R----RTRDQSPNVSPNHSTEEEKKTFDNQGPQMVDSVESEEALNV--------------  669

Query  1761  rsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQ  1582
                  S++++ D L  + +P  R+S  ER ++  D     +K     ++   +K K +S+
Sbjct  670   -----SSMDHKDALAGKSLPGDRSSEPERNEVPSDASKAGEK-----LLHPRRKDKFNSR  719

Query  1581  LEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQT  1405
              E+ +  E D GED +AARSSENSK RSGSS+D  K  D  EEE VQ     H+ D+R+ 
Sbjct  720   GEQVALDEFDEGEDFRAARSSENSKARSGSSRDSQKWRDSTEEEVVQAGLPTHMGDSRRH  779

Query  1404  GGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERD  1231
               E E + +RK  D + ETEK R +VK + D Y  +  D SS H+   K+   DRRKER+
Sbjct  780   LDENEHKFRRKDHDRRQETEKSRTVVKDKVDPY--RDRDPSSVHNLPVKSDNFDRRKERE  837

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
             YSD A + RDD+   RR ++EDSRKRE  DE+ S+HR++ R+ +R+++E  H  +KQLDN
Sbjct  838   YSDGARRLRDDEPSSRRLRLEDSRKRERSDEVGSRHRSRGRETERNDKEEYHSSKKQLDN  897

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSRE--HVDREETLHSR  877
             G  + ++DK+   R RER+ D L+SRY+  D+   KR+K D    RE  H+D+EE L  +
Sbjct  898   GMHKVNYDKEVALRGRERD-DSLRSRYEAADEYRGKRKKADEYFPRERDHIDKEEILREQ  956

Query  876   GDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRE  697
              D + RRKR+RDD +DQR+R+D S  R RD      DD H +R+K+E     E+ E+ R 
Sbjct  957   RDNSGRRKRDRDDNNDQRQREDQS--RVRDSV----DDHHSSRHKDESWSHREKIEKPRG  1010

Query  696   RDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDA  517
             R+EW++ KQ H+E   KRER+E R  +R GR  E+K+WAG  R +D+ + S R+Y  KD 
Sbjct  1011  REEWHKAKQGHEENRLKREREEERATIRGGRGGEDKTWAGQDRPRDDRRASGRDYQFKDT  1070

Query  516   GRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSS  337
              R  E  KRRE  E+ S  ++R  E+ + RG+Q   +E+R+R E+ STR +  A  SD+ 
Sbjct  1071  ARQNEDAKRREHQEDESFLQYRGHEEIHARGNQNKNEEKRSRFEKSSTRNEKPANVSDNQ  1130

Query  336   KVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDD  235
             ++HEK  K +  K+K PE  D ++   S  N+DD
Sbjct  1131  RMHEK--KHSHRKNKEPEGGDHHT---SKRNQDD  1159



>ref|XP_011033463.1| PREDICTED: FIP1[V]-like protein isoform X2 [Populus euphratica]
Length=1107

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/890 (49%), Positives = 569/890 (64%), Gaps = 43/890 (5%)
 Frame = -1

Query  2835  NTSLVAGRGRGDWRPPGMKGALTMQKGF-PGY--NAWGSNPSGRGIGLDFTLPSHKTIFE  2665
             N   +AGRGRGDWRP G+KGA   QK F PG+  +AWG+   G G G++FTLPSHKTIF+
Sbjct  56    NMGAIAGRGRGDWRPVGIKGA--PQKNFHPGFGGSAWGAG-RGFGSGMEFTLPSHKTIFD  112

Query  2664  VDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTE  2485
             VDID F+EKPW+  G+D+SD+FNFGLNEESWKDYCKQLEQ RLE+TMQ KIRVYESGR E
Sbjct  113   VDIDGFEEKPWKYPGVDISDYFNFGLNEESWKDYCKQLEQYRLETTMQSKIRVYESGRAE  172

Query  2484  QEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGS  2305
             QEYDPDLPPELAAA G     ++N+N GK+++GQ+DL +GS R RP +P GR IQVE+G 
Sbjct  173   QEYDPDLPPELAAATGFH-ASADNSNAGKSDIGQSDLTKGSARMRPQIPTGRAIQVETGY  231

Query  2304  GDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD---NNLEQG--NQPSREGIRGGDEI-GD  2143
             G+R+PSI+ R PR+RDSDAIIEIVCQGS DD    + ++ G  N P ++  +  D    D
Sbjct  232   GERIPSIEGRAPRLRDSDAIIEIVCQGSLDDSPPRDGVQDGAHNDPQKDDFKVSDASEDD  291

Query  2142  LQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPD-SR  1966
             ++Q +  +  GF  AYNG K   G RR  + +   + S  D +   P + P  YH   SR
Sbjct  292   MEQTENEYAGGFPQAYNGRK---GGRRTPYLNSARNMSGGDVLPFHP-KAPAPYHQTGSR  347

Query  1965  GQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrsp  1786
             G    YPGR     H+  + +GR+   S  +  S++ +DK+   D   E + S+ D+ SP
Sbjct  348   GHHPSYPGRDSGTPHEERQMQGRSCDSSPHLTPSQNSQDKKFVDDVEEESTESMDDKLSP  407

Query  1785  lssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTA  1606
               +SP++ R  +E + E  D++     P Q       G+  + E       KD +V  + 
Sbjct  408   RVTSPITVRDARELSSEEKDDVE----PLQTEGSSRLGRDEMTENEEITNDKDGNVHHST  463

Query  1605  KKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA  1429
             +K K+SS +E+P+ Q+ D  EDSKAARSSENSK RSGSSKDY K  DG+EEEV QD+R  
Sbjct  464   RKQKVSSHVEQPALQQLDDEEDSKAARSSENSKARSGSSKDYQKWQDGVEEEVVQDRRST  523

Query  1428  HVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSI  1255
                  RQ   E E   QRK RD  +E E++  +++GREDSY  +  D S + H H K   
Sbjct  524   RSGSIRQHLDENEQNFQRKDRDVRREMERNCGVIRGREDSYPHRDLDPSLSRHLHMKHES  583

Query  1254  ADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRH  1075
              DRRKER+  D++WQ RD+D H R+ + ED RKREHGDE+ S+HR KIR+ +RS+++   
Sbjct  584   YDRRKERENPDISWQQRDEDPHSRKHRTED-RKREHGDEMGSRHRGKIRETERSDKDEHL  642

Query  1074  LLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDRE  895
               RKQL NGS R  HDKD  SRHRER+ D+LKSR++ +DD HSKRRK++  + RE+ D+E
Sbjct  643   HSRKQL-NGSYRIHHDKDGSSRHRERD-DNLKSRFEMVDDYHSKRRKDEEYVKREYADKE  700

Query  894   ETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSER  715
             E LH   + T  R+ ERDD   QR RD++             D  H  ++K+E   Q ER
Sbjct  701   EILHGHRENTSSRRHERDD--QQRIRDNL-------------DGYHSVKHKDEVWIQRER  745

Query  714   GERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDRE  535
             GER RER+E YR KQS +E L KRER+EGR   R GR  ++K+WAG +  KDEYK SD+E
Sbjct  746   GERQREREELYRVKQSSEENLPKREREEGRASARSGRLVDDKAWAGHAWAKDEYKVSDKE  805

Query  534   YHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAA  355
             Y  KD  R  EH KRR+R ++ S S HR  +D Y RG+Q S +ERR+R ER S+R D   
Sbjct  806   YQLKDTVRISEHQKRRDRMKDESLSHHRGHDDVYARGNQFSNEERRSRQERSSSRVDRTV  865

Query  354   YESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASETVC  205
               S S +VHEKK KEN  K+K  +  D  +  PS  N+++ +G+  ETV 
Sbjct  866   DTSVSQRVHEKKHKENPRKNKESDGGDHGTWGPSKRNQENLNGHGEETVL  915



>gb|KEH37869.1| Fip1 [V]-like protein [Medicago truncatula]
Length=1328

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/1012 (46%), Positives = 621/1012 (61%), Gaps = 71/1012 (7%)
 Frame = -1

Query  3210  LRIVLNDNNH---GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  3040
             L+IVLND+NH          +G D D+DDD+   LVIVA   +P+    +E+QEWG+   
Sbjct  157   LQIVLNDDNHMAMAMEKGGVVGDDDDEDDDEDGGLVIVAG--EPNQG--LEDQEWGESAN  212

Query  3039  NSADGERKE--DAAKVNVGPG-----YAPKIGYSNHGY-HHPYHSQFKYVRpgaapipga  2884
                DGERK+  +  K   GP        PK+GY NH + +HP+HSQFKY+RPGA  IPGA
Sbjct  213   IPVDGERKDAVEPGKPVAGPAAGGIPVVPKVGYGNHAHGYHPFHSQFKYIRPGATTIPGA  272

Query  2883  ppvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGR  2713
             P    GG PGQ+ P  N   + GRGRGDWRPPG+KGA+ MQKGF   PG  +WG+N +GR
Sbjct  273   PGAAQGGPPGQIRPLAN---MIGRGRGDWRPPGIKGAIGMQKGFHTGPGQPSWGNNAAGR  329

Query  2712  GIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLR  2539
             G G  L+FTLPSHKTIF+VDI+SF+EK W+   +D SDFFNFGLNEE+WKDYCKQLEQLR
Sbjct  330   GFGGGLEFTLPSHKTIFDVDIESFEEKLWKYPNVDASDFFNFGLNEETWKDYCKQLEQLR  389

Query  2538  LESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSI  2359
             LESTMQ KIRVYESGRTE +YDPDLPPELAAA G+ D   ENAN  K++VGQ+D+ +GS 
Sbjct  390   LESTMQSKIRVYESGRTEHDYDPDLPPELAAATGLHDGAVENANSVKSDVGQSDVMKGSG  449

Query  2358  RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQ--  2185
             R RPP+P GR IQVE G G+RLP+IDTRPPR+RDSDAIIEIV QG+ DDD+++  G Q  
Sbjct  450   RMRPPMPTGRAIQVEGGYGERLPTIDTRPPRLRDSDAIIEIVLQGAEDDDSSVGIGVQDQ  509

Query  2184  -----PSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRS  2023
                  P RE  R   E GD    +  + DG    YN  K+E   R+  F  S   + +  
Sbjct  510   SEDGEPQRESFREDVEAGDEPSLEPEYSDGIPQDYNRRKKEHAGRKMPFATSVSSNVANE  569

Query  2022  DRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQ  1843
             D  + +  +EP  Y   SRGQ     G   + + +  + +   R +S       SP  K 
Sbjct  570   DESLFVSQDEPIEYS-GSRGQNPRSYGGNSSSSQEERKMQKTVRSQSPI-----SPIRKL  623

Query  1842  IDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMERGKIS  1663
                DN++EDS+   + +    SS      V++S++E+ D   ++   A  +  + + +  
Sbjct  624   NTDDNKKEDSVESMEVKDTTLSSSPVIEDVKQSSLEDKDGELEDTGTADGSPRLGKKETD  683

Query  1662  VDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKD  1483
             ++     D  KD   ID  KK  L+SQ+E+P   E+D  ED KAARSS+NSK RS SS+D
Sbjct  684   LNAVDKVDVLKDG--ID--KKQNLTSQVEQPLLDESDDWEDIKAARSSDNSKARSASSRD  739

Query  1482  YHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRKGRDEKE-TEKHRMIVKGREDSY  1312
               K  +GL+EE VQD R   +   RQ   E E    RK  D K+  E++ M+++GRE SY
Sbjct  740   NQKRREGLDEEVVQDPRSTRLASIRQHPDENEQGFYRKEHDGKQDPERNHMVLRGREGSY  799

Query  1311  MRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIE  1132
               K    S AH  HT T   DR+K+RD SD+ W  RDDD++ R+ +  + RKR+      
Sbjct  800   PYKDRHRSLAHQLHTNTDGFDRQKDRDSSDMDWARRDDDVYNRKVRTNEPRKRD------  853

Query  1131  SKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNID  958
                R K+R+ +R+++E     RKQLDNGS R  ++KD  SR  R RERD+ ++ RY+ ++
Sbjct  854   ---RAKLRENERNDKEDSFHSRKQLDNGSYRIPYEKDVGSRDSRHRERDEGVRVRYEAVE  910

Query  957   DRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQR  778
             D H KRRK++  L REH+D+EE  H   +   RR+RERD++  QR RD            
Sbjct  911   DYHIKRRKDEEYLRREHMDKEEIPHGYRENASRRRRERDEV--QRSRD------------  956

Query  777   LREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAA  598
                DDQ+  R K++     ERG+R R+R+EW+R K SHD  L KRER+EGR   R  R A
Sbjct  957   -YPDDQYTNRQKDDAWLMQERGDRQRDREEWHRLKLSHDGPLPKREREEGRSSGRNVRGA  1015

Query  597   EEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQ  418
             EEK+W G    KDE+K S+++Y S+++ RH + LKRR+R    S S H+ R+D Y RG+Q
Sbjct  1016  EEKAWVGRVSAKDEHKLSEKDYQSRESVRHNDQLKRRDRIPEES-SHHKGRDDAYSRGNQ  1074

Query  417   PSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSL  262
              + +ERR+R ER S+R D  A  SD+ ++HE+K KE S K K  + SD NSL
Sbjct  1075  YTAEERRSRQERSSSRSDRVANASDNQRLHERKHKEGSRKSKERDISDLNSL  1126



>gb|KHN35290.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine soja]
Length=1125

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/990 (47%), Positives = 613/990 (62%), Gaps = 100/990 (10%)
 Frame = -1

Query  3072  VEEQEWGDELGNSA-DGERKEDA---AKVNVGPGYAPKIGYSNHGYHHPYHSQFKY--VR  2911
              +E EWG+    +A DG+RK+ A   AKV  G    PKIGYSNHGYH P+HS FKY  VR
Sbjct  12    TDEPEWGENAALAAGDGDRKDAAGELAKVG-GAAVPPKIGYSNHGYH-PFHSPFKYQYVR  69

Query  2910  pgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF---PGYN  2740
             PGAA +PGA    PGG PGQ+ P  N   +AGRGRG+WRPPG+KG   MQKGF   PG  
Sbjct  70    PGAALMPGAAASAPGGPPGQIRPLAN---MAGRGRGEWRPPGIKGGAAMQKGFHAGPGLP  126

Query  2739  AWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKD  2566
              WGS+ +GRG G  L+FTLPSHKTIF+V+I++F+EKPW+   +D+SDFFNFGLNEESWKD
Sbjct  127   GWGSSAAGRGFGGGLEFTLPSHKTIFDVEIENFEEKPWKYPNVDISDFFNFGLNEESWKD  186

Query  2565  YCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVG  2386
             YCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPELAAA GI D+P E+ N  K++VG
Sbjct  187   YCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPELAAATGIHDVPGEHTNSLKSDVG  246

Query  2385  QNDLARGS--IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
             Q+D+ +GS   R RPPLP GR IQVE G GDRLPSIDTRPPR+RDSDAIIEIV Q + DD
Sbjct  247   QSDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDTRPPRIRDSDAIIEIVLQDTEDD  306

Query  2211  DNNL------EQGNQPSREGIR----GGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRR  2062
             +++        +   P RE  R     GDEI  L+ +   + DGF   YNG K+E   RR
Sbjct  307   ESSAGIAQDPPESGDPHREDFREDHVAGDEIPRLEPK---YFDGFPQDYNGRKKEIAGRR  363

Query  2061  AEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCR  1885
               F NS   +    D  +  P EEP  Y   SRGQ     G   + +HD  + + R R +
Sbjct  364   MPFINSCAANMPNGDEKLFFPQEEPIEYS-GSRGQNRRNYGGNFSSSHDERQMQRRVRGQ  422

Query  1884  SA------DIGASESPKDKQID-VDNRREDSLSVGDrrsplssspvsnrsVQESAVENND  1726
             S       ++    S K++  + ++ R   S +V D                ES+VE  D
Sbjct  423   SPPIIPIQELATDNSQKEESAESMEGRHRSSPAVKDVG--------------ESSVEYKD  468

Query  1725  NLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQET-DG  1549
                ++   A  +S +E+ + +VD     D  +D      AK+ K++SQ+E P P E  D 
Sbjct  469   IELEDTETADGSSRLEKEE-TVD---RVDTLED----GVAKRQKVTSQVEPPLPDEVDDD  520

Query  1548  GEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-EDRLQRK  1375
              EDSKAA+SS+NSK RS SS+D  K  +G EEE VQD + AH+   RQ   E E    ++
Sbjct  521   WEDSKAAKSSDNSKARSASSRDNQKRQEGFEEEVVQDPQSAHLSSIRQHPDEIEPGFYKR  580

Query  1374  GRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDD  1198
               D K E E++RM++KGRE SY  K    SSA   H  T   D +KERD S++ W  RDD
Sbjct  581   EHDAKQEPERNRMMLKGRERSYPYKDRHPSSAPQLHANTDGFDGQKERDNSEMDWARRDD  640

Query  1197  DLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDA  1018
             DL+ RR + ++ RKR+         R K+R+ +R+++E     RKQLDNGS R  ++KD 
Sbjct  641   DLYNRRVRNDEPRKRD---------RAKVRENERNDKEDSLHSRKQLDNGSYRVLYEKDV  691

Query  1017  VSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRER  844
              SR  R RERD+ L+ RY+ ++D   KRRK++  L REH+D+EE LH   +   RR+RER
Sbjct  692   GSRDSRHRERDEGLRIRYEAVEDYRGKRRKDEEYLRREHIDKEEVLHGYRENASRRRRER  751

Query  843   DDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSH  664
             D++ D RKRDD+  QR RD+     DDQ+  R K++     ERG+R R+R+EW+R KQSH
Sbjct  752   DEVLDPRKRDDL--QRARDNP----DDQYATRQKDDAWVPRERGDRQRDREEWHRMKQSH  805

Query  663   DEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRE  484
             +E L KRER+EGR  +R GR A             E+K S++EY S++A R  + LKRR+
Sbjct  806   EEHLPKREREEGRSSVRSGRGA-------------EHKLSEKEYQSREAMRQNDQLKRRD  852

Query  483   RDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENS  304
             R ++ SP  H+ R+D   RG+Q +T+ERR+R ER S+R D  A  SD+ KV   K +E S
Sbjct  853   RIQDESP-HHKGRDDASARGNQYTTEERRSRQERSSSRSDRVANFSDNQKV---KHREGS  908

Query  303   TKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
              K K  + SD NSL  S  +++++ G  +E
Sbjct  909   RKSKERDVSDLNSLGLSKRSQENQIGPTNE  938



>ref|XP_006598040.1| PREDICTED: uncharacterized protein LOC100799266 [Glycine max]
Length=1304

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/1058 (47%), Positives = 645/1058 (61%), Gaps = 94/1058 (9%)
 Frame = -1

Query  3294  IPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPL  3115
             IPG++G  E       + +      +DDL+IVLN+NNH  M    M    ++++D  + L
Sbjct  123   IPGLTG--ELAAPTEGEGDDWDSDSEDDLKIVLNENNHMAMERGGMADGDEEEEDGDEEL  180

Query  3114  VIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDAAKVNVGPGYA--PKIGYSNHGYH  2944
             VIVA  D P+     EE EWG+    +A DGERK+ A ++    G A  PKIGYSN GYH
Sbjct  181   VIVAGGD-PNQG--AEEPEWGENATLAAGDGERKDAAGELAKAGGAAVPPKIGYSNQGYH  237

Query  2943  HPYHSQFKY--VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGAL  2770
              P+HS FKY  VRPGAA +PGA    PGG PGQ+ P  N   +AGRGRGDWRPPG+KG  
Sbjct  238   -PFHSPFKYQYVRPGAALMPGAAASAPGGPPGQIRPLAN---MAGRGRGDWRPPGIKGGA  293

Query  2769  TMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSD  2605
              MQKGF   PG   WG+  +GRG G  L+FTLPSHKTIF+VDI++F+EKPW+   ID SD
Sbjct  294   AMQKGFHAGPGLPGWGNGAAGRGFGGGLEFTLPSHKTIFDVDIENFEEKPWQYPNIDTSD  353

Query  2604  FFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDI  2425
             FFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQEYDPDLPPELAAA GI D 
Sbjct  354   FFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQEYDPDLPPELAAATGIHDS  413

Query  2424  PSENANLGKTEVGQNDLARGS--IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSD  2251
             P EN N  K++VGQ+D+ +GS   R RPPLP GR IQVE G GDRLPSIDTRPPR+RDSD
Sbjct  414   PVENTNSLKSDVGQSDVMKGSGTGRVRPPLPTGRAIQVEGGYGDRLPSIDTRPPRIRDSD  473

Query  2250  AIIEIVCQGSADDDNNL------EQGNQPSREGIR----GGDEIGDLQQEDIHHVDGFQH  2101
             AIIEIV Q + DD ++        +G +P RE  R     GDEI  L+ E   + DGF  
Sbjct  474   AIIEIVLQDTEDDQSSAGVAQDPPEGGEPHREDFREDHVAGDEIPRLEPE---YFDGFPQ  530

Query  2100  AYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVA  1924
              YNG K+E   RR  F NS   +    D  +  P EEP  Y   S+GQ     G   + +
Sbjct  531   VYNGRKKEIAGRRMSFINSSAANMPNGDEKLFFPQEEPIEYS-GSKGQNRRSYGGNCSSS  589

Query  1923  HDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQES  1744
             HD  + + R   +S  I    +P  +    ++ +E+S    +       S  + + ++ES
Sbjct  590   HDERQMQRRVGGQSPSI----TPIQELATDNSLKEES---AESMEGRHRSSPAVKDIRES  642

Query  1743  AVENND-NLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVID-TAKKHKLSSQLEEP  1570
             +VE  D  L D        +G   G   +++    DK   D++ D  AK+ KL+S++E P
Sbjct  643   SVEEKDIELED--------TGTADGSSRLEKEETVDKV--DALEDGVAKRQKLTSRVEPP  692

Query  1569  SPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-VQDKRFAHVDDTRQTGGE-  1396
                E D  EDSKAA+SS+NSK RS SS+D  K  +G EEE VQD R A +   RQ   E 
Sbjct  693   LLDEVDDWEDSKAAKSSDNSKARSASSRDNQKRREGFEEEVVQDPRSAQLSSIRQHPDEI  752

Query  1395  EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDV  1219
             E    R+  D K E  ++ M++KGRE  Y  K    SSA   +T     D +KERD S++
Sbjct  753   EQGFYRREHDAKQEPGRNLMMLKGRERPYPYKDRHPSSATQLNTNADGFDGQKERDNSEM  812

Query  1218  AWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLR  1039
              W  RDDDL+ RR + ++ RKR+         R K+R+ +++++E     RKQLDNGS R
Sbjct  813   DWSRRDDDLYNRRVRNDEPRKRD---------RAKVRENEKNDKEDSLHSRKQLDNGSYR  863

Query  1038  PDHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHS-RGDG  868
               ++KD  SR  R+RERD+ L+ RY+ ++D   K+RK++  L REH+D+EE LH  R   
Sbjct  864   VSYEKDVGSRDSRQRERDEGLRIRYEAVEDYRGKKRKDEEYLRREHIDKEEVLHGYREIA  923

Query  867   TLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDE  688
             + RR+RERD++ D RKRDD+  QR RD+     DDQ+  R K+E     ERG+R R+R+E
Sbjct  924   SSRRRRERDEVLDPRKRDDL--QRARDNP----DDQYATRQKDEAWVLKERGDRQRDREE  977

Query  687   WYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRH  508
             W R KQSH+E L KRER EGR  +R GR A             E+K S++EY S++A RH
Sbjct  978   WCRMKQSHEEHLPKRER-EGRSSVRSGRGA-------------EHKLSEKEYQSREAMRH  1023

Query  507   VEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVH  328
              + LKRR+R ++ SP  H+ R+D   RG+Q +T+ERR+R ER S+R D  A  SD+ KV 
Sbjct  1024  NDQLKRRDRIQDESP-HHKGRDDASARGNQYTTEERRSRLERSSSRSDRVANVSDNQKV-  1081

Query  327   EKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
               K +E S K K  + SD NSL  S  +++++SG  +E
Sbjct  1082  --KHREGSRKSKERDVSDLNSLGLSKRSQENQSGPTNE  1117



>ref|XP_007154905.1| hypothetical protein PHAVU_003G157600g [Phaseolus vulgaris]
 gb|ESW26899.1| hypothetical protein PHAVU_003G157600g [Phaseolus vulgaris]
Length=1243

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/972 (44%), Positives = 583/972 (60%), Gaps = 90/972 (9%)
 Frame = -1

Query  3072  VEEQEWGDELGNSADGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapi  2893
             VEE++WG+      DGE+K+    V      APKIGYSN GYHHP+HSQFKYVR GA  I
Sbjct  144   VEERDWGENSTQPVDGEKKDVGESVK---AVAPKIGYSNQGYHHPFHSQFKYVRTGAVSI  200

Query  2892  pgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGR  2713
             P A    PGG   Q+ P  N + VAG GRGDWRP G+KGA  MQKGF      GS    R
Sbjct  201   PAATSSTPGGPLSQIRPLANMNPVAGHGRGDWRPAGIKGAAAMQKGFQA----GSGVPMR  256

Query  2712  GIG---------LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYC  2560
             G G         L+F LPS KTIF+V IDSF+EKPW+  G+D+SDFFNFGLN+++WKDYC
Sbjct  257   GHGAAGRGFGGGLEFVLPSQKTIFDVQIDSFEEKPWKYPGVDVSDFFNFGLNDDTWKDYC  316

Query  2559  KQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQN  2380
             KQLEQLRLESTMQ KI VYE GRTEQ+YDPDLPPELAAA+G + +P  NAN  K++VGQN
Sbjct  317   KQLEQLRLESTMQSKIHVYERGRTEQDYDPDLPPELAAASG-RHVPVNNANYVKSDVGQN  375

Query  2379  DLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL  2200
             D+ +GS   RPP+P GR IQVESGSGDRLPSIDTRPPR+RDSDAIIEIV Q  ADDD+N 
Sbjct  376   DIIKGSGPMRPPIPTGRAIQVESGSGDRLPSIDTRPPRIRDSDAIIEIVLQDPADDDSNA  435

Query  2199  EQGNQPSREGIRGGDEIGDLQQEDIH--HVDGFQ------HAYNGWKREF-GSRRAEFNS  2047
             +   Q  +EG       G+ Q++D    H+ G++        +NG KRE  G R     +
Sbjct  436   KVDVQDQQEG-------GEPQRKDFSDDHLSGYEIPRLESKYFNGQKRELIGRRMPNMKA  488

Query  2046  GPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGA  1867
              P           +P E  D   P  +G+T  Y         DS + +G A  +S     
Sbjct  489   SP---------TSIPVE--DENLPFPQGKTMDY--------SDSRKMQGSACDQSPRFTG  529

Query  1866  SESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNS  1687
             S+    +   VDN++E+S+   + R     S  +   V+ES+++NN    +E   A   S
Sbjct  530   SQ----EVTIVDNKKEESVESMEGRHSAHLSFPAVVDVKESSIQNNQ--LEETGTADGTS  583

Query  1686  GMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSK  1507
              +E+G I ++   + D  KD      A++ K++SQ+E+P   +    EDSK+ RSS+NSK
Sbjct  584   RLEKGDIDLNAVDDRDTIKD----GVAEREKITSQVEQPLLGDGSDWEDSKSVRSSDNSK  639

Query  1506  TRSGSSKDYHKLHDGLEEEVQDKRFAHVDDTR-QTGGEEDRLQRKGRD-EKETEKHRMIV  1333
              +S SS+DYHK  DG  E VQD +  H+   + Q+   E    R+  D  K+TE +  ++
Sbjct  640   AKSESSRDYHKQWDGF-EVVQDPQSVHLGSIKMQSDDNELVFHRREHDGGKKTETNGTVI  698

Query  1332  KGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKR  1153
             K RE+SY  K    SS+H SH +    D +++R  SD+ W+ R+DDL+G+R K ++ RKR
Sbjct  699   KSRENSYPHKERLPSSSHPSHLRIDGFDSQRDRVSSDMDWERRNDDLYGKRIKHDEPRKR  758

Query  1152  EHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDA---VSRHRERERDDL  982
             + G         ++R+ +RS+ +     RKQLDNGS R  +DKD    VSRH+ER+ D L
Sbjct  759   DRG---------RVRENERSDNDDTFRSRKQLDNGSYRVPYDKDIRSRVSRHKERD-DSL  808

Query  981   KSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISD  802
             K +++ ++D  +KRRK +  L REHV +E     R +   R K E+D + D RKRDD   
Sbjct  809   KDKHEALEDFRNKRRKNEEYLRREHVAKEVARGYR-ENVSRHKPEKDSVLDPRKRDD--H  865

Query  801   QRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRG  622
             QR RDD     D Q+ AR K E     ERG R R+R+EW++ KQS +E   KRER  GR 
Sbjct  866   QRNRDDL----DVQYAARQKNEAWLLRERGNRKRDREEWHQVKQSREEHPLKRERG-GRD  920

Query  621   GLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSRE  442
              +R GR AE+K   GL R KDE+K S++EY  ++A RH + LK  ++ +  SP R +  +
Sbjct  921   SVRSGRGAEDKISTGLVRVKDEHKVSEKEYQHREAMRHSDQLKTADQIKGESPHR-KGHD  979

Query  441   DGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSL  262
             D Y RG+Q +++ERR++ E+ S+R   A    ++ +VHE+KR E S K K P A    SL
Sbjct  980   DAYFRGNQYNSEERRSKEEKSSSRGYCATNSLETQRVHERKRDEGSRKSKEPIA---GSL  1036

Query  261   LPSNLNEDDRSG  226
               SN + + +SG
Sbjct  1037  GTSNKSPEAQSG  1048



>gb|KHN04414.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine soja]
Length=1050

 Score =   570 bits (1470),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 421/896 (47%), Positives = 552/896 (62%), Gaps = 80/896 (9%)
 Frame = -1

Query  2823  VAGRGRGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVD  2659
             +AGRGRGDWRPPG+KG   MQKGF   PG   WG+  +GRG G  L+FTLPSHKTIF+VD
Sbjct  22    MAGRGRGDWRPPGIKGGAAMQKGFHAGPGLPGWGNGAAGRGFGGGLEFTLPSHKTIFDVD  81

Query  2658  IDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQE  2479
             I++F+EKPW+   ID SDFFNFGLNEESWKDYCKQLEQLRLESTMQ KIRVYESGRTEQE
Sbjct  82    IENFEEKPWQYPNIDTSDFFNFGLNEESWKDYCKQLEQLRLESTMQSKIRVYESGRTEQE  141

Query  2478  YDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGS--IRSRPPLPAGRPIQVESGS  2305
             YDPDLPPELAAA GI D P EN N  K++VGQ+D+ +GS   R RPPLP GR IQVE G 
Sbjct  142   YDPDLPPELAAATGIHDSPVENTNSLKSDVGQSDVMKGSGTGRVRPPLPTGRAIQVEGGY  201

Query  2304  GDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQPSREGIR----GGD  2155
             GDRLPSIDTRPPR+RDSDAIIEIV Q + DD ++        +G +P RE  R     GD
Sbjct  202   GDRLPSIDTRPPRIRDSDAIIEIVLQDTEDDQSSAGVAQDPPEGGEPHREDFREDHVAGD  261

Query  2154  EIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSGPYDKSRSDRVVILPSEEPDSYH  1978
             EI  L+ E   + DGF   YNG K+E   RR  F NS   +    D  +  P EEP  Y 
Sbjct  262   EIPRLEPE---YFDGFPQVYNGRKKEIAGRRMSFINSSAANMPNGDEKLFFPQEEPIEYS  318

Query  1977  PDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQIDVDNRREDSLSVGD  1798
               S+GQ     G   + +HD  + + R   +S  I    +P  +    ++ +E+S    +
Sbjct  319   -GSKGQNRRSYGGNCSSSHDERQMQRRVGGQSPSI----TPIQELATDNSLKEES---AE  370

Query  1797  rrsplssspvsnrsVQESAVENND-NLHDELVPAQRNSGMERGKISVDERTNCDKAKDDS  1621
                    S  + + ++ES+VE  D  L D        +G   G   +++    DK   D+
Sbjct  371   SMEGRHRSSPAVKDIRESSVEEKDIELED--------TGTADGSSRLEKEETVDKV--DA  420

Query  1620  VID-TAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEE-V  1447
             + D  AK+ KL+S++E P   E D  EDSKAA+SS+NSK RS SS+D  K  +G EEE V
Sbjct  421   LEDGVAKRQKLTSRVEPPLLDEVDDWEDSKAAKSSDNSKARSASSRDNQKRREGFEEEVV  480

Query  1446  QDKRFAHVDDTRQTGGE-EDRLQRKGRDEK-ETEKHRMIVKGREDSYMRKGYDsssahhs  1273
             QD R A +   RQ   E E    R+  D K E  ++ M++KGRE  Y  K    SSA   
Sbjct  481   QDPRSAQLSSIRQHPDEIEQGFYRREHDAKQEPGRNLMMLKGRERPYPYKDRHPSSATQL  540

Query  1272  HTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRS  1093
             +T     D +KERD S++ W  RDDDL+ RR + ++ RKR+         R K+R+ +++
Sbjct  541   NTNADGFDGQKERDNSEMDWSRRDDDLYNRRVRNDEPRKRD---------RAKVRENEKN  591

Query  1092  EREGRHLLRKQLDNGSLRPDHDKDAVSR-HRERERDD-LKSRYDNIDDRHSKRRKEDTKL  919
             ++E     RKQLDNGS R  ++KD  SR  R+RERD+ L+ RY+ ++D   K+RK++  L
Sbjct  592   DKEDSLHSRKQLDNGSYRVSYEKDVGSRDSRQRERDEGLRIRYEAVEDYRGKKRKDEEYL  651

Query  918   SREHVDREETLHS-RGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYK  742
              REH+D+EE LH  R   + RR+RERD++ D RKRDD+  QR RD+     DDQ+  R K
Sbjct  652   RREHIDKEEVLHGYREIASSRRRRERDEVLDPRKRDDL--QRARDNP----DDQYATRQK  705

Query  741   EEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGK  562
             +E     ERG+R R+R+EW R KQSH+E L KRER EGR  +R GR A            
Sbjct  706   DEAWVLKERGDRQRDREEWCRMKQSHEEHLPKRER-EGRSSVRSGRGA------------  752

Query  561   DEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNER  382
              E+K S++EY S++A RH + LKRR+R ++ SP  H+ R+D   RG+Q +T+ERR+R ER
Sbjct  753   -EHKLSEKEYQSREAMRHNDQLKRRDRIQDESP-HHKGRDDASARGNQYTTEERRSRLER  810

Query  381   VSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
              S+R D  A  SD+ KV   K +E S K K  + SD NSL  S  +++++SG  +E
Sbjct  811   SSSRSDRVANVSDNQKV---KHREGSRKSKERDVSDLNSLGLSKRSQENQSGPTNE  863



>emb|CBI36522.3| unnamed protein product [Vitis vinifera]
Length=824

 Score =   559 bits (1440),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 384/733 (52%), Positives = 473/733 (65%), Gaps = 48/733 (7%)
 Frame = -1

Query  3369  MGRSENCESSVVEAGGSEHMIPG-VSIP-GVS-----GVPETCG---------------D  3256
             +G S+NC +  +E GGS  +  G V +P G S     GV    G               D
Sbjct  88    VGGSKNCAADSLELGGSRVLESGDVKLPDGASEDDKSGVDAGRGLEPQNREKTNVVARDD  147

Query  3255  RAVdeewdsdsdddDLRIVLNDNNHGPmgmd-rmggdgddddddgDPLVIVANSDDPSHQ  3079
              +V  +      +DDL+IVLNDNNHGPM  +       DD+D+DGDPLVIVA+ D  +H 
Sbjct  148   ASVQGDDWDSDSEDDLQIVLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THP  206

Query  3078  PMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpg  2905
             P+ EEQEWG++   + DGERKE  DAAKVN      PKIGYS+HGYH P+HSQFKYVRPG
Sbjct  207   PL-EEQEWGED--TAVDGERKEGADAAKVNGAIAGPPKIGYSSHGYH-PFHSQFKYVRPG  262

Query  2904  aapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---GYNAW  2734
             AAPIPGA  V PGGTPGQV P  N   V GRGRGDWRP G+K A  MQK F    G  AW
Sbjct  263   AAPIPGAAAVVPGGTPGQVRPLANIGPVPGRGRGDWRPAGIKNAPPMQKNFHSGFGAPAW  322

Query  2733  GSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYC  2560
             G N +GRG G  L+FTLPSHKTIF+VDIDSF+EKPWR  G+D+SDFFNFG NEESWK YC
Sbjct  323   GGNMAGRGFGGGLEFTLPSHKTIFDVDIDSFEEKPWRHPGVDISDFFNFGFNEESWKQYC  382

Query  2559  KQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQN  2380
             KQLEQLRLE+TMQ KIRVYESGRTEQEYDPDLPPELAAA GI D+ +EN NLG+ +VG +
Sbjct  383   KQLEQLRLEATMQTKIRVYESGRTEQEYDPDLPPELAAAVGIHDVSAENGNLGRADVGPS  442

Query  2379  DLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL  2200
             DLA+ S R RPP+P GR IQVE G G+RLPS+DTRPPRVRDSDAIIEI  QGS DDD+  
Sbjct  443   DLAKASARVRPPIPTGRAIQVEGGCGERLPSVDTRPPRVRDSDAIIEITLQGSLDDDSPT  502

Query  2199  EQG------NQPSREGIRGGDEI-GDLQQEDIHHVDGFQHAYNGWKREFGSRRAEF-NSG  2044
               G      N   RE +R G+E+  D  QED  + D F   Y+G  RE   R A F NS 
Sbjct  503   GNGAPEPPDNDLPREDLRVGNEVEDDAAQEDTEYFDSFSTTYSGRNRELVGRSAPFMNSL  562

Query  2043  PYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGAS  1864
               D    D ++  P E P  Y P SRGQ  V+PG      H+  R +GRA  +S  +   
Sbjct  563   RDDMPGGDGILPFPPEAPVQYRPGSRGQDPVHPGGNFGTPHEDRRIRGRAHGKSPHMTPI  622

Query  1863  ESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSG  1684
             +S +D +  +D+++E+S+   D    ++SSPV     +E +VE  D L   +V A   SG
Sbjct  623   QSTRDNRF-LDSQKEESVESMD-VKGMTSSPVRVAPPREPSVEKKDALDGGIVLADGTSG  680

Query  1683  MERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKT  1504
             MER +++ +  T+ D  KD+++I   KK KLSS++E+P PQE DG ED KA RSSENSK 
Sbjct  681   MEREELTSNTMTSTDALKDENLIPFGKKQKLSSRVEQPPPQELDGDEDLKATRSSENSKA  740

Query  1503  RSGSSKDYHKLHDGLEEEV-QDKRFAHVDDT-RQTGGEEDRLQRKGRD-EKETEKHRMIV  1333
             RS SS+D  K HDG EEEV +D     + ++ R    +E   +RK RD  +E E+ RM+V
Sbjct  741   RSESSRDLQKWHDGGEEEVIEDGSSVRMGNSKRHLDEDEQSFRRKDRDGRQEMERSRMVV  800

Query  1332  KGREDSYMRKGYD  1294
             KGRED+Y  + +D
Sbjct  801   KGREDTYPHRDWD  813



>ref|XP_008790389.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103707618 
[Phoenix dactylifera]
Length=1258

 Score =   513 bits (1321),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 418/1026 (41%), Positives = 585/1026 (57%), Gaps = 73/1026 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGP---mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--  3046
             L+IVLNDN HGP      DR+G + DDD+D  + LVIV + D   H P +EEQ+WG E  
Sbjct  49    LQIVLNDN-HGPLGGERNDRVGDEEDDDEDGEEDLVIVTDEDQHHHLPAMEEQDWGGEEA  107

Query  3045  LGNSADGERK-EDAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKYVRpgaapipgappv  2875
             +  S DGE++  DAAK N   G AP  +IGYSNHG+H  +HS +KY+RPG AP+ G P  
Sbjct  108   IQPSGDGEKEMADAAKGNCPAGTAPAARIGYSNHGFHVQHHSTYKYIRPGVAPMSGGPSG  167

Query  2874  gpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAW----GSNPSGRGI  2707
             G  G  G V PP+     AGRGRGDWRP G +G     K F  + A     GS     G 
Sbjct  168   GAVGPAGHVRPPLPLGPTAGRGRGDWRPAGGRGIPNASKSFHSFGATSRSNGSLVRAIGS  227

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GLDFTLP+HKTIF++DI+SF+EKPWR  G+D+SDFFNFGL+E+ WKDYCKQL+QLRLE+T
Sbjct  228   GLDFTLPAHKTIFDIDIESFEEKPWRHPGVDISDFFNFGLDEDKWKDYCKQLDQLRLEAT  287

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLA---RGSIR  2356
             MQ KIRVYESGR+EQ YDPDLPPELAAAAG  DI   + + G+ + GQ D +   RG+  
Sbjct  288   MQSKIRVYESGRSEQGYDPDLPPELAAAAGHHDISVHSGHHGRADNGQTDFSSQGRGAAN  347

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD----DNNLEQGN  2188
              R  +P GR IQVESG G+RLPSIDTR PRVRDSDAIIEIV Q   +D    D+ LEQ  
Sbjct  348   IRALIPTGRAIQVESGHGERLPSIDTRTPRVRDSDAIIEIVLQDPINDPTMNDSALEQAE  407

Query  2187  QPSR-EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVV  2011
             +  + E  +G  E  D +     + + F HA +G KRE   R      GP+   +     
Sbjct  408   KDLQGEHYKGVHEFEDERLVASAYDNRFPHASSGRKREMTGR------GPFTPEQGG---  458

Query  2010  ILP--SEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCR--------SADIGASE  1861
             ILP  SE    Y+ +S+ ++  Y G      H     +G +R R        S D   S+
Sbjct  459   ILPFRSEVHGCYNSNSKSRSPAYSGGSFEGHHAGRLPQGTSRSRHSSASGEHSNDAIPSQ  518

Query  1860  SPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGM  1681
             S    +   D+++   +             V+  + +E ++E   + HDE +    +  +
Sbjct  519   SAHSNK-HGDHQKGKLIDSAKVNQISEVPAVAVETARELSIEQKYDEHDEKLALGDSIEV  577

Query  1680  ERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTR  1501
             E   I+ D   + +   DD+++   KK KLSS++E+P   +T G ED      S+N + +
Sbjct  578   EGEDITSDFHISSETVGDDNLVSPGKKQKLSSRVEQPVVNDT-GDEDELRTSHSDNGRAK  636

Query  1500  SGSSKDYHKLHDGLEEEVQDKRFAHVDDTRQTG-GEEDRLQRK---GRDEKE-TEKHRMI  1336
             +GSSKDY K  +  +E +QD R   + D R+   GEE  L+RK   GRD ++  +++R+ 
Sbjct  637   TGSSKDYQKRRENGDEVMQDGRSRRMGDIRRHNEGEEHILRRKDAYGRDARQDIDRNRVA  696

Query  1335  VKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRK  1156
              K RED+Y   G+       +H     +  R +   S  AWQ R +++H RR K ED R 
Sbjct  697   SKEREDTYRSSGHRDWDPISAHPIRGRSFERPKDSSSISAWQRRGEEIHSRRVKGEDIR-  755

Query  1155  REHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKS  976
             RE  +   S+HR K+R  DR++R+     RK++D+G  R   ++D  SR RER  D L +
Sbjct  756   RERSEGAGSRHRGKVRGSDRNDRDEDLHSRKRVDDGDWR-GRNRDGASRQRERN-DILIN  813

Query  975   RYDNIDDRHSKRRKEDTKLSREHVDREETLH---SRGDGTLRRKRERDDISDQRKRDDIS  805
             R +N+DD H+KR+K++    R   D+E+ LH   +R D + RRKRERD        D I 
Sbjct  814   RRENLDDFHNKRKKDEEVSRRGKTDKEDALHGYRAREDSS-RRKRERD--------DGID  864

Query  804   DQRKRDDQRLR--EDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDE  631
              +RK D  RLR   +D   A+ K++         RHRER++  + +Q H+   + RER+E
Sbjct  865   HKRKEDSTRLRGKAEDHQSAKPKDDNW-------RHREREDRQQLRQPHENAPTHREREE  917

Query  630   GRGGLRVGRAAEEKSWAGLSRGKDEYK--GSDREYHSKDAGRHVEHLKRRERDENGSPSR  457
             GRG  R  RA E+KS AG  R KDE K  GSD++Y  KD  RH E  +R +     + S+
Sbjct  918   GRGVARSSRAIEDKSLAGNGRNKDELKLIGSDKDYQDKDRRRHNELSRRGDFTGEENVSQ  977

Query  456   HRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEAS  277
             H+ R D +    Q + +ER +R ER+S   D     SDS +++ ++ +EN+ K +  EA+
Sbjct  978   HKGRGDAHAHEKQHNNEERSSRYERLSIHNDRHPSASDSQQMYRERHRENTRKVRESEAN  1037

Query  276   DKNSLL  259
             ++N+ +
Sbjct  1038  EQNNQV  1043



>ref|XP_010939301.1| PREDICTED: FIP1[V]-like protein isoform X3 [Elaeis guineensis]
Length=1232

 Score =   511 bits (1315),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 435/1063 (41%), Positives = 610/1063 (57%), Gaps = 85/1063 (8%)
 Frame = -1

Query  3294  IPGVSGVPETCGD---------RAVdeewdsdsdddDLRIVLNDNN--HGPmgmdrmggd  3148
             IPG+S  P   G          +A   E      +DDL+IVLNDN+   G    DR G +
Sbjct  184   IPGLSAGPAPPGPFLDMDGGDVKASRSEDWDTDSEDDLQIVLNDNHVPLGGERNDRGGDE  243

Query  3147  gddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNSADGERKE--DAAKVNVGPGYA  2977
              DDD+D  + LVIV + D   H P +EEQ+WG+E +  + DGERKE  D AK N   G A
Sbjct  244   DDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQPAGDGERKEMADVAKGNGPAGTA  303

Query  2976  P--KIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRG  2803
             P  +IGYS+HG+   +HS +KY+RPGA P+ G P  G  G PGQV PP+   L AGRGRG
Sbjct  304   PAARIGYSSHGFSMQHHSTYKYIRPGAVPVSGGPSGGAVGPPGQVRPPLPLGLAAGRGRG  363

Query  2802  DWRPPGMKGALTMQKGFPGYN--AW--GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKP  2635
             DWRP G +G     K F  +   AW  GS+    G GLDFTLP+HKTIF+VDI+SF+EKP
Sbjct  364   DWRPAGGRGIPNAPKSFHSFGGPAWSNGSSVRAFGSGLDFTLPAHKTIFDVDIESFEEKP  423

Query  2634  WRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPE  2455
             WR  G+D+SDFFNFGL+E+ WKDYCKQL+QLRLE+TMQ KIRVYESGR+EQEYDPDLPPE
Sbjct  424   WRHPGVDISDFFNFGLDEDKWKDYCKQLDQLRLEATMQSKIRVYESGRSEQEYDPDLPPE  483

Query  2454  LaaaAGIQDIPSENANLGKTEVGQNDL---ARGSIRSRPPLPAGRPIQVESGSGDRLPSI  2284
             LAAAAG  DI ++N   G+ +  Q D      G+   R P+P GR IQVESG G+R PSI
Sbjct  484   LAAAAGHHDISADNGYHGRADNRQTDFNSQGSGAANIRVPIPTGRAIQVESGYGERQPSI  543

Query  2283  DTRPPRVRDSDAIIEIVCQGSADD----DNNLEQGNQPSR-EGIRGGDEIGDLQQEDIHH  2119
             DTR PR+RDSDAIIEIV Q S DD    D  +E+  +  + E  +GG E  D +     H
Sbjct  544   DTRQPRLRDSDAIIEIVLQDSMDDPAMNDGAVEKPEKDLQGEHYKGGHEFEDERHVTSEH  603

Query  2118  VDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGR  1939
              +   H+ +G KRE   R      GP+     D ++ +PSE    +H +S+ ++ VY   
Sbjct  604   DNRNPHSLSGRKREMAGR------GPF-APDEDGILPIPSEAHGRHHSNSKSRSPVYSSG  656

Query  1938  KHAVAHDSTREKGRARCR--------SADIGASESPKDKQIDVDNRREDSLSVGDrrspl  1783
                   D+   +G ++ R        S D+  S+S   K+ D D+++E  L   D     
Sbjct  657   SFGGNRDARLARGTSQGRHSSASGEPSNDVVPSQSAHSKRHD-DHQKEKLL---DSTEVN  712

Query  1782  ssspvsnrsVQESAVE---NNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVID  1612
              +S VS     E+A E        HDE +    +  +E  +I+ D   + +   DD++I 
Sbjct  713   QTSEVSPAVAGETAGELSIEQKYEHDEKLALADSIDVEGEEITSDFHISSETVCDDNLIY  772

Query  1611  TAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQD---  1441
               KK KLSSQ+E+P+  +T G ED      S+NS+ ++GSSKDY K H+  EE +QD   
Sbjct  773   PHKKQKLSSQVEQPAVNDT-GDEDELRTSHSDNSRAKTGSSKDYQKRHENGEEVMQDGRS  831

Query  1440  KRFAHVDDTRQTGGEEDRLQRK---GRDEK-ETEKHRMIVKGREDSYMRKGY-Dsssahh  1276
             +R  ++   R+  GEE  L+RK   GRD + ET+++R+  KGRE+ Y   G+ D      
Sbjct  832   RRMGNISKRRE--GEEYILRRKDDYGRDARQETDRNRIASKGRENMYHSYGHRDWDPTSA  889

Query  1275  sHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDR  1096
                +    +R KE   S    Q R D +  RR K ED  KRE  +E ES+HR+K+R  DR
Sbjct  890   HPVRDRSFERPKESSSSVGVRQRRQDSIQSRRVKDEDI-KRERSEETESRHRSKVRASDR  948

Query  1095  SEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLS  916
             ++R+    L++++D+G  R   ++D  SR RER+ D L SR +N+DD + +R+K++    
Sbjct  949   NDRDEDLHLKQRMDDGDWR-GRNRDGTSRQRERD-DILMSRRENLDDSYIRRKKDEEVSR  1006

Query  915   REHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ--RLREDDQ-HY-AR  748
             R   D+E+ LH          R R+D S +++  D     +R +   RLR+  Q HY ++
Sbjct  1007  RGKADKEDALHG--------YRGREDSSRRKRERDDDIDYRRREDGPRLRDKAQDHYSSK  1058

Query  747   YKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSR  568
             +K++ L       RHRER++  + KQ H+   + RERDEGR  +R GRA ++K      R
Sbjct  1059  HKDDSL-------RHREREDRQQVKQLHENAPTHRERDEGRRVVRSGRAIQDKGLCRNGR  1111

Query  567   GKDEYK--GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRA  394
              KDE K  GSD++Y  KD  R+ E  KR +R    + S H+   D +    Q + DER +
Sbjct  1112  NKDELKTLGSDKDYQDKDRKRYNEQSKRGDRAGEENVSHHKGHGDVHACEKQHNKDERNS  1171

Query  393   RNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNS  265
             R+ER+ST  +  +  SDS +++  + +EN+ K K  EA+++N+
Sbjct  1172  RHERLSTHNERPSSASDSQQMYRDRHRENTRKGKDGEANEQNN  1214



>ref|XP_010939298.1| PREDICTED: FIP1[V]-like protein isoform X1 [Elaeis guineensis]
Length=1430

 Score =   511 bits (1317),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 435/1063 (41%), Positives = 610/1063 (57%), Gaps = 85/1063 (8%)
 Frame = -1

Query  3294  IPGVSGVPETCGD---------RAVdeewdsdsdddDLRIVLNDNN--HGPmgmdrmggd  3148
             IPG+S  P   G          +A   E      +DDL+IVLNDN+   G    DR G +
Sbjct  184   IPGLSAGPAPPGPFLDMDGGDVKASRSEDWDTDSEDDLQIVLNDNHVPLGGERNDRGGDE  243

Query  3147  gddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNSADGERKE--DAAKVNVGPGYA  2977
              DDD+D  + LVIV + D   H P +EEQ+WG+E +  + DGERKE  D AK N   G A
Sbjct  244   DDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQPAGDGERKEMADVAKGNGPAGTA  303

Query  2976  P--KIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRG  2803
             P  +IGYS+HG+   +HS +KY+RPGA P+ G P  G  G PGQV PP+   L AGRGRG
Sbjct  304   PAARIGYSSHGFSMQHHSTYKYIRPGAVPVSGGPSGGAVGPPGQVRPPLPLGLAAGRGRG  363

Query  2802  DWRPPGMKGALTMQKGFPGYN--AW--GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKP  2635
             DWRP G +G     K F  +   AW  GS+    G GLDFTLP+HKTIF+VDI+SF+EKP
Sbjct  364   DWRPAGGRGIPNAPKSFHSFGGPAWSNGSSVRAFGSGLDFTLPAHKTIFDVDIESFEEKP  423

Query  2634  WRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPE  2455
             WR  G+D+SDFFNFGL+E+ WKDYCKQL+QLRLE+TMQ KIRVYESGR+EQEYDPDLPPE
Sbjct  424   WRHPGVDISDFFNFGLDEDKWKDYCKQLDQLRLEATMQSKIRVYESGRSEQEYDPDLPPE  483

Query  2454  LaaaAGIQDIPSENANLGKTEVGQNDL---ARGSIRSRPPLPAGRPIQVESGSGDRLPSI  2284
             LAAAAG  DI ++N   G+ +  Q D      G+   R P+P GR IQVESG G+R PSI
Sbjct  484   LAAAAGHHDISADNGYHGRADNRQTDFNSQGSGAANIRVPIPTGRAIQVESGYGERQPSI  543

Query  2283  DTRPPRVRDSDAIIEIVCQGSADD----DNNLEQGNQPSR-EGIRGGDEIGDLQQEDIHH  2119
             DTR PR+RDSDAIIEIV Q S DD    D  +E+  +  + E  +GG E  D +     H
Sbjct  544   DTRQPRLRDSDAIIEIVLQDSMDDPAMNDGAVEKPEKDLQGEHYKGGHEFEDERHVTSEH  603

Query  2118  VDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGR  1939
              +   H+ +G KRE   R      GP+     D ++ +PSE    +H +S+ ++ VY   
Sbjct  604   DNRNPHSLSGRKREMAGR------GPF-APDEDGILPIPSEAHGRHHSNSKSRSPVYSSG  656

Query  1938  KHAVAHDSTREKGRARCR--------SADIGASESPKDKQIDVDNRREDSLSVGDrrspl  1783
                   D+   +G ++ R        S D+  S+S   K+ D D+++E  L   D     
Sbjct  657   SFGGNRDARLARGTSQGRHSSASGEPSNDVVPSQSAHSKRHD-DHQKEKLL---DSTEVN  712

Query  1782  ssspvsnrsVQESAVE---NNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVID  1612
              +S VS     E+A E        HDE +    +  +E  +I+ D   + +   DD++I 
Sbjct  713   QTSEVSPAVAGETAGELSIEQKYEHDEKLALADSIDVEGEEITSDFHISSETVCDDNLIY  772

Query  1611  TAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQD---  1441
               KK KLSSQ+E+P+  +T G ED      S+NS+ ++GSSKDY K H+  EE +QD   
Sbjct  773   PHKKQKLSSQVEQPAVNDT-GDEDELRTSHSDNSRAKTGSSKDYQKRHENGEEVMQDGRS  831

Query  1440  KRFAHVDDTRQTGGEEDRLQRK---GRDEK-ETEKHRMIVKGREDSYMRKGY-Dsssahh  1276
             +R  ++   R+  GEE  L+RK   GRD + ET+++R+  KGRE+ Y   G+ D      
Sbjct  832   RRMGNISKRRE--GEEYILRRKDDYGRDARQETDRNRIASKGRENMYHSYGHRDWDPTSA  889

Query  1275  sHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDR  1096
                +    +R KE   S    Q R D +  RR K ED  KRE  +E ES+HR+K+R  DR
Sbjct  890   HPVRDRSFERPKESSSSVGVRQRRQDSIQSRRVKDEDI-KRERSEETESRHRSKVRASDR  948

Query  1095  SEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLS  916
             ++R+    L++++D+G  R   ++D  SR RER+ D L SR +N+DD + +R+K++    
Sbjct  949   NDRDEDLHLKQRMDDGDWR-GRNRDGTSRQRERD-DILMSRRENLDDSYIRRKKDEEVSR  1006

Query  915   REHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ--RLREDDQ-HY-AR  748
             R   D+E+ LH          R R+D S +++  D     +R +   RLR+  Q HY ++
Sbjct  1007  RGKADKEDALHG--------YRGREDSSRRKRERDDDIDYRRREDGPRLRDKAQDHYSSK  1058

Query  747   YKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSR  568
             +K++ L       RHRER++  + KQ H+   + RERDEGR  +R GRA ++K      R
Sbjct  1059  HKDDSL-------RHREREDRQQVKQLHENAPTHRERDEGRRVVRSGRAIQDKGLCRNGR  1111

Query  567   GKDEYK--GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRA  394
              KDE K  GSD++Y  KD  R+ E  KR +R    + S H+   D +    Q + DER +
Sbjct  1112  NKDELKTLGSDKDYQDKDRKRYNEQSKRGDRAGEENVSHHKGHGDVHACEKQHNKDERNS  1171

Query  393   RNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNS  265
             R+ER+ST  +  +  SDS +++  + +EN+ K K  EA+++N+
Sbjct  1172  RHERLSTHNERPSSASDSQQMYRDRHRENTRKGKDGEANEQNN  1214



>ref|XP_008785688.1| PREDICTED: uncharacterized protein LOC103704249 [Phoenix dactylifera]
Length=1422

 Score =   509 bits (1311),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 424/1032 (41%), Positives = 604/1032 (59%), Gaps = 71/1032 (7%)
 Frame = -1

Query  3210  LRIVLNDNN--HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LG  3040
             L+IVLNDN+   G    DR+G + DDD+D  + LVIV + D   H P +EEQ+WG+E + 
Sbjct  218   LQIVLNDNHVPLGGERNDRVGAEEDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQ  277

Query  3039  NSADGERKE--DAAKVNVGPG--YAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvg  2872
              + DGERKE  D AK N GP    A +IGYS+HG+H  +HS +KY+RPGAAP+ G P  G
Sbjct  278   PAGDGERKEMADVAKGN-GPAGTSATRIGYSSHGFHMQHHSTYKYIRPGAAPVSGGPSGG  336

Query  2871  pggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNA--WGSNPSGR--GIG  2704
               G PGQV PP+     AGRGRGDWRP G +G     K F  + A  W +  S R  G G
Sbjct  337   AVGPPGQVRPPLPLGPTAGRGRGDWRPAGGRGIPNAPKSFHSFGAPAWSNGLSVRAFGSG  396

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
             LDFTLP+HKTIF++DI+SF+EKPWR  G+D+SD+FNFGL+E+ WKDYCKQL+QLRLE+TM
Sbjct  397   LDFTLPAHKTIFDIDIESFEEKPWRHPGVDISDYFNFGLDEDKWKDYCKQLDQLRLEATM  456

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL---ARGSIRS  2353
             Q KIRVYESGR+EQEYDPDLPPELAAAAG  DI ++N   G+    Q D      G+   
Sbjct  457   QSKIRVYESGRSEQEYDPDLPPELAAAAGHHDISADNGYHGRAGNRQTDFNSQGSGAANI  516

Query  2352  RPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDN-NLEQGNQPSR  2176
             R P+P GR IQVESG G+R PSIDTR PR RDSDAIIEIV Q S DD   N     QP +
Sbjct  517   RAPIPTGRAIQVESGYGERQPSIDTRAPRHRDSDAIIEIVLQDSMDDPTINNGALEQPEK  576

Query  2175  EGIRGGDEIGDLQQEDIHHV-----DGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVV  2011
             + ++G +  G  + E+  HV     + + H+ +G KRE   +      GP    + D ++
Sbjct  577   D-LQGENYKGVHEFEEERHVASEQDNRYLHSLSGRKREMARK------GPLAPDK-DGIL  628

Query  2010  ILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDS--TREKGRARCRSA------DIGASESP  1855
               PS+    YH +S+ ++ VY        HD+   +E    R  +A      D+  SES 
Sbjct  629   PFPSKAHGHYHSNSKSRSPVYSSGSFGGHHDARLPQETSHGRHSTASGEPSNDVIPSESA  688

Query  1854  KDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELVPAQRNSGMER  1675
               K+ D D+++   +   +       SP     +       +   HDE +    +  +E 
Sbjct  689   HSKRHD-DHQKGKLIDSTEVNQTSEVSPAVAVEIARKVSIEHKYEHDEKLALADSIDVEG  747

Query  1674  GKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSG  1495
              +I+ D   + +   DD+++   KK KLSS++E+P+  +TD  ++ + +R S+N++ ++G
Sbjct  748   EEITSDFHISSETVCDDNLVYPHKKQKLSSRVEQPAINDTDDEDELRTSR-SDNNRAKTG  806

Query  1494  SSKDYHKLHDGLEEEVQDKRFAHVDD-TRQTGGEEDRLQRK---GRDEK-ETEKHRMIVK  1330
             SSKDY K  +  EE +QD R   + + +++  GEE   +RK   GRD + ET+++R+  K
Sbjct  807   SSKDYQKRRENGEEVMQDGRSRLMGNISKRREGEEYIFRRKDDYGRDARQETDRNRIASK  866

Query  1329  GREDSYMRKGY-DsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKR  1153
             GRE+ Y   G+ D         +    +R KE   S    Q R DD+  RR K ED  KR
Sbjct  867   GRENMYHSYGHRDWDPTSAHPIRDRSFERPKESSSSIGVRQRRQDDIQ-RRVKDEDI-KR  924

Query  1152  EHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSR  973
             E  +E ES+HR+K+R  DR++R+     +K++D+G LR   ++D  SR RER+ D L SR
Sbjct  925   ERSEETESRHRSKVRASDRNDRDEDLRSKKRMDDGDLR-GRNRDGTSRQRERD-DILMSR  982

Query  972   YDNIDDRHSKRRKEDTKLSREHVDREETLHS-RG-DGTLRRKRERDDISDQRKRDDISDQ  799
             ++N+DD + +R+K++    R   D+E+ LH  RG + + RRKRERD        DDI+ +
Sbjct  983   HENLDDSYIRRKKDEEVSRRGKADKEDALHGHRGREDSSRRKRERD--------DDINYR  1034

Query  798   RKRDDQRLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGR  625
             R+ D  RLR+   D H A+ K++         RHRER++  + KQ H+   + RER+EGR
Sbjct  1035  RREDGTRLRDKAQDHHSAKQKDDSW-------RHREREDRQQVKQLHEHAQTHREREEGR  1087

Query  624   GGLRVGRAAEEKSWAGLSRGKDEYK--GSDREYHSKDAGRHVEHLKRRERDENGSPSRHR  451
             G +R GRA E+K     +R KDE    GSD +Y  KD  R+ E  KR +R    + SRH+
Sbjct  1088  GLVRSGRAIEDKGLCRNARDKDELNTTGSDMDYQDKDRKRYNEQSKRGDRIGEENVSRHK  1147

Query  450   SREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASD-  274
                D +    Q + DER +R+ER+ T  +  +  SDS +++ ++ +EN+ K K  EA + 
Sbjct  1148  GHGDVHACEKQHNNDERSSRHERLRTHNERPSSASDSHQMYRERHRENTRKGKDSEAKEQ  1207

Query  273   KNSLLPSNLNED  238
             KN +L    +ED
Sbjct  1208  KNQMLGGRKHED  1219



>ref|XP_010936256.1| PREDICTED: FIP1[V]-like protein [Elaeis guineensis]
Length=1425

 Score =   508 bits (1308),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 423/1050 (40%), Positives = 597/1050 (57%), Gaps = 86/1050 (8%)
 Frame = -1

Query  3210  LRIVLNDNNHGP---mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--  3046
             L+IVLNDN HGP      D +G + DDD+D  + LVIV + D   H P  EEQ+WG E  
Sbjct  218   LQIVLNDN-HGPLGGEKNDGVGDEEDDDEDGEEDLVIVTDEDQHHHLPATEEQDWGGEEA  276

Query  3045  LGNSADGERK-EDAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKYVRpgaapipgappv  2875
             +  S DGE++  DAAK N   G AP  +IGYSNHG+H  +HS +KYVRPGAAP+ G P  
Sbjct  277   IQPSGDGEKEMADAAKGNCPAGTAPAARIGYSNHGFHVQHHSTYKYVRPGAAPMSGGPSG  336

Query  2874  gpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNA--WGSNPSGR--GI  2707
             G  G  GQV PP+    +AGRGRGDWRP G +GA    K +  + A  W +   GR  G 
Sbjct  337   GAVGPAGQVRPPLPLGPMAGRGRGDWRPAGGRGAPNGPKSYHSFGAPAWSNGSLGRATGS  396

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             GLDFTLP+HKTIF++DI++F+EKPWR  G+D+SDFFNFG +E+ WKDYCKQL+QLRLE+T
Sbjct  397   GLDFTLPAHKTIFDIDIENFEEKPWRHPGVDISDFFNFGFDEDKWKDYCKQLDQLRLEAT  456

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQ--NDLARGSIRS  2353
             MQ KIRVYESGR+EQEYDPDLPPELAAAAG  DI +++ + G+   GQ  N   RG+   
Sbjct  457   MQSKIRVYESGRSEQEYDPDLPPELAAAAGHHDISADSGHHGRAHNGQDFNSQGRGAANI  516

Query  2352  RPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSAD----DDNNLEQGNQ  2185
             R PLP GR IQVESG G+RLPSIDTR PR+RDSDAIIEIV Q   D    DD  LE   Q
Sbjct  517   RAPLPTGRAIQVESGHGERLPSIDTRAPRLRDSDAIIEIVLQDPMDDPTIDDGALE---Q  573

Query  2184  PSREGIRGGDEIGDLQQEDIHHV-----DGFQHAYNGWKREFGSRRAEFNSGPYDKSRSD  2020
             P ++ ++G    G  + ED  HV     +   HA +G KRE   R      GP      D
Sbjct  574   PEKD-VQGEHYKGVREFEDERHVASEYDNRLPHALSGRKREMARR------GPV-TPEED  625

Query  2019  RVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASES----PK  1852
              +    SE    YH +S+ ++  Y G      H     +G +R R + +    S    P 
Sbjct  626   GISPFHSEVHGHYHSNSKSRSPAYSGGSFEGHHGGRLPQGISRGRHSSVSGEHSNDAIPS  685

Query  1851  ---------DKQID--VDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDELV  1705
                      D+QI   +D+   + +S         S  V+  + +E ++E   + HDE +
Sbjct  686   QSAHSNRHGDRQIGKLIDSTEVNQIS-------EVSPAVAVETARELSIEQKYDEHDEKL  738

Query  1704  PAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAAR  1525
                 +  ++   I+ D   + +   DD+++   KK KLSS++E+P+  +T   ED     
Sbjct  739   ALGDSIDVDGEDITSDFHISSETVGDDNLVYPGKKQKLSSRVEQPALNDT-ADEDELRTS  797

Query  1524  SSENSKTRSGSSKDYHKLHDGLEEEVQDKRFAHVDDTRQTG-GEEDRLQRK---GRDEKE  1357
              S++S+ ++GSSKDY K  +  +E +QD R   + D R+   GEE  LQR+   G D ++
Sbjct  798   HSDSSRAKTGSSKDYQKRRENGDEVMQDGRSRRIGDIRRRHEGEEHILQRRDDYGSDARQ  857

Query  1356  -TEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRR  1180
               +++ +  K RED+Y   G+    +  +H     +  R +   S  AWQ R++ +H RR
Sbjct  858   DIDRNHIASKEREDTYRSSGHRDWDSISAHPVRGRSFERPKESSSISAWQRREEGIHSRR  917

Query  1179  SKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRE  1000
              K ED R RE  +   S+HR+K+   DR++R+     RK +D+   R    +D   R RE
Sbjct  918   VKDEDIR-RERSEGTGSRHRSKVGGSDRNDRDEDLHSRKLVDDNDWR-GRSRDGPPRQRE  975

Query  999   RERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLH---SRGDGTLRRKRERDDISD  829
             R    L +R +N+DD ++KR+K++    R   D+E+ LH   +R D + RRKRERDD  D
Sbjct  976   RN-SMLINRRENLDDSYNKRKKDEEVSRRGKTDKEDALHGYRAREDSS-RRKRERDDGID  1033

Query  828   QRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILS  649
              ++R+D +  R RD    + +D   A++K++          HRER++  R KQ H+  L+
Sbjct  1034  HKRREDST--RLRD----KAEDHQSAKHKDDSWG-------HREREDRQRLKQPHENALT  1080

Query  648   KRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK--GSDREYHSKDAGRHVEHLKRRERDE  475
              RER EGRG  R  RA E+KS  G  R +DE K  GSD++Y  KD  RH E  KR +R  
Sbjct  1081  HRER-EGRGVARSSRAIEDKSLGGNGRNRDELKPIGSDKDYQDKDRRRHNEQSKRGDRTG  1139

Query  474   NGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKD  295
               + S+H+   D +    Q + DER +R+ER+S   D     SDS +++ ++ +EN+ K 
Sbjct  1140  EENVSQHKGHGDVHAHEKQHNNDERSSRHERLSIHNDRHPNASDSQQMYRQRHRENTRKV  1199

Query  294   KVPEASDKNSLLPSNLNEDDRSGNASETVC  205
             K  EAS++N+ +      DD + + ++ V 
Sbjct  1200  KESEASEQNNQVLGKRKHDDHNIHQNDKVS  1229



>ref|XP_010939299.1| PREDICTED: FIP1[V]-like protein isoform X2 [Elaeis guineensis]
Length=1427

 Score =   504 bits (1299),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 432/1060 (41%), Positives = 606/1060 (57%), Gaps = 82/1060 (8%)
 Frame = -1

Query  3294  IPGVSGVPETCGD---------RAVdeewdsdsdddDLRIVLNDNN--HGPmgmdrmggd  3148
             IPG+S  P   G          +A   E      +DDL+IVLNDN+   G    DR G +
Sbjct  184   IPGLSAGPAPPGPFLDMDGGDVKASRSEDWDTDSEDDLQIVLNDNHVPLGGERNDRGGDE  243

Query  3147  gddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNSADGERKE--DAAKVNVGPGYA  2977
              DDD+D  + LVIV + D   H P +EEQ+WG+E +  + DGERKE  D AK N   G A
Sbjct  244   DDDDEDGEEDLVIVTDEDQHHHIPAMEEQDWGEEAIQPAGDGERKEMADVAKGNGPAGTA  303

Query  2976  P--KIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRG  2803
             P  +IGYS+HG+   +HS +KY+RPGA P+ G P  G  G PGQV PP+   L AGRGRG
Sbjct  304   PAARIGYSSHGFSMQHHSTYKYIRPGAVPVSGGPSGGAVGPPGQVRPPLPLGLAAGRGRG  363

Query  2802  DWRPPGMKGALTMQKGFPGYN--AW--GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKP  2635
             DWRP G +G     K F  +   AW  GS+    G GLDFTLP+HKTIF+VDI+SF+EKP
Sbjct  364   DWRPAGGRGIPNAPKSFHSFGGPAWSNGSSVRAFGSGLDFTLPAHKTIFDVDIESFEEKP  423

Query  2634  WRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPE  2455
             WR  G+D+SDFFNFGL+E+ WKDYCKQL+QLRLE+TMQ KIRVYESGR+EQEYDPDLPPE
Sbjct  424   WRHPGVDISDFFNFGLDEDKWKDYCKQLDQLRLEATMQSKIRVYESGRSEQEYDPDLPPE  483

Query  2454  LaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTR  2275
             LAAAAG  DI ++N   G+ +  Q D       +    P GR IQVESG G+R PSIDTR
Sbjct  484   LAAAAGHHDISADNGYHGRADNRQTDFNSQGSGAANIRPTGRAIQVESGYGERQPSIDTR  543

Query  2274  PPRVRDSDAIIEIVCQGSADD----DNNLEQGNQPSR-EGIRGGDEIGDLQQEDIHHVDG  2110
              PR+RDSDAIIEIV Q S DD    D  +E+  +  + E  +GG E  D +     H + 
Sbjct  544   QPRLRDSDAIIEIVLQDSMDDPAMNDGAVEKPEKDLQGEHYKGGHEFEDERHVTSEHDNR  603

Query  2109  FQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHA  1930
               H+ +G KRE   R      GP+     D ++ +PSE    +H +S+ ++ VY      
Sbjct  604   NPHSLSGRKREMAGR------GPF-APDEDGILPIPSEAHGRHHSNSKSRSPVYSSGSFG  656

Query  1929  VAHDSTREKGRARCR--------SADIGASESPKDKQIDVDNRREDSLSVGDrrsplsss  1774
                D+   +G ++ R        S D+  S+S   K+ D D+++E  L   D      +S
Sbjct  657   GNRDARLARGTSQGRHSSASGEPSNDVVPSQSAHSKRHD-DHQKEKLL---DSTEVNQTS  712

Query  1773  pvsnrsVQESAVE---NNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAK  1603
              VS     E+A E        HDE +    +  +E  +I+ D   + +   DD++I   K
Sbjct  713   EVSPAVAGETAGELSIEQKYEHDEKLALADSIDVEGEEITSDFHISSETVCDDNLIYPHK  772

Query  1602  KHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQD---KRF  1432
             K KLSSQ+E+P+  +T G ED      S+NS+ ++GSSKDY K H+  EE +QD   +R 
Sbjct  773   KQKLSSQVEQPAVNDT-GDEDELRTSHSDNSRAKTGSSKDYQKRHENGEEVMQDGRSRRM  831

Query  1431  AHVDDTRQTGGEEDRLQRK---GRDEK-ETEKHRMIVKGREDSYMRKGY-DsssahhsHT  1267
              ++   R+  GEE  L+RK   GRD + ET+++R+  KGRE+ Y   G+ D         
Sbjct  832   GNISKRRE--GEEYILRRKDDYGRDARQETDRNRIASKGRENMYHSYGHRDWDPTSAHPV  889

Query  1266  KTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSER  1087
             +    +R KE   S    Q R D +  RR K ED  KRE  +E ES+HR+K+R  DR++R
Sbjct  890   RDRSFERPKESSSSVGVRQRRQDSIQSRRVKDEDI-KRERSEETESRHRSKVRASDRNDR  948

Query  1086  EGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREH  907
             +    L++++D+G  R   ++D  SR RER+ D L SR +N+DD + +R+K++    R  
Sbjct  949   DEDLHLKQRMDDGDWR-GRNRDGTSRQRERD-DILMSRRENLDDSYIRRKKDEEVSRRGK  1006

Query  906   VDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQ--RLREDDQ-HY-ARYKE  739
              D+E+ LH          R R+D S +++  D     +R +   RLR+  Q HY +++K+
Sbjct  1007  ADKEDALHG--------YRGREDSSRRKRERDDDIDYRRREDGPRLRDKAQDHYSSKHKD  1058

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             + L       RHRER++  + KQ H+   + RERDEGR  +R GRA ++K      R KD
Sbjct  1059  DSL-------RHREREDRQQVKQLHENAPTHRERDEGRRVVRSGRAIQDKGLCRNGRNKD  1111

Query  558   EYK--GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNE  385
             E K  GSD++Y  KD  R+ E  KR +R    + S H+   D +    Q + DER +R+E
Sbjct  1112  ELKTLGSDKDYQDKDRKRYNEQSKRGDRAGEENVSHHKGHGDVHACEKQHNKDERNSRHE  1171

Query  384   RVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNS  265
             R+ST  +  +  SDS +++  + +EN+ K K  EA+++N+
Sbjct  1172  RLSTHNERPSSASDSQQMYRDRHRENTRKGKDGEANEQNN  1211



>gb|EYU25349.1| hypothetical protein MIMGU_mgv1a000329mg [Erythranthe guttata]
Length=1251

 Score =   498 bits (1283),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 492/1292 (38%), Positives = 655/1292 (51%), Gaps = 267/1292 (21%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRP T   Q +              A ++A G +A   SS  Q  R
Sbjct  1     MEDDDEFGDLYTDVLRPLTTQFQPQH-----------EEAGSSAPGGRAAAASSS-QGRR  48

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNSSDFNLSLNP  3586
             ID  ++ DD  I++GA       + S+ +  +   +     P  ++  P    F+L+LN 
Sbjct  49    IDLNINSDDEEILYGAPDLKKSDSNSNLNPSSSALRWNLNAPIQEKALPEPRGFDLNLN-  107

Query  3585  qsgqsggsigvgvGANESDL-GARVFGKSDGKSRDWAF----------GDSSFTDEANId  3439
                              SDL  A++ G ++ ++ D AF          G  S   +A+  
Sbjct  108   -----------------SDLDSAKIVGIAENRADDLAFDEARVSKKGEGVKSPPQKASGG  150

Query  3438  vvveegddkdddlvqkdENIDKPMGRSENCESSVVEAGGSEHMIPGV----SIPGVSGVP  3271
              +  E DD DD  +  +E  +K     E  + + +   G E  I GV     IPG+SG  
Sbjct  151   SIFLENDDDDDINIIVEEGENKDDDFLEKDDDADISGTGKEPAI-GVDSEQMIPGLSGRL  209

Query  3270  ETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDD  3091
             +   D   +++W+S+  +DDL+IVLNDNNHGP+GM  +  + D+D +    LVI+A++ D
Sbjct  210   DNPRDSNFEDDWESEESEDDLQIVLNDNNHGPVGMAGVNDEDDEDGEQ---LVILADNGD  266

Query  3090  --------PSHQPMVEEQEWGDELGNSADGER--------KEDAAKVNVGPGYAPKIGYS  2959
                     P    M E +  G+E G +ADG++                      PK+ YS
Sbjct  267   VGHHHHQQPHQMMMEEPEWGGEEGGPAADGDKDLGDAAKASGGGGGGAAPTAVQPKVAYS  326

Query  2958  NHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMK  2779
             NHG+HHP+HSQFKYVRPGAAP+P     GP   P       N + +AGRGRGDWRPPGMK
Sbjct  327   NHGFHHPFHSQFKYVRPGAAPLPPGGIAGPVRPPV------NMAPMAGRGRGDWRPPGMK  380

Query  2778  GALTMQKGF-PGYNAWGSNPSGRGIG--LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMS  2608
             GAL MQKGF PGY   G   +GRG G  LDFTLPSHKTIFEVDIDSF+EKPW+L  ID+S
Sbjct  381   GALPMQKGFHPGY---GGMQAGRGFGSGLDFTLPSHKTIFEVDIDSFEEKPWKLPTIDVS  437

Query  2607  DFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQD  2428
             DFFNFGL+E+SWKDYCKQLEQLRLE+TMQ KIRVYESGR E++YDPDLPPELAAA GIQD
Sbjct  438   DFFNFGLDEDSWKDYCKQLEQLRLETTMQSKIRVYESGRAERDYDPDLPPELAAAVGIQD  497

Query  2427  IPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSG-DRLPSIDT-RPPRVRDS  2254
             IP ENAN G T+    D+AR +   R PLP GRPI VESG G DR+PS+D+ +  R+ D+
Sbjct  498   IPPENANRGNTDAALTDIARANANGRSPLPVGRPIPVESGGGGDRVPSVDSNKRIRMHDA  557

Query  2253  DAIIEIVCQGSADDDNNLEQGNQPSREGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREF  2074
             D +IEI+C  S DD                  DE+ + Q ++    DG            
Sbjct  558   DVVIEIICHSSVDD------------------DEVAEQQDDEPPRKDG------------  587

Query  2073  GSRRAEFNSGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRA  1894
                              D V    +E  DS+ P   GQ                RE G  
Sbjct  588   -----------------DDV----AENVDSFSPAYNGQK---------------RESG--  609

Query  1893  RCRSADIGASESPKDKQIDV---DNRREDSLSVGDrrsplssspvsnrsVQESAVENNDN  1723
               R A +  +    D++ D+   D RR+D  S        +SSP +  S +E      D 
Sbjct  610   -SRRAQLKKNTVSTDRETDILHEDERRDDKTS-------PTSSPSATESDREKPPPVEDE  661

Query  1722  LHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPS-PQETDGG  1546
             ++D  +   R+  MER KI VD +T     +D +++   KK KL S  E+ S   + D  
Sbjct  662   MNDGPLSDDRSFDMEREKIDVDTKT-----EDGNLLYPTKKQKLGSLAEQLSQEDDDDDM  716

Query  1545  EDSKAARSSEN-SKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDRLQRKG  1372
             EDSKA RSS+  SK RSGSSKD+ K  +  ++EV QD+R       ++  G  D  +RKG
Sbjct  717   EDSKAGRSSDTTSKARSGSSKDFRKFPEDADDEVLQDRRPPRAGFVKREVGNVDSSRRKG  776

Query  1371  RDEK-ETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDD  1195
               E+ ETE+H +  KGR+ S+  +            K    + +KE         +RD D
Sbjct  777   YYERDETERH-VAAKGRDYSFPHR---------HVAKNESTEWKKE---------YRDAD  817

Query  1194  LHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAV  1015
                RR +  D  K   G E ES          RSE++  H  R Q+DNG     + + A 
Sbjct  818   --NRRGRTRDMSK---GRESES----------RSEKDENHQSRNQMDNGG----NWRGAS  858

Query  1014  SRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETL-HSRGDGTLRRKRERDD  838
               H      +LK+R +N D  HSKRRKE+ ++S+E  ++E+   + R + + RRKRERDD
Sbjct  859   HDH------NLKNRNENADAFHSKRRKEEVRVSQERAEKEDISDNHRENNSSRRKRERDD  912

Query  837   ISDQRKRDDISDQRKRDDQRLREDDQHYARYKEE-PLFQSERGERHRERDEWYRPKQSHD  661
              SDQ KRD                +   AR KE    FQ ER +R RERDEWYR KQ   
Sbjct  913   GSDQIKRD--------------VHNNSNARQKEGGSSFQRERIDRQRERDEWYRIKQEEI  958

Query  660   EILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK-GSDREYHSKDAGRHVEHLKRRE  484
                 + E        R+     +K     SRGKD+Y  GS REYHSKD            
Sbjct  959   PPREREE-------TRL-----QKPRMSHSRGKDDYNTGSSREYHSKDV-----------  995

Query  483   RDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENS  304
                             Y RG Q   DE+RAR +R + R     Y SD+S+VHE+KRKE+S
Sbjct  996   ----------------YARGSQHINDEKRARYDRPNNRDGRVNYGSDTSRVHEEKRKESS  1039

Query  303   TKDKVPEASDKNSLLPSNLNEDDRSGNASETV  208
              K K  +  D++SL P   N+++  G  S+ V
Sbjct  1040  RKSKELDGGDRSSLNPYKRNQNEHGGQISKKV  1071



>ref|XP_006857169.1| hypothetical protein AMTR_s00065p00171490 [Amborella trichopoda]
 gb|ERN18636.1| hypothetical protein AMTR_s00065p00171490 [Amborella trichopoda]
Length=1406

 Score =   474 bits (1221),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 401/1022 (39%), Positives = 560/1022 (55%), Gaps = 93/1022 (9%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWGDELGNSA-DGER------KEDAAKVNVGPGYAPKIGYS  2959
              VIVA  D   H  +VE+Q+W ++    A DG++      +   AKVN G     ++G+ 
Sbjct  199   FVIVAGGD--PHAQVVEDQDWVEDPSQIATDGDKPGAVDDRGQVAKVNAG--VVARVGFG  254

Query  2958  NHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMK  2779
              HGYH  +HSQFKYVRPGAA   G         PGQV        ++GRGRGDWRP G K
Sbjct  255   GHGYHM-HHSQFKYVRPGAATATGGVVNNVPSVPGQVRSLAPMGPMSGRGRGDWRPMGGK  313

Query  2778  GALTMQKGFP---GYNAWGSNPSGRGI-GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDM  2611
                 MQKGF    G   W +N + RG  G++FTLPSHKT+F++DID+F+EKPWR  G+D 
Sbjct  314   IVPNMQKGFHAGYGLQTWANNSAMRGFNGMEFTLPSHKTVFDIDIDAFEEKPWRQPGVDT  373

Query  2610  SDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQ  2431
             SDFFNFGL+E++WK+YCKQLEQLRLE+TMQ KIRVYESGR+EQ+YDPDLPPELAAAAG+ 
Sbjct  374   SDFFNFGLDEDTWKEYCKQLEQLRLEATMQSKIRVYESGRSEQDYDPDLPPELAAAAGLH  433

Query  2430  DIPSENANLGKTEVGQND---LARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVR  2260
             D   +N ++ KT++G +D   L RGS R RP +P GR IQVE G G+RLPSIDTRPPR R
Sbjct  434   DPSMDNQHINKTDIGSSDAAGLVRGSTRVRPQIPTGRAIQVEGGYGERLPSIDTRPPRFR  493

Query  2259  DSDAIIEIVCQGSADDD-----NNLEQG-NQPSREGIRG-GDEI-GDLQQEDIHHVDGFQ  2104
             + D+IIEI+ QG+ +DD     +  EQ  N    EG+R  G E+  D +Q D   ++ F 
Sbjct  494   EPDSIIEIIPQGTPEDDSVPSNDAAEQADNGHESEGLRNEGQEVEEDSKQVDADSIEQFP  553

Query  2103  HAYNGWKREFGSRRAEFNSGPYDKS--RSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHA  1930
              +Y+G KRE    R     GP   +    D ++  P E P  YHP S+ +  +YP     
Sbjct  554   QSYDGRKREMVPNRRGPILGPVHNTVREGDGILPFPPEAPLQYHPGSKVRAPIYPMGLLG  613

Query  1929  VAHDSTREKGRARCRSADIGASESP----------KDKQIDVDNRREDSL-SVGDrrspl  1783
               H      GR   +   +     P           D+ I    ++E S  S+  +RS  
Sbjct  614   APH-----GGRGWSQGPTVHERYLPINNEPPNVPILDESIRDHRKKEKSFDSMEYKRSSE  668

Query  1782  ssspvsnrsVQESAVENNDNLHDE--LVPAQRNSGMERGKISVDERTNCDKAKDD--SVI  1615
                P  +   +E +V+   +  D   ++P Q     + G+  + +    ++A +D  S +
Sbjct  669   VPRPALDEVAREQSVDQRGDAMDSEHMLPEQV---ADEGEEVISDMKMPNEANEDIGSSV  725

Query  1614  DTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLH-DGLEEEVQDK  1438
                K+ KLSS L EP P   +  +D KA+R S+NS+ RSGSSKDY K H  G EEEV+D 
Sbjct  726   HPGKRQKLSS-LIEPLPSLREPVDDLKASR-SDNSRGRSGSSKDYPKRHEVGEEEEVEDG  783

Query  1437  RFAHVDDTRQTGGEEDRLQRKGRD-----EKETEKHRMIVKGREDSYMRKGYDsssahhs  1273
             R   + + ++  GEE+   R+  D       E ++ R+ +KGRED Y R G  +      
Sbjct  784   RVRQLGEGKRRHGEEESSFRRKDDYVRDGRHEADRKRVAMKGREDVYRRAGNGAYPLREW  843

Query  1272  HT-------KTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNK  1114
                      K    DR KER+    +W  R++D  GRR K ED R+R+  +E+ SKHR K
Sbjct  844   ALDVPHFIRKNEGFDRLKERENGMGSWPWREEDTRGRREKDEDLRRRDRVEEMGSKHRGK  903

Query  1113  IRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLK-SRYDNIDDRHSKRR  937
               +  RSE++  + LRK+ D+   R  HDK+     R+RE DD    R+D +DD   KRR
Sbjct  904   GHEASRSEKDELNHLRKRADDFDWRAHHDKEV---SRQREGDDFSLVRHDALDDPRVKRR  960

Query  936   KEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQH  757
             K++    RE  D+E+ ++   +   RRKRE+DD  D         +  R   R R +D H
Sbjct  961   KDEEVQRRERDDKEDNIYRVREDASRRKREKDDSLDH------RRREDRARSRDRPEDHH  1014

Query  756   YARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAG  577
               R +E      +   R RER++ +R +         RER++ RG  R  R  EE++W G
Sbjct  1015  SFRQRER-----DSSWRQREREDHHRGESEGRSAQLSREREDARGSARSDRTMEERAWVG  1069

Query  576   LSRG-KDEYK--GSDREYHSKDAGRHVEHL-KRRERDENGSPSRHRSRED-GYGRGHQPS  412
              SR  KD  K  GSD+++H KD  RH E   K R+R E  + +R R RE+  Y R   P 
Sbjct  1070  GSRAIKDGSKSMGSDKDHHLKDKRRHSEQQPKIRDRIEEDTSTRRRGREESAYSRESHPI  1129

Query  411   TDERRARNERVSTRQDHAAYESDSSKVHEKKRKENST-KDKVPEASDKNSLLPSNLNEDD  235
              +ER  R E+ +T+      ES+S ++++ + KE++T K K  E  D+N L     N+ D
Sbjct  1130  NEERNFRREKSTTQN-----ESESQRMYKDRSKESNTRKIKESERVDQNDLASVASNKHD  1184

Query  234   RS  229
             R+
Sbjct  1185  RA  1186



>ref|XP_009396447.1| PREDICTED: uncharacterized protein LOC103981443 [Musa acuminata 
subsp. malaccensis]
Length=1406

 Score =   454 bits (1167),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 397/1030 (39%), Positives = 577/1030 (56%), Gaps = 106/1030 (10%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-LGNS  3034
             L+IVLND++HG +G+DR    G DDDD  D LVIV + D   H P  +EQ  G+E + ++
Sbjct  222   LQIVLNDSDHGRLGVDRNDRIGIDDDDREDDLVIVTDEDQHRHVPATDEQNCGEEAMQST  281

Query  3033  ADGERKE--DAAKVNVGPGYA--PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpg  2866
              DGERKE  D AK+    G A   +IGY+ HG H  +HS +KY+RPGAAP+PG P  G  
Sbjct  282   GDGERKEMVDVAKIASATGSALEARIGYNTHGSHPQHHSMYKYIRPGAAPLPGGPAAGTA  341

Query  2865  gtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYN--AWGSNPS-GRGIGLDF  2695
               PG   PP+ +  ++G GRGDWRP G +G     KG+ G+   AW ++ S   G GLDF
Sbjct  342   CPPGAARPPLISGPLSGGGRGDWRPAGGRGIPNGPKGYTGFGFPAWANSSSRAFGSGLDF  401

Query  2694  TLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGK  2515
             TLP+HK++F+VDI+SF+EKPWR  G+D+SDFFNFG +E+ WKDYCKQL+QLRLESTMQ K
Sbjct  402   TLPAHKSVFDVDIESFEEKPWRHPGVDVSDFFNFGFDEDKWKDYCKQLDQLRLESTMQSK  461

Query  2514  IRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLA---RGSIRSRPP  2344
             I VYESGR+EQEYDPDLPPELA AAG  +I + N +  K + G+ D +   RGS   R P
Sbjct  462   IHVYESGRSEQEYDPDLPPELATAAGHHNIFANNGH-KKADDGEVDFSNQGRGSSVMRAP  520

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPSREGIR  2164
             LP GR IQVE G G+RLPSIDTRPPR+RD+DA+IEIV Q S DD        +  +   R
Sbjct  521   LPTGRAIQVEGGYGERLPSIDTRPPRIRDADAVIEIVLQDSFDDPKMCNCAPEKHKSVER  580

Query  2163  GGDE-IGDLQQEDIHHVDG----FQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVVILPS  1999
               D+   +++ +D + V G    F HA        G+R  E           + V++ PS
Sbjct  581   DDDKCFHEVKNDDRNTVSGNMRHFSHAS-------GNRNKEMTRRALSAKEKNEVLLFPS  633

Query  1998  EEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSAD------------------I  1873
             E    YH DSR ++ V P +   +       +G +  RS++                  +
Sbjct  634   ESSAEYHQDSRTRSPVSPAKALGIHQSCRLPQGSSHRRSSNGREQSIDGIPSPSVHSNRL  693

Query  1872  GASESPKDKQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDE-LVPAQ  1696
             G  E  +D    VD     S SV D             +V+E +V+     HDE L P  
Sbjct  694   GDEEETQDDSTGVDRSSGKSSSVAD------------DTVKELSVDEQCCGHDEKLTPVS  741

Query  1695  -RNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSS  1519
               N G +   +  D     + + +D ++ T KK KLSS +E+P+  ++ G ED     +S
Sbjct  742   IENEGED---MVSDVHIPNETSDNDKLVQTGKKQKLSSLVEQPAGHDS-GHEDELQTSNS  797

Query  1518  ENSKTRSGSSKDYHKLHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRK---GRDEKETEK  1348
             +NS+ +SGSSKDY K  +  ++ +Q++    V   ++   EE  L+ K   G D ++  K
Sbjct  798   DNSRQKSGSSKDYPKQTENGDKVIQEEHSIQVGHLKRPHKEECYLRPKDDYGLDARQVMK  857

Query  1347  HRMIV-KGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKV  1171
                IV KG++D+        S ++    ++   +R+KE + S  +WQ R+D++H RR K 
Sbjct  858   KDYIVSKGKDDT--------SDSYKHPLRSRSYERKKESESSISSWQRREDNVHSRRVKD  909

Query  1170  EDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERER  991
             ED R+ E+ DE+ SKHR+K+R  DR+ +E  H  +K++++   R  H++D V    +R R
Sbjct  910   ED-RRWENSDEMVSKHRSKLRVTDRNPKEEDH-SKKRVEDRDWR-GHNRDDVL--WQRSR  964

Query  990   DDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGD--GTLRRKRERDDISDQRKR  817
             DDL SR+++ D+   K+++++  L R   D+  TLH   D   + R+KR RDD  D R+R
Sbjct  965   DDLVSRHESTDEPLIKKKRDEEYL-RGKADKLSTLHGYRDEENSGRKKRARDDAIDHRRR  1023

Query  816   DDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRER  637
             +   D R RD    + DD   + +K++         R+RER++  R K  H+     RER
Sbjct  1024  E--VDTRMRD----KADDHLSSNHKDD-------NWRYREREDRQRLK-PHESAPMHRER  1069

Query  636   DEGRGGLRVGRAAEEKSWAGLSRGKDEYKG--SDREYHSKDAGRHV-EHLKR---RERDE  475
             +EGRG +R GRA E+K+  G +R +DE K    D   H +   R + +H KR   RE D 
Sbjct  1070  EEGRGSVRSGRAMEDKASGGSARNRDESKTIVHDSRVHQEKERRQLNDHSKRDHGREDDV  1129

Query  474   NGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKD  295
                  RH S  + Y      + D R +R+ER++T +D     +D  +++ ++ KEN+ K 
Sbjct  1130  QNKGRRHLSVREKYS-----NNDRRNSRHERMNTYKD-CPPSADGKQMYRERHKENTRKS  1183

Query  294   KVPEASDKNS  265
             K  EA +++S
Sbjct  1184  KDSEAHEQHS  1193



>ref|XP_009411336.1| PREDICTED: uncharacterized protein LOC103993109 [Musa acuminata 
subsp. malaccensis]
Length=1430

 Score =   447 bits (1151),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 404/1039 (39%), Positives = 584/1039 (56%), Gaps = 98/1039 (9%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdg---ddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-L  3043
             L+IVLND+NHGP G +R        +DD+D  + LVIV + D   H P +E Q+WG+E L
Sbjct  236   LQIVLNDSNHGPPGAERSNIVEFDEEDDEDGEEDLVIVTDEDQHHHLPAMEVQDWGEETL  295

Query  3042  GNSADGERKE--DAAKVNVGPGYAP--KIGYSNHGYHHPYHSQFKYVRpgaapipgappv  2875
               + +GERKE  DAAK     G AP  +IGY+NHG H  +HS +KY+RPGAAP+PG P  
Sbjct  296   QPTGEGERKEMVDAAKGIGATGTAPGARIGYNNHGIHTQHHSMYKYIRPGAAPLPGDPAA  355

Query  2874  gpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQK------GFPGYNAWGSNPSGR  2713
             G  G PG   P + +   AG GRGDWRP   +G  +  K      GFPG+    +N S R
Sbjct  356   GALGPPGAARPSLVSGPTAGHGRGDWRPASGRGIPSAPKSYHTNFGFPGW----ANGSAR  411

Query  2712  --GIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLR  2539
               G GLDFTLPSHKTIF+VDI+SF+EKPW+  G+D+SDFFNFGL+E+ WKDYCK+L+QLR
Sbjct  412   ASGGGLDFTLPSHKTIFDVDIESFEEKPWKHPGVDISDFFNFGLDEDKWKDYCKRLDQLR  471

Query  2538  LESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL-----  2374
             LESTMQ KIRVYESGR+EQEYDPDLPPELAAAAG  DI   +AN G  +    ++     
Sbjct  472   LESTMQSKIRVYESGRSEQEYDPDLPPELAAAAG-HDI---SANCGHVKADDEEIKFTGQ  527

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQ  2194
              RG    R PLP GR IQVE G G+RLPSIDTRPPR+RDSDA+IEIV Q S DD      
Sbjct  528   GRGPAVMRAPLPTGRAIQVEGGYGERLPSIDTRPPRIRDSDAVIEIVLQDSFDDPKMYSC  587

Query  2193  GNQPSREGIRG--GDEIGDLQQEDIHHVDGFQ----HAYNGWKREFGSRRAEFNSGPYDK  2032
               +     + G  G      +++D + V G+     H  +   +E   R       P+ K
Sbjct  588   TPEQLERDVEGDCGRSFHKDEKDDRNTVSGYMNRIPHTSSTRDKEMIKRV------PFAK  641

Query  2031  SRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTR-EKGRARC-------RSAD  1876
              + D ++ LPS+    Y  DSR ++ V      +  H   R  KG +         +SAD
Sbjct  642   EK-DELLPLPSDSSAEYRRDSRTRSPVSAVDGASGIHQGGRLLKGSSSRKRSRAREQSAD  700

Query  1875  IGASESPKDKQIDVDNRREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDELVPA  1699
                S S    + + D ++E  L S    ++  +   V++ + +E  VE   +  DE +  
Sbjct  701   SIPSRSAHSSR-NGDQQKETLLDSTEVNQNSQTLPAVADDTTRELGVEEQYHDQDEKLAL  759

Query  1698  QRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSS  1519
               +  +E   ++ D   + +   DD++I   KK K+ S++E+P+ Q+  G ED     +S
Sbjct  760   VDSVEIEGDDVTSDFHISSETGGDDNLIHPGKKQKICSRVEQPAVQDR-GYEDELQPPTS  818

Query  1518  ENSKTRSGSSKD-YHKLHDGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD----EKE  1357
             +NS+ +SGSSKD   +  +G  E +Q+   +   D +++  E E  L  K  D     ++
Sbjct  819   DNSREKSGSSKDCIRQAENG--EVIQEGHSSQTGDLKKSQKEDEHNLHAKDEDGLDARQQ  876

Query  1356  TEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRS  1177
              EK++++ KGRED+ +        +  +  +    DRRKE + S  +WQ R+ ++HGRRS
Sbjct  877   REKNQIVSKGREDASI--------SSQNLLRGRSYDRRKESESSTSSWQRRESNMHGRRS  928

Query  1176  KVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRER  997
             K ED R  E+ +E+ S+H++K+R IDR++++     RK ++ G  R  H +D V R RER
Sbjct  929   KDEDIR-WENNEEM-SRHQSKLRTIDRNQKD-EDQSRKHVEGGEWR-GHTRDEVLRQRER  984

Query  996   ERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGD--GTLRRKRERDDISDQR  823
             + D L SR +N+D+   KR++++  L R   D+ +T H   D   + RRKRERDD    +
Sbjct  985   D-DLLMSRRENMDNPLIKRKRDEEYL-RGKADKVDTSHGHRDREDSGRRKRERDDGLHHK  1042

Query  822   KRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKR  643
             +     D R RD    + DD   ++ K++         RHRERDE  R K    E++  R
Sbjct  1043  RE---VDTRMRD----KADDHLSSKPKDDSW-------RHRERDERQRLKPH--EVM-HR  1085

Query  642   ERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK--GSDREYHSKDAGRHVEHLKRRERDENG  469
             ER+EGR  +R GR  E+K   G  R +DE K    D++Y  K+  RH E L RR+R    
Sbjct  1086  EREEGRVTVRSGRVTEDKPVGGNGRNRDELKPISYDKDYQEKERRRHTE-LSRRDRARED  1144

Query  468   SPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKV  289
             + S+++ R D        + D R +R+E+++T  DH    +D  +++ +K +EN++K K 
Sbjct  1145  NMSQNKGRGDTSVHDKHSNADGRSSRHEKLNTYVDHPP-SADGQQMYREKHRENTSKAKD  1203

Query  288   PEASDKNSLLPSNLNEDDR  232
              ++ D+N+        DDR
Sbjct  1204  VKSHDQNNQRLGKRKHDDR  1222



>ref|XP_004167960.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101227301, 
partial [Cucumis sativus]
Length=1174

 Score =   405 bits (1040),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 313/734 (43%), Positives = 448/734 (61%), Gaps = 44/734 (6%)
 Frame = -1

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL------EQGNQP  2182
             +PAGR IQVE G G+RLPSIDTRPPR+RDSDAIIEIV Q S DD+++       E  + P
Sbjct  282   MPAGRAIQVEGGYGERLPSIDTRPPRIRDSDAIIEIVLQDSLDDNSSTGNCTPNEPNDDP  341

Query  2181  SREGIRGGDEIGD---LQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDKSRSDRVV  2011
             S +  +   E  D     + D  + D F   +N    E   RR    + P D +R D  +
Sbjct  342   SGKDFKEIHEAEDDDAQIESDTEYPDDFSETHNSELTEKVGRRKTSMNSPSDNTREDVNL  401

Query  2010  ILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKDKQID--  1837
                SE P  +HP SRG T  Y  +   +  +  R +GR   +S       SP+    D  
Sbjct  402   AFTSEGP-GHHPTSRGNTPAYSAQNLGIV-EERRSQGRTYNKSP-----HSPRQNLQDRK  454

Query  1836  -VDNRREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDE------LVPAQRNSGM  1681
               D++ E S+ S+ D+RSP  SSP    + QE + E+ D  HDE      L+ A +N+ +
Sbjct  455   SPDSQEEGSVESMDDKRSPQVSSPAIVEATQEYSAEDKDAEHDEDAEHDELIEADKNTEI  514

Query  1680  ERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTR  1501
             +R  ++    +N  K + D   +     KLS  +E    +E DG EDSKAA SSEN KTR
Sbjct  515   DRENVNFISTSNTRKIESDDE-EMENNEKLSPIVEALMLKE-DGDEDSKAA-SSENRKTR  571

Query  1500  SGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGE-EDRLQRKGRDEKETEKHRMIVKG  1327
             SGSS+DY K  DG+EEEV Q++R + +   ++   E E   +RK  D+K+ E++RM VKG
Sbjct  572   SGSSRDYPKWQDGVEEEVFQNRRSSSMGSVKKYMDENEQNFRRKDSDDKQDERNRMDVKG  631

Query  1326  REDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREH  1147
             R+D+Y  + +D S AH    KT   DRRKER  ++  WQ RDDD + R+++ E++RKRE+
Sbjct  632   RKDAYAYRDWDPSLAHQHPLKTDGFDRRKERSNAEATWQRRDDDPYYRKTRTEETRKREY  691

Query  1146  GDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYD  967
              DE  S+HR+KIR+I+RS+++ RHL +K LDNGS R  +DK A SRHRER+ D LKSRY+
Sbjct  692   DDETGSRHRSKIREIERSDKDERHLTKK-LDNGSYRAHYDKGASSRHRERD-DSLKSRYE  749

Query  966   NIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRD  787
             N D  ++K+RK++  L REHV++EE LH + +G   RKRERD++ + +KRD++   R RD
Sbjct  750   NADSYYNKKRKDEEHLRREHVEKEEILHGKREGKSHRKRERDEVFEPQKRDEL--LRVRD  807

Query  786   DQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVG  607
             +      D H   +KEE L Q ER +R R++++W+R +QS +E LSKR+RDEGR  +R G
Sbjct  808   NI----GDHHIVGHKEEWL-QRERSDRPRDKEDWHRXEQSREENLSKRDRDEGRSSIRSG  862

Query  606   RAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGR  427
               AEEK+W    R KDE K S++EY  KD  RH E  KRR+R E  S SR R RED Y R
Sbjct  863   HGAEEKAWGSHVRVKDENKVSEKEYPGKDV-RHSEQNKRRDRMEEES-SR-RGREDSYSR  919

Query  426   GHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNL  247
              + PST++RR+R E+ S+ + HAA   D+ ++H+K+ K++  K++  + SD N+L PS  
Sbjct  920   RNPPSTEDRRSRLEKSSSER-HAANAFDNQRIHDKRHKDSKMKNREVDGSDHNALGPSKK  978

Query  246   NEDDRSGNASETVC  205
             ++++++   S+ V 
Sbjct  979   SQENQNSYRSQVVL  992



>ref|XP_008336909.1| PREDICTED: uncharacterized protein LOC103400008 [Malus domestica]
Length=616

 Score =   365 bits (936),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 238/402 (59%), Positives = 278/402 (69%), Gaps = 24/402 (6%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHG       GG G +D+DD D LVIVA+ +   +QPM ++QEWG+E   + 
Sbjct  191   LQIVLNDNNHG-AMAMERGGMGGEDEDDDDGLVIVADGE--PNQPM-DDQEWGEESAXTV  246

Query  3030  DGERKEDAAKVNVGPG---YAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggt  2860
             +GERKE       G G     PK+GYS+HGYH P+HSQFKYVRPGA P+PG    GPGG 
Sbjct  247   EGERKEMGEAGKTGAGSVVVPPKVGYSSHGYH-PFHSQFKYVRPGAVPMPGPTTSGPGGV  305

Query  2859  pgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSGRGIGLD  2698
             PGQV P +N   V GRGRGDWRP GM+    +QK F      PG+        G G GL+
Sbjct  306   PGQVRPLLNMGPVPGRGRGDWRPTGMRDGTPLQKNFHSGFGTPGWGNNTGG-RGFGGGLE  364

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLE LRLESTMQ 
Sbjct  365   FTLPSHKTIFDVDIDGFEEKPWKYPGVDASDFFNFGLNEDSWKDYCKQLELLRLESTMQS  424

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             KIRVYESGRTEQEYDPDLPPELAAA GI ++P ENAN GK++V Q+DL +G+ R RPP+P
Sbjct  425   KIRVYESGRTEQEYDPDLPPELAAATGIHELPPENANPGKSDV-QSDLVKGTARLRPPIP  483

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG------NQPSR  2176
              GR IQVE G G+RLPSIDTRPPRVRDSDAIIEIV Q S DDD++   G      N   R
Sbjct  484   TGRAIQVEGGFGERLPSIDTRPPRVRDSDAIIEIVLQDSLDDDSSAGNGIPDGAENDHPR  543

Query  2175  EGIRGGDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFN  2050
             EG   G+  G L Q +    DG   A N  KRE   R+  F+
Sbjct  544   EGFGRGE--GHLAQVESECFDGLPQASNDRKRELVGRKMPFH  583



>gb|KDO59424.1| hypothetical protein CISIN_1g000758mg [Citrus sinensis]
Length=1048

 Score =   349 bits (895),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 254/527 (48%), Positives = 307/527 (58%), Gaps = 82/527 (16%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQ-PMVEEQEWGDELGNS  3034
             L+IVLN++NH PM +D  GGD DDD+D   PLVIVA++D  +HQ  MVEEQEWG   G+ 
Sbjct  153   LQIVLNEDNHRPMLIDGGGGDDDDDEDGD-PLVIVADADASNHQGLMVEEQEWG---GDD  208

Query  3033  ADGERKEDAAKVNVGPG--------------YAPKIGYSNH-GYHHPYHSQFKYVRpgaa  2899
             A  +  E  A+   G G               A KIGYSNH  YH+PYHSQFKYVRPGAA
Sbjct  209   APAQMGEGGAEKKEGTGERANGAAASAATAAAAAKIGYSNHFAYHNPYHSQFKYVRPGAA  268

Query  2898  pipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF-PGYNAWGSNP  2722
             PIPG+      G PGQV P VN    AGRGRGDWRP GMK A  MQKGF PG+    S  
Sbjct  269   PIPGSATAVAAGGPGQVRPLVNMGPAAGRGRGDWRPAGMKTAPPMQKGFHPGFGMSASGV  328

Query  2721  SGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQL  2542
             +  G GL+FTLPSHKTIFEVDID F+EKPW+  G+D++DFFNFGLNEESWKDYCKQLEQ 
Sbjct  329   NMAGRGLEFTLPSHKTIFEVDIDGFEEKPWKYPGVDITDFFNFGLNEESWKDYCKQLEQH  388

Query  2541  RLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGS  2362
             RLE+TMQ KIRVYESGR +                                         
Sbjct  389   RLETTMQSKIRVYESGRDQ-----------------------------------------  407

Query  2361  IRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG---  2191
                    P GR IQVE GSG+RLPSIDTRPPR+RDSDAIIEIVCQ S DDD++   G   
Sbjct  408   -------PTGRAIQVEGGSGERLPSIDTRPPRIRDSDAIIEIVCQDSVDDDSSAGNGDRD  460

Query  2190  NQPSREGIRG-----GDEIGDLQQEDIHHVDGFQHAYNGWKREFGSRRAEFNSGPYDK-S  2029
             N   RE  RG      DE+G +   D  + DGF+ AY+   RE     A F +  +D   
Sbjct  461   NDLPREDRRGENDGAEDEMGPV---DTEYFDGFREAYDSRNRELVRHEAPFMNVAHDNIP  517

Query  2028  RSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIGASESPKD  1849
               + ++  P E P  Y P SRG T  YPG     +H+  R  GR   RS  +  S+SP+ 
Sbjct  518   EGNGLLPFPPEAPLRYRPGSRGPTPKYPGENIGTSHEQRRRPGRTGDRSPRMTPSQSPQI  577

Query  1848  KQIDVDNRREDSLSVGDrrsplssspvsnrsVQESAVENNDNLHDEL  1708
             ++   DN+ E+S+   + +    SSPV  R  +E +VE+ D +HDEL
Sbjct  578   RKFH-DNQDEESVESMEGKHSPLSSPVIVRDARELSVEHKDAVHDEL  623


 Score =   322 bits (824),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 215/429 (50%), Positives = 293/429 (68%), Gaps = 16/429 (4%)
 Frame = -1

Query  1467  DGLEEEVQDKRFAHVDDTRQTGGE-EDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYD  1294
             +G EE +QD+R   +   ++   E E   +RK R+  +E E++RM+  GRE S+ R+ +D
Sbjct  626   EGDEEVMQDRRSTRMGSMKKHPEENEQSFRRKDREGRQEMERNRMVAIGREGSHPRRDFD  685

Query  1293  sssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKRE--HGDEIESKHR  1120
              S  H    K    DRRKER+ SD  WQ R+D+ + R++++ED+RKRE  H DEI ++HR
Sbjct  686   PSLTHDMQMKPEGFDRRKERENSDGVWQRREDEPYSRKNRIEDTRKREREHLDEIGARHR  745

Query  1119  NKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKR  940
              K R+ +R +R+     RKQLDNGS RP +DKDA SRHRER+ D LKSRY+ +DD  SKR
Sbjct  746   GKARESERIDRDEYLHSRKQLDNGSYRPHYDKDASSRHRERD-DSLKSRYEMVDDYISKR  804

Query  939   RKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE--D  766
             RK+D  + R+H +++E LH   D T RRKRERDDI DQR+R+D         QR+RE  D
Sbjct  805   RKDDEYVRRDHAEKDEILHGHRDLTSRRKRERDDILDQRRRED--------QQRIRENFD  856

Query  765   DQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKS  586
             D H  R+K+E   Q ERGER RER++W+R K  H+EILSKRER+EGRG +R GR++E+++
Sbjct  857   DHHPVRHKDENWSQRERGERQREREDWHRLK-PHEEILSKREREEGRGAVRSGRSSEDRA  915

Query  585   WAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTD  406
             W G +R KDEYKGSD+EY  KD  RH E LKRRER E+ S   HR RED Y RG+Q S +
Sbjct  916   WVGHARVKDEYKGSDKEYQVKDTVRHSEQLKRRERIEDESRPPHRGREDVYARGNQISNE  975

Query  405   ERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSG  226
             +R++R ER  TR D +A  SD+++V+EKK KE+S K++  E  + NSL+ S  N++D+SG
Sbjct  976   DRKSRQERSGTRNDRSANTSDNNRVNEKKHKESSRKNRESEVGNHNSLVASKRNQEDQSG  1035

Query  225   NASETVC*I  199
             + SE VC I
Sbjct  1036  HVSEMVCSI  1044



>ref|XP_002864546.1| hypothetical protein ARALYDRAFT_495910 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40805.1| hypothetical protein ARALYDRAFT_495910 [Arabidopsis lyrata subsp. 
lyrata]
Length=1205

 Score =   349 bits (896),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 236/316 (75%), Gaps = 14/316 (4%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  2956
             PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  193   PLVIVADTD--PNQPM-EEQLWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  248

Query  2955  HGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKG  2776
             HGYH P+HSQFKYVRPGAAPIPG      G + GQV PP N   +AGRGRGDWRP GM+ 
Sbjct  249   HGYH-PFHSQFKYVRPGAAPIPGGAASVGGTSSGQVRPPANLGPLAGRGRGDWRPLGMRN  307

Query  2775  ALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFN  2596
             A   QKGF  +  WGSN +GRG  LDFTLPSHKTIFEVDI+SF+EKPWR  G+DM+D+FN
Sbjct  308   ASAAQKGF--HQPWGSNTAGRG--LDFTLPSHKTIFEVDIESFEEKPWRYPGVDMTDYFN  363

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FGLNEESWKDYCKQL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P +
Sbjct  364   FGLNEESWKDYCKQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVD  423

Query  2415  NANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
             ++NL K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEI
Sbjct  424   SSNLVKPDSVQGDSAKVPANVRPSLPPGRPIPVEAGSGERLPSIDTRAPRMRDLDAIIEI  483

Query  2235  VCQGSADDDNNLEQGN  2188
             VCQ S +D+ + E G 
Sbjct  484   VCQDSHEDEPSGENGT  499


 Score =   154 bits (389),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 230/446 (52%), Gaps = 38/446 (9%)
 Frame = -1

Query  1617  IDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QD  1441
             ++  ++HK+SS+  + + QE DGGE SK  RSSE+SK RSGS KDY +L DG EEEV QD
Sbjct  588   VEMGEEHKMSSKFPQSAVQEDDGGE-SKTERSSESSKARSGSHKDYQQLKDGAEEEVIQD  646

Query  1440  KRFAH-VDDTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsH  1270
             K +     + +Q         RK +D  KE E+ R   KG RE+S      DSS  +   
Sbjct  647   KHYTRPASNRKQHDNNAPHQSRKNQDRGKEVERTRAASKGGRENSNPHMELDSSYIYSIA  706

Query  1269  TKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSE  1090
              +    D+RKERD     W+ ++DD + RR   + SRKR+  D+   + R K+R+ +   
Sbjct  707   NREDF-DKRKERDVDGGVWRRKEDDPYSRRGGDDGSRKRDREDDPGFRQRGKMRENEIRS  765

Query  1089  REGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSRE  910
             ++     RK +D+  +R +++                      DD  SKRRK++  L R 
Sbjct  766   KDDHVPSRKHMDDAGMRNNYE---------------------ADDHISKRRKDEEYLRRS  804

Query  909   HVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPL  730
               ++ E  + + +   R KRERDD  + +KRD     + RDD     DD    R++++  
Sbjct  805   RPEKNEISYGQRESISRLKRERDDRLEHQKRD--VQHKIRDDF----DDHSSLRHRDDIY  858

Query  729   FQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYK  550
              Q +  ER RERD+  + K +H++ +S R R E +  +R  R +E++    LSR KDEYK
Sbjct  859   MQRDGNERLRERDDLDKLKLTHEDGISARGR-ERQVAVRAHRGSEDR----LSRMKDEYK  913

Query  549   GSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTR  370
              SD+++ +KD  RH +  KRR+     S S HR  ED   R      +E++ R ER   +
Sbjct  914   ASDKDHLTKDTLRHAKQTKRRDYPGEESSSHHRGHEDFSARTDDIVNNEKKPRQERTGAK  973

Query  369   QDHAAYESDSSKVHEKKRKENSTKDK  292
              D      D  ++ ++K K++  K K
Sbjct  974   IDKFIDTLDGQRLQDRKHKDSRRKIK  999



>ref|NP_200612.2| FIP1 [V]-like protein [Arabidopsis thaliana]
 sp|F4KDH9.1|FIPS5_ARATH RecName: Full=FIP1[V]-like protein; Short=AtFIP1(V); AltName: 
Full=Factor interacting with poly(A) polymerase 1-like 5; Short=AtFIPS5; 
AltName: Full=Protein HOMOLOG OF YEAST FIP1 [Arabidopsis 
thaliana]
 gb|AED96990.1| FIP1 [V]-like protein [Arabidopsis thaliana]
Length=1196

 Score =   348 bits (894),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 236/316 (75%), Gaps = 14/316 (4%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  2956
             PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  190   PLVIVADTD--PNQPM-EEQMWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  245

Query  2955  HGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKG  2776
             HGYH P+HSQFKYVRPGAAPIPG      G + GQV PP N   +AGRGRGDWRP GM+ 
Sbjct  246   HGYH-PFHSQFKYVRPGAAPIPGGAASVGGPSSGQVRPPANLGPMAGRGRGDWRPLGMRN  304

Query  2775  ALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFN  2596
             A   QKGF  +  WGSN +GRG  LDFTLPSHKTIFEVDIDSF+EKPWR  G++M+D+FN
Sbjct  305   ASAAQKGF--HQPWGSNTAGRG--LDFTLPSHKTIFEVDIDSFEEKPWRYPGVEMTDYFN  360

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FGLNEESWKDYCKQL+Q R+++TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P +
Sbjct  361   FGLNEESWKDYCKQLDQHRIQTTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVD  420

Query  2415  NANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
             ++NL K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEI
Sbjct  421   SSNLVKPDSVQGDSAKVPANVRPTLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEI  480

Query  2235  VCQGSADDDNNLEQGN  2188
             VCQ S +D+ + E G 
Sbjct  481   VCQDSHEDEPSGENGT  496


 Score =   126 bits (317),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 140/438 (32%), Positives = 218/438 (50%), Gaps = 41/438 (9%)
 Frame = -1

Query  1596  KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKRFAH-VD  1420
             K+S    + + QE DGGE SK  RSSE+SK RSGS +D+ +     E+ +QDK  +   +
Sbjct  592   KMSFTSPQSAVQEDDGGE-SKTERSSESSKARSGSHRDFQQE----EDVIQDKHSSRPAN  646

Query  1419  DTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIADR  1246
             + +Q         RK +D  KE E+ R   KG RE+S      DS+  +   ++    D+
Sbjct  647   NRKQYDNNAPHQSRKNQDRGKEMERTRAASKGGRENSNPHMELDSTYIYSIASREDF-DK  705

Query  1245  RKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLR  1066
             RKERD     W+ ++DD + RR   E SRKR+  D+   + R K+R+ +   ++ +   R
Sbjct  706   RKERDVDGAVWRRKEDDPYSRRGGDEGSRKRDREDDPGFRQRGKMRENEIRSKDDQVPSR  765

Query  1065  KQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETL  886
             K +D+  +R  ++ D                     D  +KRRK++  L R   ++ E  
Sbjct  766   KHMDDAGMRNIYEPD---------------------DHINKRRKDEEYLRRSRPEKNEIS  804

Query  885   HSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGER  706
             + + +   R KRERDD  + +KRD     + RDD     DD    R +++   Q +  ER
Sbjct  805   YGQRESMSRVKRERDDRLEHQKRD--VQHKIRDDF----DDHGSLRQRDDIYMQRDGNER  858

Query  705   HRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHS  526
              RERD   + K  H++ +S R R E +  +R  R +E++S    SR KDEYK SD+E+ +
Sbjct  859   LRERDVLDKLKLPHEDGISARGR-ERQVAVRGHRGSEDRS----SRMKDEYKASDKEHVT  913

Query  525   KDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYES  346
             KD  RH +  KRR+     S S HR  ED   R      +E++ R ER   + D      
Sbjct  914   KDTLRHAKQTKRRDYPGEESSSHHRGHEDFSARTDNIVNNEKKPRQERTGAKIDKFIDTL  973

Query  345   DSSKVHEKKRKENSTKDK  292
             D  ++ ++K K++  K K
Sbjct  974   DGQRLQDRKHKDSRRKIK  991



>gb|KGN65237.1| hypothetical protein Csa_1G268310 [Cucumis sativus]
Length=785

 Score =   338 bits (866),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 266/629 (42%), Positives = 390/629 (62%), Gaps = 39/629 (6%)
 Frame = -1

Query  2049  SGPYDKSRSDRVVILPSEEPDSYHPDSRGQTSVYPGRKHAVAHDSTREKGRARCRSADIG  1870
             + P D +R D  +   SE P  +HP SRG T  Y  +   +  +  R +GR   +S    
Sbjct  2     NSPSDNTREDVNLAFTSEGP-GHHPTSRGNTPAYSAQNLGIV-EERRSQGRTYNKSP---  56

Query  1869  ASESPKDKQID---VDNRREDSL-SVGDrrsplssspvsnrsVQESAVENNDNLHDE---  1711
                SP+    D    D++ E S+ S+ D+RSP  SSP    + QE + E+ D  HDE   
Sbjct  57    --HSPRQNLQDRKSPDSQEEGSVESMDDKRSPQVSSPAIVEATQEYSAEDKDAEHDEDAE  114

Query  1710  ---LVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGED  1540
                L+ A +N+ ++R  ++    +N  K + D   +     KLS  +E    +E DG ED
Sbjct  115   HDELIEADKNTEIDRENVNFISTSNTRKIESDDE-EMENNEKLSPIVEALMLKE-DGDED  172

Query  1539  SKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGE-EDRLQRKGRD  1366
             SKAA SSEN KTRSGSS+DY K  DG+EEEV Q++R + +   ++   E E   +RK  D
Sbjct  173   SKAA-SSENRKTRSGSSRDYPKWQDGVEEEVFQNRRSSSMGSVKKYMDENEQNFRRKDSD  231

Query  1365  EKETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHG  1186
             +K+ E++RM VKGR+D+Y  + +D S AH    KT   DRRKER  ++  WQ RDDD + 
Sbjct  232   DKQDERNRMDVKGRKDAYAYRDWDPSLAHQHPLKTDGFDRRKERSNAEATWQRRDDDPYY  291

Query  1185  RRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRH  1006
             R+++ E++RKRE+ DE  S+HR+KIR+I+RS+++ RHL +K LDNGS R  +DK A SRH
Sbjct  292   RKTRTEETRKREYDDETGSRHRSKIREIERSDKDERHLTKK-LDNGSYRAHYDKGASSRH  350

Query  1005  RERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQ  826
             RER+ D LKSRY+N D  ++K+RK++  L REHV++EE LH + +G   RKRERD++ + 
Sbjct  351   RERD-DSLKSRYENADSYYNKKRKDEEHLRREHVEKEEILHGKREGKSHRKRERDEVFEP  409

Query  825   RKRDDISDQRKRDDQRLRED--DQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEIL  652
             +KRD++         R+R++  D H   +KEE   Q ER +R R++++W+RPKQS +E L
Sbjct  410   QKRDEL--------LRVRDNIGDHHIVGHKEE-WLQRERSDRPRDKEDWHRPKQSREENL  460

Query  651   SKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDEN  472
             SKR+RDEGR  +R G  AEEK+W    R KDE K S++EY  KD  RH E  KRR+R E 
Sbjct  461   SKRDRDEGRSSIRSGHGAEEKAWGSHVRVKDENKVSEKEYPGKDV-RHSEQNKRRDRMEE  519

Query  471   GSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDK  292
              S SR R RED Y R + PST++RR+R E+ S+ + HAA   D+ ++H+K+ K++  K++
Sbjct  520   ES-SR-RGREDSYSRRNPPSTEDRRSRLEKSSSER-HAANAFDNQRIHDKRHKDSKMKNR  576

Query  291   VPEASDKNSLLPSNLNEDDRSGNASETVC  205
               + SD N+L PS  ++++++   S+ V 
Sbjct  577   EVDGSDHNALGPSKKSQENQNSYRSQMVL  605



>gb|KFK27337.1| hypothetical protein AALP_AA8G370000 [Arabis alpina]
Length=1172

 Score =   345 bits (885),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 251/352 (71%), Gaps = 12/352 (3%)
 Frame = -1

Query  3210  LRIVLNDNNH--GPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLNDN              + DDD+DD +PLVIVA++D  ++QPM EEQ WG++   
Sbjct  138   LQIVLNDNVMIGADRRSRMGDNEDDDDEDDEEPLVIVADAD--TNQPM-EEQFWGEDGLQ  194

Query  3036  SADGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtp  2857
               DG+ KE        P    K GYS HGYH P+HSQ+KYVRPGAAPIPG  P   G + 
Sbjct  195   GVDGDGKEGGEAGKGIPTGPVKAGYSGHGYH-PFHSQYKYVRPGAAPIPGGAPSAGGTSV  253

Query  2856  gqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHK  2677
             GQ+ PP N  LVAGRGRGDWRP GM+ A   QKGF  +  WGSN +GRG  LDFTLPSHK
Sbjct  254   GQIRPPTN--LVAGRGRGDWRPMGMRNASATQKGF--HQTWGSNTAGRG--LDFTLPSHK  307

Query  2676  TIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYES  2497
             TIFEVDI++F+EKPWR QG+D+SD+FNFGLNEESWKDYCKQL+Q R+E+TMQ +IRVYES
Sbjct  308   TIFEVDIETFEEKPWRYQGVDVSDYFNFGLNEESWKDYCKQLDQRRIETTMQSRIRVYES  367

Query  2496  GRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQV  2317
             GRT+Q YDPDLPPELAAA G Q +P +++NL K +  Q D A+     RP +P GRPI V
Sbjct  368   GRTDQGYDPDLPPELAAATGAQGVPVDSSNLVKPDTAQGDSAKVPAHVRPSIPPGRPIPV  427

Query  2316  ESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPSREGIRG  2161
             E+GSG+R+PS DTR PR+RD DAIIEIVCQ   +D+ + E G + +   + G
Sbjct  428   ETGSGERMPSADTRAPRMRDLDAIIEIVCQPLPEDEPSGENGTEQADSSLPG  479


 Score =   146 bits (368),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 148/440 (34%), Positives = 228/440 (52%), Gaps = 38/440 (9%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAH-  1426
             +K++S + + + QE DGGE SK  RSSE+SK RS S KD  +L DG EEEV QDK++A  
Sbjct  564   YKMNSTVPQSAVQEDDGGE-SKTERSSESSKARSESHKDDQQLKDGAEEEVSQDKQYARP  622

Query  1425  VDDTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIA  1252
               + +          RK ++  KE E+ R   +G RE+S     +DS+  H +  +    
Sbjct  623   ASNKKHHDNNAPHQSRKNQNRGKEMERTRAASRGGRENSNPHMEFDSNYIHST-ARAEDF  681

Query  1251  DRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHL  1072
             D+RKERD     W+ ++DD + RR   E SRKR+  D+  S+ R K+R+ +   ++    
Sbjct  682   DKRKERDVDVGVWRRKEDDTYSRRGD-EGSRKRDREDDPGSRQRGKMRESEIRSKDDHVP  740

Query  1071  LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREE  892
              RK LD+G LR  ++                     +DD  +KRRK++  L R   ++ E
Sbjct  741   SRKHLDDGGLRNSYE---------------------VDDHINKRRKDEEYLRRNRSEKNE  779

Query  891   TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERG  712
               + + +   R KRERDD  + +KRD     + RDD     DD    R++++   Q +  
Sbjct  780   IPYGQRESISRLKRERDDRFEHQKRD--VQHKIRDDF----DDHSSLRHRDDFYMQRDGN  833

Query  711   ERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREY  532
             ER RER+++ + K  H++ LS R R+  +  +R  R +E++S    SR KDEYK +++E 
Sbjct  834   ERLREREDFDKLKLIHEDSLSARGRERHQVAVRGHRGSEDRS----SRMKDEYKVAEKEQ  889

Query  531   HSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAY  352
              +KD  RH +  KRRE     S S HR  ED   R      +E++ R ER   + D    
Sbjct  890   LTKDTARHTKQTKRREYPGEESSSHHRGHEDFSARTDNIVNNEKKPRQERTGAKSDKVID  949

Query  351   ESDSSKVHEKKRKENSTKDK  292
               D  ++ +KK K++  K K
Sbjct  950   SLDGQRLQDKKHKDSRRKIK  969



>ref|XP_010443517.1| PREDICTED: uncharacterized protein LOC104726372 [Camelina sativa]
Length=1212

 Score =   345 bits (885),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 229/314 (73%), Gaps = 13/314 (4%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDE---LGNSADGERKEDAAKVNVGPGYAPKIGYSNHG  2950
             PLVIVA++D   +QPM EEQ WG E    G   DG+   +A K   GPG APK GYS+HG
Sbjct  204   PLVIVADTD--PNQPM-EEQLWGGEDGLQGVEGDGKDGGEAGK-GTGPGSAPKAGYSSHG  259

Query  2949  YHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGAL  2770
             +HHP+HSQFKYVRPGAAPIPG  P   G       P  N   + GRGRGDWRPPGM+ A 
Sbjct  260   FHHPFHSQFKYVRPGAAPIPGGAPPTGGTAGQVRPPA-NLGPMVGRGRGDWRPPGMRNAS  318

Query  2769  TMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFG  2590
               QKGF  + +WG N +GRG  LDFTLPSHKTIFEVDI+SF+EKPWR   ++M+D+FNFG
Sbjct  319   APQKGF--HQSWGGNTAGRG--LDFTLPSHKTIFEVDIESFEEKPWRYPVVEMTDYFNFG  374

Query  2589  LNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENA  2410
             LNEESWKDYCKQL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P +++
Sbjct  375   LNEESWKDYCKQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDSS  434

Query  2409  NLGKTEVG-QNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIV  2233
             N+ K +   Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEIV
Sbjct  435   NVVKPDSAVQGDSAKVPANVRPSLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEIV  494

Query  2232  CQGSADDDNNLEQG  2191
             C    +D+ + E G
Sbjct  495   CHDPHEDEPSGENG  508


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 155/441 (35%), Positives = 226/441 (51%), Gaps = 38/441 (9%)
 Frame = -1

Query  1602  KHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAH  1426
             +HK SS + + + QE D GE SK  RSSE+ K RSG+ +DY +  DG EEEV QDK +A 
Sbjct  604   EHKTSSVVPQSAVQEDDVGE-SKTERSSESGKARSGNHRDYQRFKDGAEEEVIQDKHYAR  662

Query  1425  VDDTRQTGGEEDRLQ-RKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSI  1255
                 R+        Q RK  D  KE E+ R   KG RE+S      DSS  ++S      
Sbjct  663   PASNRKQHDNNAPYQSRKNPDRGKEMERTRAPSKGGRENSIPHMELDSSYNNYSIANRED  722

Query  1254  ADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRH  1075
              D+RKERD     W  ++DD + RR   E SRKR H D+  S+ R K+RD          
Sbjct  723   FDKRKERDVDGGVWHRKEDDPYSRRGGDEGSRKRNHEDDPGSRQRGKMRD----------  772

Query  1074  LLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDRE  895
                       +R   D     +H E   D  ++ Y+ +DD  SKRRK++  L R   ++ 
Sbjct  773   --------NEIRSKDDHIPSRKHME---DVARNTYE-VDDHISKRRKDEEFLRRSRPEKN  820

Query  894   ETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSER  715
             E  + + +   R KRERDD  + +KRD     + RDD     DD    R++++   Q + 
Sbjct  821   EITYGQRETISRLKRERDDRLEHQKRD--FQHKIRDDF----DDHSSLRHRDDFYMQRDG  874

Query  714   GERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDRE  535
              ER RER+++ + K +H++ LS R R E +  +R  R +E++S    SR KDEYK SD+E
Sbjct  875   NERLREREDFDKLKLTHEDGLSARGR-ERQVAVRAHRGSEDRS----SRMKDEYKVSDKE  929

Query  534   YHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAA  355
             + +KD  RH +  KRR+     S S HR  ED   R     ++E++ R ER   + D   
Sbjct  930   HFTKDTTRHTKQAKRRDYPGEESSSHHRGYEDFSARADDIVSNEKKPRQERTGAKSDKVI  989

Query  354   YESDSSKVHEKKRKENSTKDK  292
                D  ++ ++K K++  K+K
Sbjct  990   DTLDGQRLQDRKHKDSRRKNK  1010



>ref|XP_006279559.1| hypothetical protein CARUB_v10025759mg [Capsella rubella]
 gb|EOA12457.1| hypothetical protein CARUB_v10025759mg [Capsella rubella]
Length=1204

 Score =   343 bits (879),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 231/315 (73%), Gaps = 16/315 (5%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  2956
             PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  189   PLVIVADTD--PNQPM-EEQHWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  244

Query  2955  HGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKG  2776
             HGYH P+HSQFKYVRPGAAPIPG      G +     P       AGRGRGDWRP GM+ 
Sbjct  245   HGYH-PFHSQFKYVRPGAAPIPGGAASTGGTSGQVRPPANLGP--AGRGRGDWRPLGMRN  301

Query  2775  ALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFN  2596
             A   QKGF  + +WGSN +GR  GLDFTLPSHKTIFEVDI+SF+EKPWR  GIDM+D++N
Sbjct  302   ASAAQKGF--HQSWGSNTAGR--GLDFTLPSHKTIFEVDIESFEEKPWRYPGIDMTDYYN  357

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FGLNEESWKDYCKQL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P +
Sbjct  358   FGLNEESWKDYCKQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVD  417

Query  2415  NANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
             ++NL K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEI
Sbjct  418   SSNLVKPDSVQGDSAKVPANVRPSLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEI  477

Query  2235  VCQGSADDDNNLEQG  2191
             VCQ S +D+ + E G
Sbjct  478   VCQDSHEDEPSGENG  492


 Score =   150 bits (378),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 160/462 (35%), Positives = 236/462 (51%), Gaps = 45/462 (10%)
 Frame = -1

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             SVD     D+   D+  D  ++HK+SS + + + QE DGGE SK  RSSE+SK RSGS +
Sbjct  581   SVDREDVGDEVGKDA--DMEEEHKVSSTVPQSAVQEDDGGE-SKTERSSESSKARSGSHR  637

Query  1485  DYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDRLQ-RKGRDE-KETEKHRMIVKG-RED  1318
             DY +L DG+EEEV QDK +A     R+        Q RK +D  KE E+ R   KG RE+
Sbjct  638   DYPQLKDGVEEEVIQDKHYARPASNRKQHDNNAPYQSRKNQDRGKEMERTRAASKGGREN  697

Query  1317  SYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDE  1138
             S      DSS  +    +    DRRKERD     W+  +DD + RR   E SRKR+  D+
Sbjct  698   SNPHMELDSSYIYSIANREDF-DRRKERDVDGGVWRRTEDDPYSRRGGDEGSRKRDREDD  756

Query  1137  IESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNID  958
               S+ R K+R+ +   ++     RK +D                      D+      +D
Sbjct  757   PGSRQRGKMRENEIRSKDDHVPSRKHMD----------------------DVGRNIYEVD  794

Query  957   DRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQR  778
             D  +KRRK++  L R   ++ E  + + +   R KRERDD  + +KRD     + RDD  
Sbjct  795   DHINKRRKDEEYLRRSRPEKSEIPYGQRESISRLKRERDDRMEHQKRD--FQHKIRDDF-  851

Query  777   LREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAA  598
                DD    R++++   Q +  ER RER++    K  H++ LS R R E +  +R  R +
Sbjct  852   ---DDHSSLRHRDDFYMQRDGNERLRERED----KPMHEDGLSARGR-ERQVAVRAHRGS  903

Query  597   EEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQ  418
             E++S    SR KDEYK SD+E+ +KD  RH +  KRR+     S S HR  ED   R   
Sbjct  904   EDRS----SRMKDEYKASDKEHLTKDTTRHTKQTKRRDYPGEESSSHHRGYEDFSARTDD  959

Query  417   PSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKENSTKDK  292
               ++E++ R+ER   + D      D+ ++ ++K K++  K K
Sbjct  960   IVSNEKKPRHERTGAKNDKVIDTLDAQRLLDRKHKDSRRKIK  1001



>ref|XP_006401136.1| hypothetical protein EUTSA_v10012479mg [Eutrema salsugineum]
 gb|ESQ42589.1| hypothetical protein EUTSA_v10012479mg [Eutrema salsugineum]
Length=1200

 Score =   341 bits (875),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 233/324 (72%), Gaps = 17/324 (5%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKEDA-AKVNVGPGYAP---KIGYSNH  2953
             PLVIVA++D   +QPM EEQ WG++     DG+ K+   A    GPG A    K GYS+H
Sbjct  193   PLVIVADAD--PNQPM-EEQMWGEDGLQVVDGDGKDGGEAGKGSGPGGASGQSKTGYSSH  249

Query  2952  GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGA  2773
             GYH P+HSQFKYVRPGAAP+PG+        P       N   +AGRGRGDWRP GM+ A
Sbjct  250   GYH-PFHSQFKYVRPGAAPMPGSAASSGQVRPPA-----NLGPMAGRGRGDWRPMGMRNA  303

Query  2772  LTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNF  2593
                QKGF  +  WGSN +GRG  LDFTLPSHKTIFEVDI++F+EKPWR QG D++D+FNF
Sbjct  304   SAPQKGF--HQTWGSNTAGRG--LDFTLPSHKTIFEVDIETFEEKPWRYQGNDVTDYFNF  359

Query  2592  GLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSEN  2413
             GLNEESWKDYCKQL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P ++
Sbjct  360   GLNEESWKDYCKQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDS  419

Query  2412  ANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIV  2233
             +NL K +  Q+D  +    +RP LP GRPI VE+GSG+R+PS DTR PR+RD DAIIEIV
Sbjct  420   SNLVKPDTTQSDSVKVPAHARPSLPPGRPIPVETGSGERMPSSDTRAPRMRDLDAIIEIV  479

Query  2232  CQGSADDDNNLEQGNQPSREGIRG  2161
             CQ S +D+ + E G + +   + G
Sbjct  480   CQDSHEDEPSGENGAEQADSSLPG  503


 Score =   145 bits (366),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 223/442 (50%), Gaps = 38/442 (9%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAH-  1426
             HK+SS + + + QE +G E SKA RSSE+SK RSGS +DY +L DG EEEV QD   A  
Sbjct  588   HKMSSAVPQSAVQEDEGVE-SKAERSSESSKARSGSHRDYQQLKDGAEEEVIQDNNSARP  646

Query  1425  VDDTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIA  1252
               + +          RK +D  KE E+ R   KG RE S      DS   +   +     
Sbjct  647   ASNKKNHDNNAPHQSRKTQDRGKEMERSRAASKGGREYSNPHMEVDSCYNYSIASGEDF-  705

Query  1251  DRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHL  1072
             DRRKERD     W+ ++DD   RR   E SRKR+  D++ S+ R K+R+ +   ++    
Sbjct  706   DRRKERDVDGGVWRRKEDDPFIRRGGDEGSRKRDREDDLGSRQRGKMRESEIRSKDDHVP  765

Query  1071  LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREE  892
              RK LD+  LR  ++                     +D+  SKRRK++  L R   ++ E
Sbjct  766   SRKHLDDVGLRNSYE---------------------LDNHISKRRKDEEYLRRNRSEKNE  804

Query  891   TLHSRGDGTLRRKRERDDISDQRKRDDISD--QRKRDDQRLREDDQHYARYKEEPLFQSE  718
               + + +   R KRER D  D +KRD   +   + RDD     DD    R++++   Q +
Sbjct  805   ISYGQRESISRLKRERGDRLDHQKRDAQHNVQHKFRDDF----DDHGSLRHRDDFYMQRD  860

Query  717   RGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDR  538
               ER RER+++ + K +H++ LS R R E     R  R +E++S    S+ KDEYK SD+
Sbjct  861   GNERLREREDFDKLKLTHEDGLSARGR-ERHVAARGHRGSEDRS----SKMKDEYKASDK  915

Query  537   EYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHA  358
             E+ +KD  RH +  KRRE     S S HR  ED   R      +E++ R ER   + D  
Sbjct  916   EHLTKDTARHTKQTKRREYPGEESSSHHRGNEDFSARTDDFVNNEKKTRQERTGAKSDKV  975

Query  357   AYESDSSKVHEKKRKENSTKDK  292
                SD  ++ ++K K++  K K
Sbjct  976   MDSSDGQRLQDRKHKDSRRKIK  997



>emb|CDY43886.1| BnaC09g33570D [Brassica napus]
Length=1161

 Score =   340 bits (872),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 248/350 (71%), Gaps = 14/350 (4%)
 Frame = -1

Query  3210  LRIVLNDNN-HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE--LG  3040
             L+IVLNDNN        R     +DDDDD +PLVIV ++D   +QPM E+Q WG++   G
Sbjct  131   LQIVLNDNNVMMGGDNRRSRMGDNDDDDDEEPLVIVTDTD--QNQPM-EDQLWGEDGLQG  187

Query  3039  NSADGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgp  2869
                +G+     A    GPG A   PK GYS+HGYH P+HSQFKYVRPGAAP  G      
Sbjct  188   VEGEGKEGGGEALKGSGPGGAVGPPKAGYSSHGYH-PFHSQFKYVRPGAAPTLGGAASNA  246

Query  2868  ggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTL  2689
             G + GQV PPVN   VAGRGRGDWRP GM+     QKG+  + AWGSN +GRG  LDFTL
Sbjct  247   GTSSGQVRPPVNLGPVAGRGRGDWRPMGMRNPSVAQKGY--HQAWGSNTAGRG--LDFTL  302

Query  2688  PSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIR  2509
             PSHKTIFEVDI++F+EKPWR QG+D++D+FNFGLNEE+W DYC+QL+Q R+E+TMQ +IR
Sbjct  303   PSHKTIFEVDIETFEEKPWRYQGVDITDYFNFGLNEETWIDYCRQLDQRRIETTMQSRIR  362

Query  2508  VYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGR  2329
             VYESGRT+Q YDPDLPPELAAA G Q +P  +++L K E  Q D A+     RP LP GR
Sbjct  363   VYESGRTDQGYDPDLPPELAAATGAQGVPVGSSDLVKVETAQGDSAKVPAHVRPALPPGR  422

Query  2328  PIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPS  2179
             PI VE+GSG+R PS+DTR PR+RD DAIIEIVCQ S +D  + E   +P+
Sbjct  423   PIPVETGSGERQPSVDTRAPRMRDLDAIIEIVCQDSHEDAPSGENDTEPA  472


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 143/433 (33%), Positives = 211/433 (49%), Gaps = 52/433 (12%)
 Frame = -1

Query  1563  QETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDR  1387
             QE DGGE SK  RSS NSK RS S +D+ +L D  E+EV Q+K       +++       
Sbjct  571   QEDDGGE-SKTERSSGNSKARSESHRDHQQLKDSAEQEVIQNKHSTRPASSKKHHDNSAP  629

Query  1386  LQ-RKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIA-----DRRKERD  1231
              Q RK +D  KE E+ R   KG RE S      D           SIA     DRRKERD
Sbjct  630   YQSRKNQDRGKEMERTRAASKGGREYSNPHTDVDY----------SIARGDDYDRRKERD  679

Query  1230  YSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDN  1051
                  W+ ++DD   RR   E  RKR+  +++ SK R K+R+ D   ++     RK LD+
Sbjct  680   VDGGFWRRKEDDPFSRRGGDEGFRKRDREEDLGSKQRGKMRESDIRNKDDHVPSRKHLDD  739

Query  1050  GSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGD  871
             G LR  ++                     +DD   KRRK++  L R   ++ E  + + +
Sbjct  740   GGLRNSYE---------------------LDDHIGKRRKDEEYLRRNRSEKNEISYGQRE  778

Query  870   GTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERD  691
              T R KRER D  D +KRD     + RDD     DD    R++++   Q +  ER RER+
Sbjct  779   STSRLKRERGDRLDHQKRD--VQHKSRDDF----DDHSSLRHRDDFYMQRDGNERLRERE  832

Query  690   EWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGR  511
             +  + K + ++ LS R R+      R  R +E++S    S  KD+YK S++E+ +KD+ R
Sbjct  833   DMDKLKLTQEDGLSARGRERQVPTTRGHRGSEDRS----SMMKDDYKASEKEHLTKDSTR  888

Query  510   HVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKV  331
             H +  KRRE     S S HR   D   R  +   +E+  R E+ S + D+     D  ++
Sbjct  889   HSKQTKRREYHGEES-SHHRGHGDFSARTDETVNNEKMPRQEKTSAKSDNVINSMDGQQL  947

Query  330   HEKKRKENSTKDK  292
              ++K K++  K K
Sbjct  948   QDRKHKDSRRKIK  960



>ref|XP_009120319.1| PREDICTED: filaggrin isoform X1 [Brassica rapa]
Length=1172

 Score =   340 bits (871),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 251/353 (71%), Gaps = 17/353 (5%)
 Frame = -1

Query  3210  LRIVLNDNNHGP----mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-  3046
             L+IVLNDNN               + DDDDDD +PLVIV ++D   +QPM E+Q WG++ 
Sbjct  139   LQIVLNDNNVMMGGDNRRSRMGDNEADDDDDDEEPLVIVTDTD--QNQPM-EDQLWGEDG  195

Query  3045  -LGNSADGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgapp  2878
               G   +G+     A    GPG A   PK GYS+HGYH P+HSQFKYVRPGAAP+PG   
Sbjct  196   LQGVEGEGKEGGGEALKGSGPGGAVGPPKAGYSSHGYH-PFHSQFKYVRPGAAPMPGGAA  254

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLD  2698
               PG + GQV PP N   +AGRGRGDWRP GM+     QKG+  + AWGSN +GRG  LD
Sbjct  255   SAPGTSSGQVRPPANLGPMAGRGRGDWRPMGMRNPSVAQKGY--HQAWGSNTAGRG--LD  310

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIFEVDI++F++KPWR QG+D++D+FNFGLNEE+W DYCKQL+Q R+E+TMQ 
Sbjct  311   FTLPSHKTIFEVDIETFEDKPWRYQGVDITDYFNFGLNEETWIDYCKQLDQRRIETTMQS  370

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             +IRVYESGRT+Q YDPDLPPELAAA G Q +P +++NL K E  Q D A+     RP LP
Sbjct  371   RIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDSSNLVKVETAQVDSAKVPAHVRPALP  430

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPS  2179
              GRPI VE+GSG+R PS+DTR PR+RD DAIIEIVCQ S +D  + E   +P+
Sbjct  431   PGRPIPVETGSGERQPSVDTRAPRMRDLDAIIEIVCQDSHEDAPSGENDTEPA  483


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 140/428 (33%), Positives = 209/428 (49%), Gaps = 42/428 (10%)
 Frame = -1

Query  1563  QETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDR  1387
             QE DGGE SK  RSS NSK RS S +D+ +L D  E+EV Q+K       +++       
Sbjct  582   QEDDGGE-SKTERSSGNSKARSESHRDHQQLKDSAEQEVIQNKHSTRPASSKKHHDNSAP  640

Query  1386  LQ-RKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVA  1216
              Q RK +D  KE E+ R   KG RE S      D +       +    DRRK RD     
Sbjct  641   YQSRKNQDRGKEMERTRAASKGGREYSNPHTDVDYTI-----ARGDDYDRRKGRDVDGGF  695

Query  1215  WQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRP  1036
             W+ ++DD   RR   E  RKR+  +++ SK R K+R+ D   ++     RK LD+G LR 
Sbjct  696   WRRKEDDPFSRRGGDEGFRKRDREEDLSSKQRGKMRESDIRNKDDHVPSRKHLDDGGLRN  755

Query  1035  DHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRR  856
              ++                     +DD   KRRK++  L R   ++ E  H + + T R 
Sbjct  756   SYE---------------------LDDHIGKRRKDEEYLRRNRSEKNEISHGQRESTSRL  794

Query  855   KRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRP  676
             KRER D  D +KRD     + RDD     DD    R++++   Q +  ER RER++  + 
Sbjct  795   KRERGDRLDHQKRD--VQHKSRDDF----DDHSSLRHRDDFYMQRDGNERLREREDMDKL  848

Query  675   KQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHL  496
             K + ++ LS R R+      R  R +E++S    S  KD+YK S++E+ +KD+ RH +  
Sbjct  849   KLTQEDGLSARGRERQVPTTRGHRGSEDRS----SMMKDDYKASEKEHLTKDSTRHSKQT  904

Query  495   KRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKR  316
             KRRE     S S HR   D   R  +   +E+  R E+ S + D+     D  ++ ++K 
Sbjct  905   KRREYHGEES-SHHRGHGDFSARTDETVNNEKMPRQEKTSAKSDNVINSMDGQQLQDRKH  963

Query  315   KENSTKDK  292
             K++  K K
Sbjct  964   KDSRRKIK  971



>ref|XP_009120320.1| PREDICTED: filaggrin isoform X2 [Brassica rapa]
Length=1153

 Score =   339 bits (870),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 251/353 (71%), Gaps = 17/353 (5%)
 Frame = -1

Query  3210  LRIVLNDNNHGP----mgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDE-  3046
             L+IVLNDNN               + DDDDDD +PLVIV ++D   +QPM E+Q WG++ 
Sbjct  139   LQIVLNDNNVMMGGDNRRSRMGDNEADDDDDDEEPLVIVTDTD--QNQPM-EDQLWGEDG  195

Query  3045  -LGNSADGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgapp  2878
               G   +G+     A    GPG A   PK GYS+HGYH P+HSQFKYVRPGAAP+PG   
Sbjct  196   LQGVEGEGKEGGGEALKGSGPGGAVGPPKAGYSSHGYH-PFHSQFKYVRPGAAPMPGGAA  254

Query  2877  vgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLD  2698
               PG + GQV PP N   +AGRGRGDWRP GM+     QKG+  + AWGSN +GRG  LD
Sbjct  255   SAPGTSSGQVRPPANLGPMAGRGRGDWRPMGMRNPSVAQKGY--HQAWGSNTAGRG--LD  310

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIFEVDI++F++KPWR QG+D++D+FNFGLNEE+W DYCKQL+Q R+E+TMQ 
Sbjct  311   FTLPSHKTIFEVDIETFEDKPWRYQGVDITDYFNFGLNEETWIDYCKQLDQRRIETTMQS  370

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             +IRVYESGRT+Q YDPDLPPELAAA G Q +P +++NL K E  Q D A+     RP LP
Sbjct  371   RIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDSSNLVKVETAQVDSAKVPAHVRPALP  430

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPS  2179
              GRPI VE+GSG+R PS+DTR PR+RD DAIIEIVCQ S +D  + E   +P+
Sbjct  431   PGRPIPVETGSGERQPSVDTRAPRMRDLDAIIEIVCQDSHEDAPSGENDTEPA  483


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 140/428 (33%), Positives = 209/428 (49%), Gaps = 42/428 (10%)
 Frame = -1

Query  1563  QETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDR  1387
             QE DGGE SK  RSS NSK RS S +D+ +L D  E+EV Q+K       +++       
Sbjct  582   QEDDGGE-SKTERSSGNSKARSESHRDHQQLKDSAEQEVIQNKHSTRPASSKKHHDNSAP  640

Query  1386  LQ-RKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVA  1216
              Q RK +D  KE E+ R   KG RE S      D +       +    DRRK RD     
Sbjct  641   YQSRKNQDRGKEMERTRAASKGGREYSNPHTDVDYTI-----ARGDDYDRRKGRDVDGGF  695

Query  1215  WQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRP  1036
             W+ ++DD   RR   E  RKR+  +++ SK R K+R+ D   ++     RK LD+G LR 
Sbjct  696   WRRKEDDPFSRRGGDEGFRKRDREEDLSSKQRGKMRESDIRNKDDHVPSRKHLDDGGLRN  755

Query  1035  DHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRR  856
              ++                     +DD   KRRK++  L R   ++ E  H + + T R 
Sbjct  756   SYE---------------------LDDHIGKRRKDEEYLRRNRSEKNEISHGQRESTSRL  794

Query  855   KRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRP  676
             KRER D  D +KRD     + RDD     DD    R++++   Q +  ER RER++  + 
Sbjct  795   KRERGDRLDHQKRD--VQHKSRDDF----DDHSSLRHRDDFYMQRDGNERLREREDMDKL  848

Query  675   KQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHL  496
             K + ++ LS R R+      R  R +E++S    S  KD+YK S++E+ +KD+ RH +  
Sbjct  849   KLTQEDGLSARGRERQVPTTRGHRGSEDRS----SMMKDDYKASEKEHLTKDSTRHSKQT  904

Query  495   KRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKR  316
             KRRE     S S HR   D   R  +   +E+  R E+ S + D+     D  ++ ++K 
Sbjct  905   KRREYHGEES-SHHRGHGDFSARTDETVNNEKMPRQEKTSAKSDNVINSMDGQQLQDRKH  963

Query  315   KENSTKDK  292
             K++  K K
Sbjct  964   KDSRRKIK  971



>gb|EPS62002.1| hypothetical protein M569_12793, partial [Genlisea aurea]
Length=450

 Score =   319 bits (817),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 224/386 (58%), Positives = 263/386 (68%), Gaps = 27/386 (7%)
 Frame = -1

Query  3297  SIPGVSGVPETCGDRAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDP  3118
             +IPG+SG  E+ G    D+ WDSD  +DDL IVLNDNN   MGM+RM G  D + ++G+P
Sbjct  10    AIPGLSGKMESRGTANFDDGWDSDESEDDLEIVLNDNNRVIMGMERMKGMDDANYEEGEP  69

Query  3117  LVIVANSDDPSHQ----PMVEEQEWGDE-LGNSADGERKE--DAAKVNVG-----PGYAP  2974
             LV+VA++ D  H      M++EQEWGDE  G +ADGERKE  DA K  +G         P
Sbjct  70    LVVVADNSDLGHHLHHPHMIDEQEWGDEEAGPAADGERKESGDATKPAMGGPSAMAAVPP  129

Query  2973  KIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWR  2794
             KIGY++H YHHP HSQFKYVRPGAAPIP   P   GG   QV PP+     AGRGRGDWR
Sbjct  130   KIGYNSHMYHHPLHSQFKYVRPGAAPIPSTAPATAGGPQTQVRPPMTMPTGAGRGRGDWR  189

Query  2793  PPGMKGALTM--QKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQG  2620
             P   +G +TM  +         G +  G G GLDFTLPSHKTIFEVDID F+EKPW+LQG
Sbjct  190   PTSGRGTVTMGGRGFGGSAWGGGMSGRGYGSGLDFTLPSHKTIFEVDIDGFEEKPWKLQG  249

Query  2619  IDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaA  2440
             ID+SDFFNFGLNEESWK+YCK+LE LRLE+TMQGKIRVYESGR EQ++DPDLPPELAAA 
Sbjct  250   IDVSDFFNFGLNEESWKEYCKKLEHLRLETTMQGKIRVYESGRAEQDFDPDLPPELAAAL  309

Query  2439  GIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVR  2260
             G  D PSEN N  K E+         I +   LP GRPI VE+GS DR PS DTR  R  
Sbjct  310   GHSDFPSENTNAAKLEL--------EIET---LPVGRPIPVETGSIDRTPSADTRRLRFH  358

Query  2259  DSDAIIEIVCQGSADDDNNL--EQGN  2188
             D+D IIEI C  S DDDN +  ++GN
Sbjct  359   DNDTIIEIFCGRSVDDDNKVANQEGN  384



>dbj|BAB10995.1| unnamed protein product [Arabidopsis thaliana]
Length=1189

 Score =   334 bits (857),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 225/299 (75%), Gaps = 14/299 (5%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDE--LGNSADGERKEDAAKVNVGPGYA---PKIGYSN  2956
             PLVIVA++D   +QPM EEQ WG++   G   DG+   +A K   GPG A   PK GYS+
Sbjct  190   PLVIVADTD--PNQPM-EEQMWGEDGLQGIEGDGKDGGEAGK-GSGPGGATGPPKAGYSS  245

Query  2955  HGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKG  2776
             HGYH P+HSQFKYVRPGAAPIPG      G + GQV PP N   +AGRGRGDWRP GM+ 
Sbjct  246   HGYH-PFHSQFKYVRPGAAPIPGGAASVGGPSSGQVRPPANLGPMAGRGRGDWRPLGMRN  304

Query  2775  ALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFN  2596
             A   QKGF  +  WGSN +GRG  LDFTLPSHKTIFEVDIDSF+EKPWR  G++M+D+FN
Sbjct  305   ASAAQKGF--HQPWGSNTAGRG--LDFTLPSHKTIFEVDIDSFEEKPWRYPGVEMTDYFN  360

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FGLNEESWKDYCKQL+Q R+++TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P +
Sbjct  361   FGLNEESWKDYCKQLDQHRIQTTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVD  420

Query  2415  NANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIE  2239
             ++NL K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIE
Sbjct  421   SSNLVKPDSVQGDSAKVPANVRPTLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIE  479


 Score =   125 bits (315),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 140/438 (32%), Positives = 218/438 (50%), Gaps = 41/438 (9%)
 Frame = -1

Query  1596  KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKRFAH-VD  1420
             K+S    + + QE DGGE SK  RSSE+SK RSGS +D+ +     E+ +QDK  +   +
Sbjct  588   KMSFTSPQSAVQEDDGGE-SKTERSSESSKARSGSHRDFQQE----EDVIQDKHSSRPAN  642

Query  1419  DTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIADR  1246
             + +Q         RK +D  KE E+ R   KG RE+S      DS+  +   ++    D+
Sbjct  643   NRKQYDNNAPHQSRKNQDRGKEMERTRAASKGGRENSNPHMELDSTYIYSIASREDF-DK  701

Query  1245  RKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLR  1066
             RKERD     W+ ++DD + RR   E SRKR+  D+   + R K+R+ +   ++ +   R
Sbjct  702   RKERDVDGAVWRRKEDDPYSRRGGDEGSRKRDREDDPGFRQRGKMRENEIRSKDDQVPSR  761

Query  1065  KQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETL  886
             K +D+  +R  ++ D                     D  +KRRK++  L R   ++ E  
Sbjct  762   KHMDDAGMRNIYEPD---------------------DHINKRRKDEEYLRRSRPEKNEIS  800

Query  885   HSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGER  706
             + + +   R KRERDD  + +KRD     + RDD     DD    R +++   Q +  ER
Sbjct  801   YGQRESMSRVKRERDDRLEHQKRD--VQHKIRDDF----DDHGSLRQRDDIYMQRDGNER  854

Query  705   HRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHS  526
              RERD   + K  H++ +S R R E +  +R  R +E++S    SR KDEYK SD+E+ +
Sbjct  855   LRERDVLDKLKLPHEDGISARGR-ERQVAVRGHRGSEDRS----SRMKDEYKASDKEHVT  909

Query  525   KDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYES  346
             KD  RH +  KRR+     S S HR  ED   R      +E++ R ER   + D      
Sbjct  910   KDTLRHAKQTKRRDYPGEESSSHHRGHEDFSARTDNIVNNEKKPRQERTGAKIDKFIDTL  969

Query  345   DSSKVHEKKRKENSTKDK  292
             D  ++ ++K K++  K K
Sbjct  970   DGQRLQDRKHKDSRRKIK  987



>ref|XP_010453107.1| PREDICTED: uncharacterized protein LOC104735083 [Camelina sativa]
Length=1204

 Score =   333 bits (854),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 228/314 (73%), Gaps = 12/314 (4%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE----DAAKVNVGPGYAPKIGYSNH  2953
             PLVIVA++D   +QPM EEQ WG++     +G+ K+           G    PK GYS+H
Sbjct  195   PLVIVADTD--PNQPM-EEQLWGEDGLQGVEGDGKDGGEAGKGTGPGGVTGPPKAGYSSH  251

Query  2952  GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGA  2773
             G+HHP+HSQFKYVRPGAAPIPG  P   G T     P  N   + GRGRGDWRP GM+ A
Sbjct  252   GFHHPFHSQFKYVRPGAAPIPGGAPPTGGTTGQVRPPA-NLGPMVGRGRGDWRPQGMRNA  310

Query  2772  LTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNF  2593
                QKGF  + +WGSN +GRG  LDFTLPSHKTIFEVDI+SF+EKPWR QG++M+D+FNF
Sbjct  311   SAPQKGF--HQSWGSNTAGRG--LDFTLPSHKTIFEVDIESFEEKPWRYQGVEMTDYFNF  366

Query  2592  GLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSEN  2413
             GLNEESWKDYCKQL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P ++
Sbjct  367   GLNEESWKDYCKQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDS  426

Query  2412  ANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIV  2233
             +N+ K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEIV
Sbjct  427   SNVVKPDSVQGDSAKVPANVRPSLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEIV  486

Query  2232  CQGSADDDNNLEQG  2191
             C    +D+ + E G
Sbjct  487   CHDPHEDEPSGENG  500


 Score =   156 bits (394),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 155/442 (35%), Positives = 231/442 (52%), Gaps = 38/442 (9%)
 Frame = -1

Query  1605  KKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA  1429
             ++HK+SS + + + QE DGGE SK  RSSE+SK RSG+ +DY +L DG EEEV QDK +A
Sbjct  595   EEHKMSSTVPQSAVQEDDGGE-SKTERSSESSKARSGNHRDYQRLKDGAEEEVIQDKHYA  653

Query  1428  HVDDTRQT-GGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTS  1258
                + R           RK  D  KE E+ R   KG RE+S      DSS  ++S     
Sbjct  654   RPANNRNYHDNNAPHESRKNPDRGKEMERTRAPSKGGRENSIPHMELDSSHNNYSIANRE  713

Query  1257  IADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGR  1078
               D+RKERD     W  ++DD + RR   E SRKR H D+  S+ R+K+RD +   ++  
Sbjct  714   DFDKRKERDVDGGVWHRKEDDPYSRRGGDEGSRKRNHEDDPGSRQRSKMRDNEIRSKDDH  773

Query  1077  HLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDR  898
                RK +D                     D  ++ Y+ +DD  SKRRK++  L R   ++
Sbjct  774   IPSRKHMD---------------------DVARNTYE-VDDHISKRRKDEEYLRRSRPEK  811

Query  897   EETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSE  718
              E  + + +   R KRERDD  + +KRD     + RDD     DD    R++++   Q +
Sbjct  812   NEITYGQRESISRLKRERDDRLEHQKRD--FQHKIRDDF----DDHISLRHRDDFYMQRD  865

Query  717   RGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDR  538
               ER RER++  + K +H++ LS R R E +  +R  R +E++S    SR KDEYK SD+
Sbjct  866   GNERLREREDLDKLKLTHEDGLSARGR-ERQVAVRPHRGSEDRS----SRMKDEYKVSDK  920

Query  537   EYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHA  358
             ++ +KD  RH +  KRR+     S S HR  ED   R     ++E++ R ER   + D  
Sbjct  921   DHFTKDTTRHTKQAKRRDYPGEESSSHHRGYEDFSARADDIVSNEKKPRQERTGAKSDKV  980

Query  357   AYESDSSKVHEKKRKENSTKDK  292
                 D  ++ ++K K++  K+K
Sbjct  981   IDTLDGQRLQDRKHKDSRRKNK  1002



>ref|XP_010483368.1| PREDICTED: uncharacterized protein LOC104761899 [Camelina sativa]
Length=1216

 Score =   326 bits (835),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 225/314 (72%), Gaps = 12/314 (4%)
 Frame = -1

Query  3120  PLVIVANSDDPSHQPMVEEQEWGDELGNSADGERKE----DAAKVNVGPGYAPKIGYSNH  2953
             PLVIVA++D   +QPM EEQ WG++     +G+ K+           G    PK GYS+H
Sbjct  207   PLVIVADTD--PNQPM-EEQLWGEDGLQGVEGDGKDGGEAGKGTGPGGATGPPKAGYSSH  263

Query  2952  GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGA  2773
             GYHHP+HSQFKYVRPGAAPIPG  P   G T     P  N   + GRGRGDWRP  M+ A
Sbjct  264   GYHHPFHSQFKYVRPGAAPIPGGAPPTGGITGQVRPPA-NLGPMVGRGRGDWRPLVMRNA  322

Query  2772  LTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNF  2593
                QKGF  + +WG N +GRG  LDFTLPSHKTIFEVDI+SF+EKPWR  G++M+D+FNF
Sbjct  323   SAAQKGF--HQSWGGNTAGRG--LDFTLPSHKTIFEVDIESFEEKPWRYPGVEMTDYFNF  378

Query  2592  GLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSEN  2413
             GLNEESWKDYC+QL+Q R+E+TMQ +IRVYESGRT+Q YDPDLPPELAAA G Q +P ++
Sbjct  379   GLNEESWKDYCQQLDQHRIETTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDS  438

Query  2412  ANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIV  2233
             +N+ K +  Q D A+     RP LP GRPI VE+GSG+RLPSIDTR PR+RD DAIIEIV
Sbjct  439   SNVVKPDSVQGDSAKVPANVRPSLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEIV  498

Query  2232  CQGSADDDNNLEQG  2191
             C    +D+ + E G
Sbjct  499   CHDPHEDEPSGENG  512


 Score =   156 bits (394),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 153/440 (35%), Positives = 227/440 (52%), Gaps = 39/440 (9%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHV  1423
             HK+SS + + + QE D GE SK  RSSE+SK RSG+ +DY +L DG EEEV QDK +A  
Sbjct  609   HKMSSIVPQSAVQEDDVGE-SKTERSSESSKARSGNHRDYQRLKDGAEEEVIQDKHYARP  667

Query  1422  DDTRQTGGEEDRLQ-RKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTKTSIA  1252
              + R+        Q RK  D  KE E+ R   KG RE+S      DSS  +    +    
Sbjct  668   ANNRKHHDNNAPHQNRKNPDRGKEMERTRAASKGGRENSNPHMEVDSSYMYSIPNREDF-  726

Query  1251  DRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHL  1072
             D+RKERD     W  ++DD + RR   E SRK++H D++ S+ R+K+RD D   ++    
Sbjct  727   DKRKERDVDGGVWHRKEDDPYSRRGGAEGSRKKDHEDDLGSRQRSKMRDNDIRSKDDHIP  786

Query  1071  LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREE  892
              RK +D                      D+      +DD  SKRRK++  L R   ++ E
Sbjct  787   SRKHMD----------------------DIARNTYEVDDHISKRRKDEEYLRRSRPEKNE  824

Query  891   TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERG  712
               + + +   R KRERDD  + +KRD     + RDD     DD    R++++   Q +  
Sbjct  825   ISYGQRESISRLKRERDDRLEHQKRD--FQHKIRDDF----DDHSSLRHRDDFYMQRDGN  878

Query  711   ERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREY  532
             ER R R++  + K +H++ LS R R E +  +R  R +E++S    SR KDEYK SD+E+
Sbjct  879   ERLRAREDLDKLKLTHEDGLSARGR-ERQVAVRAHRGSEDRS----SRMKDEYKVSDKEH  933

Query  531   HSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAY  352
              +KD  RH + +KRR+     S S HR  ED   R     ++E++ R ER   + D    
Sbjct  934   LTKDTTRHTKQIKRRDYAGEESSSHHRGYEDFSARADDIVSNEKKPRQERTGAKSDKVID  993

Query  351   ESDSSKVHEKKRKENSTKDK  292
               D  ++ ++K K++  K K
Sbjct  994   TLDGQRLQDRKHKDSRRKIK  1013



>ref|XP_004172292.1| PREDICTED: uncharacterized LOC101212971 [Cucumis sativus]
Length=520

 Score =   308 bits (789),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 321/556 (58%), Gaps = 70/556 (13%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRPF +S  S  P P                   ++      Q P 
Sbjct  1     MEDDDEFGDLYTDVLRPFASSSSSSVPQP-----------------QLSSSAPPPLQRP-  42

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNSSDFNLSLNP  3586
             ID     DD    FGA  SN      S   +   ++T   QP  ++  P +  F   LN 
Sbjct  43    IDLNRHHDDENPPFGASYSN------SRVPLQFPKETPPLQPP-RESTPVAGSFGFVLN-  94

Query  3585  qsgqsggsigvgvGANESDLGARVFGKSDGKSRDWAFGDSSFTDEANIdvvveegddkdd  3406
                            N+ D G+RV G  D  S D    +    D  N  V        + 
Sbjct  95    -----------LAARNDGD-GSRVKGSEDFASVDVELPNRGLEDR-NFGVESGIVGGLEK  141

Query  3405  dlvqkdENIDKPMGRSENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGD----------  3256
             D+   D+++   +   E   + V +  G E +IPG+S  G   +  T G+          
Sbjct  142   DVNLMDKDVKFDI---EEGNAGVEDDVGGEPIIPGLSPSGGISIHGTSGNLENPEGFRMN  198

Query  3255  -----RAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDD  3091
                  R    +      +DDL+I+LND++ GPM M+R G  GDD+D+   PLVI+ ++D 
Sbjct  199   DASRDRGDGGDDWDSDSEDDLQILLNDSDRGPMAMERGGLVGDDEDEP--PLVILGDND-  255

Query  3090  PSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKY  2917
                  ++EEQEWGD+   +ADGERKE  +AAK + G   APK+GYSN+GY  P+HSQ+KY
Sbjct  256   --QNQVMEEQEWGDDTVPTADGERKETGEAAKSSAGMVVAPKLGYSNYGYR-PFHSQYKY  312

Query  2916  VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---G  2746
             VRPGAAP PG    GPGGTP QV P VN   V GRGRGDWRP G K   ++QKGF    G
Sbjct  313   VRPGAAPFPGTSASGPGGTPTQVRPLVNMGPVGGRGRGDWRPTGPKDPASVQKGFHSGFG  372

Query  2745  YNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWK  2569
                W +N  GR  G L+FTLPSHKTIFEVDIDSF+EKPW+  G+D+SDFFNFGLNE+SWK
Sbjct  373   MPGWSNNMGGRSFGGLEFTLPSHKTIFEVDIDSFEEKPWKSTGVDVSDFFNFGLNEDSWK  432

Query  2568  DYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEV  2389
             +YCKQLEQLRLE+TMQ KIRVYESGRTEQ YDPDLPPELAAAAGI DIP+E+  LGK++ 
Sbjct  433   EYCKQLEQLRLEATMQSKIRVYESGRTEQGYDPDLPPELAAAAGIHDIPNEHT-LGKSDG  491

Query  2388  GQNDLARGSIRSRPPL  2341
              QND+ +G  R RPPL
Sbjct  492   LQNDVGKGVPRVRPPL  507



>gb|KGN65239.1| hypothetical protein Csa_1G268330 [Cucumis sativus]
Length=520

 Score =   308 bits (788),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 321/556 (58%), Gaps = 70/556 (13%)
 Frame = -1

Query  3945  MEDDDEFGDLYTDVLRPFTASLQSEQPPPVAQNLgggggaaaaAEGSKATETSSVFQSPR  3766
             MEDDDEFGDLYTDVLRPF +S  S  P P                   ++      Q P 
Sbjct  1     MEDDDEFGDLYTDVLRPFASSSSSSVPQP-----------------QLSSSAPPPLQRP-  42

Query  3765  IDPKVDEDDRGIIFGAQKSNCDPNLSSGSSVNVQEKTLATQPEDKQPRPNSSDFNLSLNP  3586
             ID     DD    FGA  SN      S   +   ++T   QP  ++  P +  F   LN 
Sbjct  43    IDLNRHHDDENPPFGASYSN------SRVPLQFPKETPPLQPP-RESTPVAGSFGFVLN-  94

Query  3585  qsgqsggsigvgvGANESDLGARVFGKSDGKSRDWAFGDSSFTDEANIdvvveegddkdd  3406
                            N+ D G+RV G  D  S D    +    D  N  V        + 
Sbjct  95    -----------LAARNDGD-GSRVKGSEDFASVDVELPNRGLEDR-NFGVESGIVGGLEK  141

Query  3405  dlvqkdENIDKPMGRSENCESSVVEAGGSEHMIPGVSIPGVSGVPETCGD----------  3256
             D+   D+++   +   E   + V +  G E +IPG+S  G   +  T G+          
Sbjct  142   DVNLMDKDVKFDI---EEGNAGVEDDVGGEPIIPGLSPSGGISIHGTSGNLENPEGFRMN  198

Query  3255  -----RAVdeewdsdsdddDLRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDD  3091
                  R    +      +DDL+I+LND++ GPM M+R G  GDD+D+   PLVI+ ++D 
Sbjct  199   DASRDRGDGGDDWDSDSEDDLQILLNDSDRGPMAMERGGLVGDDEDEP--PLVILGDND-  255

Query  3090  PSHQPMVEEQEWGDELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKY  2917
                  ++EEQEWGD+   +ADGERKE  +AAK + G   APK+GYSN+GY  P+HSQ+KY
Sbjct  256   --QNQVMEEQEWGDDTVPTADGERKETGEAAKSSAGMVVAPKLGYSNYGYR-PFHSQYKY  312

Query  2916  VRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---G  2746
             VRPGAAP PG    GPGGTP QV P VN   V GRGRGDWRP G K   ++QKGF    G
Sbjct  313   VRPGAAPFPGTSASGPGGTPTQVRPLVNMGPVGGRGRGDWRPTGPKDPASVQKGFHSGFG  372

Query  2745  YNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWK  2569
                W +N  GR  G L+FTLPSHKTIFEVDIDSF+EKPW+  G+D+SDFFNFGLNE+SWK
Sbjct  373   MPGWSNNMGGRSFGGLEFTLPSHKTIFEVDIDSFEEKPWKSTGVDVSDFFNFGLNEDSWK  432

Query  2568  DYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEV  2389
             +YCKQLEQLRLE+TMQ KIRVYESGRTEQ YDPDLPPELAAAAGI DIP+E+  LGK++ 
Sbjct  433   EYCKQLEQLRLEATMQSKIRVYESGRTEQGYDPDLPPELAAAAGIHDIPNEHT-LGKSDG  491

Query  2388  GQNDLARGSIRSRPPL  2341
              QND+ +G  R RPPL
Sbjct  492   LQNDVGKGVPRVRPPL  507



>ref|XP_010539467.1| PREDICTED: uncharacterized protein LOC104813541 [Tarenaya hassleriana]
Length=1178

 Score =   321 bits (822),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 202/363 (56%), Positives = 246/363 (68%), Gaps = 29/363 (8%)
 Frame = -1

Query  3210  LRIVLNDN--NHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGN  3037
             L+IVLND+  N       R   D DD++DD +PLVIV ++D   +Q M E   W ++   
Sbjct  131   LQIVLNDSSRNSLIGAGRRANPDEDDEEDDEEPLVIVTDTD--PNQAM-EGHIWAEDSLQ  187

Query  3036  SADGERKE--DAAKVNVGPGYA--PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgp  2869
             + +G+ K+  +A K +     A  PKIGY  HGYH  +HSQFKYVRPGAAP+ GA     
Sbjct  188   ATEGDGKDAGEAGKASGAGAVAAPPKIGYIGHGYH-TFHSQFKYVRPGAAPMAGATASTA  246

Query  2868  ggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIG--LDF  2695
             G + GQV PPVN   +AGRGRGDWR  G                WGSN +GRG+G  LDF
Sbjct  247   GTSSGQVRPPVNVVPMAGRGRGDWRRLGFG------------TGWGSNTAGRGVGVGLDF  294

Query  2694  TLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGK  2515
             TLPSHKTIFEVDID F+EKPWR  G+D +DFFNFGLNEESWKDYCKQL+Q R+E+TMQ +
Sbjct  295   TLPSHKTIFEVDIDGFEEKPWRYPGVDTTDFFNFGLNEESWKDYCKQLDQHRVETTMQSR  354

Query  2514  IRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPA  2335
             IRVYESGRT+Q YDPDLPPELAAA G Q IP++++NL K    Q D  +G    RP LP 
Sbjct  355   IRVYESGRTDQGYDPDLPPELAAATGAQGIPADSSNLVKPTTTQGDSTKGPAHVRPALPP  414

Query  2334  GRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD----NNLEQ-GNQPSREG  2170
             GRPI VE+GSG+RLPSIDTR PR+RD+DAIIEIVCQ S + +    N+++Q GN    E 
Sbjct  415   GRPIPVETGSGERLPSIDTRAPRIRDADAIIEIVCQDSREAEPSSGNDVDQVGNSLPGEN  474

Query  2169  IRG  2161
             I G
Sbjct  475   ILG  477


 Score =   170 bits (431),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 180/526 (34%), Positives = 272/526 (52%), Gaps = 45/526 (9%)
 Frame = -1

Query  1752  QESAVENNDNLHDELVPAQRNSGMERGKISVDERTNCDKAKDDSVIDTAKKHKLSSQLEE  1573
             QE A+  N +    L  +    G +    SVD++     A+     +  ++ K+SS+L +
Sbjct  506   QEDAISENTDGRCSLRSSSPIGGRDTRSSSVDQKDTG--AEPSKYSEMEEERKMSSELLQ  563

Query  1572  PSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKRFAHVDDTRQTGGEE  1393
                QE DGGE SK  RSSE+SK +SG+ ++Y +  D           + VD  R + G++
Sbjct  564   SVVQEDDGGE-SKTERSSESSKAKSGNHREYQQSKD-----------SAVDARRPSSGKQ  611

Query  1392  -----DRLQRKGRD-EKETEKHRMIVK--GREDSYMRKGYDsssahhsHTKTSIADRRKE  1237
                      RK +D E+ETE+ R+     GRE+SY    +DSS   HS+TK    D+RKE
Sbjct  612   LHENSQHQSRKNQDREQETERTRVAASKGGRENSYPHMEFDSSYPRHSYTKGEDFDKRKE  671

Query  1236  RDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQL  1057
              D +   W  R+D+ + R+S+ E SRKR+ GD + S+HR K+R+ +   ++     RK L
Sbjct  672   CDIAGSVWHRREDEAYSRKSRDEGSRKRDRGDYLGSRHRGKMRESETYGKDDHVPSRKHL  731

Query  1056  DNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSR  877
             D+G +R   DKD  SR +ER+ D L++ Y+ +DD  SKRRK++  L R   D+ E  HS+
Sbjct  732   DDGGMRVPSDKDFGSRPKERD-DSLRNNYEVMDDYVSKRRKDEEYLRRSRSDKNEISHSQ  790

Query  876   GDGTLRRKRERDD-ISDQRKRDDISDQRKRDDQRLREDDQHYARY--KEEPLFQSERGER  706
              + +   KRER D + DQ          KR  Q++RED   +  +  ++E   Q +  ER
Sbjct  791   RESSSHPKRERGDRLEDQ----------KRAAQKIREDFGDFRSFGNRDEFYVQRDGNER  840

Query  705   HRERDEW--YRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREY  532
              RE ++    R  +  D  +  RER   R   R  R +E+++    SR KDEYKGSD+E 
Sbjct  841   QRECEDLDNLRRTREEDSSVHGRER---RVTTRNHRDSEDRA----SRMKDEYKGSDKEL  893

Query  531   HSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAY  352
              +KD  RH +H KRRE     S S +   E+   R      +E++ R ER S R D  + 
Sbjct  894   LNKDTARHNKHQKRRENAYEESSSHNGGHEETSTRQDITVNNEKKLRQERASGRSDKISD  953

Query  351   ESDSSKVHEKKRKENSTKDKVPEASDKNSLLPSNLNEDDRSGNASE  214
              SD     EKK KE+  K+K     D   L P    +++++G+  E
Sbjct  954   PSDGKGSQEKKHKESRRKNKEHRIGDAADLGPLRSKQEEQNGSFEE  999



>emb|CDX88655.1| BnaA03g09940D [Brassica napus]
Length=1046

 Score =   313 bits (801),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 238/358 (66%), Gaps = 24/358 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDN       DR    GD++DDD +PLVIV ++D   H  M E+Q WG+E   + 
Sbjct  120   LQIVLNDN-----VADRRARMGDNEDDDEEPLVIVTDADPNQH--MEEQQLWGEE---AV  169

Query  3030  DGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgq  2851
             +GE KE    V        K GY++HGYHHP+HSQFKY+RPGAAP+ G+     G     
Sbjct  170   EGESKEGGEAVKGSAAGPTKAGYNSHGYHHPFHSQFKYIRPGAAPVSGSVASAAGQVRPP  229

Query  2850  vhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTI  2671
                  N   +AGRGRGDWRP G++ A   QKG+  +  WG N +GRG  LDFTLPSHKTI
Sbjct  230   A----NLGPMAGRGRGDWRPMGVRNASAAQKGY--HQTWGGNTAGRG--LDFTLPSHKTI  281

Query  2670  FEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGR  2491
             FE D+D+F+EKPWR QG+D++D+FNFGLNEESWKDYCKQL+Q R+E+TM+ +IRVYESGR
Sbjct  282   FEFDVDAFEEKPWRYQGVDITDYFNFGLNEESWKDYCKQLDQHRIETTMKSRIRVYESGR  341

Query  2490  TEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVES  2311
             T+Q YDPDLPPELAAA G Q +P +++NL K +  Q D A       P  P      VE+
Sbjct  342   TDQSYDPDLPPELAAATGAQVVPVDSSNLVKLDTAQGDSANIRPPLPPGRPI----PVET  397

Query  2310  GSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPSREG--IRGGDEIGD  2143
             GS +R  SIDTR PR+RD +AIIEIVC+ S +D+ + E+G + +  G   R    +GD
Sbjct  398   GSVERPSSIDTRAPRMRDLEAIIEIVCEDSHEDEPSGEKGAEQADSGQTFRSSSPVGD  455


 Score = 94.7 bits (234),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 204/449 (45%), Gaps = 101/449 (22%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA--  1429
              K+SS +   + ++ DGGE SK  RSSE+SK RSGS +D+ +L D  EEEV QD+     
Sbjct  482   QKMSSAVPRSAVEKDDGGE-SKTERSSESSKARSGSHRDHQQLKDSAEEEVIQDRNHCTR  540

Query  1428  -------HVDDTRQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhs  1273
                    HV++ +          RK +D  KE E+ R   KG        G D       
Sbjct  541   PASNKKHHVNNAQHQ-------SRKYQDIGKEMERTRAGSKG------ESGKD-------  580

Query  1272  HTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRS  1093
                    D+RKERD     W+ ++DD   RR   E SRKR+ GD+               
Sbjct  581   ------FDKRKERDVDGGVWRRKEDDTFSRRGGDEGSRKRDRGDD---------------  619

Query  1092  EREGRHL-LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLS  916
                  H+  R  +D+G LR +++                     +D   SKRRK +  + 
Sbjct  620   -----HVPSRNHVDDGGLRNNYE---------------------LDYHISKRRKVEEYVR  653

Query  915   REHVDREE-TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKE  739
             R   ++ E +   R +   R +RER D  D +KRD     + RDD      DQ   R+++
Sbjct  654   RTRSEKNEISFGQREESISRLRRERGDRLDYQKRD--VQHKIRDDIY----DQASLRHRD  707

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             +   Q +  ER RER +  + K +H++ LS R R E +   R  R +E++S    SR KD
Sbjct  708   DIYMQRDGNERLRERGDLDKLKLTHEDGLSARGR-ERQVAARGHRGSEDRS---SSRMKD  763

Query  558   EYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERV  379
             EYK    E+ +KD  R  +  KR+E     S S HR RED         ++E++ R ER 
Sbjct  764   EYK----EHLTKDTTRQTKQTKRKEHPGEESSSYHRGREDDI------VSNEKKQRLERT  813

Query  378   STRQDHAAYESDSSKVHEKKRKENSTKDK  292
             S + D      D  ++ ++K K++  K K
Sbjct  814   SAKTDKVVDSLDGQRLQDRKHKDSRRKIK  842



>ref|XP_009132085.1| PREDICTED: uncharacterized protein LOC103856715 [Brassica rapa]
Length=1047

 Score =   312 bits (800),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 238/358 (66%), Gaps = 24/358 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDN       DR    GD++DDD +PLVIV ++D   H  M E+Q WG+E   + 
Sbjct  121   LQIVLNDN-----VADRRARMGDNEDDDEEPLVIVTDADPNQH--MEEQQLWGEE---AV  170

Query  3030  DGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggtpgq  2851
             +GE KE    V        K GY++HGYHHP+HSQFKY+RPGAAP+ G+     G     
Sbjct  171   EGESKEGGEAVKGSAAGPTKAGYNSHGYHHPFHSQFKYIRPGAAPVSGSVASAAGQVRPP  230

Query  2850  vhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTI  2671
                  N   +AGRGRGDWRP G++ A   QKG+  +  WG N +GRG  LDFTLPSHKTI
Sbjct  231   A----NLGPMAGRGRGDWRPMGVRNASAAQKGY--HQTWGGNTAGRG--LDFTLPSHKTI  282

Query  2670  FEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGR  2491
             FE D+D+F+EKPWR QG+D++D+FNFGLNEESWKDYCKQL+Q R+E+TM+ +IRVYESGR
Sbjct  283   FEFDVDAFEEKPWRYQGVDITDYFNFGLNEESWKDYCKQLDQHRIETTMKSRIRVYESGR  342

Query  2490  TEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVES  2311
             T+Q YDPDLPPELAAA G Q +P +++NL K +  Q D A       P  P      VE+
Sbjct  343   TDQSYDPDLPPELAAATGAQVVPVDSSNLVKLDTAQGDSANIRPPLPPGRPI----PVET  398

Query  2310  GSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQGNQPSREG--IRGGDEIGD  2143
             GS +R  SIDTR PR+RD +AIIEIVC+ S +D+ + E+G + +  G   R    +GD
Sbjct  399   GSVERPSSIDTRAPRMRDLEAIIEIVCEDSHEDEPSGEKGAEQADSGQTFRSSSPVGD  456


 Score = 94.7 bits (234),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 204/449 (45%), Gaps = 101/449 (22%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA--  1429
              K+SS +   + ++ DGGE SK  RSSE+SK RSGS +D+ +L D  EEEV QD+     
Sbjct  483   QKMSSAVPRSAVEKDDGGE-SKTERSSESSKARSGSHRDHQQLKDSAEEEVIQDRNHCTR  541

Query  1428  -------HVDDTRQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhs  1273
                    HV++ +          RK +D  KE E+ R   KG        G D       
Sbjct  542   PASNKKHHVNNAQHQ-------SRKYQDIGKEMERTRAGSKG------ESGKD-------  581

Query  1272  HTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRS  1093
                    D+RKERD     W+ ++DD   RR   E SRKR+ GD+               
Sbjct  582   ------FDKRKERDVDGGVWRRKEDDTFSRRGGDEGSRKRDRGDD---------------  620

Query  1092  EREGRHL-LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLS  916
                  H+  R  +D+G LR +++                     +D   SKRRK +  + 
Sbjct  621   -----HVPSRNHVDDGGLRNNYE---------------------LDYHISKRRKVEEYVR  654

Query  915   REHVDREE-TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKE  739
             R   ++ E +   R +   R +RER D  D +KRD     + RDD      DQ   R+++
Sbjct  655   RTRSEKNEISFGQREESISRLRRERGDRLDYQKRD--VQHKIRDDIY----DQASLRHRD  708

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             +   Q +  ER RER +  + K +H++ LS R R E +   R  R +E++S    SR KD
Sbjct  709   DIYMQRDGNERLRERGDLDKLKLTHEDGLSARGR-ERQVAARGHRGSEDRS---SSRMKD  764

Query  558   EYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERV  379
             EYK    E+ +KD  R  +  KR+E     S S HR RED         ++E++ R ER 
Sbjct  765   EYK----EHLTKDTTRQTKQTKRKEHPGEESSSYHRGREDDI------VSNEKKQRLERT  814

Query  378   STRQDHAAYESDSSKVHEKKRKENSTKDK  292
             S + D      D  ++ ++K K++  K K
Sbjct  815   SAKTDKVVDSLDGQRLQDRKHKDSRRKIK  843



>ref|XP_010545454.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein [Tarenaya hassleriana]
 ref|XP_010545455.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein [Tarenaya hassleriana]
 ref|XP_010545456.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein [Tarenaya hassleriana]
Length=1164

 Score =   298 bits (762),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 246/365 (67%), Gaps = 22/365 (6%)
 Frame = -1

Query  3210  LRIVLNDNN-HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  3034
             L+IVLND++ +G +G +R     +DD+DD +PLVIV ++D   +Q M EEQ W ++   +
Sbjct  140   LQIVLNDSSRNGLIGAERRENPDNDDEDDEEPLVIVTDTD--PNQAM-EEQLWAEDSLQA  196

Query  3033  ADGERKEDAAKVNVGPGYA-----PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgp  2869
              +G+ K D  +V    G       PK GY  +GYH P+HSQFKYVRPGA P+PG      
Sbjct  197   REGDGK-DGGEVGKASGAGGATAAPKTGYIGYGYH-PFHSQFKYVRPGAGPMPGVTTTSA  254

Query  2868  ggtpgqvhpp--VNTSLVAGRGRGDWRPPGMKGALTMQKGF--PGYNAWGSNPSGRGIGL  2701
              G          VN  L+AGRGRGDWRPPGMK A    KGF       WG    G G+GL
Sbjct  255   AGISSAGQVRPPVNAGLMAGRGRGDWRPPGMKNASVPHKGFHLGSGTPWGGR--GSGVGL  312

Query  2700  DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQ  2521
             DFT P HKTIFEV+ID F+EKPWR  G+D++DFFNFGL EESWKDYCKQLEQ R+ +TMQ
Sbjct  313   DFTPPPHKTIFEVNIDGFEEKPWRYPGVDITDFFNFGLTEESWKDYCKQLEQHRVATTMQ  372

Query  2520  GKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
              +IRVYESGRT+Q YDPDLPPELAAA G+Q +  +++NL K +  Q D  +G    RPPL
Sbjct  373   SRIRVYESGRTDQGYDPDLPPELAAATGVQGVLVDSSNLVKPDATQGDSTKGPAHVRPPL  432

Query  2340  PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD----NNLEQ-GNQPSR  2176
             P GRPI VE+GSG+RLPSIDTR PR+RD+DAIIEIVCQ S +D+    N ++Q GN    
Sbjct  433   PPGRPIPVEAGSGERLPSIDTRGPRIRDTDAIIEIVCQDSHEDEPSAGNGVDQVGNSLPE  492

Query  2175  EGIRG  2161
             E + G
Sbjct  493   ENLLG  497


 Score =   117 bits (294),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 153/464 (33%), Positives = 218/464 (47%), Gaps = 92/464 (20%)
 Frame = -1

Query  1596  KLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEVQDKRFA----  1429
             K+SS L +   QE DGGE SK  R  E       S ++Y +  +  EE +Q K +A    
Sbjct  589   KMSSGLSKSVVQEDDGGE-SKTERHRE-------SHREYQQSAE--EEVIQHKLYARPAM  638

Query  1428  ---HVDDTRQTGGEEDRLQRKGRDE-KETEKHRMIVKG-REDSYMRKGYDsssahhsHTK  1264
                H+D+  Q         RK +D   E E+ R+  +G RE+S+     +S   ++SH +
Sbjct  639   GRKHLDENTQ------HPSRKNQDRGHEIERTRVASRGGRENSHPHMEIESIYPYNSHAR  692

Query  1263  TSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSERE  1084
                 D+RKERD +   W+ R D  + RRS  E SRKR+ GD+  S+HR K RD   SE  
Sbjct  693   GEDFDKRKERDVAGNVWRSRQDGTYSRRSGDESSRKRDSGDDQGSRHRGKTRD---SETN  749

Query  1083  GRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHV  904
              R   RK LD+  LR + +                     +DD  SKRRK++  L R   
Sbjct  750   SRDNHRKHLDDNCLRNNPEL--------------------VDDYVSKRRKDEEYLRRSCS  789

Query  903   DREETLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRED--DQHYARYKEEPL  730
             D+ E LH     +  R +        R+RDD S+ ++RD QR+RED  D+H  R+     
Sbjct  790   DKNENLHDHQRESASRPK--------RERDDRSEHQRRDVQRIREDSADRHSFRH-----  836

Query  729   FQSERGERHRERDEWY--RPKQSHDEILSKRERDEGRG-----GLRVGRAAEEKSWAGLS  571
                        RDE+Y  R     D +   RE    RG      +R  R +E+++    S
Sbjct  837   -----------RDEFYSLRDGNERDNLKQTREGSSVRGRETQVAMRSLRRSEDRA----S  881

Query  570   RGKDEYKGSDREYHSKDAGRHVEHLKRRERD-ENGSPSRHRSREDGYGRGHQPSTDERRA  394
             R KDEY+GSD+E  +KD  RH +  KRRE   E  S  RHR  ED   R  +   +E++ 
Sbjct  882   RMKDEYRGSDKELLNKDTARHSKQQKRRENAYEQESSLRHRGHEDVSARADEIINNEKKL  941

Query  393   RNERVSTRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSL  262
             R ER S        E  SS    K+ + N+ + +V +A+D   L
Sbjct  942   RQERTS------GSEKVSSDQKHKESRRNNKEHRVGDAADNGPL  979



>ref|XP_009358572.1| PREDICTED: uncharacterized protein LOC103949191 [Pyrus x bretschneideri]
Length=800

 Score =   290 bits (741),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 218/299 (73%), Gaps = 17/299 (6%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDNNHGPM M+R G   +DDDD    LVIVA  D   +QPM ++QEWG+E   + 
Sbjct  190   LQIVLNDNNHGPMAMERGGMGDEDDDDG---LVIVA--DGEPNQPM-DDQEWGEESTQTV  243

Query  3030  DGERKEDAAKVNVGPGYA---PKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggt  2860
             +GERKE       G G     PK+GYS+HGYH P+HSQFKYVRPGA P+PG    GPGG 
Sbjct  244   EGERKEMGEAGKTGAGSVVVPPKVGYSSHGYH-PFHSQFKYVRPGAVPMPGPTTSGPGGV  302

Query  2859  pgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGF------PGYNAWGSNPSGRGIGLD  2698
             PGQV P +N   V GRGRGDWRP GM+    +QK F      PG+        G G GL+
Sbjct  303   PGQVRPLLNMGPVPGRGRGDWRPTGMRDGTPLQKNFHSGFGTPGWGNNTGG-RGFGGGLE  361

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             FTLPSHKTIF+VDID F+EKPW+  G+D SDFFNFGLNE+SWKDYCKQLE LRLESTMQ 
Sbjct  362   FTLPSHKTIFDVDIDGFEEKPWKYPGVDTSDFFNFGLNEDSWKDYCKQLELLRLESTMQS  421

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
             KIRVYESGRTEQEYDPDLPPELAAA GI ++P ENAN GK++V Q+DL +G+ R RPP+
Sbjct  422   KIRVYESGRTEQEYDPDLPPELAAATGIHELPPENANPGKSDVVQSDLVKGTARLRPPI  480



>ref|XP_006651764.1| PREDICTED: zinc finger CCCH domain-containing protein 13-like 
[Oryza brachyantha]
Length=1326

 Score =   281 bits (718),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 208/315 (66%), Gaps = 27/315 (9%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWGDELGNSA-DGERKEDAAKVNVGPGYAP---KIGYSN--  2956
             LVIVA  D P   P +EEQ+WG++   +  DGERKE       G   AP   +IGYS   
Sbjct  208   LVIVA--DGPI--PGMEEQDWGEDAAAAGPDGERKEGGEP---GKAVAPPSGRIGYSGGG  260

Query  2955  HGYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKG  2776
              G+H  +HS FKYVRPGA P              +   P         GRGDWRP   +G
Sbjct  261   QGFHPQHHSMFKYVRPGATPGAPLGGAPNTTGQFRPPGPSGPFPGR--GRGDWRPGSGRG  318

Query  2775  ALTMQKGF-PGYNA--WGSNPSGRGIGLDFTLPSHKTIFEVDID-SFDEKPWRLQGIDMS  2608
                M KGF PGY    WG +  G G GLDFTLP HKTIF++D+D +F+EKPW+  G D+S
Sbjct  319   ---MNKGFHPGYGMPPWGGSGRGFGGGLDFTLPPHKTIFDIDVDTTFEEKPWKHPGADIS  375

Query  2607  DFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQD  2428
             DFFNFGL++E WKDYCKQL+QLRLESTMQ +IRVYESGR+EQEYDPDLPPELAAA G  D
Sbjct  376   DFFNFGLDDEKWKDYCKQLDQLRLESTMQSRIRVYESGRSEQEYDPDLPPELAAATGHHD  435

Query  2427  IPSENANLGKTEVGQNDLA---RGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRD  2257
             I ++N N  KTE G  D +   R     RPP+  GRPIQVE+G G+RLPSIDTR PR+R+
Sbjct  436   ISADNRN--KTENGHTDFSAQGRAPTSLRPPVMTGRPIQVETGFGERLPSIDTRLPRMRE  493

Query  2256  SDAIIEIVCQGSADD  2212
             SD++IEIVCQG +DD
Sbjct  494   SDSVIEIVCQGQSDD  508


 Score =   122 bits (306),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 249/512 (49%), Gaps = 100/512 (20%)
 Frame = -1

Query  1626  DSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV  1447
             D+++ + KK KL S+ E+P+   ++  +D    R+S+NS+ RSGSSKD  K  +  EE +
Sbjct  693   DNLVHSDKKRKLISRAEQPTGPNSNE-QDELRTRNSDNSRGRSGSSKDNQKRLESGEEVL  751

Query  1446  QDKRFAHVDDTRQT-GGEEDRLQRKG---RDEKE-TEKHRMIVKGREDS---YMRKGYDs  1291
             QD+R   V+D R+   GEE    RK    RD K+  EK  +  + RED+   Y  +  D 
Sbjct  752   QDRRSRRVNDVRRYHDGEERNSHRKDEYIRDAKQDVEKSHLASRSREDTHHPYANRDRD-  810

Query  1290  ssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKI  1111
                        I  R  +R      WQ R+D +H RR+K ED R  EH  E+ +++RNK+
Sbjct  811   -----------IRGRSYDRVRETEVWQRREDSVHNRRAKEEDVRL-EHSAEVGARNRNKM  858

Query  1110  RDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKE  931
             R IDR++R+     RK+LD+G  R        SR RER  D + +R ++IDD H KR+K+
Sbjct  859   RPIDRNDRDDDLHARKRLDDGDWR-------GSRQRERG-DVVLNRREHIDDSHMKRKKD  910

Query  930   DTKLSREHVDREETLHSRG-----DGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE-  769
             +  + R   + E+ +H +      D   RRKRERDD  DQ++RDD        + R+RE 
Sbjct  911   EENMRRMKPENEDIVHGQHGYRARDDPNRRKRERDDGIDQKRRDD--------NGRMREK  962

Query  768   -DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEE  592
              DD+++ ++KE+   Q ER +RHR       PK  +   L   +RDEGRG  R GR  ++
Sbjct  963   ADDRYHTKHKEDNWRQREREDRHR-------PKHENTVTL---QRDEGRGSGRGGRILDD  1012

Query  591   KSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRE-----------------RDENGSP  463
             K  +G S+ +DE + S     ++D  R  E L+R +                 RD+N + 
Sbjct  1013  KLASG-SKKQDESRSSGLSKETQDRSRQNEPLRRDQGAEENNIQNRGRADVHPRDDNPNN  1071

Query  462   SRHRSREDGYGRGH------------QPSTD-----ERRARNERVST----------RQD  364
             S   +R+D     H            Q S D      R+ RN  ++           R+D
Sbjct  1072  SERNTRQDKLNNTHDNNRLSSSSGARQASRDRYRESTRKGRNSDINEQDLPKSSKRRRED  1131

Query  363   HAAYESDSSKVHEKKRKENSTKDKVPEASDKN  268
             H ++      V     ++NST   V     +N
Sbjct  1132  HESHRGGKVDVKGVSEQDNSTDHAVSSKKGQN  1163



>ref|XP_010545460.1| PREDICTED: uncharacterized protein LOC104817826 [Tarenaya hassleriana]
Length=873

 Score =   263 bits (671),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 228/365 (62%), Gaps = 25/365 (7%)
 Frame = -1

Query  3210  LRIVLNDNN-HGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  3034
             L+IVLND++ +G +G +R     +DD+DD +PLVIV ++D   +Q M EEQ W ++   +
Sbjct  140   LQIVLNDSSRNGLIGAERRENPDNDDEDDEEPLVIVTDTD--PNQAM-EEQLWAEDSLQA  196

Query  3033  ADGERKEDAAKVNVGPGY-----APKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgp  2869
              DG+ K D  +V    G      APK GY  +GYH P+HSQFKYVRPGA PIPG      
Sbjct  197   RDGDGK-DGGEVGKSSGAGGATAAPKTGYIGYGYH-PFHSQFKYVRPGAGPIPGGTAAPA  254

Query  2868  ggtpgqvhpp--VNTSLVAGRGRGDWRPPGMKGALTMQKGFP--GYNAWGSNPSGRGIGL  2701
              G          VN   +AGRGRGDW P GMK A    KGF       WG    G G+GL
Sbjct  255   TGISSSGQVRPPVNAGFMAGRGRGDWHPLGMKNASVPHKGFHLGSGTPWGGR--GSGVGL  312

Query  2700  DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQ  2521
             DFT P HKTIFEV+ID F++KPWR  G+D +DF N GL EESWKDYCKQLEQ R+ +T+Q
Sbjct  313   DFTPPPHKTIFEVNIDGFEKKPWRYPGVDTTDFSNSGLTEESWKDYCKQLEQHRVATTVQ  372

Query  2520  GKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
              +I VYESGRT Q  DPDLPPELAAA G+Q +    +NL K +  Q D  +G      PL
Sbjct  373   SRIHVYESGRTNQGCDPDLPPELAAATGVQGVLVVCSNLVKPDAIQGDSTKGPAL---PL  429

Query  2340  PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDD----NNLEQ-GNQPSR  2176
             P GRPI VE+GSG+RLPSI  R PR+ D+DAIIE V Q S  D+    N ++Q GN    
Sbjct  430   PPGRPILVEAGSGERLPSIHARGPRIHDTDAIIETVYQDSHKDEPSTGNGVDQAGNSLPE  489

Query  2175  EGIRG  2161
             E + G
Sbjct  490   ENLLG  494



>emb|CDY11833.1| BnaC03g12590D [Brassica napus]
Length=1065

 Score =   262 bits (670),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 185/394 (47%), Positives = 232/394 (59%), Gaps = 70/394 (18%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNSA  3031
             L+IVLNDN    MG DR    GD++DDD +PLVIV       +QPM E+Q WG+E     
Sbjct  127   LQIVLNDNVM--MGADRRARLGDNEDDDEEPLVIVDK-----NQPMEEQQLWGEEEAVDR  179

Query  3030  DGERKEDAAKVNVGPGYAPKIGYSNHGYHHPYHSQF------------------------  2923
             DG+   +A K +              GYH P+HSQF                        
Sbjct  180   DGKEGGEAVKGSAA------------GYH-PFHSQFKVRVNAPMLSLVTLLNGRGSCRGP  226

Query  2922  ------------KYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMK  2779
                         KYVRPGA+PIPG+     G          N   +AGRGRGDWRP GM+
Sbjct  227   VFIFISPLYLYIKYVRPGASPIPGSVASAAGQVRPPA----NLGPMAGRGRGDWRPMGMR  282

Query  2778  GALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFF  2599
              A   QKG+  +  WG N +GRG  LDFTLPSHKTIFE DID+F+EKPWR QG+D++D+F
Sbjct  283   NASAAQKGY--HQTWGGNAAGRG--LDFTLPSHKTIFEFDIDAFEEKPWRYQGVDITDYF  338

Query  2598  NFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPS  2419
             NFGLNEE+WKDYCK L+Q R+E+TM+ +IRVYESGRT+Q YDP LPPELAAA G Q +P 
Sbjct  339   NFGLNEETWKDYCKHLDQHRIETTMKSRIRVYESGRTDQGYDPYLPPELAAATGAQVVPV  398

Query  2418  ENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIE  2239
             +++NL K +  Q D A            GRPI VE+GS +R  SIDTR PR+RD +AIIE
Sbjct  399   DSSNLVKLDTAQGDSANIRPPLP----PGRPIPVETGSVERPSSIDTRAPRMRDLEAIIE  454

Query  2238  IVCQGSADDDNNLEQGNQPSREG--IRGGDEIGD  2143
             IVC+ S +D+ + E G + +  G   R    +GD
Sbjct  455   IVCEDSHEDEPSGENGAEQADSGQSFRSSSPVGD  488


 Score = 91.7 bits (226),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 139/459 (30%), Positives = 205/459 (45%), Gaps = 102/459 (22%)
 Frame = -1

Query  1599  HKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFA--  1429
             HK+SS +   + +E DGG  SK  RSSE+SK R GS +D+ +L D  EEEV QD+     
Sbjct  515   HKMSSAVPRSAVEEDDGG-GSKTERSSESSKARCGSHRDHQQLKDSAEEEVIQDRNHCTR  573

Query  1428  -------HVDDTRQTGGEEDRLQRKGRD-EKETEKHRMIVKGREDSYMRKGYDsssahhs  1273
                    HV++ +          RK +D  KE E+ R   KG        G D       
Sbjct  574   PASNKKHHVNNAQHQ-------SRKYQDIGKEMERTRAGSKGE------SGED-------  613

Query  1272  HTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRS  1093
                    D+RKERD     W+ R+DD   RR   E SRKR+ GD+               
Sbjct  614   ------FDKRKERDVDGGVWRRREDDTFSRRGGDEGSRKRDRGDD---------------  652

Query  1092  EREGRHL-LRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLS  916
                  H+  R  +D+G LR +++                     +DD  SKRRK +  + 
Sbjct  653   -----HVPSRNHVDDGGLRNNYE---------------------LDDHISKRRKVEEYVR  686

Query  915   REHVDREE-TLHSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLREDDQHYARYKE  739
             R   ++ + +   R +   R KRER D  D +KRD     + RDD      D    R+++
Sbjct  687   RTRSEKNKISFGQREESISRLKRERGDRLDYQKRD--VQHKIRDDIY----DHASLRHRD  740

Query  738   EPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKD  559
             +   Q +  ER RER +  + K +H++ LS   R E +   R  R +E++S    SR KD
Sbjct  741   DFYMQRDGNERLRERGDLDKLKLTHEDGLSAPGR-ERQVAARGHRGSEDRS---SSRMKD  796

Query  558   EYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSREDGYGRGHQPSTDERRARNERV  379
             EYK    E+ +KD  R  +  K+RE     S S HR      G G    ++E++ R ER 
Sbjct  797   EYK----EHLTKDTTRQTKQTKKREYPGEESSSYHR------GHGDDIVSNEKKTRLERT  846

Query  378   STRQDHAAYESDSSKVHEKKRKENSTKDKVPEASDKNSL  262
             S + D      D  +  ++  K++  K K  ++ D +SL
Sbjct  847   SAKSDKVVESLDGQRFQDRNHKDSRRKIK-EQSEDTDSL  884



>ref|XP_008644546.1| PREDICTED: zinc finger CCCH domain-containing protein 13 [Zea 
mays]
Length=1249

 Score =   261 bits (667),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 165/359 (46%), Positives = 214/359 (60%), Gaps = 29/359 (8%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWG-DELGNSADGERKEDAAKVNVGPGYAPKIGYSNHG--Y  2947
             LVIVA+       P +EEQ+WG D     A+GERK+             +IGYS  G  +
Sbjct  165   LVIVADG------PAMEEQDWGEDPAAAGAEGERKDGCEPGKTVAAPTGRIGYSGGGPGF  218

Query  2946  HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             H  +HS FKYVRPGA         G  G      P       +GRGRG+WRP   +G   
Sbjct  219   HQQHHSMFKYVRPGAPGASVGGVPGGPGQFRPPGP---LGPFSGRGRGEWRPAAGRG---  272

Query  2766  MQKGFP---GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDEKPWRLQGIDMSDFF  2599
             M K F    G   WG +    G GLDF LP HKTIF++D+++ F+EKPW+  G D+SDFF
Sbjct  273   MNKSFHSGYGITPWGGSGRNFGGGLDFALPPHKTIFDIDVETAFEEKPWKFPGADISDFF  332

Query  2598  NFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPS  2419
             NFGL+EE WKD+CKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPELAA  G  DI +
Sbjct  333   NFGLDEEKWKDFCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPELAAVTGHPDISA  392

Query  2418  ENANLGKTEVGQNDLA---RGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDA  2248
             ++ N  K   G  D +   RG    R PL  GRPIQVE+   DR PS+D+R  R+R+SD+
Sbjct  393   DSRN--KMVNGHTDFSAQGRGPANVRTPLMTGRPIQVETNYTDRFPSVDSRSHRMRESDS  450

Query  2247  IIEIVCQG-SADDDNNLEQGNQPSREGIRGGDEIGDL---QQEDIHHVDGFQHAYNGWK  2083
             +IEIVCQG  + DD  ++Q  + S +G++     G L    + D+  +D   H+   +K
Sbjct  451   VIEIVCQGRDSMDDETVDQTEKDS-QGVKKTQHKGQLPVSSESDMLSMDANTHSPPSYK  508



>ref|XP_003560420.1| PREDICTED: zinc finger CCCH domain-containing protein 13 [Brachypodium 
distachyon]
Length=1280

 Score =   261 bits (666),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 200/312 (64%), Gaps = 20/312 (6%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWG-DELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGY  2947
             LVIVA   D  H P +EEQEWG D      DGERKE  ++ K    PG          G+
Sbjct  169   LVIVA---DGPHIPGMEEQEWGEDATAAGPDGERKEGGESGKTVPVPGGRIGYSGGGQGF  225

Query  2946  HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             H  +HS FKYVRPGAAP              +   P         GRGDWRP   +G   
Sbjct  226   HPQHHSMFKYVRPGAAPGAPLTGAPSAPGQFRPTGPPGPFPGR--GRGDWRPGAGRG---  280

Query  2766  MQKGFP---GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDID-SFDEKPWRLQGIDMSDFF  2599
             M KGF    G + WG +  G G GLDFTLP HK IF+VDID +F+EKPW+  G D+SD+F
Sbjct  281   MNKGFNSGYGMSPWGGSGRGFGGGLDFTLPPHKAIFDVDIDTTFEEKPWKYPGADISDYF  340

Query  2598  NFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPS  2419
             NFG++EE WKDYCKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPELAAA G  DI +
Sbjct  341   NFGIDEEKWKDYCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPELAAATGHHDISA  400

Query  2418  ENANLGKTEVGQNDL-ARGSIRS--RPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDA  2248
             +N N  K + G  D  A+G + +  RP +  GRPIQVE+G G+R PS DTR PR+R+SD+
Sbjct  401   DNRN--KVDNGHTDFSAQGRVPTSMRPAMMTGRPIQVETGYGERFPSADTRLPRMRESDS  458

Query  2247  IIEIVCQGSADD  2212
             +IEIVCQ  +DD
Sbjct  459   VIEIVCQVPSDD  470


 Score =   110 bits (276),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 180/343 (52%), Gaps = 47/343 (14%)
 Frame = -1

Query  1653  RTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHK  1474
             RT  +  + D +  + KK KL S++E+P P      +D     +SENS+ RSGSSKD  K
Sbjct  643   RTASETNEGDKLSHSYKKQKLISRVEQP-PVLNSSDQDELRTVNSENSRGRSGSSKDNQK  701

Query  1473  LHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRK----GRDEK-ETEKHRMIVKGREDSYM  1309
               +  EE +QD+    V+D R+  G EDR  R+     RD K + E+  +  +GRED + 
Sbjct  702   RLESGEEVLQDRLSRRVNDVRRHHGGEDRDSRRKDEYTRDVKADIERTHLASRGREDIHH  761

Query  1308  RKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIES  1129
                           +    DR +E +     WQ R+D++H RR K ED R   + D + +
Sbjct  762   -----PHVNRDRDIRGKSNDRVREPE----TWQRREDNIHNRRGKEEDLRLDYNAD-VGA  811

Query  1128  KHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRH  949
             +HRNK R+    +R+     RK LD+G  R        SR RER  D + +R +++DD H
Sbjct  812   RHRNKARN----DRDEDPHSRKWLDDGDWR-------GSRQRERG-DMVLNRRESLDDPH  859

Query  948   SKRRKEDTKLSREHVDREETLHS-RG-DGTLRRKRERDDISDQRKRDDISDQRKRDDQRL  775
              KR+K++  + R   + E+T+H+ RG D   +RKRERDD+ DQ++RD        D  R+
Sbjct  860   IKRKKDEENMRRIKSENEDTVHAYRGRDDPNKRKRERDDVLDQKRRD--------DSVRM  911

Query  774   RE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEIL  652
             RE  DD+ YA+ KE+         R RE+++  RPK  +  IL
Sbjct  912   REKADDRSYAKNKEDNW-------RQREKEDRQRPKHENTLIL  947



>ref|XP_004981927.1| PREDICTED: filaggrin-like [Setaria italica]
Length=1291

 Score =   256 bits (655),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 210/330 (64%), Gaps = 22/330 (7%)
 Frame = -1

Query  3114  VIVANSDDPSHQPMVEEQEWGDELGNS-ADGERKE--DAAKVNVGPGYAPKIGYSNHGYH  2944
             VIVA   D  H P +EEQ+WG++  ++  +G+RK+  +  K    PG          G+H
Sbjct  176   VIVA---DGPHIPGMEEQDWGEDPASAGVEGDRKDGGEPGKAVAAPGGRIGYSGGGPGFH  232

Query  2943  HPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTM  2764
               +HS FKYVRPGA         G  G      P   +   +GRGRGDWRP G +G   M
Sbjct  233   PQHHSMFKYVRPGAPGASIGGAPGGPGQFRPPGP---SGPFSGRGRGDWRPAGGRG---M  286

Query  2763  QKGF-PGYNA--WGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDEKPWRLQGIDMSDFFN  2596
              K F  GY +  WG +  G G GLDFTLP HKTIF++D+D+ F+EKPW+  G D+SDFFN
Sbjct  287   NKNFHSGYGSTPWGGSGRGFGGGLDFTLPPHKTIFDIDVDAAFEEKPWKHPGADISDFFN  346

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FG +EE WKD+CKQL+QLRLES MQ +IRVYESGR+EQ+YDPDLPPELAAA G  DI  +
Sbjct  347   FGFDEEKWKDFCKQLDQLRLESRMQSRIRVYESGRSEQDYDPDLPPELAAATGHPDISVD  406

Query  2415  NANLGKTEVGQNDL---ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
             N N  KT+ G  D     RG    R P+  GRPIQVE+   DR+P+ D+RP R+R+SD++
Sbjct  407   NRN--KTDNGHTDFDAQGRGPANVRTPVMTGRPIQVENIYTDRIPTADSRPHRMRESDSV  464

Query  2244  IEIVCQG-SADDDNNLEQGNQPSREGIRGG  2158
             IEIVCQG  + DD  ++Q  + S+ G + G
Sbjct  465   IEIVCQGRDSMDDETVDQTEKDSQGGNKKG  494


 Score =   109 bits (272),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 135/377 (36%), Positives = 200/377 (53%), Gaps = 50/377 (13%)
 Frame = -1

Query  1644  CDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSKDYHKLHD  1465
              D  +DD +  + KK K  S +E+P+   +    +    R+SENSK RSGSSKD  K  +
Sbjct  658   SDTNEDDILDHSGKKQKPISMVEQPAGHNS---SEPDELRTSENSKGRSGSSKDQQKRLE  714

Query  1464  GLEEEVQDKRFAHVDDTRQTGGEEDR-LQRK---GRDEK-ETEKHRMIVKGREDSYMRKG  1300
               EE +QD+    V+D R+    E+R L+RK    RD K + E+  +  +GRED +    
Sbjct  715   SGEEVLQDRHPRRVNDVRRHHDVEERNLRRKDEFSRDGKPDVERSHLPSRGREDPHQ---  771

Query  1299  YDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKH-  1123
                   + +  +  I  R  +R      W  R+D +HGRR K ED R  E+  E+ ++H 
Sbjct  772   -----TYANRDRVDIRSRSYDRVRETEIWPRREDSVHGRRGKEEDLRL-EYNAEVGARHN  825

Query  1122  RNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSK  943
             RNK R  DR++R+     RK+LD+G  R        SR RER  D + +R +++DD H K
Sbjct  826   RNKARPTDRNDRDEDLHSRKRLDDGDWR-------GSRQRERG-DVVLNRRESLDDSHIK  877

Query  942   RRKEDTKLSREHVDREETL--HSRGDGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE  769
             R K+D  L R   + E+ +  +   D   RRKRERDD  DQ++RDD          R+RE
Sbjct  878   RNKDDENLRRMKPENEDMVPGYRARDDNNRRKRERDDGVDQKRRDDSG--------RMRE  929

Query  768   --DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAE  595
               DD+H+A++K++   Q ER +R        RPK  H+  L+  +R+EGRG  R GR  +
Sbjct  930   KVDDRHHAKHKDDNWRQREREDR-------QRPK--HENALTL-QREEGRGTGR-GRVMD  978

Query  594   EKSWAGLSRGKDEYKGS  544
             +K  +G  + KDE + S
Sbjct  979   DKLVSG-GKKKDELRSS  994



>gb|AFW67761.1| hypothetical protein ZEAMMB73_253225, partial [Zea mays]
Length=778

 Score =   245 bits (625),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 214/365 (59%), Gaps = 30/365 (8%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWG-DELGNSADGERKEDAAKVNVGPGYAPKIGYSNHG--Y  2947
             LVIVA+       P +EEQ+WG D     A+GERK+             +IGYS  G  +
Sbjct  165   LVIVADG------PAMEEQDWGEDPAAAGAEGERKDGCEPGKTVAAPTGRIGYSGGGPGF  218

Query  2946  HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             H  +HS FKYVRPGA         G  G      P       +GRGRG+WRP   +G   
Sbjct  219   HQQHHSMFKYVRPGAPGASVGGVPGGPGQFRPPGP---LGPFSGRGRGEWRPAAGRG---  272

Query  2766  MQKGFP---GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDEKPWRLQGIDMSDFF  2599
             M K F    G   WG +    G GLDF LP HKTIF++D+++ F+EKPW+  G D+SDFF
Sbjct  273   MNKSFHSGYGITPWGGSGRNFGGGLDFALPPHKTIFDIDVETAFEEKPWKFPGADISDFF  332

Query  2598  NFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPS  2419
             NFGL+EE WKD+CKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPELAA  G  DI +
Sbjct  333   NFGLDEEKWKDFCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPELAAVTGHPDISA  392

Query  2418  ENANLGKTEVGQNDLARGSIRSRPPL-PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAII  2242
             ++ N  K   G  D    S + R P    GRPIQVE+   DR PS+D+R  R+R+SD++I
Sbjct  393   DSRN--KMVNGHTDF---SAQGRGPANMTGRPIQVETNYTDRFPSVDSRSHRMRESDSVI  447

Query  2241  EIVCQG-SADDDNNLEQGNQPSREGIRGGDEIGDL---QQEDIHHVDGFQHAYNGWKREF  2074
             EIVCQG  + DD  ++Q  + S +G++     G L    + D+  +D   H+   +K   
Sbjct  448   EIVCQGRDSMDDETVDQTEKDS-QGVKKTQHKGQLPVSSESDMLSMDANTHSPPSYKTRG  506

Query  2073  GSRRA  2059
               R A
Sbjct  507   SPRGA  511


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 92/183 (50%), Gaps = 21/183 (11%)
 Frame = -1

Query  1677  RGKISVDERTN-----CDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSEN  1513
             R ++ VD+ T+      D   DD+++ +  K K  S +E+P+   +    +    R++EN
Sbjct  602   RVEMDVDDATSDPNMPSDANHDDNLVHSDTKQKHISVVEQPTEHNS---SEPDELRNTEN  658

Query  1512  SKTRSGSSKDYHKLHDGLEEEVQDKRFAHVDDTRQ-TGGEEDRLQRK---GRDEK-ETEK  1348
             SK RSGSSKD  K  +  EE +QDK+   V++ R     EE +L++K    RD K + E+
Sbjct  659   SKGRSGSSKDQQKHLESGEEVLQDKQLRRVNNVRMHHDAEEHKLRQKDEHSRDAKSDLER  718

Query  1347  HRMIVKGREDSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVE  1168
              R+  +GRED  + + Y       +  +  I  R   +         RDD +H RR+K E
Sbjct  719   SRLPSRGRED--IHQSY------ANRDRVDIQGRSYNKVRETEILPRRDDGVHSRRAKEE  770

Query  1167  DSR  1159
             D R
Sbjct  771   DLR  773



>gb|EMS52121.1| hypothetical protein TRIUR3_15899 [Triticum urartu]
Length=1117

 Score =   233 bits (595),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 159/224 (71%), Gaps = 16/224 (7%)
 Frame = -1

Query  2808  RGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDE  2641
             RGDWRP   +G   M KGF    G   WG    G G GLDFTLP HK IF++DID+ F+E
Sbjct  95    RGDWRPGAGRG---MNKGFHSGYGMTPWGGAGRGFGGGLDFTLPPHKIIFDIDIDTTFEE  151

Query  2640  KPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLP  2461
             KPW+  G ++SDFFNFGL+EE WKDYCKQL+Q RLESTMQ +IRVYESGR+EQ+YDPDLP
Sbjct  152   KPWKYPGAEISDFFNFGLDEEKWKDYCKQLDQSRLESTMQSRIRVYESGRSEQDYDPDLP  211

Query  2460  PELaaaAGIQDIPSENANLGKTEVGQNDLA---RGSIRSRPPLPAGRPIQVESGSGDRLP  2290
             PELAAAAG  D+ ++N N  K + G  D +   R    +RP +  GRPIQVE+G G+R P
Sbjct  212   PELAAAAGHHDVSADNRN--KVDNGHTDFSAQGRVPTSNRPAVMTGRPIQVETGYGERFP  269

Query  2289  SIDTRPPRVRDSDAIIEIVCQGSADD----DNNLEQGNQPSREG  2170
             S DTRP R R+SD++IEIVC+  ADD    D++++Q  + S+ G
Sbjct  270   SADTRPGRNRESDSVIEIVCEPPADDPIVADSSVDQSEKDSQGG  313



>gb|EMT14553.1| hypothetical protein F775_08060 [Aegilops tauschii]
Length=1120

 Score =   226 bits (575),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 159/225 (71%), Gaps = 17/225 (8%)
 Frame = -1

Query  2808  RGDWRPPGMKGALTMQKGF---PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDE  2641
             RGDWRP   +G   M KGF    G   WG +  G G GLDFTLP HK IF++DID+ F+E
Sbjct  70    RGDWRPGAGRG---MNKGFHSGYGMTPWGGSGRGFGGGLDFTLPPHKIIFDIDIDTTFEE  126

Query  2640  KPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLP  2461
             KPW+  G ++SDFFNFGL+EE WKDYCKQL+Q RLESTMQ +IRVYESGR+EQ+YDPDLP
Sbjct  127   KPWKYPGAEISDFFNFGLDEEKWKDYCKQLDQSRLESTMQSRIRVYESGRSEQDYDPDLP  186

Query  2460  PELaaaAGIQDIPSENANLGKTEVGQNDLA---RGSIRSRPPLPAGRPIQVESGSGDRLP  2290
             PELAAAAG  D+ ++N N  K + G  D +   R    +RP +  GRPIQVE+G G+R P
Sbjct  187   PELAAAAGHHDVSADNRN--KVDNGHTDFSAQGRVPTSNRPAVMTGRPIQVETGYGERFP  244

Query  2289  SIDTRPPRVRDSDA-IIEIVCQGSADD----DNNLEQGNQPSREG  2170
             S DTR  R R+SD+ +IEIVC+  ADD    D++++Q  + S+ G
Sbjct  245   SADTRTARNRESDSVVIEIVCEPPADDPVVADSSVDQSEKDSQGG  289


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 161/524 (31%), Positives = 251/524 (48%), Gaps = 71/524 (14%)
 Frame = -1

Query  1644  CDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSK-TRSGSSKDYHKLH  1468
              D  +DD+   ++K+ K+ S++E+P        +      +SENS+  RSGSSKD+ K  
Sbjct  455   SDTNEDDNEDHSSKRQKIISKVEQPPGLINSSDQVDLKTLNSENSRGVRSGSSKDHQKRL  514

Query  1467  DGLEEEVQDKRFAHVDDTRQTGGEEDRLQRK----GRDEK-ETEKHRMIVKGREDSYMRK  1303
             +  EE +QD+R   V+D R+    E+R  R+     RD K E E+  +  +GR+D +   
Sbjct  515   ESGEEVLQDRRSRRVNDVRRHHDGEERDPRRKDVSARDVKPEIERTHLASRGRDDIHHPY  574

Query  1302  GYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGDEIESKH  1123
             G           +    DR +E +      Q R+D +H RR K ED R   +  E+ ++H
Sbjct  575   G-----NRDRDIRGKSFDRVRETEI----LQRREDSMHNRRGKEEDLRL-NYNAEVGARH  624

Query  1122  RNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDNIDDRHSK  943
             RNK+R IDR++R+     RK LD+G  R        SR RER    L SR +++DD H K
Sbjct  625   RNKLRPIDRNDRDEDPHPRKLLDDGDWRG-------SRQRERGDMVLNSR-ESLDDSHIK  676

Query  942   RRKEDTKLSREHVDREETLHS-RG-DGTLRRKRERDDISDQRKRDDISDQRKRDDQRLRE  769
             R+K++    R   + E+ +H  RG D   RRKRERDD  DQ++RD        D  R+RE
Sbjct  677   RKKDEENTRRMKPENEDAVHGYRGRDDPNRRKRERDDGIDQKRRD--------DGVRMRE  728

Query  768   --DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGRGGLRVGRAAE  595
               DD+   + KE+ L       R RE+D+  RPK     +L + E      G RV     
Sbjct  729   KADDRSIVKNKEDNL-------RQREKDDRQRPKHESTLLLQREEGRGTGRGGRVM----  777

Query  594   EKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENG--------SPSRHRSRED  439
             +    G  R KDE         S+ A    E L+R +++E G        + ++++ R D
Sbjct  778   DDKIVGGGRKKDE---------SRSALLSKETLERNKQNEPGRRGQGAEENSTQNKGRAD  828

Query  438   GYGRGHQPSTDERRARNERVSTRQDH--AAYESDSSKVHEKKRKENSTKDK--VPEASD-  274
                R   P+ +ER +R ++++   D+   +  SD+ +    K +E++ K +  VP   D 
Sbjct  829   VRPRDDNPNNNERNSRQDKINKIHDNNRVSSSSDARQASRDKPRESTRKGRGSVPNEQDL  888

Query  273   -KNSLLPSNLNEDDRSGNASETVC*IFA*SGIR-LKDCDSNLYY  148
              ++S      +E  RSG A+   C +     +R  K C   L  
Sbjct  889   HRSSKRRREDHESHRSGKANYKTCVLVPFLILRHCKGCTCLLLV  932



>ref|XP_001758120.1| predicted protein [Physcomitrella patens]
 gb|EDQ76942.1| predicted protein [Physcomitrella patens]
Length=1766

 Score =   209 bits (532),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 200/374 (53%), Gaps = 49/374 (13%)
 Frame = -1

Query  3210  LRIVLNDNNHG---PmgmdrmggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELG  3040
             L+IVLND+  G   P    +       DD+D + L+IVA       +P   ++ WG+E G
Sbjct  463   LQIVLNDDALGYDNPTIEAKSEFYVGSDDEDEEDLIIVAGD-----EPRDGQENWGEEGG  517

Query  3039  ----------------------NSADGERKEDAAKVNVGPGYA-PKIGYSNHGYHH--PY  2935
                                    S   +R         GP  A P+IGYS  GY++  P+
Sbjct  518   LLSEPPLPGPPSGGPLGALERVTSGGDDRGPPVKPGGQGPNLAGPRIGYSGQGYYNGQPH  577

Query  2934  HSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRG----RGDWRPPGMKGALT  2767
             H+Q+KYVRPG+           G              +AGRG    +GDW   G  G+  
Sbjct  578   HAQYKYVRPGSGASGAPASSQAGEPQPGERGAGRVDWIAGRGADGGKGDWAGRGRGGSNG  637

Query  2766  MQKGFPGYNAWGSNPSGRGIG-LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFG  2590
              +    G  +WG +      G ++FTLP  KT+F++D+D  +EKPW+  G D++D+FNFG
Sbjct  638   QRGSQSGSASWGGSGGRGYSGGMEFTLPPTKTVFDIDLDELEEKPWQRPGADVTDYFNFG  697

Query  2589  LNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENA  2410
               E SWK+YC QL Q+RLE+TMQ KIRVYESGRTEQEYDPDLPPEL AA G+QD   +N 
Sbjct  698   FTESSWKNYCLQLSQVRLEATMQSKIRVYESGRTEQEYDPDLPPELMAAQGLQDASGDNG  757

Query  2409  NLGKTEVGQNDLARGSI-------RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSD  2251
             N  +    Q+D    S        R RP +P GR IQVE G G+R PS D R  R RDSD
Sbjct  758   NHQR----QSDHGGHSACRGRGAGRGRPVMPTGRAIQVEGGGGERRPSADIRRQRTRDSD  813

Query  2250  AIIEIVCQGSADDD  2209
             A+I+IV Q +++D+
Sbjct  814   AVIQIVLQDASEDE  827



>ref|XP_002466539.1| hypothetical protein SORBIDRAFT_01g009630 [Sorghum bicolor]
 gb|EER93537.1| hypothetical protein SORBIDRAFT_01g009630 [Sorghum bicolor]
Length=685

 Score =   197 bits (501),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 180/327 (55%), Gaps = 48/327 (15%)
 Frame = -1

Query  3114  VIVANSDDPSHQPMVEEQEWG-DELGNSADGERKE--DAAKVNVGPGYAPKIGYSNHGYH  2944
             VIVA   D  H   +EEQ+WG D     A+GERK+  +  K    PG          G+H
Sbjct  174   VIVA---DGPHITGMEEQDWGEDPAAAGAEGERKDGGEPGKTVAAPGGRIGYSGGGPGFH  230

Query  2943  HPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALTM  2764
               +HS FKYVRPGA         G  G      P   +   +GRGRGDWRP   +G   M
Sbjct  231   QQHHSMFKYVRPGAPGASVGGVPGGPGQFRPPGP---SGPFSGRGRGDWRPAAGRG---M  284

Query  2763  QKGFPGYNAWGSNP----SGRGIGLDFTLPSHKTIFEVDIDS-FDEKPWRLQGIDMSDFF  2599
              K F  ++ +G  P         GLDF LP HKTIF++D+++ F+EKPW+  G D+SDFF
Sbjct  285   NKSF--HSGYGITPWGGSGRGFGGLDFALPPHKTIFDIDVETAFEEKPWKFPGADISDFF  342

Query  2598  NFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPS  2419
             NFGL+EE WKD+CKQL+                       YDPDLPPELAA  G  DI +
Sbjct  343   NFGLDEEKWKDFCKQLD-----------------------YDPDLPPELAAVTGHPDISA  379

Query  2418  ENANLGKTEVGQNDLA---RGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDA  2248
             ++ N  KT+    D +   RG    R P+  GRPIQVE+   DR PS+D+RP R+R+SD+
Sbjct  380   DSRN--KTDNSHTDFSAQGRGPANVRTPVMTGRPIQVETNYTDRFPSVDSRPHRMRESDS  437

Query  2247  IIEIVCQG-SADDDNNLEQGNQPSREG  2170
             +IEIVCQG  + DD  ++Q  + S+ G
Sbjct  438   VIEIVCQGRDSMDDETVDQTEKDSQGG  464



>gb|AAT77079.1| putative Fip1 motif containing protein [Oryza sativa Japonica 
Group]
 gb|ABF98630.1| Fip1 motif family protein, expressed [Oryza sativa Japonica Group]
 gb|ABF98631.1| Fip1 motif family protein, expressed [Oryza sativa Japonica Group]
Length=1379

 Score =   189 bits (481),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 158/267 (59%), Gaps = 20/267 (7%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWGDELGNSADGE-RKE--DAAKVNVGPGYAPKIGYSNHGY  2947
             LVIVA  D P   P +EEQ+WG++   +     RKE  +  K    PG          G+
Sbjct  186   LVIVA--DGPI--PGMEEQDWGEDAAAAGAEGERKEGGEPGKAAAAPGGRIGYSGGGQGF  241

Query  2946  HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             H  +HS FKYVRPGA                +   P         GRGDWRP   +G   
Sbjct  242   HPQHHSMFKYVRPGATLGAPLGGAPTATGQFRPPGPPGPFAGR--GRGDWRPGAGRG---  296

Query  2766  MQKGFP-GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDID-SFDEKPWRLQGIDMSDFFNF  2593
             M KGF  G   WG +      GLDFTLP HKTIF++D+D +F+EKPW+  G D+SDFFNF
Sbjct  297   MNKGFGYGMPPWGGS-GRGFGGLDFTLPPHKTIFDIDVDTTFEEKPWKYPGADISDFFNF  355

Query  2592  GLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSEN  2413
             GL++E WKDYCKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPELAAA G  DI +++
Sbjct  356   GLDDEKWKDYCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPELAAATGHHDISADS  415

Query  2412  ANLGKTEVGQNDL---ARGSIRSRPPL  2341
              N  KT+ G  D+    R     RPP+
Sbjct  416   RN--KTDNGHTDVNTQGRVPTSMRPPV  440


 Score =   119 bits (298),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 238/455 (52%), Gaps = 55/455 (12%)
 Frame = -1

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             +V E T  D    D++  + KK KL S+ E+P+   +   +D    R+S+NS+ RSGSSK
Sbjct  733   TVSETTTTDG---DNLSHSGKKQKLISRAEQPTGHNS-SDQDELRTRNSDNSRGRSGSSK  788

Query  1485  DYHKLHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRKG----RDEK-ETEKHRMIVKGRE  1321
             D  K  +  EE +QD+R   ++D R+    EDR  R+     RD K + E+  +  + R+
Sbjct  789   DNQKRLESGEEVLQDRRSRRINDARRHHDGEDRNSRRKDEYLRDIKPDVERSHLASRSRD  848

Query  1320  DSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGD  1141
             D+Y           +++    +  R  +R      WQ R++ +H RR+K ED R  EH  
Sbjct  849   DTY---------HPYANRDRDMRGRSYDRVRDTEIWQRREESVHNRRAKEEDVRL-EHNA  898

Query  1140  EIESKHRNKIR-DIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDN  964
             E+ +++RNK+R  +DR++R      RK+LD+G  R        SR RER  D + +R +N
Sbjct  899   EVGARNRNKMRPPVDRNDRIEDPHARKRLDDGDWR-------GSRPRERG-DVVLNRREN  950

Query  963   IDDRHSKRRKEDTKLSREHVDREETLHS----RG-DGTLRRKRERDDISDQRKRDDISDQ  799
             IDD H KR+K++  + R   + E+ +H     RG D   RRKRERDD  DQ++RD     
Sbjct  951   IDDSHMKRKKDEENMRRMKPENEDIVHGQHGYRGRDDPNRRKRERDDGIDQKRRD-----  1005

Query  798   RKRDDQRLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGR  625
                D+ R+RE  DD+++ ++KE+   Q ER +RH       RPK  HD  ++  +RDEGR
Sbjct  1006  ---DNARMREKADDRYHTKHKEDNWRQREREDRH-------RPK--HDNTVTL-QRDEGR  1052

Query  624   GGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSR  445
             G  R GR  ++K      R +DE + +     +++  R  + L+R +  E  +  ++R R
Sbjct  1053  GSGRGGRILDDK-LVTSGRKQDESRSAGLSKEAQERSRQNDPLRRDQGAEENN-MQNRGR  1110

Query  444   EDGYGRGHQPSTDERRARNERVSTRQDHAAYESDS  340
              D + R   P+  ER  R E+ +   D     S+S
Sbjct  1111  SDVHPRDENPNNSERNTRQEKPNNTHDGNRLSSNS  1145


 Score = 72.4 bits (176),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -1

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSAD----DDNNLEQGNQPSREG  2170
              GRPIQVE+G G+RLPSIDTR PR+R+SD++IEIVCQG +D    DD+ ++Q  + S+ G
Sbjct  521   TGRPIQVETGYGERLPSIDTRLPRMRESDSVIEIVCQGQSDDPLVDDSTVDQTEKDSQRG  580



>gb|EAZ28430.1| hypothetical protein OsJ_12413 [Oryza sativa Japonica Group]
Length=1459

 Score =   188 bits (478),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 158/267 (59%), Gaps = 20/267 (7%)
 Frame = -1

Query  3117  LVIVANSDDPSHQPMVEEQEWGDELGNSADGE-RKE--DAAKVNVGPGYAPKIGYSNHGY  2947
             LVIVA  D P   P +EEQ+WG++   +     RKE  +  K    PG          G+
Sbjct  266   LVIVA--DGPI--PGMEEQDWGEDAAAAGAEGERKEGGEPGKAAAAPGGRIGYSGGGQGF  321

Query  2946  HHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPGMKGALT  2767
             H  +HS FKYVRPGA                +   P         GRGDWRP   +G   
Sbjct  322   HPQHHSMFKYVRPGATLGAPLGGAPTATGQFRPPGPPGPFAGR--GRGDWRPGAGRG---  376

Query  2766  MQKGFP-GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDID-SFDEKPWRLQGIDMSDFFNF  2593
             M KGF  G   WG +      GLDFTLP HKTIF++D+D +F+EKPW+  G D+SDFFNF
Sbjct  377   MNKGFGYGMPPWGGS-GRGFGGLDFTLPPHKTIFDIDVDTTFEEKPWKYPGADISDFFNF  435

Query  2592  GLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSEN  2413
             GL++E WKDYCKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPELAAA G  DI +++
Sbjct  436   GLDDEKWKDYCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPELAAATGHHDISADS  495

Query  2412  ANLGKTEVGQNDL---ARGSIRSRPPL  2341
              N  KT+ G  D+    R     RPP+
Sbjct  496   RN--KTDNGHTDVNTQGRVPTSMRPPV  520


 Score =   119 bits (298),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 238/455 (52%), Gaps = 55/455 (12%)
 Frame = -1

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             +V E T  D    D++  + KK KL S+ E+P+   +   +D    R+S+NS+ RSGSSK
Sbjct  813   TVSETTTTDG---DNLSHSGKKQKLISRAEQPTGHNS-SDQDELRTRNSDNSRGRSGSSK  868

Query  1485  DYHKLHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRKG----RDEK-ETEKHRMIVKGRE  1321
             D  K  +  EE +QD+R   ++D R+    EDR  R+     RD K + E+  +  + R+
Sbjct  869   DNQKRLESGEEVLQDRRSRRINDARRHHDGEDRNSRRKDEYLRDIKPDVERSHLASRSRD  928

Query  1320  DSYMRKGYDsssahhsHTKTSIADRRKERDYSDVAWQHRDDDLHGRRSKVEDSRKREHGD  1141
             D+Y           +++    +  R  +R      WQ R++ +H RR+K ED R  EH  
Sbjct  929   DTY---------HPYANRDRDMRGRSYDRVRDTEIWQRREESVHNRRAKEEDVRL-EHNA  978

Query  1140  EIESKHRNKIR-DIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDDLKSRYDN  964
             E+ +++RNK+R  +DR++R      RK+LD+G  R        SR RER  D + +R +N
Sbjct  979   EVGARNRNKMRPPVDRNDRIEDPHARKRLDDGDWR-------GSRPRERG-DVVLNRREN  1030

Query  963   IDDRHSKRRKEDTKLSREHVDREETLHS----RG-DGTLRRKRERDDISDQRKRDDISDQ  799
             IDD H KR+K++  + R   + E+ +H     RG D   RRKRERDD  DQ++RD     
Sbjct  1031  IDDSHMKRKKDEENMRRMKPENEDIVHGQHGYRGRDDPNRRKRERDDGIDQKRRD-----  1085

Query  798   RKRDDQRLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSKRERDEGR  625
                D+ R+RE  DD+++ ++KE+   Q ER +RH       RPK  HD  ++  +RDEGR
Sbjct  1086  ---DNARMREKADDRYHTKHKEDNWRQREREDRH-------RPK--HDNTVTL-QRDEGR  1132

Query  624   GGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGSPSRHRSR  445
             G  R GR  ++K      R +DE + +     +++  R  + L+R +  E  +  ++R R
Sbjct  1133  GSGRGGRILDDK-LVTSGRKQDESRSAGLSKEAQERSRQNDPLRRDQGAEENN-MQNRGR  1190

Query  444   EDGYGRGHQPSTDERRARNERVSTRQDHAAYESDS  340
              D + R   P+  ER  R E+ +   D     S+S
Sbjct  1191  SDVHPRDENPNNSERNTRQEKPNNTHDGNRLSSNS  1225


 Score = 72.4 bits (176),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -1

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSAD----DDNNLEQGNQPSREG  2170
              GRPIQVE+G G+RLPSIDTR PR+R+SD++IEIVCQG +D    DD+ ++Q  + S+ G
Sbjct  601   TGRPIQVETGYGERLPSIDTRLPRMRESDSVIEIVCQGQSDDPLVDDSTVDQTEKDSQRG  660



>gb|EEC76101.1| hypothetical protein OsI_13355 [Oryza sativa Indica Group]
Length=1140

 Score =   178 bits (451),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 116/161 (72%), Gaps = 11/161 (7%)
 Frame = -1

Query  2808  RGDWRPPGMKGALTMQKGFP-GYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDS-FDEKP  2635
             RGDWRP   +G   M KGF  G   WG +      GLDFTLP HKTIF++D+D+ F+EKP
Sbjct  47    RGDWRPGAGRG---MNKGFGYGMPPWGGS-GRGFGGLDFTLPPHKTIFDIDVDTTFEEKP  102

Query  2634  WRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPE  2455
             W+  G D+SDFFNFGL++E WKDYCKQL+QLRLESTMQ +IRVYESGR+EQ+YDPDLPPE
Sbjct  103   WKYPGADISDFFNFGLDDEKWKDYCKQLDQLRLESTMQSRIRVYESGRSEQDYDPDLPPE  162

Query  2454  LaaaAGIQDIPSENANLGKTEVGQNDL---ARGSIRSRPPL  2341
             LAAA G  DI +++ N  KT+ G  D+    R     RPP+
Sbjct  163   LAAATGHHDISADSRN--KTDNGHTDVNTQGRVPTSMRPPV  201


 Score =   117 bits (293),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 239/462 (52%), Gaps = 69/462 (15%)
 Frame = -1

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             +V E T  D    D++  + KK KL S+ E+P+   +   +D    R+S+NS+ RSGSSK
Sbjct  494   TVSETTTTDG---DNLSHSGKKQKLISRAEQPTGHNS-SDQDELRTRNSDNSRGRSGSSK  549

Query  1485  DYHKLHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRKG----RDEK-ETEKHRMIVKGRE  1321
             D  K  +  EE +QD+R   ++D R+    EDR  R+     RD K + E+  +  + R+
Sbjct  550   DNQKRLESGEEVLQDRRSRRINDARRHHDGEDRNSRRKDEYLRDIKPDVERSHLASRSRD  609

Query  1320  DSYMRKGYDsssahhsHTKTSIADRRKE---RDYSDV----AWQHRDDDLHGRRSKVEDS  1162
             D+Y                   A+R ++   R Y  V     WQ R++ +H RR+K ED 
Sbjct  610   DTYH----------------PYANRDRDMRGRSYDRVRDTEIWQRREESVHNRRAKEEDV  653

Query  1161  RKREHGDEIESKHRNKIR-DIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDD  985
             R  EH  E+ +++RNK+R  +DR++R      RK+LD+G  R        SR RER  D 
Sbjct  654   RL-EHNAEVGARNRNKMRPPVDRNDRIEDPHARKRLDDGDWR-------GSRPRERG-DV  704

Query  984   LKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHS----RG-DGTLRRKRERDDISDQRK  820
             + +R +NIDD H KR+K++  + R   + E+ +H     RG D   RRKRERDD  DQ++
Sbjct  705   VLNRRENIDDSHMKRKKDEENMRRMKPENEDIVHGQHGYRGRDDPNRRKRERDDGIDQKR  764

Query  819   RDDISDQRKRDDQRLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSK  646
             RD        D+ R+RE  DD+++ ++KE+   Q ER +RH       RPK  HD  ++ 
Sbjct  765   RD--------DNARMREKADDRYHTKHKEDNWRQREREDRH-------RPK--HDNTVTL  807

Query  645   RERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGS  466
              +RDEGRG  R GR  ++K      R +DE + +     +++  R  + L+R +  E  +
Sbjct  808   -QRDEGRGSGRGGRILDDK-LVTSGRKQDESRSAGLSKEAQERSRQNDPLRRDQGAEENN  865

Query  465   PSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDS  340
               ++R R D + R   P+  ER  R E+ +   D     S+S
Sbjct  866   -MQNRGRSDVHPRDENPNNSERNTRQEKPNNTHDGNRLSSNS  906


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = -1

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSAD----DDNNLEQGNQPSREG  2170
              GRPIQVE+G G+RLPSIDTR PR+R+SD++IEIVCQG +D    DD+ ++Q  + S+ G
Sbjct  282   TGRPIQVETGYGERLPSIDTRLPRMRESDSVIEIVCQGQSDDPLVDDSTVDQTEKDSQRG  341



>emb|CDY55018.1| BnaA10g29420D [Brassica napus]
Length=110

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 69/103 (67%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -1

Query  2784  MKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSD  2605
             M+     QKG+  + AWGSN +GRG  LDFTLPSHKTIFEVDI++F++KPWR QG+D++D
Sbjct  1     MRNPSVAQKGY--HQAWGSNTAGRG--LDFTLPSHKTIFEVDIETFEDKPWRYQGVDITD  56

Query  2604  FFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEY  2476
             +FNFGLNEE+W DYCKQL+Q R+E+TMQ +IRVYESGRT+Q Y
Sbjct  57    YFNFGLNEETWIDYCKQLDQRRIETTMQSRIRVYESGRTDQVY  99



>emb|CAN75318.1| hypothetical protein VITISV_026156 [Vitis vinifera]
Length=362

 Score =   139 bits (351),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 134/186 (72%), Gaps = 13/186 (7%)
 Frame = -1

Query  3210  LRIVLNDNNHGPmgmdrm-ggdgddddddgDPLVIVANSDDPSHQPMVEEQEWGDELGNS  3034
             L+IVLNDNNHGPM  +R      DD+D+DGDPLVIVA+ D  +H P+ EEQEWG++   +
Sbjct  182   LQIVLNDNNHGPMAAERNGVMGSDDEDEDGDPLVIVADGDQ-THPPL-EEQEWGED--TA  237

Query  3033  ADGERKE--DAAKVNVGPGYAPKIGYSNHGYHHPYHSQFKYVRpgaapipgappvgpggt  2860
              DGERKE  DAAKVN      PKIGYS+HGY HP+HSQFKYVRPGAAPIPGA  V PGGT
Sbjct  238   VDGERKEGADAAKVNGAIAGPPKIGYSSHGY-HPFHSQFKYVRPGAAPIPGAAAVVPGGT  296

Query  2859  pgqvhppVNTSLVAGRGRGDWRPPGMKGALTMQKGFP---GYNAWGSNPSGRGI--GLDF  2695
             PGQV P  N   V GRGRGDWRP G+K A  MQK F    G  AWG N +GRG   GL+F
Sbjct  297   PGQVRPLANIGPVPGRGRGDWRPAGIKNAPPMQKNFHSGFGAPAWGGNMAGRGFGGGLEF  356

Query  2694  TLPSHK  2677
             TLPSHK
Sbjct  357   TLPSHK  362



>ref|XP_006841433.1| hypothetical protein AMTR_s00003p00049560 [Amborella trichopoda]
 gb|ERN03108.1| hypothetical protein AMTR_s00003p00049560 [Amborella trichopoda]
Length=1203

 Score =   141 bits (355),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 108/183 (59%), Gaps = 15/183 (8%)
 Frame = -1

Query  2772  LTMQKGF-PGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFN  2596
             + +  GF   YN+  S P  +  G +F+LP +KTI +++I+ F+ KPWR  G+D++DFFN
Sbjct  282   VVLCSGFISSYNSGISAP--KHNGFEFSLPRYKTILDINIERFEMKPWRHPGVDITDFFN  339

Query  2595  FGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSE  2416
             FG NEESWK+YCK LEQ R ++ MQ KI VYESGRT Q ++PD   +  AA    D    
Sbjct  340   FGFNEESWKEYCKCLEQHRQQAMMQTKIPVYESGRTSQAHEPDFFDKEVAAQATAD----  395

Query  2415  NANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
                L +   G+       I     +  GR I VE G  +R PS+D R  R+RDS+ +I+I
Sbjct  396   --KLDQVRTGER------ISFTENMVKGRVIPVEDGFTERRPSVDMRRSRLRDSNVVIQI  447

Query  2235  VCQ  2227
               Q
Sbjct  448   ALQ  450



>emb|CAN76673.1| hypothetical protein VITISV_011790 [Vitis vinifera]
Length=1338

 Score =   135 bits (340),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 98/289 (34%), Positives = 140/289 (48%), Gaps = 48/289 (17%)
 Frame = -1

Query  2952  GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPG---M  2782
             GYH  + SQ+KY+R  +   P                    S  +   RGDW   G    
Sbjct  129   GYHLQF-SQYKYIRSHSTVFPSNAKANGTAKV--------ASFSSMLARGDWEENGSNQH  179

Query  2781  KGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDF  2602
             KG+ +++       A      G   G  F+LP ++TI +V+ID+F++KPWR  G+D++DF
Sbjct  180   KGSSSVEIASTHTRAAPLVAQG---GYGFSLPWYRTILDVNIDTFEQKPWRHPGVDLTDF  236

Query  2601  FNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIP  2422
             FNFG NEE+WK+YC  LEQ R +  +  +  V+ S +  Q                    
Sbjct  237   FNFGFNEETWKNYCNSLEQYRKQMXILNQTPVHHSSKPNQ--------------------  276

Query  2421  SENANLGKTEVGQNDLAR-GSIRS-------RPPLPAGRPIQVESGSGDRLPSIDTRPPR  2266
             +E   L   + GQ  + + GSI S       R  LP GR IQVE  +G+R PS+D R PR
Sbjct  277   TEEGGLEHEKDGQEPVCKQGSIVSPTSKSTDRLELPKGRAIQVEGSTGERQPSMDVRRPR  336

Query  2265  VRDSDAIIEIVCQGSADDD-NNLEQGNQPSREGIRGGDEIGDLQQEDIH  2122
              RDS  +I I  Q S DD+ +N++     S E   G  ++GD   +DIH
Sbjct  337   HRDSGVVIHIAVQDSVDDEIDNIDSTEDESSEN--GDFKVGD--NKDIH  381



>ref|XP_002272609.1| PREDICTED: FIP1[III]-like protein [Vitis vinifera]
 emb|CBI22883.3| unnamed protein product [Vitis vinifera]
Length=1300

 Score =   135 bits (339),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 98/289 (34%), Positives = 140/289 (48%), Gaps = 48/289 (17%)
 Frame = -1

Query  2952  GYHHPYHSQFKYVRpgaapipgappvgpggtpgqvhppVNTSLVAGRGRGDWRPPG---M  2782
             GYH  + SQ+KY+R  +   P                    S  +   RGDW   G    
Sbjct  129   GYHLQF-SQYKYIRSHSTVFPSNAKANGTAKV--------ASFSSMLARGDWEENGSNQH  179

Query  2781  KGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDF  2602
             KG+ +++       A      G   G  F+LP ++TI +V+ID+F++KPWR  G+D++DF
Sbjct  180   KGSSSVEIASTHTRAAPLVAQG---GYGFSLPWYRTILDVNIDTFEQKPWRHPGVDLTDF  236

Query  2601  FNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIP  2422
             FNFG NEE+WK+YC  LEQ R +  +  +  V+ S +  Q                    
Sbjct  237   FNFGFNEETWKNYCNSLEQYRKQMHILNQTPVHHSSKPNQ--------------------  276

Query  2421  SENANLGKTEVGQNDLAR-GSIRS-------RPPLPAGRPIQVESGSGDRLPSIDTRPPR  2266
             +E   L   + GQ  + + GSI S       R  LP GR IQVE  +G+R PS+D R PR
Sbjct  277   TEEGGLEHEKDGQEPVCKQGSIVSPTSKSTDRLELPKGRAIQVEGSTGERQPSMDVRRPR  336

Query  2265  VRDSDAIIEIVCQGSADDD-NNLEQGNQPSREGIRGGDEIGDLQQEDIH  2122
              RDS  +I I  Q S DD+ +N++     S E   G  ++GD   +DIH
Sbjct  337   HRDSGVVIHIAVQDSVDDEIDNIDSTEDESSEN--GDFKVGD--NKDIH  381



>ref|XP_010921466.1| PREDICTED: LOW QUALITY PROTEIN: FIP1[V]-like protein [Elaeis 
guineensis]
Length=1301

 Score =   132 bits (332),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 8/166 (5%)
 Frame = -1

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             G  FTLP ++TIF+++I++F++KPWR  G+D++D+FNFGL+E+SWK YC+QL+Q R + T
Sbjct  223   GYSFTLPRNRTIFDINIEAFEQKPWRQPGVDITDYFNFGLDEDSWKSYCQQLDQFRQQVT  282

Query  2526  MQGKIRVYESGRTEQEYDPDL-PPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
             M  +   Y   R  Q  + DL  P+   +   Q    E + L    V +  +        
Sbjct  283   MFTQFPDYNLSRRNQVLESDLGSPKAMLSEAAQWEHREKSFLHMENVERRLMG-------  335

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
               +P GR IQVESG G+R+PS D R PR  DSD +I+I   GS ++
Sbjct  336   LQMPKGRAIQVESGVGERIPSADIRRPRHLDSDVVIQIAMDGSMEN  381



>ref|XP_007035794.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY06720.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1247

 Score =   131 bits (329),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 10/162 (6%)
 Frame = -1

Query  2709  IGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLES  2530
              G  F+LP ++TI ++ ID+F+EKPWR  GID++DFFNFG NE+SWK YC  LE+ R  S
Sbjct  202   FGYGFSLPWYRTILDMKIDAFEEKPWRHPGIDITDFFNFGFNEDSWKRYCNSLEKFRHRS  261

Query  2529  TMQGKIRVYESGRTEQEYDPDLPPELaaaAGI-QDIPSENANLGKTEVGQNDLARGSIRS  2353
             + Q +I VY S + +Q Y+ +   E A    + +D+     +    + G+  L       
Sbjct  262   SRQARIPVYFSSKLDQAYEAEAGLETATQEAMTEDVSKVEPSFKCADRGEMPLE------  315

Query  2352  RPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
                LP GR IQVE    +R PS+D R PR +DSD II+I  Q
Sbjct  316   ---LPKGRAIQVEDSINERQPSMDLRRPRFQDSDVIIQITVQ  354



>ref|XP_010267959.1| PREDICTED: uncharacterized protein LOC104605053 [Nelumbo nucifera]
Length=1300

 Score =   130 bits (326),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 104/175 (59%), Gaps = 21/175 (12%)
 Frame = -1

Query  2724  PSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQ  2545
             PS    G DF+LP ++TI +V+I+ F+ KPWR  G+D++DFFNFGL+EE+WKDYC +LEQ
Sbjct  255   PSVTSRGRDFSLPWYRTILDVNIEMFERKPWRQPGVDITDFFNFGLDEENWKDYCNRLEQ  314

Query  2544  LRLESTMQGKIRVYESGRTEQEYDPDL----PPELaaaAGIQDIPSENANLGKTEVGQND  2377
              R ++ +    R   S + E E  P++      ++    GI  +P +N +          
Sbjct  315   FRQKAAIL--TRPNRSHQDETENRPEVVAGESSQILDGEGIS-LPLKNTD----------  361

Query  2376  LARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                G++R    +P GR IQVE G G+R PSID R PR RDSD +IEI  Q S +D
Sbjct  362   ---GAVRL-LEMPKGRAIQVEGGIGERRPSIDVRRPRNRDSDVVIEIAVQDSLED  412



>ref|XP_008781139.1| PREDICTED: uncharacterized protein LOC103700993 [Phoenix dactylifera]
Length=1264

 Score =   129 bits (323),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 102/174 (59%), Gaps = 8/174 (5%)
 Frame = -1

Query  2730  SNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQL  2551
             S P+    G  FTLP ++TIF++ +++F++KPWR  G D++D+FNFGL+E+SWK Y +QL
Sbjct  226   SIPASAQNGYGFTLPRNRTIFDISVEAFEQKPWRRPGADITDYFNFGLDEDSWKTYFQQL  285

Query  2550  EQLRLESTMQGKIRVYESGRTEQEYDPDL-PPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             +Q R ++TM  +   Y+  R  Q  + DL  P+       Q    + + L    V +  +
Sbjct  286   DQCRQQATMFTQFPFYKLSRQNQVLESDLGSPKAMLTKAAQWEQRKKSFLHMENVERRLM  345

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       +P GR IQVESG G+R+PS D R PR RDSD +I+I   GS ++
Sbjct  346   G-------LQMPKGRAIQVESGVGERIPSADIRRPRHRDSDVVIQIAMGGSMEN  392



>ref|XP_011010422.1| PREDICTED: FIP1[III]-like protein isoform X2 [Populus euphratica]
Length=1194

 Score =   122 bits (307),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 106/204 (52%), Gaps = 22/204 (11%)
 Frame = -1

Query  2832  TSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDID  2653
              S  +   RG+W     K           ++A  ++    G G  ++LP +++I +V+ID
Sbjct  177   ASCSSSSARGNWEDNRCKQHKVNSGRVANFHATTNSVLSHG-GYGYSLPWYRSILDVNID  235

Query  2652  SFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYD  2473
             +F+EK WR  G+ +S+FFNFG NE+SWK YC  LEQ   +S M G + +  S ++ Q Y 
Sbjct  236   AFEEKQWRYPGVHISNFFNFGFNEDSWKQYCMSLEQYGQQSYMHGAMSILHSSKSTQAY-  294

Query  2472  PDLPPE-----LaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
                 PE     +A      D  SE A+ G  ++G              L  GRPIQVE  
Sbjct  295   -GFGPEQNSIAIADHISQVDSSSEYADRGGKQLG--------------LRKGRPIQVEDS  339

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEI  2236
             +G+R P++D R PRV DSD +I+I
Sbjct  340   TGERQPTMDLRRPRVWDSDVVIKI  363



>ref|XP_011010415.1| PREDICTED: FIP1[III]-like protein isoform X1 [Populus euphratica]
Length=1209

 Score =   122 bits (307),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 106/204 (52%), Gaps = 22/204 (11%)
 Frame = -1

Query  2832  TSLVAGRGRGDWRPPGMKGALTMQKGFPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDID  2653
              S  +   RG+W     K           ++A  ++    G G  ++LP +++I +V+ID
Sbjct  177   ASCSSSSARGNWEDNRCKQHKVNSGRVANFHATTNSVLSHG-GYGYSLPWYRSILDVNID  235

Query  2652  SFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYD  2473
             +F+EK WR  G+ +S+FFNFG NE+SWK YC  LEQ   +S M G + +  S ++ Q Y 
Sbjct  236   AFEEKQWRYPGVHISNFFNFGFNEDSWKQYCMSLEQYGQQSYMHGAMSILHSSKSTQAY-  294

Query  2472  PDLPPE-----LaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
                 PE     +A      D  SE A+ G  ++G              L  GRPIQVE  
Sbjct  295   -GFGPEQNSIAIADHISQVDSSSEYADRGGKQLG--------------LRKGRPIQVEDS  339

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEI  2236
             +G+R P++D R PRV DSD +I+I
Sbjct  340   TGERQPTMDLRRPRVWDSDVVIKI  363



>ref|XP_008340604.1| PREDICTED: uncharacterized protein LOC103403539 isoform X3 [Malus 
domestica]
Length=1010

 Score =   117 bits (293),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 96/178 (54%), Gaps = 18/178 (10%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPWR   +D++D+FNFGL E+SWK YC  LEQLRL ++MQ 
Sbjct  40    FRLPWYRTILDVNIESFEEKPWRYPEVDVTDYFNFGLKEDSWKQYCISLEQLRL-TSMQF  98

Query  2517  KI------RVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
             +I      ++Y++     EYD             + I  E  N G  +         S  
Sbjct  99    RIPVSRASKLYQAKEAGSEYD---------KFAQETIYKETNNAGPRKFAPPSRDSDSSF  149

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
                 LP GR IQ+E    +R PS D R PR  DSD +I+I  Q   ++  N   EQG+
Sbjct  150   RELELPKGRAIQIEDSMVERQPSFDGRHPRSLDSDVVIQIAVQDGTEETTNSGEEQGH  207



>ref|XP_008340602.1| PREDICTED: uncharacterized protein LOC103403539 isoform X1 [Malus 
domestica]
Length=1159

 Score =   117 bits (293),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 96/178 (54%), Gaps = 18/178 (10%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPWR   +D++D+FNFGL E+SWK YC  LEQLRL ++MQ 
Sbjct  189   FRLPWYRTILDVNIESFEEKPWRYPEVDVTDYFNFGLKEDSWKQYCISLEQLRL-TSMQF  247

Query  2517  KI------RVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
             +I      ++Y++     EYD             + I  E  N G  +         S  
Sbjct  248   RIPVSRASKLYQAKEAGSEYD---------KFAQETIYKETNNAGPRKFAPPSRDSDSSF  298

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
                 LP GR IQ+E    +R PS D R PR  DSD +I+I  Q   ++  N   EQG+
Sbjct  299   RELELPKGRAIQIEDSMVERQPSFDGRHPRSLDSDVVIQIAVQDGTEETTNSGEEQGH  356



>ref|XP_008340603.1| PREDICTED: uncharacterized protein LOC103403539 isoform X2 [Malus 
domestica]
Length=1152

 Score =   117 bits (292),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 96/178 (54%), Gaps = 18/178 (10%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPWR   +D++D+FNFGL E+SWK YC  LEQLRL ++MQ 
Sbjct  189   FRLPWYRTILDVNIESFEEKPWRYPEVDVTDYFNFGLKEDSWKQYCISLEQLRL-TSMQF  247

Query  2517  KI------RVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
             +I      ++Y++     EYD             + I  E  N G  +         S  
Sbjct  248   RIPVSRASKLYQAKEAGSEYD---------KFAQETIYKETNNAGPRKFAPPSRDSDSSF  298

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
                 LP GR IQ+E    +R PS D R PR  DSD +I+I  Q   ++  N   EQG+
Sbjct  299   RELELPKGRAIQIEDSMVERQPSFDGRHPRSLDSDVVIQIAVQDGTEETTNSGEEQGH  356



>ref|XP_007035795.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY06721.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=907

 Score =   116 bits (290),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 85/147 (58%), Gaps = 10/147 (7%)
 Frame = -1

Query  2664  VDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTE  2485
             + ID+F+EKPWR  GID++DFFNFG NE+SWK YC  LE+ R  S+ Q +I VY S + +
Sbjct  1     MKIDAFEEKPWRHPGIDITDFFNFGFNEDSWKRYCNSLEKFRHRSSRQARIPVYFSSKLD  60

Query  2484  QEYDPDLPPELaaaAGI-QDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESG  2308
             Q Y+ +   E A    + +D+     +    + G+  L          LP GR IQVE  
Sbjct  61    QAYEAEAGLETATQEAMTEDVSKVEPSFKCADRGEMPLE---------LPKGRAIQVEDS  111

Query  2307  SGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
               +R PS+D R PR +DSD II+I  Q
Sbjct  112   INERQPSMDLRRPRFQDSDVIIQITVQ  138



>ref|XP_008223390.1| PREDICTED: uncharacterized protein LOC103323193 [Prunus mume]
Length=1170

 Score =   115 bits (287),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 97/175 (55%), Gaps = 16/175 (9%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+++SF+EKPWR  G+D++D+FNFGLNE+SWK YC  LEQLR+ S   G
Sbjct  204   FRLPWYRTILDVNVESFEEKPWRYPGVDLTDYFNFGLNEDSWKQYCNSLEQLRMASMQFG  263

Query  2517  -----KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGK-TEVGQNDLARGSIR  2356
                    ++Y++     EYD             Q+  S++ N     + G       S  
Sbjct  264   IPVPDSSKLYQAKEAGSEYD----------KFAQETISKDMNHADPRKHGPPSRFFDSRV  313

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNLEQG  2191
              +  LP GR IQ+E    +R PS D+R P   DSD +I+I  QG  ++ ++  +G
Sbjct  314   RQLELPKGRAIQIEDSIIERQPSFDSRHPLSLDSDVVIQITVQGPTEETSDSGEG  368



>ref|XP_008360248.1| PREDICTED: uncharacterized protein LOC103423952 isoform X2 [Malus 
domestica]
Length=1133

 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 9/174 (5%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPW+  G+D++D+FNFGLNE+ WK YC  LEQL L ++MQ 
Sbjct  162   FRLPWYRTILDVNIESFEEKPWKYPGVDVTDYFNFGLNEDCWKQYCISLEQLWL-TSMQF  220

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVG--QNDLARGSIRSRPP  2344
              I V ++ +  Q  +     E  +    + I  E  N G T+     +  +  S R    
Sbjct  221   GIPVSKASKFYQAKEAGSAYEKFSQ---ETIYKETNNAGPTKFAPPPSRDSDSSFRE-LE  276

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
             LP GR IQVE    +R PS D+R PR  DSD +I+I  Q   ++ +N   EQG+
Sbjct  277   LPKGRAIQVEDSMVERQPSFDSRHPRSLDSDVVIQIAVQDGTEETSNSGEEQGH  330



>ref|XP_008360247.1| PREDICTED: uncharacterized protein LOC103423952 isoform X1 [Malus 
domestica]
Length=1140

 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 9/174 (5%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPW+  G+D++D+FNFGLNE+ WK YC  LEQL L ++MQ 
Sbjct  162   FRLPWYRTILDVNIESFEEKPWKYPGVDVTDYFNFGLNEDCWKQYCISLEQLWL-TSMQF  220

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVG--QNDLARGSIRSRPP  2344
              I V ++ +  Q  +     E  +    + I  E  N G T+     +  +  S R    
Sbjct  221   GIPVSKASKFYQAKEAGSAYEKFSQ---ETIYKETNNAGPTKFAPPPSRDSDSSFRE-LE  276

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
             LP GR IQVE    +R PS D+R PR  DSD +I+I  Q   ++ +N   EQG+
Sbjct  277   LPKGRAIQVEDSMVERQPSFDSRHPRSLDSDVVIQIAVQDGTEETSNSGEEQGH  330



>ref|XP_008390577.1| PREDICTED: uncharacterized protein LOC103452819 [Malus domestica]
Length=816

 Score =   114 bits (284),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 100/174 (57%), Gaps = 9/174 (5%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++TI +V+I+SF+EKPW+  G+D++D+FNFGLNE+ WK YC  LEQL L ++MQ 
Sbjct  162   FRLPWYRTILDVNIESFEEKPWKYPGVDVTDYFNFGLNEDCWKQYCISLEQLWL-TSMQF  220

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVG--QNDLARGSIRSRPP  2344
              I V ++ +  Q  +     E       + I  E  N G T+     +  +  S R    
Sbjct  221   GIPVSKASKFYQAKEAGSAYE---KFSQETIYKETNNAGPTKFAPPPSRDSDSSFREL-E  276

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADDDNNL--EQGN  2188
             LP GR IQVE    +R PS D+R PR  DSD +I+I  Q   ++ +N   EQG+
Sbjct  277   LPKGRAIQVEDSMVERQPSFDSRHPRSLDSDVVIQIAVQDGTEETSNSGEEQGH  330



>ref|XP_010097780.1| hypothetical protein L484_004194 [Morus notabilis]
 gb|EXB71059.1| hypothetical protein L484_004194 [Morus notabilis]
Length=1179

 Score =   113 bits (283),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 88/169 (52%), Gaps = 41/169 (24%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRL------  2536
             F+LP +++I +V+ID+ +EKPWR  G+D++DFFNFG NE+SW+ YC  LEQLR       
Sbjct  182   FSLPWYRSILDVNIDTLEEKPWRYPGVDVTDFFNFGFNEDSWRQYCNSLEQLRWPSFGES  241

Query  2535  -ESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSI  2359
               S    + + YE+G    E             G ++   +N +                
Sbjct  242   GNSNHMSRNQDYEAGSNYDE-------------GFEETMVDNVD----------------  272

Query  2358  RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                   P GR IQVE GSG+R PS+D R PR RDSD +I+I  +   +D
Sbjct  273   -----QPKGRAIQVEDGSGERQPSVDVRRPRDRDSDVVIQITLEDPIED  316



>ref|XP_002519223.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43087.1| conserved hypothetical protein [Ricinus communis]
Length=1155

 Score =   110 bits (276),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 103/199 (52%), Gaps = 14/199 (7%)
 Frame = -1

Query  2811  GRGDWRPPGMKGALTMQKG-FPGYNAWGSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKP  2635
              RG+W     K       G     +A GS+    G G  ++LP ++TI +VDID+F+EK 
Sbjct  138   SRGNWEDDRYKLHEVSSTGPAASVHAAGSSVGSHG-GYCYSLPWYRTILDVDIDAFEEKR  196

Query  2634  WRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPE  2455
             WR  G+D+SDFFNFG NE+SWK YC  LE+LR    M+ K    E  +  Q  +     E
Sbjct  197   WRCPGVDVSDFFNFGFNEDSWKQYCISLEKLRKRPYMRSKSLNQEFFKHAQACEAVTKHE  256

Query  2454  LaaaAG-IQDIPSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDT  2278
               A    ++D     +++   ++G+  +          LP G  IQVE  + +R P++D 
Sbjct  257   REAKETVVEDSAQAGSSMKFIDLGERLMV---------LPRG--IQVEDSTAERQPTMDL  305

Query  2277  RPPRVRDSDAIIEIVCQGS  2221
             R PR  DSD +I+I  Q S
Sbjct  306   RRPRTWDSDVVIQINVQDS  324



>ref|NP_001051127.1| Os03g0725100 [Oryza sativa Japonica Group]
 dbj|BAF13041.1| Os03g0725100, partial [Oryza sativa Japonica Group]
Length=661

 Score =   108 bits (271),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 239/462 (52%), Gaps = 69/462 (15%)
 Frame = -1

Query  1665  SVDERTNCDKAKDDSVIDTAKKHKLSSQLEEPSPQETDGGEDSKAARSSENSKTRSGSSK  1486
             +V E T  D    D++  + KK KL S+ E+P+   +   +D    R+S+NS+ RSGSSK
Sbjct  15    TVSETTTTDG---DNLSHSGKKQKLISRAEQPTGHNS-SDQDELRTRNSDNSRGRSGSSK  70

Query  1485  DYHKLHDGLEEEVQDKRFAHVDDTRQTGGEEDRLQRKG----RDEK-ETEKHRMIVKGRE  1321
             D  K  +  EE +QD+R   ++D R+    EDR  R+     RD K + E+  +  + R+
Sbjct  71    DNQKRLESGEEVLQDRRSRRINDARRHHDGEDRNSRRKDEYLRDIKPDVERSHLASRSRD  130

Query  1320  DSYMRKGYDsssahhsHTKTSIADRRKE---RDYSDV----AWQHRDDDLHGRRSKVEDS  1162
             D+Y                   A+R ++   R Y  V     WQ R++ +H RR+K ED 
Sbjct  131   DTYH----------------PYANRDRDMRGRSYDRVRDTEIWQRREESVHNRRAKEEDV  174

Query  1161  RKREHGDEIESKHRNKIR-DIDRSEREGRHLLRKQLDNGSLRPDHDKDAVSRHRERERDD  985
             R  EH  E+ +++RNK+R  +DR++R      RK+LD+G  R        SR RER  D 
Sbjct  175   RL-EHNAEVGARNRNKMRPPVDRNDRIEDPHARKRLDDGDWR-------GSRPRERG-DV  225

Query  984   LKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHS----RG-DGTLRRKRERDDISDQRK  820
             + +R +NIDD H KR+K++  + R   + E+ +H     RG D   RRKRERDD  DQ++
Sbjct  226   VLNRRENIDDSHMKRKKDEENMRRMKPENEDIVHGQHGYRGRDDPNRRKRERDDGIDQKR  285

Query  819   RDDISDQRKRDDQRLRE--DDQHYARYKEEPLFQSERGERHRERDEWYRPKQSHDEILSK  646
             RD        D+ R+RE  DD+++ ++KE+   Q ER +RH       RPK  HD  ++ 
Sbjct  286   RD--------DNARMREKADDRYHTKHKEDNWRQREREDRH-------RPK--HDNTVTL  328

Query  645   RERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRERDENGS  466
              +RDEGRG  R GR  ++K      R +DE + +     +++  R  + L+R +  E  +
Sbjct  329   -QRDEGRGSGRGGRILDDK-LVTSGRKQDESRSAGLSKEAQERSRQNDPLRRDQGAEENN  386

Query  465   PSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDS  340
               ++R R D + R   P+  ER  R E+ +   D     S+S
Sbjct  387   -MQNRGRSDVHPRDENPNNSERNTRQEKPNNTHDGNRLSSNS  427



>ref|XP_004296247.1| PREDICTED: uncharacterized protein LOC101314266 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   108 bits (271),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 86/161 (53%), Gaps = 18/161 (11%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQ-  2521
             F LP ++TI +VDI+SF+EK WR  G+D++D+FNF LNE+SWK+YCK L+QLR   +MQ 
Sbjct  188   FRLPWYRTILDVDIESFEEKSWRYPGVDLTDYFNFDLNEDSWKEYCKSLQQLRRVKSMQY  247

Query  2520  ---GKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSR  2350
                G  + Y++     E+            GI     E  + G    G    A  S    
Sbjct  248   GTPGSSKFYQANEAGSEH------------GI--FAQEIMSTGVNYAGSWTYAPPSSTVS  293

Query  2349  PPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
                P G  IQ+E    +R PS D+R PR  +SD +I+I  Q
Sbjct  294   DCRPIGNTIQIEDSIVERQPSFDSRHPRSWNSDVVIQISVQ  334



>ref|XP_010064911.1| PREDICTED: uncharacterized protein LOC104452045 [Eucalyptus grandis]
Length=1120

 Score =   108 bits (269),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 92/158 (58%), Gaps = 10/158 (6%)
 Frame = -1

Query  2706  GLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLEST  2527
             G  F+LP ++ I +V+I++  EKPWR  G+D++D+FNFGL+EESWK YC  LEQ+R +S+
Sbjct  122   GRSFSLPWYRNIIDVNINALKEKPWRYPGVDITDYFNFGLDEESWKQYCSSLEQVRQQSS  181

Query  2526  MQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRP  2347
             +  +I  YES    QE   +L  E   A G+  + S   +   T V    L R S+ +  
Sbjct  182   LLSRIPTYESSSLNQE---ELVQE-GMADGVGQVGSGRTHAPSTTVS---LDRQSLLT--  232

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIV  2233
              +  G+ I+V    G+R PS+  R  R  D+D +IE+ 
Sbjct  233   -MQKGKAIEVAESLGERQPSMVLRRLRSYDADVVIEVA  269



>ref|XP_006651314.1| PREDICTED: uncharacterized protein LOC102703384 [Oryza brachyantha]
Length=1066

 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 28/154 (18%)
 Frame = -1

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
               F LP ++T+F++DI++F EKPWR  G+D++D+FNFG++EE W+ YC  +   R  +  
Sbjct  170   FSFFLPRNRTVFDIDIEAFQEKPWRQHGVDLTDYFNFGMDEEGWRKYCLDMGNFRHGTRT  229

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEV-GQNDLARGSIRSRP  2347
               K    ES   EQE+  +L        G+      + ++ K+E+  +N+LA+       
Sbjct  230   LAK----ESSGLEQEFHYNL--------GL------SKSVPKSEIYSRNELAK-------  264

Query  2346  PLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
               P GR I VE G  +RLPS D  PPR RDSD I
Sbjct  265   --PKGRAIHVEGGLQERLPSADMWPPRRRDSDVI  296



>gb|ABF95555.1| Fip1 motif family protein, expressed [Oryza sativa Japonica Group]
Length=1069

 Score =   104 bits (260),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 84/153 (55%), Gaps = 22/153 (14%)
 Frame = -1

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
              +F LP ++T+F+VDI++F EKPWR  G+D++D+FNFGL+EESW+ YC  +E  R     
Sbjct  167   FNFFLPRNRTVFDVDIEAFQEKPWRQHGVDLTDYFNFGLDEESWRKYCFDMEHFR-----  221

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPP  2344
                       RT       L  E     G+      + ++ K+E+  + L  G+  ++P 
Sbjct  222   -------HGTRTLANELSGLQQEFHYNLGL------SKSVPKSEI-YSVLKEGNGIAKPK  267

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
                GR I VE G  +RLPS D  PPR RDSD I
Sbjct  268   ---GRAIHVEGGMHERLPSADMWPPRQRDSDVI  297



>gb|EAZ26675.1| hypothetical protein OsJ_10579 [Oryza sativa Japonica Group]
Length=1085

 Score =   104 bits (260),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 84/153 (55%), Gaps = 22/153 (14%)
 Frame = -1

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
              +F LP ++T+F+VDI++F EKPWR  G+D++D+FNFGL+EESW+ YC  +E  R     
Sbjct  183   FNFFLPRNRTVFDVDIEAFQEKPWRQHGVDLTDYFNFGLDEESWRKYCFDMEHFR-----  237

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPP  2344
                       RT       L  E     G+      + ++ K+E+  + L  G+  ++P 
Sbjct  238   -------HGTRTLANELSGLQQEFHYNLGL------SKSVPKSEI-YSVLKEGNGIAKPK  283

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
                GR I VE G  +RLPS D  PPR RDSD I
Sbjct  284   ---GRAIHVEGGMHERLPSADMWPPRQRDSDVI  313



>gb|EAY89720.1| hypothetical protein OsI_11258 [Oryza sativa Indica Group]
Length=1085

 Score =   104 bits (260),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 84/153 (55%), Gaps = 22/153 (14%)
 Frame = -1

Query  2703  LDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTM  2524
              +F LP ++T+F+VDI++F EKPWR  G+D++D+FNFGL+EESW+ YC  +E  R     
Sbjct  183   FNFFLPRNRTVFDVDIEAFQEKPWRQHGVDLTDYFNFGLDEESWRKYCFDMEHFR-----  237

Query  2523  QGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPP  2344
                       RT       L  E     G+      + ++ K+E+  + L  G+  ++P 
Sbjct  238   -------HGTRTLANELSGLQQEFHYNLGL------SKSVPKSEI-YSVLKEGNGIAKPK  283

Query  2343  LPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
                GR I VE G  +RLPS D  PPR RDSD I
Sbjct  284   ---GRAIHVEGGMHERLPSADMWPPRQRDSDVI  313



>ref|XP_007147362.1| hypothetical protein PHAVU_006G117800g [Phaseolus vulgaris]
 gb|ESW19356.1| hypothetical protein PHAVU_006G117800g [Phaseolus vulgaris]
Length=1101

 Score =   103 bits (258),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 90/174 (52%), Gaps = 25/174 (14%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
              +NP     G    LP +  IF+V+ID+F EKPW + G+D++D+FNFG NE +WK YC  
Sbjct  160   AANPVALQCGYGSVLPWYWGIFDVNIDTFMEKPWNVPGVDITDYFNFGFNESTWKLYCAS  219

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   ++++  I V  S +  QE              +++  ++ A  G      +D 
Sbjct  220   LEQL-WRTSLRTGISVDGSAKWNQE-------------AVRE-KTDQAVFGSVLFPSSDC  264

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R PSID R PR RD + +IEI    S+DD
Sbjct  265   ---------KLPKGRAIQVEDSIVERQPSIDVRRPRNRDFN-VIEIKLLESSDD  308



>ref|XP_006597704.1| PREDICTED: uncharacterized protein LOC100816009 isoform X3 [Glycine 
max]
Length=1101

 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 89/174 (51%), Gaps = 22/174 (13%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
               NP     G    LP +  IF+V+ID+  EKPW++ G+D++D+FNFG NE SWK Y   
Sbjct  156   AENPMAVQCGYGLALPWYWGIFDVNIDTLTEKPWKVPGVDITDYFNFGFNESSWKLYRAS  215

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V +S    Q ++  +  +         + S NA    ++ G    
Sbjct  216   LEQL-WRTSLQTGISVDDSTNWNQVFNEAMREQ------TDQVVSGNAFFPSSDCG----  264

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R P++D R PR RD + +IEI    S+DD
Sbjct  265   ----------LPKGRAIQVEDSMVERKPTMDVRRPRNRDFN-VIEIKLLDSSDD  307



>ref|XP_006597702.1| PREDICTED: uncharacterized protein LOC100816009 isoform X1 [Glycine 
max]
Length=1104

 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 89/174 (51%), Gaps = 22/174 (13%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
               NP     G    LP +  IF+V+ID+  EKPW++ G+D++D+FNFG NE SWK Y   
Sbjct  159   AENPMAVQCGYGLALPWYWGIFDVNIDTLTEKPWKVPGVDITDYFNFGFNESSWKLYRAS  218

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V +S    Q ++  +  +         + S NA    ++ G    
Sbjct  219   LEQL-WRTSLQTGISVDDSTNWNQVFNEAMREQ------TDQVVSGNAFFPSSDCG----  267

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R P++D R PR RD + +IEI    S+DD
Sbjct  268   ----------LPKGRAIQVEDSMVERKPTMDVRRPRNRDFN-VIEIKLLDSSDD  310



>ref|XP_002970425.1| hypothetical protein SELMODRAFT_441074 [Selaginella moellendorffii]
 gb|EFJ28555.1| hypothetical protein SELMODRAFT_441074 [Selaginella moellendorffii]
Length=1016

 Score =   100 bits (248),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 98/183 (54%), Gaps = 31/183 (17%)
 Frame = -1

Query  2751  PGYNAWGSNP-SGRGIGL----------DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSD  2605
             PG  A    P +G G+G+          +F LP  KT+F++DID F+EKPW  +G D++D
Sbjct  223   PGATAIAPIPFAGYGLGMWDFHTFQPAYEFVLPPSKTVFDIDIDQFEEKPWEYEGTDITD  282

Query  2604  FFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDI  2425
             +FNFG  E++WK YC++  + + E++ + K+R  ++G ++Q ++ D              
Sbjct  283   YFNFGFTEDTWKQYCEEFARAKAEASKKSKMRGLDNGHSQQGWNYD--------------  328

Query  2424  PSENANLGKTEVGQNDLARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAI  2245
                NA    T   Q   A+G    R    +GR IQVE G  +R  S + R  R+RDS++ 
Sbjct  329   ---NARYNDTPEPQRGRAQGQRGMRN--HSGRAIQVEEGGNERRSS-ELRRQRLRDSESG  382

Query  2244  IEI  2236
             I+I
Sbjct  383   IQI  385



>gb|EMT27449.1| Pre-mRNA 3'-end-processing factor FIP1 [Aegilops tauschii]
Length=1184

 Score = 99.4 bits (246),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 22/154 (14%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++T+F+++I++F +KPWR  GID++D+FNFGL+EE W+ YC  ++Q     T   
Sbjct  468   FFLPRNRTVFDINIEAFQQKPWRQHGIDLTDYFNFGLDEEGWRKYCFGMKQF----TQGA  523

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
             +    +S   +QE   +L          + +P      G    G ND+A+         P
Sbjct  524   RSLAEKSSGMDQESHHNLESS-------KLMPKSAIYSGFE--GSNDVAK---------P  565

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
              GR I V+ G  +RLPS D   PR RDSD +I++
Sbjct  566   KGRAIDVQGGLFERLPSADMWRPRERDSDVVIQV  599



>ref|XP_010228706.1| PREDICTED: uncharacterized protein LOC100823950 [Brachypodium 
distachyon]
Length=1347

 Score = 99.4 bits (246),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 24/155 (15%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++T+F+++I++F +KPWR  G+D++D+FNF L+EE W+ YC  ++Q         
Sbjct  468   FFLPRNRTVFDINIEAFQQKPWRQHGVDLTDYFNFDLDEEGWRKYCFGMKQFA-------  520

Query  2517  KIRVYESGRTEQEYDPDLPPE-LaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
                  +  R+  E  P +  E       I+ +P      G    G NDL++         
Sbjct  521   -----DGARSPAEKLPGMDQESYHNLESIKLMPKSATYCGFE--GSNDLSK---------  564

Query  2340  PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
             P GR I VE G  +RLPS D   PR RDSD +I++
Sbjct  565   PKGRAIHVEGGVFERLPSADLWRPRQRDSDVVIQV  599



>gb|EMS57064.1| hypothetical protein TRIUR3_11958 [Triticum urartu]
Length=886

 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 87/160 (54%), Gaps = 34/160 (21%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
             F LP ++T+F+++I++F +KPWR  GID++D+FNFGL+EE W+ YC  ++Q       QG
Sbjct  166   FFLPRNRTVFDINIEAFQQKPWRQHGIDLTDYFNFGLDEEGWRKYCFGMKQF-----TQG  220

Query  2517  KIRVYE--SGRTEQEY----DPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIR  2356
                + E  SG  ++ +       L P+ A  +G +              G ND+A+    
Sbjct  221   ARSLAEKSSGMDQESHHNLESSKLMPKSAIYSGFE--------------GSNDVAK----  262

Query  2355  SRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEI  2236
                  P GR I V+ G  +RLPS D   PR RDSD +I++
Sbjct  263   -----PKGRAIDVQGGLFERLPSADMWRPRERDSDVVIQV  297



>gb|KHN14687.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine soja]
Length=1098

 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 87/174 (50%), Gaps = 25/174 (14%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
               NP     G    LP +  IF+V+ID+  EKPW++ G+D++D+FNFG NE SWK Y   
Sbjct  156   AENPMAVQCGYGLALPWYWGIFDVNIDTLTEKPWKVPGVDITDYFNFGFNESSWKLYRAS  215

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V +S    QE         A       + S NA    ++ G    
Sbjct  216   LEQL-WRTSLQTGISVDDSTNWNQE---------AMREQTDQVVSGNAFFPSSDCG----  261

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R P++D R PR RD + +IEI    S+DD
Sbjct  262   ----------LPKGRAIQVEDSMVERKPTMDVRRPRNRDFN-VIEIKLLDSSDD  304



>ref|XP_006597703.1| PREDICTED: uncharacterized protein LOC100816009 isoform X2 [Glycine 
max]
Length=1101

 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 87/174 (50%), Gaps = 25/174 (14%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
               NP     G    LP +  IF+V+ID+  EKPW++ G+D++D+FNFG NE SWK Y   
Sbjct  159   AENPMAVQCGYGLALPWYWGIFDVNIDTLTEKPWKVPGVDITDYFNFGFNESSWKLYRAS  218

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V +S    QE         A       + S NA    ++ G    
Sbjct  219   LEQL-WRTSLQTGISVDDSTNWNQE---------AMREQTDQVVSGNAFFPSSDCG----  264

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R P++D R PR RD + +IEI    S+DD
Sbjct  265   ----------LPKGRAIQVEDSMVERKPTMDVRRPRNRDFN-VIEIKLLDSSDD  307



>ref|XP_006586891.1| PREDICTED: uncharacterized protein LOC100816396 isoform X1 [Glycine 
max]
Length=1097

 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 86/174 (49%), Gaps = 25/174 (14%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
              +NP     G    LP +  IF+V+ D+  EK W++ G+D++D+FNFG NE +WK YC  
Sbjct  161   AANPMAVQCGYGSALPWYWGIFDVNTDTLTEKLWKVPGVDITDYFNFGFNESTWKLYCSS  220

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V ++    QE                 + S NA    ++ G    
Sbjct  221   LEQL-WRTSLQTGISVDDAANWNQEV---------MREQTDQVVSGNAFFPSSDCG----  266

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R PSID R PR RD + +IEI    S+DD
Sbjct  267   ----------LPKGRAIQVEDSMVERQPSIDVRRPRNRDFN-VIEIKLLDSSDD  309



>ref|XP_006586892.1| PREDICTED: uncharacterized protein LOC100816396 isoform X2 [Glycine 
max]
Length=1094

 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 86/174 (49%), Gaps = 25/174 (14%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
              +NP     G    LP +  IF+V+ D+  EK W++ G+D++D+FNFG NE +WK YC  
Sbjct  158   AANPMAVQCGYGSALPWYWGIFDVNTDTLTEKLWKVPGVDITDYFNFGFNESTWKLYCSS  217

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             LEQL   +++Q  I V ++    QE                 + S NA    ++ G    
Sbjct  218   LEQL-WRTSLQTGISVDDAANWNQEV---------MREQTDQVVSGNAFFPSSDCG----  263

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
                       LP GR IQVE    +R PSID R PR RD + +IEI    S+DD
Sbjct  264   ----------LPKGRAIQVEDSMVERQPSIDVRRPRNRDFN-VIEIKLLDSSDD  306



>ref|XP_004984604.1| PREDICTED: uncharacterized protein LOC101781476 isoform X1 [Setaria 
italica]
Length=1037

 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 107/212 (50%), Gaps = 32/212 (15%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
               LP + TIF++DI++  +KPWR QG+D++D+FNF L+EE W+ Y   ++QLRL +    
Sbjct  175   LFLPRNSTIFDIDIEALQQKPWRQQGVDLTDYFNFNLDEEGWRKYWCSMKQLRLGT----  230

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
                     R+       L  E      ++ +P + AN    E G+N LA+         P
Sbjct  231   --------RSLANETSGLDQESYKLKSVKAMP-KAANYSGFE-GRNSLAK---------P  271

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVC------QGSADDDNNLEQGNQPSR  2176
              GR I VE  + +R+PS D   P  RDSD +I++        Q ++DD + L      + 
Sbjct  272   KGRAIHVEGSAHERVPSADLWRPIQRDSDVVIQVNMTLSPSNQSTSDDSSKLNHKCVTTE  331

Query  2175  EGIRGGDEIGD-LQQEDIHHVDGFQHAYNGWK  2083
               ++G   + D + ++++H  DG    ++G K
Sbjct  332   RRLKGSSFVVDRVVEKEVH--DGDSSEFSGSK  361



>ref|XP_008667405.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=1331

 Score = 97.4 bits (241),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 95/173 (55%), Gaps = 29/173 (17%)
 Frame = -1

Query  2700  DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQ  2521
             +F L  + TIF++DI++F  KPWR QG D++D+FNF L+EE W+ Y   ++QLRL +   
Sbjct  471   NFFLSRNSTIFDIDIEAFQLKPWRQQGADLTDYFNFSLDEEGWRKYWCSMKQLRLGA---  527

Query  2520  GKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPL  2341
              +  V E+   EQE       +L +A  + ++ +++ + G+ ++G+              
Sbjct  528   -RSLVNETSGLEQE-----SYKLKSAKAMSNVANDSGSEGRNDIGK--------------  567

Query  2340  PAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVC------QGSADDDNNL  2200
             P GR I VE  + +R+PS D   P  RDSD +I++        Q ++DD + L
Sbjct  568   PKGRAIHVEGSACERVPSADLWRPIQRDSDVVIQVNMTLSPSNQSTSDDSSKL  620



>emb|CDY70580.1| BnaA10g29090D, partial [Brassica napus]
Length=584

 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 133/419 (32%), Positives = 204/419 (49%), Gaps = 49/419 (12%)
 Frame = -1

Query  1539  SKAARSSENSKTRSGSSKDYHKLHDGLEEEV-QDKRFAHVDDTRQTGGEEDRLQ-RKGRD  1366
             SK  RSS NSK RS S +D+ +L D  E+EV Q+K       +++        Q RK +D
Sbjct  1     SKTERSSGNSKARSESHRDHQQLKDSAEQEVIQNKHSTRPASSKKHHDNSAPYQSRKNQD  60

Query  1365  E-KETEKHRMIVKGREDSYMRKGYDsssahhsHTKTSIA-----DRRKERDYSDVAWQHR  1204
               KE E+ R   KG        G++ S+ H      SIA     DRRK RD     W+ +
Sbjct  61    RGKEMERTRAASKG--------GWEYSNPHTD-VDYSIARGDDYDRRKGRDVDGGFWRRK  111

Query  1203  DDDLHGRRSKVEDSRKREHGDEIESKHRNKIRDIDRSEREGRHLLRKQLDNGSLRPDHDK  1024
             +DD   RR   E  RKR+  +++ SK R K+R+ D   ++     RK LD+G LR  ++ 
Sbjct  112   EDDPFSRRGGDEGFRKRDREEDLGSKQRGKMRESDIRNKDDHVPSRKHLDDGGLRNSYE-  170

Query  1023  DAVSRHRERERDDLKSRYDNIDDRHSKRRKEDTKLSREHVDREETLHSRGDGTLRRKRER  844
                                 +DD   KRRK++  L R   ++ E  + + + T R KRER
Sbjct  171   --------------------LDDHIGKRRKDEEYLRRNRSEKNEISYGQRESTSRLKRER  210

Query  843   DDISDQRKRDDISDQRKRDDQRLREDDQHYARYKEEPLFQSERGERHRERDEWYRPKQSH  664
              D  D +KRD     + RDD     DD    R++++   Q +  ER RER++  + K + 
Sbjct  211   GDRLDHQKRD--VQHKSRDDF----DDHSSLRHRDDFYMQRDGNERLREREDMDKLKLTQ  264

Query  663   DEILSKRERDEGRGGLRVGRAAEEKSWAGLSRGKDEYKGSDREYHSKDAGRHVEHLKRRE  484
             ++ LS R R+      R  R +E++S    S  KD+YK S++E+ +KD+ RH +  KRRE
Sbjct  265   EDGLSARGRERQVPTTRGHRGSEDRS----SMMKDDYKASEKEHLTKDSTRHSKQTKRRE  320

Query  483   RDENGSPSRHRSREDGYGRGHQPSTDERRARNERVSTRQDHAAYESDSSKVHEKKRKEN  307
                  S S HR   D   R  +   +E+  R E+ S + D+     D  ++ ++K K++
Sbjct  321   YHGEES-SHHRGHGDFSARTDETVNNEKMPRQEKTSAKSDNVINSMDGQQLQDRKHKDS  378



>ref|XP_004984605.1| PREDICTED: uncharacterized protein LOC101781476 isoform X2 [Setaria 
italica]
Length=1036

 Score = 96.3 bits (238),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 108/212 (51%), Gaps = 33/212 (16%)
 Frame = -1

Query  2697  FTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQG  2518
               LP + TIF++DI++  +KPWR QG+D++D+FNF L+EE W+ Y   ++QLRL +    
Sbjct  175   LFLPRNSTIFDIDIEALQQKPWRQQGVDLTDYFNFNLDEEGWRKYWCSMKQLRLGT----  230

Query  2517  KIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARGSIRSRPPLP  2338
                     R+       L  E      ++ +P + AN    E G+N LA+         P
Sbjct  231   --------RSLANETSGLDQESYKLKSVKAMP-KAANYSGFE-GRNSLAK---------P  271

Query  2337  AGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVC------QGSADDDNNLEQGNQPSR  2176
              GR I VE  + +R+PS D   P  RDSD +I++        Q ++DD + L      + 
Sbjct  272   KGRAIHVEGSAHERVPSADLWRPIQRDSDVVIQVNMTLSPSNQSTSDDSSKLNH-KCVTT  330

Query  2175  EGIRGGDEIGD-LQQEDIHHVDGFQHAYNGWK  2083
             E ++G   + D + ++++H  DG    ++G K
Sbjct  331   ERLKGSSFVVDRVVEKEVH--DGDSSEFSGSK  360



>ref|XP_010671727.1| PREDICTED: FIP1[V]-like protein isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=1197

 Score = 93.6 bits (231),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 88/169 (52%), Gaps = 15/169 (9%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
             G  P   G G +F LP ++TI +VDID+ ++K W   G D +D+FNF  +EESW++YC+ 
Sbjct  197   GFVPGLAGNGNNFWLPWYRTILDVDIDAIEQKSWTQPGADKTDYFNFEFDEESWRNYCQS  256

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             L+QLR  +  Q + +  E+G          P +   + G  D  S    L K    ++  
Sbjct  257   LDQLRQRTFSQTRNQNNEAG----------PVKELESEGFVDAESIPYGLRKMTSHESAF  306

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
             A    + +     G+ I VES + +R PS D R P  RDSD +I+I  Q
Sbjct  307   ATRQFKKQ----IGQAIHVESSNIERQPSTDARRPCNRDSD-VIQITVQ  350



>ref|XP_010671728.1| PREDICTED: FIP1[V]-like protein isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=1194

 Score = 93.2 bits (230),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 88/169 (52%), Gaps = 15/169 (9%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
             G  P   G G +F LP ++TI +VDID+ ++K W   G D +D+FNF  +EESW++YC+ 
Sbjct  197   GFVPGLAGNGNNFWLPWYRTILDVDIDAIEQKSWTQPGADKTDYFNFEFDEESWRNYCQS  256

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             L+QLR  +  Q + +  E+G          P +   + G  D  S    L K    ++  
Sbjct  257   LDQLRQRTFSQTRNQNNEAG----------PVKELESEGFVDAESIPYGLRKMTSHESAF  306

Query  2373  ARGSIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQ  2227
             A    + +     G+ I VES + +R PS D R P  RDSD +I+I  Q
Sbjct  307   ATRQFKKQ----IGQAIHVESSNIERQPSTDARRPCNRDSD-VIQITVQ  350



>tpg|DAA45033.1| TPA: hypothetical protein ZEAMMB73_268123 [Zea mays]
Length=1670

 Score = 91.7 bits (226),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 95/181 (52%), Gaps = 37/181 (20%)
 Frame = -1

Query  2700  DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDY-CKQL-------EQ  2545
             +F L  + TIF++DI++F  KPWR QG D++D+FNF L+EE W+ Y C  L       +Q
Sbjct  14    NFFLSRNSTIFDIDIEAFQLKPWRQQGADLTDYFNFSLDEEGWRKYWCSMLSTPLFVQKQ  73

Query  2544  LRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDLARG  2365
             LRL      +  V E+   EQE       +L +A  + ++ +++ + G+ ++G+      
Sbjct  74    LRL----GARSLVNETSGLEQE-----SYKLKSAKAMSNVANDSGSEGRNDIGK------  118

Query  2364  SIRSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVC------QGSADDDNN  2203
                     P GR I VE  + +R+PS D   P  RDSD +I++        Q ++DD + 
Sbjct  119   --------PKGRAIHVEGSACERVPSADLWRPIQRDSDVVIQVNMTLSPSNQSTSDDSSK  170

Query  2202  L  2200
             L
Sbjct  171   L  171



>ref|XP_002978504.1| hypothetical protein SELMODRAFT_443841 [Selaginella moellendorffii]
 gb|EFJ20490.1| hypothetical protein SELMODRAFT_443841 [Selaginella moellendorffii]
Length=1009

 Score = 90.5 bits (223),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = -1

Query  2751  PGYNAWGSNP-SGRGIGL----------DFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSD  2605
             PG  A    P +G G+G+          +F LP  KT+F++DID F+EKPW  +G D++D
Sbjct  223   PGATAIAPIPFAGYGLGMWDFHTFQPAYEFVLPPSKTVFDIDIDQFEEKPWEYEGTDITD  282

Query  2604  FFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYESGRTEQEYDPD  2467
             +FNFG  E++WK YC++  + + E++ + K+R  ++G ++Q ++ D
Sbjct  283   YFNFGFTEDTWKQYCEEFARAKAEASKKSKMRGLDNGHSQQGWNYD  328



>ref|XP_003284406.1| hypothetical protein DICPUDRAFT_96691 [Dictyostelium purpureum]
 gb|EGC39056.1| hypothetical protein DICPUDRAFT_96691 [Dictyostelium purpureum]
Length=445

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = -1

Query  2685  SHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRV  2506
             + KTI+EVDIDSF+EKPW   G D+SD+FN+   E++WK YC++  Q+RLE    GKI+ 
Sbjct  126   NQKTIYEVDIDSFEEKPWLKPGADISDYFNYNFTEDTWKAYCERQNQMRLEVNNLGKIKG  185

Query  2505  YESGR---TEQEYDPDLPPEL  2452
             YES     ++     DLPPEL
Sbjct  186   YESKNNIDSKSNGAIDLPPEL  206



>gb|KHN12870.1| Pre-mRNA 3'-end-processing factor FIP1 [Glycine soja]
Length=1116

 Score = 87.8 bits (216),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 85/177 (48%), Gaps = 10/177 (6%)
 Frame = -1

Query  2733  GSNPSGRGIGLDFTLPSHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQ  2554
              +NP     G    LP +  IF+V+ D+  EK W++ G+D++D+FNFG NE +WK YC  
Sbjct  159   AANPMAVQCGYGSALPWYWGIFDVNTDTLTEKLWKVPGVDITDYFNFGFNESTWKLYCSS  218

Query  2553  LEQLRLESTMQGKIRVYESGRTEQEYDPDLPPELaaaAGIQDIPSENANLGKTEVGQNDL  2374
             L    +               TEQ +   L   +     + D  + N  + + +  Q  +
Sbjct  219   LVDAGIIYLSIPLASCTGISATEQLWRTSLQTGI----SVDDAANWNQEVMREQTDQ--V  272

Query  2373  ARGSI---RSRPPLPAGRPIQVESGSGDRLPSIDTRPPRVRDSDAIIEIVCQGSADD  2212
               G+     S   LP GR IQVE    +R PSID R PR RD + +IEI    S+DD
Sbjct  273   VSGNAFFPSSDCGLPKGRAIQVEDSMVERQPSIDVRRPRNRDFN-VIEIKLLDSSDD  328



>gb|ESA00082.1| hypothetical protein GLOINDRAFT_272533 [Rhizophagus irregularis 
DAOM 181602]
Length=309

 Score = 81.3 bits (199),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -1

Query  2676  TIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRVYES  2497
             +I++VD+DSF++KPWR  G D++D+FN+G NE +WK YC + +Q+R +   + KI VYES
Sbjct  143   SIYDVDLDSFEDKPWRKPGADITDYFNYGFNEYTWKAYCAKQKQMREDQHQRKKIHVYES  202

Query  2496  GRTEQEYDPDLPPEL  2452
                +QE + +LPPEL
Sbjct  203   ---KQELN-NLPPEL  213



>ref|XP_636526.1| cleavage and polyadenylation specificity factor FIP1 [Dictyostelium 
discoideum AX4]
 gb|EAL63020.1| cleavage and polyadenylation specificity factor FIP1 [Dictyostelium 
discoideum AX4]
Length=560

 Score = 81.6 bits (200),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  2685  SHKTIFEVDIDSFDEKPWRLQGIDMSDFFNFGLNEESWKDYCKQLEQLRLESTMQGKIRV  2506
             + KTIFE DI+SF+EKPW   G D+SD+FN+   EE+WK YC++   +R+E    GKI+ 
Sbjct  146   NQKTIFEFDIESFEEKPWLKPGADISDYFNYNFTEETWKAYCERQNTMRMELNNLGKIKG  205

Query  2505  YESGR  2491
             YES +
Sbjct  206   YESNK  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13562187899112