BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22373_g4_i2 len=778 path=[1393:0-5 1404:6-384 1783:385-777]

Length=778
                                                                      Score     E

ref|XP_009604167.1|  PREDICTED: uncharacterized protein LOC104099009    272   1e-88   
ref|XP_009778075.1|  PREDICTED: uncharacterized protein LOC104227516    271   2e-88   
ref|XP_004251570.1|  PREDICTED: uncharacterized protein LOC101264...    259   9e-84   
ref|XP_006364901.1|  PREDICTED: uncharacterized protein LOC102595975    258   4e-83   
ref|XP_007023869.1|  Lactoylglutathione lyase / glyoxalase I fami...    248   3e-79   
gb|KDP32380.1|  hypothetical protein JCGZ_13305                         248   6e-79   
ref|XP_002517606.1|  lactoylglutathione lyase, putative                 247   1e-78   Ricinus communis
ref|XP_006475817.1|  PREDICTED: uncharacterized protein LOC102622259    248   1e-78   
ref|XP_006450972.1|  hypothetical protein CICLE_v10009574mg             247   1e-78   
ref|XP_006476111.1|  PREDICTED: uncharacterized protein LOC102629469    242   1e-76   
ref|XP_004287347.1|  PREDICTED: metallothiol transferase FosB-lik...    242   1e-76   
ref|XP_007215072.1|  hypothetical protein PRUPE_ppa012380mg             241   1e-76   
ref|XP_010088321.1|  hypothetical protein L484_005835                   241   2e-76   
ref|XP_008243712.1|  PREDICTED: uncharacterized protein LOC103341942    241   2e-76   
gb|KEH28697.1|  lactoylglutathione lyase/glyoxalase I family protein    241   2e-76   
ref|XP_004506908.1|  PREDICTED: uncharacterized protein YwkD-like       241   3e-76   
ref|XP_008357276.1|  PREDICTED: uncharacterized protein LOC103421019    240   4e-76   
gb|ACU18440.1|  unknown                                                 240   4e-76   Glycine max [soybeans]
ref|XP_008244727.1|  PREDICTED: uncharacterized protein LOC103342852    240   6e-76   
ref|XP_010097255.1|  hypothetical protein L484_025804                   240   6e-76   
ref|XP_010049980.1|  PREDICTED: glyoxalase domain-containing prot...    239   9e-76   
gb|KHN01342.1|  hypothetical protein glysoja_009548                     239   1e-75   
ref|XP_004302970.1|  PREDICTED: metallothiol transferase FosB-like      239   1e-75   
gb|KHG30572.1|  Metallothiol transferase fosB                           239   1e-75   
ref|XP_009362525.1|  PREDICTED: uncharacterized protein LOC103952618    239   2e-75   
ref|XP_007013389.1|  Lactoylglutathione lyase / glyoxalase I fami...    238   2e-75   
dbj|BAJ53235.1|  JHL06P13.16                                            238   2e-75   
ref|XP_002309802.1|  hypothetical protein POPTR_0007s01900g             238   2e-75   Populus trichocarpa [western balsam poplar]
ref|NP_001235416.1|  uncharacterized protein LOC100305695               238   2e-75   
ref|NP_001237532.1|  uncharacterized protein LOC100306100               238   3e-75   
ref|XP_009348777.1|  PREDICTED: uncharacterized protein LOC103940388    238   4e-75   
ref|XP_007135739.1|  hypothetical protein PHAVU_010G154400g             239   4e-75   
gb|KDO80289.1|  hypothetical protein CISIN_1g029305mg                   238   4e-75   
ref|XP_002285087.1|  PREDICTED: uncharacterized protein LOC100244070    238   4e-75   Vitis vinifera
ref|XP_004135860.1|  PREDICTED: uncharacterized protein LOC101209593    237   5e-75   
gb|ACF74315.1|  lactoylglutathione lyase                                238   5e-75   Arachis hypogaea [goober]
ref|XP_002524466.1|  lactoylglutathione lyase, putative                 238   6e-75   Ricinus communis
ref|XP_008461098.1|  PREDICTED: uncharacterized protein LOC103499788    237   7e-75   
emb|CDO98135.1|  unnamed protein product                                237   8e-75   
ref|XP_007154988.1|  hypothetical protein PHAVU_003G163400g             236   1e-74   
ref|XP_010061928.1|  PREDICTED: uncharacterized protein LOC104449460    236   1e-74   
ref|XP_004287346.1|  PREDICTED: metallothiol transferase FosB-lik...    236   4e-74   
ref|XP_008242749.1|  PREDICTED: uncharacterized protein LOC103341047    236   6e-74   
gb|EYU21620.1|  hypothetical protein MIMGU_mgv1a014857mg                234   8e-74   
ref|XP_010691164.1|  PREDICTED: uncharacterized protein LOC104904575    234   8e-74   
gb|AFK41458.1|  unknown                                                 234   1e-73   
gb|KFK42418.1|  hypothetical protein AALP_AA2G253600                    233   2e-73   
gb|KHN15103.1|  hypothetical protein glysoja_011721                     232   5e-73   
ref|XP_010430002.1|  PREDICTED: uncharacterized protein LOC104714...    231   7e-73   
ref|XP_006302910.1|  hypothetical protein CARUB_v10021045mg             231   9e-73   
ref|NP_001236449.1|  uncharacterized protein LOC100305770               231   1e-72   
ref|XP_006593342.1|  PREDICTED: uncharacterized protein LOC100305...    231   1e-72   
emb|CDY37573.1|  BnaA02g19970D                                          231   1e-72   
emb|CAN75608.1|  hypothetical protein VITISV_040444                     231   1e-72   Vitis vinifera
ref|XP_009402147.1|  PREDICTED: uncharacterized protein LOC103986010    231   1e-72   
ref|XP_010472977.1|  PREDICTED: uncharacterized protein LOC104752515    231   2e-72   
ref|XP_009128447.1|  PREDICTED: uncharacterized protein LOC103853278    231   2e-72   
ref|XP_010049979.1|  PREDICTED: uncharacterized protein LOC104438513    231   2e-72   
ref|XP_009402148.1|  PREDICTED: uncharacterized protein LOC103986012    231   2e-72   
ref|XP_010914889.1|  PREDICTED: uncharacterized protein LOC105040176    231   2e-72   
ref|XP_004236038.1|  PREDICTED: uncharacterized protein LOC101250492    231   2e-72   
ref|XP_002270395.1|  PREDICTED: uncharacterized protein LOC100247488    230   3e-72   Vitis vinifera
ref|XP_010417742.1|  PREDICTED: uncharacterized protein LOC104703428    230   3e-72   
ref|XP_008792059.1|  PREDICTED: uncharacterized protein LOC103708766    230   5e-72   
ref|XP_009594193.1|  PREDICTED: uncharacterized protein LOC104090726    229   7e-72   
ref|XP_009402188.1|  PREDICTED: uncharacterized protein LOC103986041    229   9e-72   
gb|AAD55473.1|AC009322_13  Hypothetical protein                         230   1e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71329.1|  BnaC02g46640D                                          229   1e-71   
ref|XP_011072230.1|  PREDICTED: uncharacterized protein LOC105157526    229   1e-71   
ref|XP_009802082.1|  PREDICTED: uncharacterized protein LOC104247701    228   2e-71   
ref|XP_009407659.1|  PREDICTED: uncharacterized protein LOC103990300    228   2e-71   
ref|XP_006364200.1|  PREDICTED: uncharacterized protein LOC102594644    228   2e-71   
gb|KHG26581.1|  Metallothiol transferase fosB                           227   6e-71   
ref|XP_006389762.1|  hypothetical protein EUTSA_v10019227mg             227   7e-71   
ref|XP_010033948.1|  PREDICTED: uncharacterized protein LOC104423170    226   1e-70   
emb|CDY38650.1|  BnaC02g23290D                                          226   1e-70   
ref|XP_009403405.1|  PREDICTED: uncharacterized protein LOC103986970    229   1e-70   
ref|NP_565231.1|  GLYOXYLASE I 7                                        226   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450973.1|  hypothetical protein CICLE_v10010755mg             224   9e-70   
ref|XP_002298106.2|  hypothetical protein POPTR_0001s17160g             226   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007200863.1|  hypothetical protein PRUPE_ppa027137mg             223   1e-69   
ref|XP_002270473.1|  PREDICTED: uncharacterized protein LOC100242353    223   2e-69   Vitis vinifera
emb|CDY39639.1|  BnaC05g11680D                                          223   2e-69   
ref|XP_009388525.1|  PREDICTED: uncharacterized protein LOC103975318    223   3e-69   
gb|AFK37770.1|  unknown                                                 222   4e-69   
ref|XP_009148927.1|  PREDICTED: uncharacterized protein LOC103872329    222   4e-69   
ref|XP_008465032.1|  PREDICTED: uncharacterized protein LOC103502748    223   5e-69   
ref|XP_004151211.1|  PREDICTED: uncharacterized protein LOC101203188    223   5e-69   
ref|XP_002889306.1|  lactoylglutathione lyase family protein            221   9e-69   
ref|XP_004960819.1|  PREDICTED: uncharacterized protein LOC101757142    222   1e-68   
ref|XP_011035678.1|  PREDICTED: uncharacterized protein LOC105133400    221   1e-68   
ref|XP_009110487.1|  PREDICTED: uncharacterized protein LOC103836030    221   2e-68   
ref|XP_003609290.1|  hypothetical protein MTR_4g114080                  220   2e-68   
ref|XP_006427237.1|  hypothetical protein CICLE_v10026643mg             220   2e-68   
ref|XP_009598365.1|  PREDICTED: uncharacterized protein LOC104094188    221   2e-68   
ref|XP_009402190.1|  PREDICTED: nucleobase-ascorbate transporter ...    235   2e-68   
ref|XP_007150729.1|  hypothetical protein PHAVU_005G176100g             222   2e-68   
gb|EPS59665.1|  hypothetical protein M569_15140                         220   2e-68   
ref|XP_004252486.1|  PREDICTED: uncharacterized protein LOC101249440    220   3e-68   
emb|CDX96844.1|  BnaA08g23870D                                          220   3e-68   
ref|XP_011040040.1|  PREDICTED: uncharacterized protein LOC105136415    220   3e-68   
ref|XP_006465353.1|  PREDICTED: uncharacterized protein LOC102630180    220   3e-68   
ref|XP_003568834.1|  PREDICTED: uncharacterized protein LOC100821708    221   3e-68   
ref|XP_004508519.1|  PREDICTED: uncharacterized protein YwkD-like       219   5e-68   
ref|XP_002303256.2|  lactoylglutathione lyase family protein            218   1e-67   Populus trichocarpa [western balsam poplar]
ref|NP_001054776.1|  Os05g0171900                                       220   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010532163.1|  PREDICTED: uncharacterized protein LOC104808228    218   1e-67   
dbj|BAJ85628.1|  predicted protein                                      219   2e-67   
ref|XP_009117831.1|  PREDICTED: uncharacterized protein LOC103842901    218   3e-67   
ref|XP_006655044.1|  PREDICTED: uncharacterized protein LOC102706197    219   3e-67   
gb|KFK43791.1|  hypothetical protein AALP_AA1G173300                    218   3e-67   
ref|XP_002890101.1|  lactoylglutathione lyase family protein            218   3e-67   
ref|NP_563973.1|  Lactoylglutathione lyase / glyoxalase I family ...    217   4e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81709.1|  BnaC08g38920D                                          217   4e-67   
gb|KHN47772.1|  hypothetical protein glysoja_029190                     216   5e-67   
ref|XP_004486683.1|  PREDICTED: metallothiol transferase FosB 2-like    216   5e-67   
ref|XP_002439371.1|  hypothetical protein SORBIDRAFT_09g005270          218   7e-67   Sorghum bicolor [broomcorn]
ref|XP_010497101.1|  PREDICTED: uncharacterized protein LOC104774130    216   9e-67   
ref|XP_010476624.1|  PREDICTED: uncharacterized protein LOC104755853    216   1e-66   
emb|CDY55981.1|  BnaA09g56790D                                          216   1e-66   
ref|XP_006305709.1|  hypothetical protein CARUB_v10010450mg             216   1e-66   
gb|EMT20922.1|  hypothetical protein F775_15409                         216   2e-66   
ref|XP_010459070.1|  PREDICTED: uncharacterized protein LOC104740...    215   3e-66   
gb|EPS70220.1|  hypothetical protein M569_04537                         214   4e-66   
emb|CDX83979.1|  BnaC08g16660D                                          214   5e-66   
ref|NP_001149571.1|  lactoylglutathione lyase                           216   6e-66   Zea mays [maize]
gb|AGT16646.1|  lactoylglutathione lyase                                214   3e-65   
ref|XP_010250045.1|  PREDICTED: uncharacterized protein LOC104592394    213   3e-65   
ref|XP_010254369.1|  PREDICTED: uncharacterized protein LOC104595363    213   5e-65   
ref|XP_002457260.1|  hypothetical protein SORBIDRAFT_03g004330          214   6e-65   Sorghum bicolor [broomcorn]
ref|XP_003565402.1|  PREDICTED: uncharacterized protein LOC100842326    210   1e-63   
ref|XP_006346650.1|  PREDICTED: uncharacterized protein LOC102599142    208   2e-63   
emb|CAP72290.1|  Glyoxalase                                             211   2e-63   Triticum aestivum [Canadian hard winter wheat]
gb|KDO80293.1|  hypothetical protein CISIN_1g036243mg                   207   2e-63   
ref|NP_001152619.1|  lactoylglutathione lyase                           209   3e-63   Zea mays [maize]
ref|XP_003597871.1|  Metallothiol transferase fosB                      207   4e-63   
ref|XP_004968374.1|  PREDICTED: uncharacterized protein LOC101776223    209   5e-63   
gb|AFK47501.1|  unknown                                                 204   2e-62   
gb|KCW79803.1|  hypothetical protein EUGRSUZ_C01137                     203   8e-62   
gb|KHN22460.1|  hypothetical protein glysoja_024969                     203   9e-62   
ref|XP_006842870.1|  hypothetical protein AMTR_s00081p00168190          203   1e-61   
ref|XP_008673641.1|  PREDICTED: uncharacterized protein LOC103649687    206   1e-61   
ref|XP_010065333.1|  PREDICTED: uncharacterized protein LOC104452578    204   1e-61   
ref|NP_001042158.1|  Os01g0173600                                       203   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ10730.1|  hypothetical protein OsJ_00566                          203   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17137.1|  unknown                                                 202   6e-61   Picea sitchensis
ref|XP_007223440.1|  hypothetical protein PRUPE_ppa011519mg             201   3e-60   
gb|ABK26885.1|  unknown                                                 199   7e-60   Picea sitchensis
ref|XP_008218742.1|  PREDICTED: uncharacterized protein LOC103319...    200   8e-60   
ref|XP_008218743.1|  PREDICTED: uncharacterized protein LOC103319...    200   8e-60   
ref|XP_010545777.1|  PREDICTED: uncharacterized protein LOC104818034    197   2e-59   
gb|KHN31586.1|  hypothetical protein glysoja_043029                     197   2e-59   
ref|XP_006416913.1|  hypothetical protein EUTSA_v10008912mg             197   4e-59   
ref|NP_001236582.1|  uncharacterized protein LOC100305781               196   9e-59   
gb|AEW07933.1|  hypothetical protein 0_14804_01                         194   1e-58   
gb|EAY72730.1|  hypothetical protein OsI_00595                          197   1e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_007041249.1|  Lactoylglutathione lyase / glyoxalase I fami...    196   1e-58   
ref|XP_006598804.1|  PREDICTED: uncharacterized protein LOC102662470    194   4e-58   
gb|KHN39666.1|  Metallothiol transferase fosB                           194   5e-58   
ref|XP_006349333.1|  PREDICTED: uncharacterized protein LOC102593019    195   6e-58   
gb|KHG29618.1|  Metallothiol transferase fosB                           194   9e-58   
gb|ABK24179.1|  unknown                                                 193   1e-57   Picea sitchensis
gb|AFG69131.1|  hypothetical protein 0_14804_01                         191   2e-57   
ref|XP_010271470.1|  PREDICTED: uncharacterized protein LOC104607512    193   2e-57   
ref|XP_010256292.1|  PREDICTED: uncharacterized protein LOC104596717    193   2e-57   
ref|XP_004230457.1|  PREDICTED: uncharacterized protein LOC101243831    194   2e-57   
ref|XP_006385027.1|  hypothetical protein POPTR_0004s23200g             193   3e-57   
ref|XP_008781506.1|  PREDICTED: uncharacterized protein LOC103701277    193   3e-57   
ref|XP_010912492.1|  PREDICTED: uncharacterized protein LOC105038392    193   3e-57   
ref|XP_011028328.1|  PREDICTED: uncharacterized protein LOC105128...    193   4e-57   
ref|XP_010313702.1|  PREDICTED: uncharacterized protein LOC101264...    190   4e-57   
ref|XP_010271473.1|  PREDICTED: uncharacterized protein LOC104607...    192   4e-57   
ref|XP_011028327.1|  PREDICTED: uncharacterized protein LOC105128...    193   5e-57   
ref|XP_011028331.1|  PREDICTED: uncharacterized protein LOC105128...    193   5e-57   
ref|XP_010087426.1|  hypothetical protein L484_018453                   193   8e-57   
ref|XP_010271474.1|  PREDICTED: uncharacterized protein LOC104607...    190   8e-57   
gb|KDP42432.1|  hypothetical protein JCGZ_00229                         192   9e-57   
ref|XP_006389541.1|  hypothetical protein POPTR_0022s00750g             192   9e-57   
ref|XP_008784259.1|  PREDICTED: uncharacterized protein LOC103703257    191   1e-56   
ref|XP_009801533.1|  PREDICTED: uncharacterized protein LOC104247275    192   1e-56   
ref|XP_009785992.1|  PREDICTED: uncharacterized protein LOC104234167    192   2e-56   
ref|XP_006471156.1|  PREDICTED: uncharacterized protein LOC102612635    191   2e-56   
gb|ABK93893.1|  unknown                                                 191   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010930831.1|  PREDICTED: uncharacterized protein LOC105051...    191   2e-56   
ref|XP_006389542.1|  hypothetical protein POPTR_0022s00750g             191   2e-56   
ref|XP_009621424.1|  PREDICTED: uncharacterized protein LOC104113047    191   2e-56   
ref|XP_010930832.1|  PREDICTED: uncharacterized protein LOC105051...    191   2e-56   
ref|XP_009770635.1|  PREDICTED: uncharacterized protein LOC104221297    191   3e-56   
emb|CDO97602.1|  unnamed protein product                                191   3e-56   
ref|XP_006431676.1|  hypothetical protein CICLE_v10002584mg             190   4e-56   
gb|EYU26486.1|  hypothetical protein MIMGU_mgv1a013702mg                189   9e-56   
ref|XP_009608053.1|  PREDICTED: uncharacterized protein LOC104102125    189   1e-55   
ref|XP_002526462.1|  lactoylglutathione lyase, putative                 190   1e-55   Ricinus communis
ref|XP_002263444.1|  PREDICTED: uncharacterized protein LOC100266411    189   1e-55   Vitis vinifera
emb|CBI29715.3|  unnamed protein product                                188   1e-55   
ref|XP_004231328.1|  PREDICTED: glyoxalase domain-containing prot...    189   1e-55   
ref|XP_003597869.1|  hypothetical protein MTR_2g103460                  187   1e-55   
ref|XP_011047942.1|  PREDICTED: uncharacterized protein LOC105142135    189   2e-55   
ref|XP_003592932.1|  Metallothiol transferase fosB                      187   2e-55   
ref|XP_009606733.1|  PREDICTED: uncharacterized protein LOC104101037    189   2e-55   
ref|XP_007148556.1|  hypothetical protein PHAVU_006G218600g             189   4e-55   
ref|XP_006349336.1|  PREDICTED: uncharacterized protein LOC102593899    186   2e-54   
ref|XP_010263899.1|  PREDICTED: uncharacterized protein LOC104602043    186   2e-54   
ref|XP_009355289.1|  PREDICTED: uncharacterized protein LOC103946346    186   2e-54   
ref|XP_010033467.1|  PREDICTED: uncharacterized protein LOC104422744    185   3e-54   
ref|XP_008365316.1|  PREDICTED: uncharacterized protein LOC103428958    187   3e-54   
ref|XP_011088117.1|  PREDICTED: uncharacterized protein LOC105169423    183   4e-54   
ref|XP_010263898.1|  PREDICTED: uncharacterized protein LOC104602042    184   7e-54   
ref|XP_010277693.1|  PREDICTED: uncharacterized protein LOC104612074    183   3e-53   
ref|XP_009403272.1|  PREDICTED: uncharacterized protein LOC103986843    182   3e-53   
gb|ABK22105.1|  unknown                                                 182   4e-53   Picea sitchensis
ref|XP_009415753.1|  PREDICTED: glyoxalase domain-containing prot...    181   4e-53   
ref|XP_009402807.1|  PREDICTED: uncharacterized protein LOC103986514    182   5e-53   
ref|XP_010459071.1|  PREDICTED: uncharacterized protein LOC104740...    180   6e-53   
ref|XP_006383134.1|  hypothetical protein POPTR_0005s11890g             181   1e-52   
ref|XP_008357640.1|  PREDICTED: uncharacterized protein LOC103421393    185   2e-52   
gb|EMS60611.1|  hypothetical protein TRIUR3_34137                       182   4e-52   
ref|XP_004512116.1|  PREDICTED: uncharacterized protein LOC101496496    180   4e-52   
gb|ABD28405.2|  Glyoxalase/bleomycin resistance protein/dioxygenase     179   4e-52   Medicago truncatula
ref|XP_011028775.1|  PREDICTED: uncharacterized protein LOC105128688    179   6e-52   
ref|XP_002310845.1|  hypothetical protein POPTR_0007s13840g             179   7e-52   Populus trichocarpa [western balsam poplar]
ref|XP_007157944.1|  hypothetical protein PHAVU_002G111300g             177   3e-51   
ref|NP_001237480.1|  uncharacterized protein LOC100305841               177   5e-51   
ref|XP_010271469.1|  PREDICTED: uncharacterized protein LOC104607511    177   6e-51   
ref|XP_006425532.1|  hypothetical protein CICLE_v10026552mg             176   7e-51   
ref|XP_010919439.1|  PREDICTED: uncharacterized protein LOC105043568    176   8e-51   
ref|XP_002531512.1|  lactoylglutathione lyase, putative                 175   2e-50   Ricinus communis
ref|NP_001238378.1|  uncharacterized protein LOC100499688               174   3e-50   
ref|XP_007203893.1|  hypothetical protein PRUPE_ppa012053mg             174   3e-50   
ref|XP_002967188.1|  hypothetical protein SELMODRAFT_439738             174   3e-50   
ref|XP_009378199.1|  PREDICTED: uncharacterized protein LOC103966725    174   3e-50   
ref|XP_009618674.1|  PREDICTED: uncharacterized protein LOC104110822    175   4e-50   
ref|XP_009338642.1|  PREDICTED: uncharacterized protein LOC103930963    173   6e-50   
ref|XP_004287830.1|  PREDICTED: uncharacterized protein LOC101304803    174   6e-50   
gb|AES95089.2|  lactoylglutathione lyase/glyoxalase I family protein    174   6e-50   
ref|XP_003612131.1|  Lactoylglutathione lyase                           174   7e-50   
gb|AFK47459.1|  unknown                                                 174   7e-50   
ref|XP_008241797.1|  PREDICTED: lactoylglutathione lyase-like           173   8e-50   
ref|XP_008372764.1|  PREDICTED: uncharacterized protein LOC103436125    172   2e-49   
ref|XP_002970945.1|  hypothetical protein SELMODRAFT_94230              171   2e-49   
ref|XP_007046744.1|  Lactoylglutathione lyase / glyoxalase I fami...    171   5e-49   
ref|XP_008372762.1|  PREDICTED: lactoylglutathione lyase-like           171   5e-49   
ref|XP_010113383.1|  hypothetical protein L484_026715                   171   6e-49   
gb|AFK38981.1|  unknown                                                 171   9e-49   
ref|XP_002880927.1|  lactoylglutathione lyase family protein            169   2e-48   
ref|NP_029429.1|  lactoylglutathione lyase / glyoxalase I-like pr...    169   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003629350.1|  Lactoylglutathione lyase                           169   4e-48   
gb|AAK97724.1|  At2g28420/T1B3.6                                        169   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15596.1|  Metallothiol transferase fosB                           169   5e-48   
gb|KHG30040.1|  Metallothiol transferase fosB                           169   5e-48   
gb|KDO71123.1|  hypothetical protein CISIN_1g029033mg                   169   6e-48   
ref|XP_009599860.1|  PREDICTED: lactoylglutathione lyase-like           169   6e-48   
ref|XP_003631871.2|  PREDICTED: lactoylglutathione lyase-like           169   7e-48   
ref|XP_006409867.1|  hypothetical protein EUTSA_v10017750mg             168   7e-48   
gb|KHF99790.1|  Lactoylglutathione lyase                                168   9e-48   
ref|XP_006295738.1|  hypothetical protein CARUB_v10024857mg             168   2e-47   
ref|XP_004509342.1|  PREDICTED: uncharacterized protein LOC101515606    167   2e-47   
dbj|BAJ99951.1|  predicted protein                                      166   2e-47   
ref|XP_008791704.1|  PREDICTED: uncharacterized protein LOC103708522    166   2e-47   
ref|XP_002527954.1|  lactoylglutathione lyase, putative                 167   2e-47   Ricinus communis
gb|KCW68975.1|  hypothetical protein EUGRSUZ_F02538                     164   3e-47   
gb|KDP46697.1|  hypothetical protein JCGZ_06485                         167   3e-47   
emb|CDP01926.1|  unnamed protein product                                167   3e-47   
ref|XP_011091777.1|  PREDICTED: uncharacterized protein LOC105172134    166   3e-47   
ref|XP_007202864.1|  hypothetical protein PRUPE_ppa015560mg             164   4e-47   
ref|XP_009368069.1|  PREDICTED: uncharacterized protein LOC103957616    167   4e-47   
ref|XP_002446863.1|  hypothetical protein SORBIDRAFT_06g023890          166   5e-47   Sorghum bicolor [broomcorn]
gb|KCW82516.1|  hypothetical protein EUGRSUZ_C03913                     166   8e-47   
ref|XP_011092314.1|  PREDICTED: uncharacterized protein LOC105172535    166   1e-46   
ref|XP_009103687.1|  PREDICTED: uncharacterized protein LOC103829741    165   2e-46   
ref|XP_007220131.1|  hypothetical protein PRUPE_ppa020131mg             165   2e-46   
ref|XP_010279599.1|  PREDICTED: uncharacterized protein LOC104613472    164   2e-46   
gb|KDP43609.1|  hypothetical protein JCGZ_16896                         165   2e-46   
ref|XP_011025918.1|  PREDICTED: uncharacterized protein LOC105126680    165   2e-46   
ref|XP_006652586.1|  PREDICTED: uncharacterized protein LOC102704697    164   2e-46   
ref|XP_009780118.1|  PREDICTED: lactoylglutathione lyase-like           165   2e-46   
ref|XP_010679102.1|  PREDICTED: uncharacterized protein LOC104894542    164   3e-46   
ref|XP_009781311.1|  PREDICTED: lactoylglutathione lyase-like           164   3e-46   
ref|XP_010068955.1|  PREDICTED: uncharacterized protein LOC104455948    163   7e-46   
ref|XP_009629333.1|  PREDICTED: uncharacterized protein LOC104119517    162   9e-46   
ref|XP_004305407.1|  PREDICTED: lactoylglutathione lyase-like           163   9e-46   
ref|XP_006340705.1|  PREDICTED: lactoylglutathione lyase-like           163   9e-46   
gb|KCW65990.1|  hypothetical protein EUGRSUZ_G03282                     162   1e-45   
gb|ACF74334.1|  lactoylglutathione lyase                                163   1e-45   
ref|XP_008375286.1|  PREDICTED: uncharacterized protein LOC103438528    163   1e-45   
ref|XP_010414525.1|  PREDICTED: lactoylglutathione lyase-like           162   1e-45   
emb|CAN76551.1|  hypothetical protein VITISV_004420                     162   2e-45   
ref|NP_001053434.1|  Os04g0538900                                       162   2e-45   
ref|XP_004516235.1|  PREDICTED: lactoylglutathione lyase-like           161   2e-45   
ref|XP_004959863.1|  PREDICTED: uncharacterized protein LOC101765502    162   2e-45   
ref|XP_004232464.1|  PREDICTED: lactoylglutathione lyase-like           162   3e-45   
ref|XP_006658057.1|  PREDICTED: uncharacterized protein LOC102717631    162   3e-45   
ref|XP_003559863.1|  PREDICTED: uncharacterized protein LOC100829748    162   3e-45   
ref|XP_010470082.1|  PREDICTED: lactoylglutathione lyase-like           161   3e-45   
ref|XP_008231537.1|  PREDICTED: uncharacterized protein LOC103330708    161   4e-45   
ref|XP_010510624.1|  PREDICTED: lactoylglutathione lyase-like           161   4e-45   
gb|EMT24138.1|  hypothetical protein F775_26104                         161   5e-45   
ref|XP_008461357.1|  PREDICTED: lactoylglutathione lyase                161   5e-45   
gb|EMT24670.1|  hypothetical protein F775_19881                         161   6e-45   
ref|NP_001060509.1|  Os07g0657100                                       161   6e-45   
ref|XP_004976384.1|  PREDICTED: uncharacterized protein LOC101777224    159   1e-44   
ref|XP_001782990.1|  predicted protein                                  159   1e-44   
ref|XP_004229676.1|  PREDICTED: lactoylglutathione lyase                160   1e-44   
ref|XP_009790866.1|  PREDICTED: uncharacterized protein LOC104238246    160   1e-44   
gb|KEH44439.1|  lactoylglutathione lyase/glyoxalase I family protein    158   2e-44   
gb|EMS48558.1|  hypothetical protein TRIUR3_13403                       159   2e-44   
ref|XP_008653417.1|  PREDICTED: uncharacterized protein LOC103633514    160   3e-44   
gb|EAZ04990.1|  hypothetical protein OsI_27170                          159   3e-44   
ref|XP_009602386.1|  PREDICTED: lactoylglutathione lyase                159   4e-44   
ref|XP_001782171.1|  predicted protein                                  158   5e-44   
ref|XP_006854877.1|  hypothetical protein AMTR_s00182p00048530          158   6e-44   
ref|XP_002271319.1|  PREDICTED: uncharacterized protein LOC100244855    158   7e-44   
ref|XP_008354674.1|  PREDICTED: uncharacterized protein LOC103418323    158   8e-44   
gb|KDO83290.1|  hypothetical protein CISIN_1g047907mg                   156   9e-44   
ref|XP_002313326.1|  hypothetical protein POPTR_0009s06040g             157   1e-43   
ref|NP_001152631.1|  lactoylglutathione lyase                           158   1e-43   
ref|XP_004136133.1|  PREDICTED: lactoylglutathione lyase-like           158   1e-43   
gb|KFK32298.1|  hypothetical protein AALP_AA6G224300                    157   1e-43   
ref|XP_002463313.1|  hypothetical protein SORBIDRAFT_02g041630          158   1e-43   
gb|KEH17675.1|  lactoylglutathione lyase/glyoxalase I family protein    157   1e-43   
ref|XP_006343374.1|  PREDICTED: uncharacterized protein LOC102590728    157   1e-43   
ref|XP_001769353.1|  predicted protein                                  156   2e-43   
emb|CBI28596.3|  unnamed protein product                                158   2e-43   
ref|XP_009392743.1|  PREDICTED: uncharacterized protein LOC103978621    157   3e-43   
ref|XP_006345488.1|  PREDICTED: lactoylglutathione lyase-like           155   4e-43   
ref|XP_010103284.1|  hypothetical protein L484_007953                   155   5e-43   
ref|XP_011025508.1|  PREDICTED: lactoylglutathione lyase                155   1e-42   
gb|KGN45087.1|  hypothetical protein Csa_7G420800                       157   1e-42   
ref|XP_007052436.1|  Lactoylglutathione lyase / glyoxalase I fami...    157   2e-42   
ref|XP_010926993.1|  PREDICTED: uncharacterized protein LOC105049...    154   4e-42   
ref|XP_006856971.1|  hypothetical protein AMTR_s00190p00012330          152   4e-42   
ref|XP_002952841.1|  hypothetical protein VOLCADRAFT_62902              151   1e-41   
gb|EYU42982.1|  hypothetical protein MIMGU_mgv1a025275mg                151   1e-41   
gb|KHN36051.1|  hypothetical protein glysoja_003174                     151   2e-41   
gb|KDP46699.1|  hypothetical protein JCGZ_06487                         150   8e-41   
ref|XP_001695866.1|  hypothetical protein CHLREDRAFT_104003             147   3e-40   
ref|NP_001077851.1|  GLYOXYLASE I 7                                     147   4e-40   
gb|KDP46698.1|  hypothetical protein JCGZ_06486                         147   1e-39   
dbj|BAK05838.1|  predicted protein                                      145   3e-39   
gb|KDO80291.1|  hypothetical protein CISIN_1g029305mg                   144   4e-39   
ref|XP_006450971.1|  hypothetical protein CICLE_v10009574mg             144   5e-39   
ref|XP_005646543.1|  Glyoxalase/Bleomycin resistance protein/Dihy...    141   5e-38   
ref|XP_005847028.1|  hypothetical protein CHLNCDRAFT_31396              141   4e-37   
gb|AFK34097.1|  unknown                                                 136   2e-36   
gb|KDO43371.1|  hypothetical protein CISIN_1g0429452mg                  136   2e-36   
ref|XP_010926992.1|  PREDICTED: uncharacterized protein LOC105049...    139   5e-36   
gb|KCW82223.1|  hypothetical protein EUGRSUZ_C03639                     136   9e-36   
gb|KHN47166.1|  hypothetical protein glysoja_022467                     132   3e-35   
gb|EMS52469.1|  hypothetical protein TRIUR3_27380                       133   4e-35   
gb|ABK26156.1|  unknown                                                 134   8e-35   
ref|XP_010930834.1|  PREDICTED: uncharacterized protein LOC105051...    133   1e-34   
ref|XP_010930833.1|  PREDICTED: uncharacterized protein LOC105051...    133   1e-34   
ref|XP_006279353.1|  hypothetical protein CARUB_v10008045mg             130   4e-34   
ref|XP_011016833.1|  PREDICTED: uncharacterized protein LOC105120369    124   8e-32   
ref|XP_006279294.1|  hypothetical protein CARUB_v10016526mg             123   2e-31   
ref|XP_008671456.1|  PREDICTED: uncharacterized protein LOC103648836    123   5e-31   
ref|XP_006425533.1|  hypothetical protein CICLE_v10026552mg             123   1e-30   
ref|XP_006438925.1|  hypothetical protein CICLE_v10033699mg             120   1e-30   
ref|XP_008644824.1|  PREDICTED: uncharacterized protein LOC103626202    119   3e-30   
ref|XP_009782478.1|  PREDICTED: uncharacterized protein LOC104231221    114   2e-27   
ref|XP_007202916.1|  hypothetical protein PRUPE_ppa016181mg             108   4e-26   
gb|KDD76200.1|  hypothetical protein H632_c317p0                        103   3e-23   
ref|WP_002654663.1|  hypothetical protein                               101   6e-23   
tpg|DAA36659.1|  TPA: hypothetical protein ZEAMMB73_840050              100   8e-23   
gb|ACJ84047.1|  unknown                                               99.8    1e-22   
gb|KCW53108.1|  hypothetical protein EUGRSUZ_J02400                     100   2e-22   
gb|KGN65311.1|  hypothetical protein Csa_1G313810                     95.5    6e-21   
ref|NP_001148141.1|  lactoylglutathione lyase                         94.4    4e-20   
ref|XP_005707253.1|  hypothetical protein Gasu_19720                  92.4    2e-19   
gb|ACG48997.1|  lactoylglutathione lyase                              91.3    3e-19   
ref|XP_009620487.1|  PREDICTED: uncharacterized protein LOC104112312  86.7    7e-18   
ref|XP_008347914.1|  PREDICTED: uncharacterized protein LOC103411046  85.5    3e-17   
ref|XP_009603155.1|  PREDICTED: uncharacterized protein LOC104098188  81.3    8e-16   
emb|CAN75175.1|  hypothetical protein VITISV_031575                   78.2    3e-15   
dbj|BAD95096.1|  hypothetical protein                                 78.2    4e-15   
ref|WP_007918513.1|  Glyoxalase/bleomycin resistance protein/diox...  78.2    1e-14   
ref|XP_004486233.1|  PREDICTED: uncharacterized protein LOC101498649  76.6    2e-14   
ref|WP_013835657.1|  glyoxalase                                       74.3    3e-13   
ref|XP_004343324.1|  glyoxalase family protein                        75.5    5e-13   
ref|WP_035341625.1|  glyoxalase                                       73.6    5e-13   
gb|ABB82567.1|  putative glyoxylase family member                     70.9    1e-12   
ref|WP_012960829.1|  glyoxalase                                       72.4    1e-12   
ref|XP_010317742.1|  PREDICTED: uncharacterized protein LOC104646188  72.8    1e-12   
ref|XP_005646329.1|  Glyoxalase/Bleomycin resistance protein/Dihy...  73.6    2e-12   
gb|EWM21285.1|  lactoylglutathione lyase glyoxalase i-like protein    75.9    2e-12   
dbj|GAF64405.1|  hypothetical protein BTS2_1298                       71.6    3e-12   
ref|WP_013966710.1|  glyoxalase                                       71.2    3e-12   
ref|WP_026673291.1|  glyoxalase                                       70.9    4e-12   
ref|WP_037326949.1|  glyoxalase                                       70.9    5e-12   
ref|WP_025908054.1|  glyoxalase                                       70.5    7e-12   
ref|WP_017725883.1|  hypothetical protein                             70.1    8e-12   
ref|WP_039705989.1|  hypothetical protein                             69.3    1e-11   
ref|WP_022629529.1|  glyoxalase                                       69.3    1e-11   
ref|WP_035862524.1|  glyoxalase                                       67.4    8e-11   
ref|WP_036279261.1|  hypothetical protein                             67.4    9e-11   
gb|ADD24468.1|  Lactoylglutathione lyase                              69.7    9e-11   
ref|WP_010584326.1|  glyoxalase                                       67.4    1e-10   
emb|CDY65249.1|  BnaC07g50510D                                        66.2    1e-10   
gb|EJK50743.1|  hypothetical protein THAOC_30164                      71.2    1e-10   
ref|WP_013646295.1|  glyoxalase                                       67.0    1e-10   
ref|WP_015029770.1|  Glyoxalase/bleomycin resistance protein/diox...  66.2    2e-10   
gb|ABK25860.1|  unknown                                               65.5    2e-10   
ref|WP_019308302.1|  glyoxalase                                       65.9    3e-10   
ref|WP_039321233.1|  hypothetical protein                             66.6    3e-10   
gb|ABR16804.1|  unknown                                               63.5    6e-10   
ref|WP_002647090.1|  glyoxalase                                       65.1    7e-10   
ref|WP_035874201.1|  glyoxalase                                       65.1    8e-10   
ref|WP_020054797.1|  hypothetical protein                             64.7    9e-10   
ref|WP_006162674.1|  glyoxalase                                       65.1    1e-09   
ref|WP_035392891.1|  hypothetical protein                             64.3    1e-09   
ref|WP_031434869.1|  glyoxalase                                       64.3    1e-09   
ref|WP_035975661.1|  glyoxalase                                       64.7    1e-09   
gb|AHF00940.1|  glyoxalase                                            63.9    1e-09   
ref|XP_005842954.1|  hypothetical protein CHLNCDRAFT_141766           64.7    2e-09   
ref|WP_039010716.1|  glyoxalase                                       64.3    2e-09   
ref|WP_013930223.1|  glyoxalase                                       63.5    2e-09   
ref|WP_020021186.1|  hypothetical protein                             63.5    2e-09   
ref|WP_010509293.1|  glyoxalase                                       63.2    2e-09   
ref|WP_019422567.1|  hypothetical protein                             63.2    3e-09   
ref|WP_035666292.1|  glyoxalase                                       63.2    3e-09   
ref|WP_006767247.1|  glyoxalase                                       63.9    3e-09   
gb|KGA98872.1|  glyoxalase                                            63.2    3e-09   
ref|WP_039522716.1|  glyoxalase                                       62.8    4e-09   
ref|WP_037130347.1|  glyoxalase                                       62.8    4e-09   
ref|WP_038476480.1|  hypothetical protein                             62.8    4e-09   
ref|XP_008337405.1|  PREDICTED: uncharacterized protein LOC103400531  62.8    5e-09   
ref|WP_012637725.1|  glyoxalase                                       62.4    5e-09   
gb|ABO80471.1|  Glyoxalase/extradiol ring-cleavage dioxygenase        61.6    5e-09   
ref|WP_027955681.1|  glyoxalase                                       62.4    5e-09   
ref|WP_008080807.1|  hypothetical protein                             62.4    5e-09   
ref|WP_018231138.1|  glyoxalase                                       62.0    7e-09   
ref|WP_013108380.1|  glyoxalase                                       62.8    7e-09   
ref|WP_028194232.1|  MULTISPECIES: glyoxalase                         62.8    7e-09   
ref|WP_009581712.1|  hypothetical protein                             62.0    7e-09   
ref|WP_005001022.1|  glyoxalase                                       62.0    8e-09   
ref|WP_018324761.1|  hypothetical protein                             62.0    8e-09   
ref|XP_001764314.1|  predicted protein                                62.0    9e-09   
ref|WP_018922616.1|  hypothetical protein                             61.6    9e-09   
ref|WP_010899997.1|  glyoxalase                                       61.6    1e-08   
ref|WP_020384427.1|  glyoxalase                                       62.4    1e-08   
ref|WP_039223610.1|  glyoxalase                                       62.0    1e-08   
ref|WP_017228262.1|  glyoxalase                                       62.0    1e-08   
ref|WP_026461943.1|  glyoxalase                                       61.6    1e-08   
gb|KER68476.1|  glyoxalase                                            61.6    1e-08   
gb|KDC61756.1|  glyoxalase-like domain protein                        62.4    1e-08   
ref|WP_034762013.1|  glyoxalase                                       61.2    2e-08   
ref|WP_024298377.1|  glyoxalase                                       61.2    2e-08   
ref|WP_028608769.1|  glyoxalase                                       60.8    2e-08   
ref|XP_007154625.1|  hypothetical protein PHAVU_003G134400g           62.4    2e-08   
ref|WP_034301394.1|  glyoxalase                                       60.8    2e-08   
emb|CBI27874.3|  unnamed protein product                              62.0    2e-08   
ref|WP_003817395.1|  putative dioxygenase                             61.2    2e-08   
ref|WP_018953112.1|  glyoxalase                                       60.5    2e-08   
emb|CAN63060.1|  hypothetical protein VITISV_016330                   62.0    2e-08   
ref|XP_002281014.1|  PREDICTED: uncharacterized protein LOC100242371  62.0    3e-08   
ref|WP_036711666.1|  glyoxalase                                       60.5    3e-08   
ref|WP_009470552.1|  hypothetical protein                             60.5    3e-08   
ref|WP_003811524.1|  MULTISPECIES: glyoxalase                         60.8    3e-08   
ref|WP_011301755.1|  glyoxalase                                       60.8    3e-08   
ref|WP_028395683.1|  glyoxalase                                       60.5    3e-08   
ref|WP_034477869.1|  hypothetical protein                             60.5    3e-08   
ref|WP_035956791.1|  glyoxalase                                       60.8    3e-08   
ref|WP_031537860.1|  glyoxalase                                       60.1    3e-08   
ref|WP_012392501.1|  glyoxalase                                       61.2    4e-08   
ref|WP_026676653.1|  glyoxalase                                       59.7    4e-08   
ref|WP_013951994.1|  glyoxalase                                       60.5    5e-08   
ref|WP_011739395.1|  glyoxalase                                       60.8    5e-08   
ref|WP_012911346.1|  glyoxalase                                       60.1    5e-08   
ref|WP_029624519.1|  hypothetical protein                             59.7    6e-08   
ref|WP_034750167.1|  glyoxalase                                       59.3    6e-08   
ref|WP_028525552.1|  glyoxalase                                       59.3    6e-08   
ref|WP_011880434.1|  MULTISPECIES: glyoxalase                         60.1    6e-08   
ref|WP_033135474.1|  hypothetical protein                             59.7    7e-08   
ref|WP_028997789.1|  glyoxalase                                       59.7    7e-08   
ref|WP_018309103.1|  glyoxalase                                       59.7    7e-08   
ref|WP_024283321.1|  glyoxalase                                       59.7    7e-08   
ref|WP_035421728.1|  MULTISPECIES: hypothetical protein               59.3    7e-08   
ref|WP_028166445.1|  hypothetical protein                             59.3    7e-08   
ref|WP_012823152.1|  glyoxalase                                       59.3    9e-08   
ref|WP_038572046.1|  glyoxalase                                       59.7    9e-08   
dbj|GAK27198.1|  glutathione transferase                              59.3    9e-08   
ref|WP_034184374.1|  glyoxalase                                       59.7    9e-08   
ref|WP_037095517.1|  glyoxalase                                       58.9    9e-08   
ref|WP_026304412.1|  lactoylglutathione lyase                         58.9    1e-07   
ref|WP_020561655.1|  hypothetical protein                             58.9    1e-07   
ref|WP_027583469.1|  glyoxalase                                       59.3    1e-07   
ref|WP_009054848.1|  glyoxalase                                       59.3    1e-07   
ref|WP_015354272.1|  lyase                                            59.7    1e-07   
ref|WP_012248177.1|  glyoxalase                                       59.3    1e-07   
ref|WP_034193603.1|  glyoxalase                                       59.3    1e-07   
ref|XP_004287586.1|  PREDICTED: uncharacterized protein YaeR-like...  59.7    1e-07   
ref|WP_006751821.1|  diguanylate cyclase                              58.9    1e-07   
ref|WP_007577254.1|  glyoxalase                                       58.9    1e-07   
ref|WP_029050041.1|  glyoxalase                                       58.9    1e-07   
ref|WP_021905953.1|  lactoylglutathione lyase and related lyases      58.5    2e-07   
ref|WP_022726099.1|  hypothetical protein                             58.5    2e-07   
ref|WP_020257440.1|  hypothetical protein                             58.9    2e-07   
ref|WP_016483797.1|  Lactoylglutathione lyase and related lyases      58.2    2e-07   
ref|WP_036351560.1|  glyoxalase                                       59.3    2e-07   
ref|WP_036050192.1|  hypothetical protein                             58.5    2e-07   



>ref|XP_009604167.1| PREDICTED: uncharacterized protein LOC104099009 [Nicotiana tomentosiformis]
Length=163

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHIS+VC SVEKSLDFYQN+LGFFPIRRPGSF+F GAWLFNYGIGIHLLQ
Sbjct  1    MENPLHLKSLNHISVVCRSVEKSLDFYQNILGFFPIRRPGSFNFDGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D  N+PK++ INPKDNHISFQCESM  VEKRLKEMEIEY+K RVEEGG++VDQLFFHD
Sbjct  61   SEDPENMPKISTINPKDNHISFQCESMVTVEKRLKEMEIEYIKSRVEEGGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTMqqqqiqqLV  538
            PDGMMIEICNCDNLPVIPLSGE LRP + L C MQQQ+IQQLV
Sbjct  121  PDGMMIEICNCDNLPVIPLSGETLRPCSTLHCGMQQQKIQQLV  163



>ref|XP_009778075.1| PREDICTED: uncharacterized protein LOC104227516 [Nicotiana sylvestris]
Length=163

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHIS+VC SVEKSLDFYQN+LGFFPIRRPGSF+F GAWLFNYGIGIHLLQ
Sbjct  1    MENPLHLKSLNHISVVCRSVEKSLDFYQNILGFFPIRRPGSFNFDGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D  N+PK+  INPKDNHISFQCESM  VEKRLKEMEIEY+K RVEEGG++VDQLFFHD
Sbjct  61   SEDPENMPKIRIINPKDNHISFQCESMTTVEKRLKEMEIEYIKSRVEEGGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTMqqqqiqqLV  538
            PDGMMIEICNCDNLPVIPLSGE LRP + L C+MQ+++ QQLV
Sbjct  121  PDGMMIEICNCDNLPVIPLSGETLRPCSTLRCSMQRKKNQQLV  163



>ref|XP_004251570.1| PREDICTED: uncharacterized protein LOC101264403 isoform X1 [Solanum 
lycopersicum]
Length=165

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 145/165 (88%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHISIVC S+EKSLDFYQN+LGFFPIRRPGSF+F GAWLFNYGIGIHLLQ
Sbjct  1    MENPLHLKSLNHISIVCRSLEKSLDFYQNILGFFPIRRPGSFNFDGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D  N+PK+  INPKDNHISFQCESM MVE RLKEME EY+KCRVEEG ++VDQ+FFHD
Sbjct  61   SEDPNNMPKINIINPKDNHISFQCESMTMVENRLKEMETEYIKCRVEEGNIYVDQIFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSG--EPLRPPAGLTCTMqqqqiqqLV  538
            PDG MIEICNCDNLPVIPLSG    LRP + L CTMQQ +IQQ+V
Sbjct  121  PDGTMIEICNCDNLPVIPLSGGETVLRPCSTLHCTMQQNKIQQMV  165



>ref|XP_006364901.1| PREDICTED: uncharacterized protein LOC102595975 [Solanum tuberosum]
Length=165

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHISIVC SVEKSLDFYQN+LGFFPIRRPGSF+F GAWLFNYGIGIHLLQ
Sbjct  1    MENPLHLKSLNHISIVCRSVEKSLDFYQNILGFFPIRRPGSFNFDGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D  N+PK+  INPKDNHISFQCESM MVE  LKEME EY+KCRVEEG ++VDQ+FFHD
Sbjct  61   SEDPENMPKINIINPKDNHISFQCESMTMVENWLKEMETEYIKCRVEEGNIYVDQIFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSG--EPLRPPAGLTCTMqqqqiqqLV  538
            PDG MIEICNCDNLPVIPLSG    LRP + L CTMQQ +IQQ+V
Sbjct  121  PDGTMIEICNCDNLPVIPLSGGETVLRPCSTLHCTMQQNKIQQMV  165



>ref|XP_007023869.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOY26491.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=170

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN++NPL LKSLNH+S+VC SVE+S++FYQN+LGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKENVDNPLHLKSLNHVSLVCRSVEESINFYQNILGFVPIRRPGSFDFNGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK   INPKDNHISFQCESM  VEK+LKEME+EYV+  VEEGG++V+QL
Sbjct  61   HLLQSEDPDNMPKKKKINPKDNHISFQCESMGAVEKKLKEMELEYVRAMVEEGGIYVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            FFHDPDG MIEICNCDNLPVIPL+GE +R  + L   M
Sbjct  121  FFHDPDGFMIEICNCDNLPVIPLAGEMVRSCSRLNLQM  158



>gb|KDP32380.1| hypothetical protein JCGZ_13305 [Jatropha curcas]
Length=194

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 4/159 (3%)
 Frame = +2

Query  44   MKEN-MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            MKEN MENPL+LKSLNHISI+C S+EKSLDFYQNVLGFFP++RPGSFDF GAWLF+YGIG
Sbjct  1    MKENVMENPLQLKSLNHISILCRSLEKSLDFYQNVLGFFPVKRPGSFDFDGAWLFSYGIG  60

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLLQ++D  N+PK+  INPKDNHISFQCE+MAMVEK+LKEM+IE+VK RVEEGG++VDQ
Sbjct  61   IHLLQSEDPENMPKINQINPKDNHISFQCENMAMVEKKLKEMKIEHVKGRVEEGGINVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEP-LRPPAGLTCT  508
            LFFHDPDG MIEICNCD LPVIPL+G+  +R  + + C 
Sbjct  121  LFFHDPDGSMIEICNCDVLPVIPLAGDATIRSCSLMNCN  159



>ref|XP_002517606.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF44770.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=172

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S+DFYQNVLGF PIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESIDFYQNVLGFVPIRRPGSFDFDGAWLFGFGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK + INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+HVDQL
Sbjct  61   HLLQSEDPENMPKKSEINPKDNHISFQCESMGAVEKKLKEMEIKYVRATVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            FFHDPDG MIEICNCD+LPVIPL+GE  R  + +   M
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAGEMARSCSRVNLQM  158



>ref|XP_006475817.1| PREDICTED: uncharacterized protein LOC102622259 [Citrus sinensis]
 gb|KDO80290.1| hypothetical protein CISIN_1g029305mg [Citrus sinensis]
Length=194

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ENPL LKSLNHIS+VC SVE SLDFYQNVLGFFPIRRPGSFDF GAWLFNYG+GI
Sbjct  1    MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGI  60

Query  224  HLLQAD--DNLPKV-TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLL+++  DNLPK   NINPKDNHISFQCE+MA+VE+RLKEM+I+YVK RVEEGG++VDQ
Sbjct  61   HLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNCD LPV+PL+G+ +R
Sbjct  121  LFFHDPDGSMIEICNCDVLPVVPLAGDAVR  150



>ref|XP_006450972.1| hypothetical protein CICLE_v10009574mg [Citrus clementina]
 gb|ESR64212.1| hypothetical protein CICLE_v10009574mg [Citrus clementina]
Length=194

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ENPL LKSLNHIS+VC SVE SLDFYQNVLGFFPIRRPGSFDF GAWLFNYG+GI
Sbjct  1    MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGAWLFNYGMGI  60

Query  224  HLLQAD--DNLPKV-TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLL+++  DNLPK   NINPKDNHISFQCE+MA+VE+RLKEM+I+YVK RVEEGG++VDQ
Sbjct  61   HLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNCD LPV+PL+G+ +R
Sbjct  121  LFFHDPDGSMIEICNCDVLPVVPLAGDAVR  150



>ref|XP_006476111.1| PREDICTED: uncharacterized protein LOC102629469 [Citrus sinensis]
Length=178

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M+NPL LKSLNH S+VC SVEKSLDFYQNV+GF PIRRPGSFDF GAWLFNYGIGI
Sbjct  1    MKESMQNPLSLKSLNHFSLVCRSVEKSLDFYQNVIGFLPIRRPGSFDFHGAWLFNYGIGI  60

Query  224  HLLQADD--NLPKVTNI-NPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLL+ +D   +P ++ I NPKDNHISFQCE+MA VE++L EM+IEYVK RVEEGG++VDQ
Sbjct  61   HLLKCEDPDRMPSISKIINPKDNHISFQCENMATVERKLTEMKIEYVKSRVEEGGIYVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            +FFHDPDG MIEICNCD LPV+PL+G+ +R  + + C +
Sbjct  121  VFFHDPDGSMIEICNCDVLPVVPLAGDTIRSCSIVNCNI  159



>ref|XP_004287347.1| PREDICTED: metallothiol transferase FosB-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=195

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE   NPL+LKSLNHIS+VC S+EKSLDFYQNVLGFFP+RRP S DF GAWLFNYGIGI
Sbjct  1    MKERTGNPLQLKSLNHISLVCRSLEKSLDFYQNVLGFFPVRRPDSLDFNGAWLFNYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA+D   LPK+++INPKDNHISFQCESM  VE +LKEM IEYV   VEEGG++VDQL
Sbjct  61   HLLQAEDPETLPKISHINPKDNHISFQCESMIRVENKLKEMGIEYVTSSVEEGGINVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG-EPLRPPAGLTCTM  511
            FFHDPDG MIEICNCDNLPVIPL G + LR    + C +
Sbjct  121  FFHDPDGTMIEICNCDNLPVIPLVGDQTLRSCTRVKCNV  159



>ref|XP_007215072.1| hypothetical protein PRUPE_ppa012380mg [Prunus persica]
 gb|EMJ16271.1| hypothetical protein PRUPE_ppa012380mg [Prunus persica]
Length=172

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE M NPL LKSLNHIS++C SVE+S+DFYQNVLGF PIRRPGSF+F GAWLF YGIGI
Sbjct  1    MKETMGNPLHLKSLNHISLICRSVEQSIDFYQNVLGFVPIRRPGSFNFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  ++PK T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEDPESMPKKTEINPKDNHISFQCESMGAVEKKLKEMELKYKRAMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPVIP++GE  R
Sbjct  121  FFHDPDGFMIEICDCDNLPVIPIAGEIAR  149



>ref|XP_010088321.1| hypothetical protein L484_005835 [Morus notabilis]
 gb|EXB33937.1| hypothetical protein L484_005835 [Morus notabilis]
Length=175

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL+LKSLNHIS++C S+EKSLDFY++VLGFFPIRRP SFDF GAWLF+YGIGIHLLQ +
Sbjct  7    NPLQLKSLNHISLLCRSLEKSLDFYRSVLGFFPIRRPDSFDFDGAWLFSYGIGIHLLQCE  66

Query  242  D--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
            D   LPK+  INPKDNHISFQCESM+ VE++L+EM I YVK RVEEGG+HVDQLFFHDPD
Sbjct  67   DPEKLPKIKRINPKDNHISFQCESMSTVERKLQEMGIIYVKTRVEEGGIHVDQLFFHDPD  126

Query  416  GMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            G+MIEICNCDNLPV+PL+GE +R  + ++C +
Sbjct  127  GLMIEICNCDNLPVVPLTGETVRSCSKISCNV  158



>ref|XP_008243712.1| PREDICTED: uncharacterized protein LOC103341942 [Prunus mume]
Length=168

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE M NPL LKSLNHIS++C SVE+S+DFYQNVLGF PIRRPGSF+F GAWLF YGIGI
Sbjct  1    MKETMGNPLHLKSLNHISLICRSVEQSIDFYQNVLGFVPIRRPGSFNFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  ++PK T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEDPESMPKKTEINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPVIP++GE  R
Sbjct  121  FFHDPDGFMIEICDCDNLPVIPIAGEIAR  149



>gb|KEH28697.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=175

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPL LKS+NHIS++C SVE+S+DFYQNVLGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKESVGNPLHLKSVNHISLICRSVEESIDFYQNVLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LP+   INPKDNHISFQCESM  VEK+LKEMEI YV+ RVEEGG+ VDQL
Sbjct  61   HLLEAENPETLPRKKEINPKDNHISFQCESMGAVEKKLKEMEINYVRARVEEGGIEVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLVGEVAR  149



>ref|XP_004506908.1| PREDICTED: uncharacterized protein YwkD-like [Cicer arietinum]
Length=171

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPL LKS+NHIS++C SVE+S+DFYQNVLGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKESVGNPLHLKSVNHISLICRSVEESMDFYQNVLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LP+   INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLEAENPEKLPRKKEINPKDNHISFQCESMGAVEKKLKEMEIDYVRATVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLT  502
            FFHDPDG MIEICNCD+LPVIPL G+  RP + L 
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLVGDLARPCSRLN  155



>ref|XP_008357276.1| PREDICTED: uncharacterized protein LOC103421019 [Malus domestica]
Length=172

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M NPL LKSLNHIS++C SVE+S++FYQNVLGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKESMANPLHLKSLNHISLICRSVEESINFYQNVLGFVPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEDPENMPKKTEINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPV+P++G   R
Sbjct  121  FFHDPDGFMIEICDCDNLPVVPIAGGMAR  149



>gb|ACU18440.1| unknown [Glycine max]
Length=172

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPLRL+S+NHIS++C SVE+S+DFYQNVLGF+PIRRPGS DF GAWLF YGIGI
Sbjct  1    MKESVGNPLRLQSVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LPK   INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLEAENPEKLPKKKEINPKDNHISFQCESMVAVEKKLKEMEIDYVRATVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLVGEVAR  149



>ref|XP_008244727.1| PREDICTED: uncharacterized protein LOC103342852 [Prunus mume]
Length=171

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 6/150 (4%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M   L LKSLNHIS+VC SVEKSLDFYQ+VLGFFPIRRPGSFDF GAWL NYGI I
Sbjct  1    MKESM---LNLKSLNHISLVCRSVEKSLDFYQSVLGFFPIRRPGSFDFNGAWLLNYGIDI  57

Query  224  HLLQADD--NLPK-VTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQ++D   +PK +T INPKDNHISFQCESM  VEK+LKEMEIEYVKCRV+EGG++V Q
Sbjct  58   HLLQSEDPDKMPKKITQINPKDNHISFQCESMVTVEKKLKEMEIEYVKCRVDEGGIYVAQ  117

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
             FFHD D  MIEICNCDNLPVIPL+GEP+R
Sbjct  118  FFFHDADATMIEICNCDNLPVIPLTGEPVR  147



>ref|XP_010097255.1| hypothetical protein L484_025804 [Morus notabilis]
 gb|EXB67322.1| hypothetical protein L484_025804 [Morus notabilis]
Length=180

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ENPL LKSLNHIS+VC S+ +S+DFYQNVLGF PIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKESVENPLHLKSLNHISLVCRSLVESIDFYQNVLGFVPIRRPGSFDFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+P+ + INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLQSEDPDNMPRKSVINPKDNHISFQCESMGAVEKKLKEMEIKYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDNLPVVPLAGEIAR  149



>ref|XP_010049980.1| PREDICTED: glyoxalase domain-containing protein 5-like [Eucalyptus 
grandis]
 gb|KCW82813.1| hypothetical protein EUGRSUZ_C04184 [Eucalyptus grandis]
Length=170

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL+LKSLNHIS+VC S+E+++DFYQ VLGF P+RRPGSFDF GAWLFNYGIGIHLLQ
Sbjct  1    MENPLQLKSLNHISLVCRSLERTVDFYQKVLGFVPVRRPGSFDFEGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            A+D   +P    INPKDNHISFQCESMA VEK+L+EMEIEYVK RVEEGG++VDQ+FFHD
Sbjct  61   AEDPHQMPAAGGINPKDNHISFQCESMATVEKKLEEMEIEYVKSRVEEGGIYVDQIFFHD  120

Query  410  PDGMMIEICNCDNLPVIPL-SGEPLRPPAGLTCTM  511
            PDG+MIE+CNCD LPVIPL  G P+   + + C +
Sbjct  121  PDGLMIEVCNCDILPVIPLDGGAPVLQCSRMNCNL  155



>gb|KHN01342.1| hypothetical protein glysoja_009548 [Glycine soja]
Length=172

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPLRL+S+NHIS++C SVE+S+DFYQNVLGF+PIRRPGS DF GAWLF YGIGI
Sbjct  1    MKESVGNPLRLQSVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LPK   INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLEAENPEKLPKKKEINPKDNHISFQCESMVAVEKKLKEMEIDYVRATVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLVGEVAR  149



>ref|XP_004302970.1| PREDICTED: metallothiol transferase FosB-like [Fragaria vesca 
subsp. vesca]
Length=170

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE + NPL LKSLNHIS++C SVE+S+ FYQNVLGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKETLGNPLHLKSLNHISLICRSVEESIAFYQNVLGFVPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+++   +PK T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEEPEKMPKKTEINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPVIPL+GE  R
Sbjct  121  FFHDPDGFMIEICDCDNLPVIPLAGEMAR  149



>gb|KHG30572.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=170

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M NPL LKSLNHIS+VC SVE+S++FYQ++LGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKESMGNPLHLKSLNHISLVCRSVEESMNFYQDILGFVPIRRPGSFDFNGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  +LPK   INPKDNHISFQCESM  VEK+LKEME+EYV+  VEEGG++V+QL
Sbjct  61   HLLQSEDPESLPKKKEINPKDNHISFQCESMGAVEKKLKEMELEYVRAIVEEGGIYVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGE  475
            FFHDPDG MIEICNCDNLPV+PL+GE
Sbjct  121  FFHDPDGFMIEICNCDNLPVVPLAGE  146



>ref|XP_009362525.1| PREDICTED: uncharacterized protein LOC103952618 [Pyrus x bretschneideri]
 ref|XP_009362538.1| PREDICTED: uncharacterized protein LOC103952628 [Pyrus x bretschneideri]
Length=172

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M NPL LKSLNHIS++C SVE+S++FYQNVLGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKESMANPLHLKSLNHISLICRSVEESINFYQNVLGFVPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+P+ T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEDPENMPRKTVINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPV+P++G   R
Sbjct  121  FFHDPDGFMIEICDCDNLPVVPIAGGMAR  149



>ref|XP_007013389.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOY31008.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=168

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 132/154 (86%), Gaps = 2/154 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL+LK LNH+S+VC S+EKSLDFYQNVLGFFPI+RPGSFDF GAWLFNYGIGIHLLQ
Sbjct  1    MENPLQLKCLNHVSLVCRSIEKSLDFYQNVLGFFPIKRPGSFDFSGAWLFNYGIGIHLLQ  60

Query  236  AD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++  DN+PK+  INPKDNHISFQCE MA VEK+LKEM++EYVK  VE+GG+ VDQLFFHD
Sbjct  61   SENPDNMPKIGRINPKDNHISFQCECMATVEKKLKEMKLEYVKGGVEDGGIRVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            PDG MIE+CNCDNLPV+PL  + +   + + C +
Sbjct  121  PDGTMIEVCNCDNLPVVPLPQDAMPSCSLINCNI  154



>dbj|BAJ53235.1| JHL06P13.16 [Jatropha curcas]
 gb|KDP37108.1| hypothetical protein JCGZ_06164 [Jatropha curcas]
Length=172

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE   NPL LKSLNHIS +C SVE+S+DFY+NVLGF PIRRPGSFDF GAWL+ YGIGI
Sbjct  1    MKETTGNPLHLKSLNHISHLCKSVEQSVDFYENVLGFVPIRRPGSFDFDGAWLYGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK T INPKDNHISFQCESM  VEK+LKEM I++V+  VEEGG+HVDQL
Sbjct  61   HLLQSEDPDNMPKKTEINPKDNHISFQCESMGAVEKKLKEMGIKHVRAMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAGEVAR  149



>ref|XP_002309802.1| hypothetical protein POPTR_0007s01900g [Populus trichocarpa]
 gb|EEE90252.1| hypothetical protein POPTR_0007s01900g [Populus trichocarpa]
Length=159

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 132/145 (91%), Gaps = 3/145 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFN-YGIG  220
            +KEN +NPL+LKS+NHISIVC S+EKSLDFYQNVLGFFP+RRP S +F GAWLF+ YGIG
Sbjct  2    VKENNKNPLQLKSINHISIVCRSLEKSLDFYQNVLGFFPVRRPSSLNFDGAWLFSCYGIG  61

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLLQ++D  ++PK+T INPKDNH SFQCESMAMVEK+L+EMEI+YVK RVEE G+ VDQ
Sbjct  62   IHLLQSEDPESMPKITKINPKDNHFSFQCESMAMVEKKLEEMEIKYVKTRVEEDGMEVDQ  121

Query  395  LFFHDPDGMMIEICNCDNLPVIPLS  469
            LFFHDPDGMMIEICNCDNLPVIPL+
Sbjct  122  LFFHDPDGMMIEICNCDNLPVIPLA  146



>ref|NP_001235416.1| uncharacterized protein LOC100305695 [Glycine max]
 gb|ACU13513.1| unknown [Glycine max]
Length=173

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN+ NPL LKS+NHIS++C+SV++S++FYQN+LGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKENVGNPLHLKSVNHISLICTSVKESINFYQNLLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA+D  N+P+ T INPKDNHISFQCESM  VEK+L EMEIEYV   VEEGG+ VDQL
Sbjct  61   HLLQAEDPDNVPRKTKINPKDNHISFQCESMGAVEKKLGEMEIEYVHATVEEGGIKVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPVIPL+ 
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAA  145



>ref|NP_001237532.1| uncharacterized protein LOC100306100 [Glycine max]
 gb|ACU14119.1| unknown [Glycine max]
Length=172

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPLRL+S+NHIS++C SVE+S+DFYQNVLGF+PIRRPGS DF GAWLF YGIGI
Sbjct  1    MKESVGNPLRLQSVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LPK   INPKDNHISFQCESM  VEK+LKEMEI+Y +  VEEGG+ VDQL
Sbjct  61   HLLEAENPEKLPKKKEINPKDNHISFQCESMVAVEKKLKEMEIDYARATVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLVGEVAR  149



>ref|XP_009348777.1| PREDICTED: uncharacterized protein LOC103940388 [Pyrus x bretschneideri]
Length=172

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE M NPL LKSLNHIS++C SVE+S++FYQNVLGF PIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKEIMANPLHLKSLNHISLICRSVEESINFYQNVLGFVPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+P+ T INPKDNHISFQCESM  VEK+LKEME++Y +  VEEGG+HVDQL
Sbjct  61   HLLQSEDPENMPRKTEINPKDNHISFQCESMGAVEKKLKEMELKYKRSMVEEGGIHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPV+P++G   R
Sbjct  121  FFHDPDGFMIEICDCDNLPVVPIAGGMAR  149



>ref|XP_007135739.1| hypothetical protein PHAVU_010G154400g [Phaseolus vulgaris]
 gb|ESW07733.1| hypothetical protein PHAVU_010G154400g [Phaseolus vulgaris]
Length=227

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 7/155 (5%)
 Frame = +2

Query  53   NMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLL  232
            ++ENPLRL+S+NHIS++C SVE+S+DFYQNVLGFFPIRRPGSFDF GAWLF YGIGIHLL
Sbjct  58   SVENPLRLQSVNHISLICRSVEESMDFYQNVLGFFPIRRPGSFDFDGAWLFGYGIGIHLL  117

Query  233  QAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFH  406
            +A+  + LPK   INPKDNHISFQCESM  VEK+LKEM+I YV+  VEEGG+ VDQLFFH
Sbjct  118  EAENPEKLPKKKEINPKDNHISFQCESMGAVEKKLKEMDIAYVRATVEEGGIQVDQLFFH  177

Query  407  DPDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            DPDG MIEICNCD+LPVIPL GE  R     TC++
Sbjct  178  DPDGFMIEICNCDSLPVIPLVGEVAR-----TCSL  207



>gb|KDO80289.1| hypothetical protein CISIN_1g029305mg [Citrus sinensis]
Length=195

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAW-LFNYGIG  220
            MKE++ENPL LKSLNHIS+VC SVE SLDFYQNVLGFFPIRRPGSFDF GA  LFNYG+G
Sbjct  1    MKESVENPLCLKSLNHISLVCRSVEASLDFYQNVLGFFPIRRPGSFDFDGACRLFNYGMG  60

Query  221  IHLLQAD--DNLPKV-TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            IHLL+++  DNLPK   NINPKDNHISFQCE+MA+VE+RLKEM+I+YVK RVEEGG++VD
Sbjct  61   IHLLKSEEPDNLPKAGKNINPKDNHISFQCENMAIVERRLKEMKIDYVKSRVEEGGINVD  120

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            QLFFHDPDG MIEICNCD LPV+PL+G+ +R
Sbjct  121  QLFFHDPDGSMIEICNCDVLPVVPLAGDAVR  151



>ref|XP_002285087.1| PREDICTED: uncharacterized protein LOC100244070 [Vitis vinifera]
 emb|CAN63501.1| hypothetical protein VITISV_011676 [Vitis vinifera]
 emb|CBI28173.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            M+   ENPLRLKS+NHIS+VC SVEKSLDFYQ VLGFF IRRPGSFDF GAWL+NYG+GI
Sbjct  1    MEGRAENPLRLKSVNHISLVCRSVEKSLDFYQKVLGFFSIRRPGSFDFDGAWLYNYGMGI  60

Query  224  HLLQADD--NLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQ++D  N+PK++  INPKDNHISFQCESMA VEK+LKEM+IEYV+ RVEEGG+ VDQ
Sbjct  61   HLLQSEDPDNMPKISQQINPKDNHISFQCESMATVEKKLKEMKIEYVQSRVEEGGICVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPL  466
            LFFHDPDG MIEICNCDNLPVIPL
Sbjct  121  LFFHDPDGSMIEICNCDNLPVIPL  144



>ref|XP_004135860.1| PREDICTED: uncharacterized protein LOC101209593 [Cucumis sativus]
 ref|XP_004158775.1| PREDICTED: uncharacterized LOC101209593 [Cucumis sativus]
 gb|KGN45284.1| Lactoylglutathione lyase [Cucumis sativus]
Length=169

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+  NPL LKS+NHIS++C SVE+S+ FYQN+LGFFPIRRPGSF F GAWLF YGIGI
Sbjct  1    MKESEGNPLHLKSINHISLLCKSVEESIYFYQNILGFFPIRRPGSFKFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  +NLPK   INPKDNHISFQCESM  VEK+LKEMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSEKPENLPKKGKINPKDNHISFQCESMGAVEKKLKEMEIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDNLPVIPLGGEVSR  149



>gb|ACF74315.1| lactoylglutathione lyase [Arachis hypogaea]
Length=181

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+M NPL+LKSLNHIS+VC SVE+S+DFYQNVLGFFPIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKESMGNPLQLKSLNHISLVCRSVEQSMDFYQNVLGFFPIRRPGSFDFDGAWLFGFGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA+D   LPK   INPKDNHISFQCE M  VEK+LKEM+I +V+ RVEEGG+ VDQL
Sbjct  61   HLLQAEDPEKLPKKKEINPKDNHISFQCECMEAVEKKLKEMDINHVRARVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNC+ LPVIPL GE  R
Sbjct  121  FFHDPDGFMVEICNCECLPVIPLVGEVAR  149



>ref|XP_002524466.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF37906.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=193

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 128/140 (91%), Gaps = 2/140 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL+LKSLNHIS+VC S++KS+DFYQ+VLGFFP+RRPGSFDF GAWLFNYGIGIHLLQ++
Sbjct  8    NPLQLKSLNHISVVCRSLKKSIDFYQDVLGFFPVRRPGSFDFDGAWLFNYGIGIHLLQSE  67

Query  242  D--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
            D  N+PK+  INPKDNHISFQCESMA VEKRL+EM++E VK RVEEGG++VDQLFFHDPD
Sbjct  68   DPENMPKINQINPKDNHISFQCESMATVEKRLQEMKVECVKGRVEEGGIYVDQLFFHDPD  127

Query  416  GMMIEICNCDNLPVIPLSGE  475
            G MIEICNCD LPVIPL G+
Sbjct  128  GSMIEICNCDVLPVIPLGGD  147



>ref|XP_008461098.1| PREDICTED: uncharacterized protein LOC103499788 [Cucumis melo]
Length=169

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+  NPL LKS+NHIS++C SVE+S++FYQN+LGFFPIRRPGSF F GAWLF YGIGI
Sbjct  1    MKESEGNPLHLKSINHISLLCRSVEESIEFYQNILGFFPIRRPGSFKFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  +NLPK   INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLQSEKPENLPKKGEINPKDNHISFQCESMGAVEKKLKEMEIDYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPVIPL GE  R
Sbjct  121  FFHDPDGFMIEICNCDNLPVIPLGGEVSR  149



>emb|CDO98135.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   237 bits (604),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK NM NPL L SLNHIS++C SV KS+DFY +VLGF P+RRPGSF+F GAWLF+YGIGI
Sbjct  1    MKGNMANPLHLTSLNHISLICKSVGKSMDFYTSVLGFVPVRRPGSFNFDGAWLFSYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA+  D++P+ T INPKDNHISFQC+SMA VEK L EMEI+Y + RVEEGG++VDQL
Sbjct  61   HLLQAENPDDMPEKTVINPKDNHISFQCDSMAAVEKMLAEMEIKYARQRVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPVIPL+GE +R
Sbjct  121  FFHDPDGFMIEICNCDNLPVIPLAGEMIR  149



>ref|XP_007154988.1| hypothetical protein PHAVU_003G163400g [Phaseolus vulgaris]
 gb|ESW26982.1| hypothetical protein PHAVU_003G163400g [Phaseolus vulgaris]
Length=167

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHISIVC+S+EKS++FY NVLGF PI+RP S DF GAWLFNYGIGIHLLQ
Sbjct  1    MSNPLQLKSLNHISIVCASLEKSVEFYVNVLGFSPIQRPSSLDFNGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D   +PK T INPKDNHISFQCES+A VEKRLK+MEIEYVK RVEE G++VDQLFFHD
Sbjct  61   SEDPRGMPKTTPINPKDNHISFQCESIAAVEKRLKQMEIEYVKSRVEESGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTC  505
            PDGMMIEICNCDN+PV+PLS + +   +   C
Sbjct  121  PDGMMIEICNCDNIPVVPLSEDKVWSCSRFNC  152



>ref|XP_010061928.1| PREDICTED: uncharacterized protein LOC104449460 [Eucalyptus grandis]
 gb|KCW68974.1| hypothetical protein EUGRSUZ_F02538 [Eucalyptus grandis]
Length=167

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL LKSLNHIS VC S E+S++FYQNVLGF PIRRPGSFDF GAWLF +G+GIHLL+A+
Sbjct  4    NPLHLKSLNHISFVCRSAEESINFYQNVLGFVPIRRPGSFDFDGAWLFGFGVGIHLLEAE  63

Query  242  D--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
            D  N+PK T INPKDNHISFQCESM  VEK+LKEMEIEYV+  VEEGG+ VDQLFFHDPD
Sbjct  64   DPENMPKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRATVEEGGIQVDQLFFHDPD  123

Query  416  GMMIEICNCDNLPVIPLSGEPLR  484
            G MIEICNCD+LPVIPL+GE  R
Sbjct  124  GFMIEICNCDSLPVIPLAGEVAR  146



>ref|XP_004287346.1| PREDICTED: metallothiol transferase FosB-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=201

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 132/165 (80%), Gaps = 9/165 (5%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE   NPL+LKSLNHIS+VC S+EKSLDFYQNVLGFFP+RRP S DF GAWLFNYGIGI
Sbjct  1    MKERTGNPLQLKSLNHISLVCRSLEKSLDFYQNVLGFFPVRRPDSLDFNGAWLFNYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISF------QCESMAMVEKRLKEMEIEYVKCRVEEGG  379
            HLLQA+D   LPK+++INPKDNHISF      QCESM  VE +LKEM IEYV   VEEGG
Sbjct  61   HLLQAEDPETLPKISHINPKDNHISFQNDINLQCESMIRVENKLKEMGIEYVTSSVEEGG  120

Query  380  VHVDQLFFHDPDGMMIEICNCDNLPVIPLSG-EPLRPPAGLTCTM  511
            ++VDQLFFHDPDG MIEICNCDNLPVIPL G + LR    + C +
Sbjct  121  INVDQLFFHDPDGTMIEICNCDNLPVIPLVGDQTLRSCTRVKCNV  165



>ref|XP_008242749.1| PREDICTED: uncharacterized protein LOC103341047 [Prunus mume]
Length=208

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L LKSLN IS+VC SVEKSLDFYQ+VLGFFPIRRPGSFDF GAWLFN GIGIH LQ++D 
Sbjct  58   LNLKSLNPISLVCRSVEKSLDFYQSVLGFFPIRRPGSFDFNGAWLFNCGIGIHRLQSEDP  117

Query  245  -NLPK-VTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
              +PK +  INPKDNHISFQCESM  VEK LKEMEIEYVK RVEEGG++VDQLFFHDPD 
Sbjct  118  DKMPKKIAQINPKDNHISFQCESMVTVEKNLKEMEIEYVKRRVEEGGIYVDQLFFHDPDA  177

Query  419  MMIEICNCDNLPVIPLSGEPLRPPAGLTCT  508
             MIEICNCDNLPVIPL+GEP+RP   + C 
Sbjct  178  TMIEICNCDNLPVIPLAGEPVRPCTCVNCN  207



>gb|EYU21620.1| hypothetical protein MIMGU_mgv1a014857mg [Erythranthe guttata]
Length=176

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN +NPL L SLNHIS+VC SV++S DFYQNVLGF P+RRPGS  F GAWLF +GIGI
Sbjct  1    MKENKDNPLHLSSLNHISLVCKSVDESTDFYQNVLGFVPVRRPGSLKFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK T INPKDNHISFQCESM MVEK+L EM I++V+ RVEEGG++VDQL
Sbjct  61   HLLQSEDPQNMPKKTVINPKDNHISFQCESMGMVEKKLTEMGIDWVRQRVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDN+P++PL+GE +R
Sbjct  121  FFHDPDGFMIEICNCDNMPIVPLAGEMVR  149



>ref|XP_010691164.1| PREDICTED: uncharacterized protein LOC104904575 [Beta vulgaris 
subsp. vulgaris]
Length=171

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE   NPL LKS+NHIS++C SVE+S++FYQ+VLGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKEIQGNPLHLKSINHISLLCRSVEESINFYQDVLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA +   LP+ T INPKDNHISFQCESM  VEK+L++M I++V+ RVEEGG++VDQL
Sbjct  61   HLLQAAEPEKLPQKTEINPKDNHISFQCESMGAVEKKLRDMGIKHVRARVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEIC+CDNLPVIPL+GE +R
Sbjct  121  FFHDPDGFMIEICDCDNLPVIPLAGEMVR  149



>gb|AFK41458.1| unknown [Lotus japonicus]
 gb|AFK49461.1| unknown [Lotus japonicus]
Length=172

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK+++ NPL LKS+NHIS++C SVE+S+ FYQ+VLGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKDSVGNPLHLKSVNHISLICRSVEESMAFYQDVLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A+  + LP+   INPKDNHISFQCESM  VEK+LK+MEI YV+  VEEGG+ VDQL
Sbjct  61   HLLEAENPEKLPRKKEINPKDNHISFQCESMGAVEKKLKDMEIAYVRATVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAGELAR  149



>gb|KFK42418.1| hypothetical protein AALP_AA2G253600 [Arabis alpina]
Length=170

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S+ FYQNVLGF PIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESMSFYQNVLGFLPIRRPGSFDFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKEMEIE+V+  VEEGG+ VDQL
Sbjct  61   HLLQSPEPEKLLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEHVRAAVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAGEMAR  149



>gb|KHN15103.1| hypothetical protein glysoja_011721 [Glycine soja]
Length=161

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHISIVC+SVEKS+DFY NVLGF PI+RP S DF GAWLFNYGIGIHLLQ
Sbjct  1    MANPLQLKSLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLDFNGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D   +PK+  INPKDNHISFQCES+A VEKRL++M+IEYVK RVEE G+ VDQLFFHD
Sbjct  61   SEDPEGMPKLVPINPKDNHISFQCESIAAVEKRLQQMKIEYVKNRVEESGIFVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            PDGMMIEICNCDN+PV+PL  + +   +   C +
Sbjct  121  PDGMMIEICNCDNIPVVPLPEDKVWSCSRFNCNI  154



>ref|XP_010430002.1| PREDICTED: uncharacterized protein LOC104714363 isoform X2 [Camelina 
sativa]
Length=158

 Score =   231 bits (590),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKENM NPL +KSLNHIS++C SVE+S+ FY NVLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENMGNPLHIKSLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFDFDGAWLFGHGMGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K + INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLQSSEPEKLLKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRP  487
            FFHDPDG MIEICNCD+LPV+PL+GE ++P
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMVQP  150



>ref|XP_006302910.1| hypothetical protein CARUB_v10021045mg [Capsella rubella]
 gb|EOA35808.1| hypothetical protein CARUB_v10021045mg [Capsella rubella]
Length=171

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL++KSLNHIS++C SVE+S+ FY NVLGF PIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKENTGNPLQIKSLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFDFDGAWLFGHGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+   D L K + INPKDNHISFQCESM  VE++LKEMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSPEPDKLVKKSEINPKDNHISFQCESMEAVERKLKEMEIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPVIPL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVIPLAGEIAR  149



>ref|NP_001236449.1| uncharacterized protein LOC100305770 [Glycine max]
 gb|ACU13626.1| unknown [Glycine max]
Length=163

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHISIVC+SVEKS+DFY NVLGF PI+RP S DF GAWLFNYGIGIHLLQ
Sbjct  1    MANPLQLKSLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLDFNGAWLFNYGIGIHLLQ  60

Query  236  AD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++  + +PK   INPKDNHISFQCES+A VEKRL++++IEYVK RVEE G +VDQLFFHD
Sbjct  61   SENPEGMPKTAPINPKDNHISFQCESIAAVEKRLQQVKIEYVKNRVEESGTYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            PDGMMIEICNCDN+PV+PL+ + +   +   C +
Sbjct  121  PDGMMIEICNCDNIPVVPLTEDKVWSCSRFNCNI  154



>ref|XP_006593342.1| PREDICTED: uncharacterized protein LOC100305770 isoform X1 [Glycine 
max]
Length=167

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHISIVC+SVEKS+DFY NVLGF PI+RP S DF GAWLFNYGIGIHLLQ
Sbjct  1    MANPLQLKSLNHISIVCASVEKSVDFYVNVLGFSPIKRPSSLDFNGAWLFNYGIGIHLLQ  60

Query  236  AD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++  + +PK   INPKDNHISFQCES+A VEKRL++M+IEYVK RVEE G +VDQLFFHD
Sbjct  61   SENPEGMPKTAPINPKDNHISFQCESIAAVEKRLQQMKIEYVKNRVEESGTYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTC  505
            PDGMMIEICNCDN+PV+PL+ + +   +   C
Sbjct  121  PDGMMIEICNCDNIPVVPLTEDKVWSCSRFNC  152



>emb|CDY37573.1| BnaA02g19970D [Brassica napus]
Length=167

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S++FYQ+VLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFDFDGAWLFGHGVGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKEM IEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSTEPEKLLKKTEINPKDNHISFQCESMGAVEKKLKEMGIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>emb|CAN75608.1| hypothetical protein VITISV_040444 [Vitis vinifera]
Length=169

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE + NPL L SLNHIS+VCSSVE+S++FYQNVLGF PIRRP SFDF GAWLF+YGIGI
Sbjct  1    MKEIVGNPLHLTSLNHISLVCSSVEESINFYQNVLGFVPIRRPDSFDFNGAWLFSYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+DD   +PK   INPKDNHISFQCESM+ VEK+LKEM +EY + +V EGG+ VDQL
Sbjct  61   HLLQSDDPEKMPKKKEINPKDNHISFQCESMSAVEKKLKEMGMEYTRQKVVEGGIEVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M EICNCDNLPVIPL+G+ +R
Sbjct  121  FFHDPDGFMXEICNCDNLPVIPLAGQMIR  149



>ref|XP_009402147.1| PREDICTED: uncharacterized protein LOC103986010 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE+SLDFYQNVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  9    LPLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFDFTGAWLFNYGIGIHLLQSEDP  68

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
              +P+   INPKDNHISFQCES++MVE +LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  69   EKMPRKKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEGGIYVDQLFFHDPDGF  128

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNCDNLPVI LSGEP+
Sbjct  129  MIEICNCDNLPVISLSGEPI  148



>ref|XP_010472977.1| PREDICTED: uncharacterized protein LOC104752515 [Camelina sativa]
 ref|XP_010472978.1| PREDICTED: uncharacterized protein LOC104752515 [Camelina sativa]
Length=170

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKENM NPL +KSLNHIS++C SVE+S+ FY NVLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENMGNPLHIKSLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFDFDGAWLFGHGMGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K + INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLQSSEPEKLLKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_009128447.1| PREDICTED: uncharacterized protein LOC103853278 [Brassica rapa]
Length=167

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S+ FYQ+VLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESMSFYQHVLGFLPIRRPGSFDFDGAWLFGHGVGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKEM IEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSTEPEKLLKKTEINPKDNHISFQCESMGAVEKKLKEMGIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_010049979.1| PREDICTED: uncharacterized protein LOC104438513 [Eucalyptus grandis]
 gb|KCW82814.1| hypothetical protein EUGRSUZ_C04185 [Eucalyptus grandis]
Length=170

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 3/155 (2%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL+LKSLNHIS+VC S+EKS+ FYQNVLGF PIRRPGSFDF GAWL NYG+GIHLLQ
Sbjct  1    MENPLQLKSLNHISLVCRSLEKSISFYQNVLGFVPIRRPGSFDFEGAWLLNYGVGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
             +D   +P V  INPKDNHISFQ ESMA VEK+L+EMEIEYVK  VEEGG++VDQ+FFHD
Sbjct  61   TEDPHQMPAVGGINPKDNHISFQSESMATVEKKLEEMEIEYVKSSVEEGGIYVDQIFFHD  120

Query  410  PDGMMIEICNCDNLPVIPL-SGEPLRPPAGLTCTM  511
            PDG MIEICNC+NLPV+ L  G P+   + + C +
Sbjct  121  PDGSMIEICNCNNLPVVALDDGAPVLQCSRINCNL  155



>ref|XP_009402148.1| PREDICTED: uncharacterized protein LOC103986012 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402149.1| PREDICTED: uncharacterized protein LOC103986014 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE+SLDFYQNVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  9    LPLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFDFTGAWLFNYGIGIHLLQSEDP  68

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
              +P+   INPKDNHISFQCES++MVE +LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  69   EKMPRKKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEGGIYVDQLFFHDPDGF  128

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNCDNLPVI LSGEP+
Sbjct  129  MIEICNCDNLPVISLSGEPI  148



>ref|XP_010914889.1| PREDICTED: uncharacterized protein LOC105040176 [Elaeis guineensis]
Length=189

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE SLDFYQNVLGF P+RRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  8    LPLTSLNHISLVCRSVEMSLDFYQNVLGFVPVRRPGSFDFDGAWLFNYGIGIHLLQSEDP  67

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             N+PK T INPKD+HISFQCESM +VEK+LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  68   ENMPKKTEINPKDDHISFQCESMTLVEKKLKEMGIPYIQRRVEEGGIYVDQLFFHDPDGF  127

Query  422  MIEICNCDNLPVIPL-SGEPLR  484
            MIEICNCDNLPVIPL  GEP+R
Sbjct  128  MIEICNCDNLPVIPLVVGEPVR  149



>ref|XP_004236038.1| PREDICTED: uncharacterized protein LOC101250492 [Solanum lycopersicum]
Length=178

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK N  NPL L SLNHIS+VC SVEKS++FY+NVLGF P+RRPGSF+F GAWLF+YGIGI
Sbjct  1    MKGNSGNPLALTSLNHISLVCRSVEKSIEFYKNVLGFVPVRRPGSFNFNGAWLFSYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D   +PK T INPKDNHISFQCES+  VEK+L EM I+Y +  VEEGG++VDQL
Sbjct  61   HLLQSEDPEKMPKKTEINPKDNHISFQCESIDAVEKKLTEMGIKYARQLVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCDNLPVIPL+GE  R
Sbjct  121  FFHDPDGFMVEICNCDNLPVIPLAGEIAR  149



>ref|XP_002270395.1| PREDICTED: uncharacterized protein LOC100247488 [Vitis vinifera]
 emb|CBI36287.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE + NPL L SLNHIS+VCSSVE+S++FYQNVLGF PIRRP SFDF GAWLF+YGIGI
Sbjct  1    MKEIVGNPLHLTSLNHISLVCSSVEESINFYQNVLGFVPIRRPDSFDFNGAWLFSYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+D  + +PK   INPKDNHISFQCESM  VEK+LKEM +EY + +V EGG+ VDQL
Sbjct  61   HLLQSDNPEKMPKKKEINPKDNHISFQCESMGAVEKKLKEMGMEYTRQKVVEGGIEVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCDNLPVIPL+G+ +R
Sbjct  121  FFHDPDGFMVEICNCDNLPVIPLAGQMVR  149



>ref|XP_010417742.1| PREDICTED: uncharacterized protein LOC104703428 [Camelina sativa]
 ref|XP_010430000.1| PREDICTED: uncharacterized protein LOC104714363 isoform X1 [Camelina 
sativa]
 ref|XP_010430001.1| PREDICTED: uncharacterized protein LOC104714363 isoform X1 [Camelina 
sativa]
Length=170

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKENM NPL +KSLNHIS++C SVE+S+ FY NVLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENMGNPLHIKSLNHISLLCRSVEESMSFYHNVLGFLPIRRPGSFDFDGAWLFGHGMGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K + INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLQSSEPEKLLKKSEINPKDNHISFQCESMETVEKKLKEMEIKYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_008792059.1| PREDICTED: uncharacterized protein LOC103708766 [Phoenix dactylifera]
Length=186

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE SLDFYQNVLGF P+RRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  8    LPLTSLNHISLVCRSVEMSLDFYQNVLGFVPVRRPGSFDFDGAWLFNYGIGIHLLQSEDP  67

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             N+P+ T INPKD+HISFQCESMA+VEK+LKEM I Y++ RVEE G++VDQLFFHDPDG 
Sbjct  68   ENMPRKTEINPKDDHISFQCESMALVEKKLKEMGINYIQRRVEEAGIYVDQLFFHDPDGF  127

Query  422  MIEICNCDNLPVIPL-SGEPLR  484
            MIEICNCDNLPVIPL  GEP+R
Sbjct  128  MIEICNCDNLPVIPLVVGEPVR  149



>ref|XP_009594193.1| PREDICTED: uncharacterized protein LOC104090726 [Nicotiana tomentosiformis]
Length=177

 Score =   229 bits (585),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK +  NPL L SLNHIS+VC SVE+S++FY+NVLGF P+RRPGSF+F GAWLF+YGIGI
Sbjct  1    MKGSTGNPLSLTSLNHISLVCRSVEQSIEFYKNVLGFVPVRRPGSFNFNGAWLFSYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D   +PK T INPKDNHISFQCES+  VEK+L EM I+YV+  VEEGG++VDQL
Sbjct  61   HLLQSEDPEKMPKKTEINPKDNHISFQCESIGAVEKKLTEMGIKYVRQLVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCDNLPVIPL+GE  R
Sbjct  121  FFHDPDGFMVEICNCDNLPVIPLAGEMAR  149



>ref|XP_009402188.1| PREDICTED: uncharacterized protein LOC103986041 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   229 bits (584),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE+SLDFYQNVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  9    LPLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFDFTGAWLFNYGIGIHLLQSEDP  68

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
              +P+   INPKDNHISFQCES+++VE +LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  69   EKMPRKREINPKDNHISFQCESLSLVEGKLKEMGIPYIQRRVEEGGIYVDQLFFHDPDGF  128

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNCDNLPVI LSGEP+
Sbjct  129  MIEICNCDNLPVISLSGEPI  148



>gb|AAD55473.1|AC009322_13 Hypothetical protein [Arabidopsis thaliana]
Length=208

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = +2

Query  35   QEKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYG  214
            +EKMK+   NPL +KSLNHIS++C SVE+S+ FYQNVLGF PIRRP SFDF GAWLF +G
Sbjct  39   KEKMKDETGNPLHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHG  98

Query  215  IGIHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHV  388
            IGIHLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKEMEIEYV+  VEEGG+ V
Sbjct  99   IGIHLLQSPEPEKLLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQV  158

Query  389  DQLFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGL  499
            DQLFFHDPD  MIEICNCD+LPVIPL+GE  R  + L
Sbjct  159  DQLFFHDPDAFMIEICNCDSLPVIPLAGEMARSCSRL  195



>emb|CDY71329.1| BnaC02g46640D [Brassica napus]
Length=167

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S++FYQ+VLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFDFDGAWLFGHGVGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+L EM IEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSTEPEKLLKKTEINPKDNHISFQCESMGAVEKKLNEMGIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_011072230.1| PREDICTED: uncharacterized protein LOC105157526 [Sesamum indicum]
Length=172

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNHIS+VC SV++S  FY NVLGF P+RRPGSF+F GAWLF +GIGI
Sbjct  1    MKENKGNPLHLSSLNHISLVCQSVDQSTHFYHNVLGFMPVRRPGSFNFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  +LPK T INPKDNHISFQCE+M MVEK+L EM I++V+ RVEEGG++VDQL
Sbjct  61   HLLQSEDPESLPKKTVINPKDNHISFQCENMGMVEKKLTEMGIDWVRQRVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDN+PVIPL GE +R
Sbjct  121  FFHDPDGFMIEICNCDNIPVIPLPGEMVR  149



>ref|XP_009802082.1| PREDICTED: uncharacterized protein LOC104247701 [Nicotiana sylvestris]
Length=177

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK N  NPL L SLNHIS+VC SVE+S++FY+N+LGF P+RRPGSF+F GAWLF+YGIGI
Sbjct  1    MKGNTGNPLALTSLNHISLVCRSVEQSIEFYKNILGFVPVRRPGSFNFNGAWLFSYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D   +PK T INPKDNHISFQCES+  VEK+L EM I+Y +  VEEGG++VDQL
Sbjct  61   HLLQSEDPEKMPKKTEINPKDNHISFQCESIDAVEKKLTEMGIKYARQLVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCDNLPVIPL+GE  R
Sbjct  121  FFHDPDGFMVEICNCDNLPVIPLAGEMAR  149



>ref|XP_009407659.1| PREDICTED: uncharacterized protein LOC103990300 [Musa acuminata 
subsp. malaccensis]
Length=179

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC S+ +SLDFYQNVLGF P+RRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  9    LPLASLNHISVVCRSLVRSLDFYQNVLGFLPVRRPGSFDFDGAWLFNYGIGIHLLQSEDP  68

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             N+PK   INPKDNHISFQCES+A+VEK+LKEM I Y++  VEEGG++VDQLFFHDPDG 
Sbjct  69   ENMPKKREINPKDNHISFQCESLALVEKQLKEMGIPYIQSGVEEGGIYVDQLFFHDPDGF  128

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNCDNLPVI LSGEP+
Sbjct  129  MIEICNCDNLPVISLSGEPI  148



>ref|XP_006364200.1| PREDICTED: uncharacterized protein LOC102594644 [Solanum tuberosum]
Length=178

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK N  NPL L SLNHIS+VC SVEKS++FY+NVLGF P+RRPGSF+F GAWLF+YGIGI
Sbjct  1    MKGNTGNPLALTSLNHISLVCRSVEKSIEFYKNVLGFVPVRRPGSFNFNGAWLFSYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D   + K T INPKDNHISFQCES+  VEK+L EM I+Y +  VEEGG++VDQL
Sbjct  61   HLLQSEDPEEMQKKTEINPKDNHISFQCESIDAVEKKLTEMGIKYARHLVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCDNLPVIPL+GE  R
Sbjct  121  FFHDPDGFMVEICNCDNLPVIPLAGEMAR  149



>gb|KHG26581.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=169

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK + ENPL LKSLNHIS+VC SVE+S++FYQ  LGF PIRRPGSFDF GAWLF YG GI
Sbjct  1    MKGSAENPLHLKSLNHISLVCRSVEESINFYQKTLGFVPIRRPGSFDFNGAWLFGYGFGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  NLPK   INPKDNHISFQCE+M  VE +LKEME+EY +  VEEGG+ V+QL
Sbjct  61   HLLQSEDPDNLPKKWKINPKDNHISFQCENMGCVENKLKEMEMEYERAIVEEGGICVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDNLPVVPLAGEMAR  149



>ref|XP_006389762.1| hypothetical protein EUTSA_v10019227mg [Eutrema salsugineum]
 gb|ESQ27048.1| hypothetical protein EUTSA_v10019227mg [Eutrema salsugineum]
Length=168

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE   NPL +KSLNHIS++C SVE+S+ FYQNVLGF PIRRPGSFDF GAWLF +GIGI
Sbjct  1    MKETTGNPLHIKSLNHISLLCRSVEESMSFYQNVLGFLPIRRPGSFDFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCE+M  VEK+LKEMEIE V+  VEEGG+ VDQL
Sbjct  61   HLLQSPEPEKLLKKTEINPKDNHISFQCENMEAVEKKLKEMEIENVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_010033948.1| PREDICTED: uncharacterized protein LOC104423170 [Eucalyptus grandis]
 gb|KCW53813.1| hypothetical protein EUGRSUZ_J03055 [Eucalyptus grandis]
Length=174

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +2

Query  44   MKEN-MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            MKE+ ++NPL L SLNHIS+VC S+E+S++FYQNVLGF PIRRPGSFDF GAWLF +GIG
Sbjct  1    MKESSLQNPLHLTSLNHISLVCRSLEESMNFYQNVLGFVPIRRPGSFDFDGAWLFGHGIG  60

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            +HLLQ++D   +PK + INPKDNHISFQCESM  VEK+LKEM ++YV+  VEEGG+ V+Q
Sbjct  61   MHLLQSEDPEKMPKKSEINPKDNHISFQCESMEAVEKKLKEMGMDYVRAAVEEGGIQVEQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNCD+LPVIPL+GE  R
Sbjct  121  LFFHDPDGFMIEICNCDSLPVIPLAGEMAR  150



>emb|CDY38650.1| BnaC02g23290D [Brassica napus]
Length=167

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL LKSLNHIS++C SVE+S++FYQ+VLGF PIRRPGSFDF GAWLF +G+GI
Sbjct  1    MKENTGNPLHLKSLNHISLLCRSVEESMNFYQHVLGFLPIRRPGSFDFDGAWLFGHGVGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+L EM IEYV+   EEGG+ VDQL
Sbjct  61   HLLQSTEPEKLLKKTEINPKDNHISFQCESMGAVEKKLNEMGIEYVRAVGEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL+GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAGEMAR  149



>ref|XP_009403405.1| PREDICTED: uncharacterized protein LOC103986970 [Musa acuminata 
subsp. malaccensis]
Length=254

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SVE SLDFYQNVLGF PIRRPGSF F GAWLFNYGIGIHLLQ++D 
Sbjct  83   LPLASLNHISIVCRSVETSLDFYQNVLGFLPIRRPGSFKFDGAWLFNYGIGIHLLQSEDP  142

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
              +P+   INPKDNHISFQCES+A+VEK+LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  143  EKMPRKREINPKDNHISFQCESLALVEKKLKEMVIPYIQNRVEEGGIYVDQLFFHDPDGF  202

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNC+NLPVI LSGEP+
Sbjct  203  MIEICNCENLPVISLSGEPI  222



>ref|NP_565231.1| GLYOXYLASE I 7 [Arabidopsis thaliana]
 gb|AAM63332.1| unknown [Arabidopsis thaliana]
 gb|ACF88486.1| At1g80160 [Arabidopsis thaliana]
 dbj|BAH19863.1| AT1G80160 [Arabidopsis thaliana]
 gb|AEE36364.1| GLYOXYLASE I 7 [Arabidopsis thaliana]
Length=167

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK+   NPL +KSLNHIS++C SVE+S+ FYQNVLGF PIRRP SFDF GAWLF +GIGI
Sbjct  1    MKDETGNPLHIKSLNHISLLCRSVEESISFYQNVLGFLPIRRPDSFDFDGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKEMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLQSPEPEKLLKKTEINPKDNHISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPD  MIEICNCD+LPVIPL+GE  R
Sbjct  121  FFHDPDAFMIEICNCDSLPVIPLAGEMAR  149



>ref|XP_006450973.1| hypothetical protein CICLE_v10010755mg, partial [Citrus clementina]
 gb|ESR64213.1| hypothetical protein CICLE_v10010755mg, partial [Citrus clementina]
Length=164

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 17/160 (11%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAW------------  199
            M+NPL LKSLNH S+VC SVEKSLDFYQNV+GF PIRRPGSFDF GAW            
Sbjct  1    MQNPLSLKSLNHFSLVCRSVEKSLDFYQNVIGFLPIRRPGSFDFHGAWKCINITVINIDE  60

Query  200  --LFNYGIGIHLLQADD--NLPKVTNI-NPKDNHISFQCESMAMVEKRLKEMEIEYVKCR  364
              LFNYGIGIHLL+ +D   +P ++ I NPKDNHISFQCE+MA VE++L EM+IEYVK R
Sbjct  61   FRLFNYGIGIHLLKCEDPDRMPSISKIINPKDNHISFQCENMATVERKLTEMKIEYVKSR  120

Query  365  VEEGGVHVDQLFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            VEEGG++VDQ+FFHDPDG MIEICNCD LPV+PL+G+ +R
Sbjct  121  VEEGGIYVDQVFFHDPDGSMIEICNCDVLPVVPLAGDTIR  160



>ref|XP_002298106.2| hypothetical protein POPTR_0001s17160g [Populus trichocarpa]
 gb|EEE82911.2| hypothetical protein POPTR_0001s17160g [Populus trichocarpa]
Length=225

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +2

Query  41   KMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            +MK++M N L LKSLNHIS++C SV +S+DFYQ+VLGF PIRRPGSF+F GAWLF +GIG
Sbjct  53   RMKDHMGNSLHLKSLNHISLLCRSVVESIDFYQDVLGFVPIRRPGSFNFDGAWLFGFGIG  112

Query  221  IHLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLLQ++  + +PK + INPKDNHISFQCESM  VEK+LKE+ I++V+  VEEGG+ V+Q
Sbjct  113  IHLLQSENPEKMPKKSEINPKDNHISFQCESMGAVEKKLKELGIQHVRALVEEGGIQVEQ  172

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNCDNLPVIPL+GE  R
Sbjct  173  LFFHDPDGFMIEICNCDNLPVIPLAGEVAR  202



>ref|XP_007200863.1| hypothetical protein PRUPE_ppa027137mg [Prunus persica]
 gb|EMJ02062.1| hypothetical protein PRUPE_ppa027137mg [Prunus persica]
Length=166

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 7/140 (5%)
 Frame = +2

Query  56   MENP----LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            ME+P    L LKSLNHIS+VC SVEKSLDFYQ+VLGFFPIRRPGSFDF GAWLFNYGIGI
Sbjct  1    MESPTVTMLNLKSLNHISLVCRSVEKSLDFYQSVLGFFPIRRPGSFDFIGAWLFNYGIGI  60

Query  224  HLLQADD--NLPK-VTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQ++D   +PK +T I PKDNHISFQCESM  VEK LKEMEIEYVK RVE+GG++VDQ
Sbjct  61   HLLQSEDPDKMPKKITQIKPKDNHISFQCESMVTVEKNLKEMEIEYVKRRVEKGGIYVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLP  454
            LFFHDPD  MIEICNCDNLP
Sbjct  121  LFFHDPDATMIEICNCDNLP  140



>ref|XP_002270473.1| PREDICTED: uncharacterized protein LOC100242353 [Vitis vinifera]
 emb|CBI36286.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK ++ NPL L SLNHIS+VC SV +S+DFYQN LGF PIRRPGSFDF GAWLF+YG+GI
Sbjct  1    MKGDLGNPLHLTSLNHISLVCKSVPESIDFYQNTLGFVPIRRPGSFDFDGAWLFSYGLGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+PK T INPKDNHISFQCES+  VEK LKEMEI YV+ +V EGG  VDQL
Sbjct  61   HLLQSEDPENMPKKTEINPKDNHISFQCESIDAVEKNLKEMEIHYVRKKVTEGGFEVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPL  466
            FFHDPDG MIEICNCDN+P++PL
Sbjct  121  FFHDPDGFMIEICNCDNIPIVPL  143



>emb|CDY39639.1| BnaC05g11680D [Brassica napus]
Length=174

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S+ FYQ VLGFFPIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSIEESMVFYQTVLGFFPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM+ VEK+L+EMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLRSSEPEKLPKKTEINPKDNHISFQCESMSAVEKKLEEMEIEYVRAIVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>ref|XP_009388525.1| PREDICTED: uncharacterized protein LOC103975318 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SVE+SLDFY NVLGF P+RRP SFDF GAWLFNYGIGIHLLQ++D 
Sbjct  9    LPLASLNHISIVCRSVERSLDFYHNVLGFLPVRRPVSFDFDGAWLFNYGIGIHLLQSEDP  68

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             N+P    INPKDNHISFQCES+A+VEK+L+EM I Y++ RVEEGG++VDQ+FFHDPDG 
Sbjct  69   ENMPTKREINPKDNHISFQCESLALVEKKLREMGIPYIQSRVEEGGIYVDQMFFHDPDGF  128

Query  422  MIEICNCDNLPVIPLSGE  475
            MIEICNC+NLPVI LSGE
Sbjct  129  MIEICNCENLPVISLSGE  146



>gb|AFK37770.1| unknown [Lotus japonicus]
Length=169

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHIS+VC SVEKS+DFY NVLGF PI+RP S DF GAWLFNYGIGIHLLQ
Sbjct  1    MANPLQLKSLNHISLVCGSVEKSVDFYVNVLGFIPIKRPSSLDFNGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++D   +PK  +INPKDNHISFQCE++A VE +L++++IEYVK +VEE G++VDQLFFHD
Sbjct  61   SNDPEGMPKHAHINPKDNHISFQCENIAAVENKLQQLKIEYVKSKVEESGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAGLTC  505
            PDG MIEICNCD++PV+PLS + +   +   C
Sbjct  121  PDGSMIEICNCDSIPVVPLSEDKVWSCSRFNC  152



>ref|XP_009148927.1| PREDICTED: uncharacterized protein LOC103872329 [Brassica rapa]
 emb|CDY36553.1| BnaA06g10060D [Brassica napus]
Length=174

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S+ FYQ VLGFFPIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSIEESMVFYQTVLGFFPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM+ VEK+L+EMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLRSSEPEKLPKKTEINPKDNHISFQCESMSAVEKKLEEMEIEYVRAIVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLIG  145



>ref|XP_008465032.1| PREDICTED: uncharacterized protein LOC103502748 [Cucumis melo]
Length=195

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL LKS+NHISIVC+SVEKSL+FYQ +LGF+P++RP SF F GAWL+NYG+GIHLLQ+D
Sbjct  4    NPLLLKSMNHISIVCNSVEKSLEFYQKILGFYPVKRPASFTFHGAWLYNYGMGIHLLQSD  63

Query  242  --DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
              DN+PK   INPKDNH+SFQ E+M   EK+LKEM IEYVKC VE+ G+ VDQLFFHDPD
Sbjct  64   EPDNIPKKRIINPKDNHLSFQSENMETTEKQLKEMRIEYVKCEVEDEGIFVDQLFFHDPD  123

Query  416  GMMIEICNCDNLPVIPLSG  472
            G+MIEICNC+NLPV+P SG
Sbjct  124  GLMIEICNCENLPVVPASG  142



>ref|XP_004151211.1| PREDICTED: uncharacterized protein LOC101203188 [Cucumis sativus]
 ref|XP_004171438.1| PREDICTED: uncharacterized protein LOC101223914 [Cucumis sativus]
Length=194

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL LKS+NHISIVC+SVEKSL+FYQ VLGF+P++RP SF F GAWL++YG+GIHLLQ+D
Sbjct  4    NPLLLKSMNHISIVCNSVEKSLEFYQKVLGFYPVKRPASFTFHGAWLYSYGMGIHLLQSD  63

Query  242  --DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
              DN+PK   INPKDNH+SFQ E+M+  EK+LKEM IEYVKC VE+ G+ VDQLFFHDPD
Sbjct  64   EPDNIPKKRVINPKDNHLSFQSENMSTTEKQLKEMRIEYVKCEVEDEGIFVDQLFFHDPD  123

Query  416  GMMIEICNCDNLPVIPLSG  472
            G+MIEICNC+NLP++P+SG
Sbjct  124  GLMIEICNCENLPILPVSG  142



>ref|XP_002889306.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65565.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = +2

Query  44   MKENME-NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            MKE+   NPL +KSLNHIS++C SVE+S+ FY NVLGF PIRRPGSFDF GAWLF +GIG
Sbjct  1    MKEDTTGNPLHIKSLNHISLLCRSVEESISFYHNVLGFLPIRRPGSFDFDGAWLFGHGIG  60

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLLQ+ +   L K T INPKDNHISFQCESM  VEK+LKE+EI+YV+  VEEGG+ VDQ
Sbjct  61   IHLLQSPEPEKLLKKTEINPKDNHISFQCESMEAVEKKLKELEIKYVRAVVEEGGIQVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPD  MIEICNCD+LPV+PL+GE  R
Sbjct  121  LFFHDPDAFMIEICNCDSLPVVPLAGEMAR  150



>ref|XP_004960819.1| PREDICTED: uncharacterized protein LOC101757142 [Setaria italica]
Length=206

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SVE+SL FY +VLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  15   LPLASLNHISIVCRSVEESLSFYTDVLGFVPIRRPGSFDFDGAWLFNYGIGIHLLQSEDP  74

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             +LP+   INPKDNHISFQCESMA VE+RLKEM I YV+  VEEGG++VDQ+FFHDPDG 
Sbjct  75   GSLPEKREINPKDNHISFQCESMAAVERRLKEMGIPYVQRCVEEGGINVDQIFFHDPDGF  134

Query  422  MIEICNCDNLPVIPLSGEPLRPPAG  496
            MIEICNCDNLPVIPL+G    P  G
Sbjct  135  MIEICNCDNLPVIPLAGGDRAPVLG  159



>ref|XP_011035678.1| PREDICTED: uncharacterized protein LOC105133400 [Populus euphratica]
Length=172

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK+++ N L LKSLNHIS++C SVE+S+DFYQ+VLGF PIRRPGSF+F GAWLF +GIGI
Sbjct  1    MKDHIGNSLHLKSLNHISLLCRSVEESIDFYQDVLGFVPIRRPGSFNFDGAWLFGFGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  + +PK + INPKDNHISFQC SMA VEK+LK++ I++V+  VEEGG+ V+QL
Sbjct  61   HLLQSENPEKMPKKSEINPKDNHISFQCGSMAAVEKKLKDLGIQHVRALVEEGGIQVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCDNLPVIPL+G+  R
Sbjct  121  FFHDPDGFMIEICNCDNLPVIPLAGDVAR  149



>ref|XP_009110487.1| PREDICTED: uncharacterized protein LOC103836030 [Brassica rapa]
Length=174

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S++FYQ VLGFFPIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSIEESMNFYQKVLGFFPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A +   LPK   INPKDNHISFQCESM  VEK+L EMEI+YV+ +VEEGG+ VDQL
Sbjct  61   HLLRALELEKLPKKNEINPKDNHISFQCESMGAVEKKLDEMEIDYVRSKVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LP++PL G  +R
Sbjct  121  FFHDPDGFMIEICNCDSLPIVPLVGGMVR  149



>ref|XP_003609290.1| hypothetical protein MTR_4g114080 [Medicago truncatula]
 gb|AES91487.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
 gb|AFK35867.1| unknown [Medicago truncatula]
Length=168

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHIS+VC S++KS+DFY NVLGFFPI+RP S  F GAWLFNYGIGIHLLQ
Sbjct  1    MGNPLQLKSLNHISLVCRSLDKSVDFYVNVLGFFPIKRPTSLAFNGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            +DD  ++ K  +INPKDNHISFQCESMA VE +L++M+IEYVK  VEE G++VDQLFFHD
Sbjct  61   SDDPESMTKNVHINPKDNHISFQCESMAAVENKLQQMKIEYVKNLVEENGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLS  469
            PDG MIEICNCDN+P++PLS
Sbjct  121  PDGTMIEICNCDNIPIVPLS  140



>ref|XP_006427237.1| hypothetical protein CICLE_v10026643mg [Citrus clementina]
 gb|ESR40477.1| hypothetical protein CICLE_v10026643mg [Citrus clementina]
Length=168

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE++ NPL LKS+NH+S+VC ++ +S+DFYQNVLGF PIRRPGSF+F GAWLF +GIGI
Sbjct  1    MKESVGNPLHLKSVNHVSLVCRNISESIDFYQNVLGFVPIRRPGSFNFDGAWLFGHGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  D+LPK + INPKDNH+SFQCES+  VEK LKEM I+YV+  VEEGG+ V+QL
Sbjct  61   HLLQSENPDSLPKKSVINPKDNHLSFQCESVGNVEKFLKEMGIKYVRALVEEGGILVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPA  493
            FFHDPDG MIEIC+CDNLPV+PL G+  R  A
Sbjct  121  FFHDPDGFMIEICDCDNLPVVPLVGDVARSCA  152



>ref|XP_009598365.1| PREDICTED: uncharacterized protein LOC104094188, partial [Nicotiana 
tomentosiformis]
Length=196

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  35   QEKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYG  214
            ++++K N  NPL L SLNHIS+VC SVE+S+DFY+ VLGF P+RRPGSF+F GAWLF +G
Sbjct  15   KKEIKGNTGNPLALTSLNHISLVCRSVEESIDFYKYVLGFVPVRRPGSFNFNGAWLFGHG  74

Query  215  IGIHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHV  388
            IGIHLLQ++D   LPK T INPKDNHISFQCES+  VEK+L EM IEYV+  VEEGG++V
Sbjct  75   IGIHLLQSEDPEKLPKKTEINPKDNHISFQCESIDAVEKKLTEMGIEYVRQLVEEGGIYV  134

Query  389  DQLFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            DQLFFHDPD  M+EICNCD LPVIPL GE  R
Sbjct  135  DQLFFHDPDDFMVEICNCDKLPVIPLVGEMAR  166



>ref|XP_009402190.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Musa acuminata 
subsp. malaccensis]
Length=701

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHIS+VC SVE+SLDFYQNVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  359  LPLASLNHISLVCRSVERSLDFYQNVLGFLPIRRPGSFDFTGAWLFNYGIGIHLLQSEDP  418

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
              +P+   INPKDNHISFQCES++MVE +LKEM I Y++ RVEEGG++VDQLFFHDPDG 
Sbjct  419  EKMPRKKEINPKDNHISFQCESLSMVEGKLKEMGIPYIQRRVEEGGIYVDQLFFHDPDGF  478

Query  422  MIEICNCDNLPVIPLSGEPL  481
            MIEICNCDNLPVI LSGEP+
Sbjct  479  MIEICNCDNLPVISLSGEPI  498



>ref|XP_007150729.1| hypothetical protein PHAVU_005G176100g, partial [Phaseolus vulgaris]
 gb|ESW22723.1| hypothetical protein PHAVU_005G176100g, partial [Phaseolus vulgaris]
Length=214

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +2

Query  38   EKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGI  217
            +KMKE +ENPL LKS+NHIS+VC+SV KS++FYQNVLGFFPIRRPGSFDF GAWLF YGI
Sbjct  33   QKMKEIVENPLHLKSVNHISLVCTSVVKSINFYQNVLGFFPIRRPGSFDFDGAWLFGYGI  92

Query  218  GIHLLQADDN--LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            GIHLLQ ++   +P+   INPKDNHISFQCESM  VEK+L+EME+EYV+  VEEGG+ VD
Sbjct  93   GIHLLQLEEPNVIPRKKEINPKDNHISFQCESMVAVEKKLEEMEMEYVRATVEEGGIKVD  152

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            QLFFHDPDG MIEICNCD+LPVIPL G+ +R  + +   M
Sbjct  153  QLFFHDPDGFMIEICNCDSLPVIPLGGDMVRSCSRVNLQM  192



>gb|EPS59665.1| hypothetical protein M569_15140, partial [Genlisea aurea]
Length=168

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK+N  NPLRL SLNHIS+VC SVE+S DFY  VLGF P++RPGS  F GAWLF +GIGI
Sbjct  4    MKDNKSNPLRLSSLNHISLVCKSVEESADFYHRVLGFIPVKRPGSLKFDGAWLFGHGIGI  63

Query  224  HLLQ--ADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            H++Q  A   + K T I+PKD HISFQCESMA VEK+LK+M I++V+ RVEEGGV+VDQL
Sbjct  64   HIIQSEAPHKMIKKTVIDPKDTHISFQCESMATVEKKLKQMGIDWVRARVEEGGVYVDQL  123

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGE  475
            FFHDPDG MIEICNCDN+PV+PL+GE
Sbjct  124  FFHDPDGFMIEICNCDNIPVVPLAGE  149



>ref|XP_004252486.1| PREDICTED: uncharacterized protein LOC101249440 [Solanum lycopersicum]
Length=173

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK N+ NPL L SLNHIS VC+S+E+S+DFY+N+LGF P+RRP SF+F GAWLF +GIGI
Sbjct  2    MKGNIGNPLGLTSLNHISRVCTSLEESIDFYKNILGFVPVRRPTSFNFNGAWLFGHGIGI  61

Query  224  HLLQADDN--LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ +D+  LPK T INPKDNH+SFQCES+  VEK+L EM IEY+K  VEEGG+HVDQL
Sbjct  62   HLLQLEDSEKLPKKTEINPKDNHMSFQCESIDGVEKKLIEMGIEYIKQLVEEGGIHVDQL  121

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCD LP+IPL G+ +R
Sbjct  122  FFHDPDGFMVEICNCDKLPIIPLVGDMVR  150



>emb|CDX96844.1| BnaA08g23870D [Brassica napus]
Length=174

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S++FYQ VLGFFPIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSIEESMNFYQRVLGFFPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A +   LPK   INPKDNHISFQCESM  VEK+L EMEI+YV+ +VEEGG+ VDQL
Sbjct  61   HLLRALELEKLPKKNEINPKDNHISFQCESMGAVEKKLDEMEIDYVRSKVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LP++PL G  +R
Sbjct  121  FFHDPDGFMIEICNCDSLPIVPLVGGMVR  149



>ref|XP_011040040.1| PREDICTED: uncharacterized protein LOC105136415 [Populus euphratica]
 ref|XP_011015871.1| PREDICTED: uncharacterized protein LOC105119430 [Populus euphratica]
Length=169

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL LKSLNHIS++C S+E+S+DFY++VLGF PIRRPGSF+F GAWLF YGIGIHLLQ
Sbjct  1    MGNPLHLKSLNHISLLCKSLEESIDFYEDVLGFVPIRRPGSFNFDGAWLFGYGIGIHLLQ  60

Query  236  AD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++  + + K   INPKDNHISFQCESMA VEK+LKEM I++V+  VEEGG+ V+QLFFHD
Sbjct  61   SENPEKMQKKGKINPKDNHISFQCESMAAVEKKLKEMGIQHVRALVEEGGIQVEQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGE  475
            PDG MIEIC+CDNLPVIPL+GE
Sbjct  121  PDGFMIEICDCDNLPVIPLAGE  142



>ref|XP_006465353.1| PREDICTED: uncharacterized protein LOC102630180 [Citrus sinensis]
 gb|KDO45231.1| hypothetical protein CISIN_1g030972mg [Citrus sinensis]
Length=168

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+  NPL LKS+NH+S+VC ++ +S+DFYQNVLGF PIRRPGSF+F GAWLF +GIGI
Sbjct  1    MKESAGNPLHLKSVNHVSLVCRNISESIDFYQNVLGFVPIRRPGSFNFDGAWLFGHGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  D+LPK + INPKDNH+SFQCES+  VEK LKEM I+YV+  VEEGG+ V+QL
Sbjct  61   HLLQSENPDSLPKKSVINPKDNHLSFQCESVGNVEKFLKEMGIKYVRALVEEGGILVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPA  493
            FFHDPDG MIEIC+CDNLPV+PL G+  R  A
Sbjct  121  FFHDPDGFMIEICDCDNLPVVPLVGDVARSCA  152



>ref|XP_003568834.1| PREDICTED: uncharacterized protein LOC100821708 [Brachypodium 
distachyon]
 ref|XP_010231663.1| PREDICTED: uncharacterized protein LOC100821708 [Brachypodium 
distachyon]
Length=207

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SVE+SLDFY NVLGF PIRRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  15   LPLASLNHISIVCRSVEESLDFYMNVLGFMPIRRPGSFDFDGAWLFNYGIGIHLLQAEDP  74

Query  245  -NLP-KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
             +LP K   INPKDNHISFQCESM  VE+RLKE+ I Y++  VEEGG++VDQ+FFHDPDG
Sbjct  75   ESLPEKTARINPKDNHISFQCESMVAVERRLKELGIAYIQRCVEEGGIYVDQIFFHDPDG  134

Query  419  MMIEICNCDNLPVIPLS  469
             MIEICNCDNLPV+PL+
Sbjct  135  FMIEICNCDNLPVVPLA  151



>ref|XP_004508519.1| PREDICTED: uncharacterized protein YwkD-like [Cicer arietinum]
Length=168

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL+LKSLNHIS+VC S+EKS+DFY NVLGFFPI+RP S +F GAWLFNYGIGIHLLQ
Sbjct  1    MGNPLQLKSLNHISLVCRSLEKSVDFYVNVLGFFPIKRPTSLNFNGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            +DD   + +  +INPKD+HISFQCESM  VE +L++M+IEYVK RVEE G++VDQLFFHD
Sbjct  61   SDDPEGMTRNLHINPKDSHISFQCESMGAVENKLQQMKIEYVKNRVEENGIYVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLS  469
            PDG MIEICNCDN+PV+PLS
Sbjct  121  PDGSMIEICNCDNIPVVPLS  140



>ref|XP_002303256.2| lactoylglutathione lyase family protein [Populus trichocarpa]
 gb|EEE78235.2| lactoylglutathione lyase family protein [Populus trichocarpa]
Length=169

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M NPL LKSLNHIS++C S+E+S+DFY++VLGF PIRRPGSF+F GAWLF YGIGIHLLQ
Sbjct  1    MGNPLHLKSLNHISLLCKSLEESIDFYEDVLGFVPIRRPGSFNFDGAWLFGYGIGIHLLQ  60

Query  236  AD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            ++  + + K   INPKDNHISFQCESMA VEK+LK+M I++V+  VEEGG+ V+QLFFHD
Sbjct  61   SENPEKMQKKGKINPKDNHISFQCESMAAVEKKLKDMGIQHVRALVEEGGIQVEQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGE  475
            PDG MIEIC+CDNLPVIPL+GE
Sbjct  121  PDGFMIEICDCDNLPVIPLAGE  142



>ref|NP_001054776.1| Os05g0171900 [Oryza sativa Japonica Group]
 gb|AAU44337.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16690.1| Os05g0171900 [Oryza sativa Japonica Group]
 gb|EAY96717.1| hypothetical protein OsI_18636 [Oryza sativa Indica Group]
 dbj|BAG91620.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62498.1| hypothetical protein OsJ_17296 [Oryza sativa Japonica Group]
Length=208

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  47   KENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIH  226
            K +  + L L SLNHISIVC S+++SL FY +VLGFFP+RRPGSFDF GAWLFNYGIGIH
Sbjct  11   KGSRGSGLPLASLNHISIVCRSLQESLTFYTDVLGFFPVRRPGSFDFDGAWLFNYGIGIH  70

Query  227  LLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLF  400
            LLQA+D  +LP  T INPKDNHISFQCESM  VE+RLKE+ I Y++  VEEGG++VDQ+F
Sbjct  71   LLQAEDPDSLPGKTEINPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEGGIYVDQIF  130

Query  401  FHDPDGMMIEICNCDNLPVIPLSGE  475
            FHDPDG MIEICNCDNLPV+PL  +
Sbjct  131  FHDPDGFMIEICNCDNLPVVPLGAD  155



>ref|XP_010532163.1| PREDICTED: uncharacterized protein LOC104808228 [Tarenaya hassleriana]
Length=167

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHIS++C SVE+S++FYQNVLGF PIRRPGSFDF GAWLF +GIGIHLL+
Sbjct  1    MENPLHLKSLNHISLLCRSVEESMNFYQNVLGFIPIRRPGSFDFDGAWLFGHGIGIHLLR  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            + +   +PK   INPKDNH+SFQCE M  VEK+LK+M+I YV+  VEEGG+ VDQLFFHD
Sbjct  61   SPEPEKMPKKEEINPKDNHVSFQCECMEAVEKKLKDMKIRYVRAVVEEGGIQVDQLFFHD  120

Query  410  PDGMMIEICNCDNLPVIPLSGEPLR  484
            PDG MIEICNC+ LPVIPL GE  R
Sbjct  121  PDGFMIEICNCECLPVIPLVGEMAR  145



>dbj|BAJ85628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNHISIVC SVE+SLDFY NVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++  
Sbjct  18   LPLASLNHISIVCRSVEESLDFYMNVLGFTPIRRPGSFDFDGAWLFNYGIGIHLLQSEHP  77

Query  242  DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
            ++LP    INPKDNHISFQCESM  VE+RLKE+ I+Y+K  VEEGG++VDQ+FFHDPDG 
Sbjct  78   ESLPAKKEINPKDNHISFQCESMVAVERRLKELGIQYIKRCVEEGGINVDQIFFHDPDGF  137

Query  422  MIEICNCDNLPVIPLSGE  475
            MIEICNCDNLPV+PL+ +
Sbjct  138  MIEICNCDNLPVVPLADQ  155



>ref|XP_009117831.1| PREDICTED: uncharacterized protein LOC103842901 [Brassica rapa]
Length=172

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            KMKEN  NPLRL SLNH+S++C S+E+S++FYQ VLGFFP+RRP S DF GAWLF +GIG
Sbjct  5    KMKENAVNPLRLTSLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLDFEGAWLFGHGIG  64

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLL++ +   LPK T IN KDNHISFQCESMA VEK+L EMEIEYV+  VE  G+ VDQ
Sbjct  65   IHLLRSTEPEKLPKKTAINSKDNHISFQCESMAAVEKKLDEMEIEYVREIVEGRGIKVDQ  124

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSG  472
            +FFHDPDG MIEICNCD+LPV+PL G
Sbjct  125  IFFHDPDGFMIEICNCDSLPVVPLVG  150



>ref|XP_006655044.1| PREDICTED: uncharacterized protein LOC102706197 [Oryza brachyantha]
Length=228

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SV++SL FY +VLGF P+RRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  37   LPLASLNHISIVCRSVQESLQFYADVLGFVPVRRPGSFDFDGAWLFNYGIGIHLLQAEDP  96

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             +LP  T INPKDNHISFQCESMA VE+RLKE+ I +V+  VEEGG++VDQ+FFHDPDG 
Sbjct  97   DSLPGKTEINPKDNHISFQCESMAAVERRLKELGIPHVQRCVEEGGIYVDQIFFHDPDGF  156

Query  422  MIEICNCDNLPVIPLSGE  475
            MIEICNCDNLPV+PL+ +
Sbjct  157  MIEICNCDNLPVVPLATD  174



>gb|KFK43791.1| hypothetical protein AALP_AA1G173300 [Arabis alpina]
Length=175

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S+ FYQNVLGF PIRRP S +F GAWLF +GIG+
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSIEESMKFYQNVLGFTPIRRPESLNFEGAWLFGHGIGV  60

Query  224  HLL--QADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL  Q  + LPK T IN KDNHISFQCESM  VEK+L EMEIE+ +  VEEGG+ VDQL
Sbjct  61   HLLRSQEPEKLPKKTAINTKDNHISFQCESMGAVEKKLNEMEIEFARAIVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL+G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLAG  145



>ref|XP_002890101.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66360.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C SV++S++FYQ VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL A +   LPK T INPKDNHISFQCESM +VEK+L+EM IEYV+  VEEGG+ VDQL
Sbjct  61   HLLCAPEPEKLPKKTAINPKDNHISFQCESMGVVEKQLEEMGIEYVRALVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>ref|NP_563973.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 ref|NP_001031049.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 gb|AAD39666.1|AC007591_31 Is a member of the PF|00903 gyloxalase family. ESTs gb|T44721, 
gb|T21844 and gb|AA395404 come from this gene [Arabidopsis 
thaliana]
 gb|AAL62369.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47938.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65839.1| unknown [Arabidopsis thaliana]
 dbj|BAH20026.1| AT1G15380 [Arabidopsis thaliana]
 gb|AEE29312.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
 gb|AEE29313.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis 
thaliana]
Length=174

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+  NPL L SLNH+S++C SV++S++FYQ VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKEDAGNPLHLTSLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL A +   LPK T INPKDNHISFQCESM +VEK+L+EM I+YV+  VEEGG+ VDQL
Sbjct  61   HLLCAPEPEKLPKKTAINPKDNHISFQCESMGVVEKKLEEMGIDYVRALVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LPV+PL GE  R
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVGEMAR  149



>emb|CDX81709.1| BnaC08g38920D [Brassica napus]
Length=173

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            KMKEN  NPLRL SLNH+S++C S+E+S++FYQ VLGFFP+RRP S DF GAWLF +GIG
Sbjct  6    KMKENAVNPLRLTSLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLDFEGAWLFGHGIG  65

Query  221  IHLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLL + +   LPK T IN KDNHISFQCESMA VEK+L EMEIEYV+  VE  G+ VDQ
Sbjct  66   IHLLGSTEPEKLPKKTAINSKDNHISFQCESMAAVEKKLDEMEIEYVREIVEGRGIKVDQ  125

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSG  472
            +FFHDPDG MIEICNCD+LPV+PL G
Sbjct  126  IFFHDPDGFMIEICNCDSLPVVPLVG  151



>gb|KHN47772.1| hypothetical protein glysoja_029190 [Glycine soja]
Length=141

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 3/139 (2%)
 Frame = +2

Query  44   MKEN-MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            MKE+ M NPLRL+S+NHIS++C SVE+S+DFYQNVLGF+PIRRPGS DF GAWLF YGIG
Sbjct  1    MKESTMGNPLRLQSVNHISLICRSVEQSMDFYQNVLGFYPIRRPGSLDFDGAWLFGYGIG  60

Query  221  IHLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            IHLL+A+  +NLPK   INPKDNHISFQCESM  VEK+LKEMEI+YV+  VEEG + VDQ
Sbjct  61   IHLLEAENPENLPKKKEINPKDNHISFQCESMEPVEKKLKEMEIDYVRATVEEGRIQVDQ  120

Query  395  LFFHDPDGMMIEICNCDNL  451
            LFFHDPD  MIEICNCD+L
Sbjct  121  LFFHDPDDFMIEICNCDSL  139



>ref|XP_004486683.1| PREDICTED: metallothiol transferase FosB 2-like [Cicer arietinum]
Length=160

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK  + NPLRLKS+NHIS++  SVE+S++FYQNVLGF PIRRP SF+F G WLF YGIGI
Sbjct  1    MKGIVGNPLRLKSVNHISLIVKSVEESINFYQNVLGFIPIRRPESFNFNGGWLFAYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQA+  +N+P+   INPKDNHISFQCESM  VEK LKEMEI YV+  VEE G+ V QL
Sbjct  61   HLLQAEKPENIPRKKEINPKDNHISFQCESMGAVEKNLKEMEICYVRAMVEEAGIQVHQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLT  502
            FFHDPDG MIEICNCD++PVIPL  + +RP + L 
Sbjct  121  FFHDPDGFMIEICNCDSIPVIPLDCDMVRPCSTLN  155



>ref|XP_002439371.1| hypothetical protein SORBIDRAFT_09g005270 [Sorghum bicolor]
 gb|EES17801.1| hypothetical protein SORBIDRAFT_09g005270 [Sorghum bicolor]
Length=219

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC +VE SL FY +VLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  21   LPLASLNHISIVCRNVEASLRFYTDVLGFVPIRRPGSFDFDGAWLFNYGIGIHLLQSEDP  80

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             +LP+   INPKDNHISFQCESM  VE+RLKEM I YV+  VEEGG++VDQ+FFHDPDG 
Sbjct  81   GSLPEKGEINPKDNHISFQCESMVAVERRLKEMGIPYVQRCVEEGGINVDQIFFHDPDGF  140

Query  422  MIEICNCDNLPVIPLSG  472
            MIEICNCDNLPVIPL+G
Sbjct  141  MIEICNCDNLPVIPLAG  157



>ref|XP_010497101.1| PREDICTED: uncharacterized protein LOC104774130 [Camelina sativa]
Length=175

 Score =   216 bits (551),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C SV++S+ FY  VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM  VEK+L++MEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLRSPEPEKLPKKTAINPKDNHISFQCESMGAVEKKLEDMEIEYVRALVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>ref|XP_010476624.1| PREDICTED: uncharacterized protein LOC104755853 [Camelina sativa]
Length=175

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C SV++S+ FY  VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM  VEK+L+EMEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLRSPEPEKLPKKTAINPKDNHISFQCESMGAVEKKLEEMEIEYVRALVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPL  466
            FFHDPDG MIEICNCD+LPV+PL
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPL  143



>emb|CDY55981.1| BnaA09g56790D [Brassica napus]
Length=167

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPLRL SLNH+S++C S+E+S++FYQ VLGFFP+RRP S DF GAWLF +GIGI
Sbjct  1    MKENAVNPLRLTSLNHVSLLCRSLEESMNFYQKVLGFFPVRRPESLDFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T IN KDNHISFQCESMA VEK+L EMEIEYV+  VE  G+ VDQ+
Sbjct  61   HLLRSTEPEKLPKKTAINSKDNHISFQCESMAAVEKKLDEMEIEYVREIVEGRGIKVDQI  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>ref|XP_006305709.1| hypothetical protein CARUB_v10010450mg [Capsella rubella]
 gb|EOA38607.1| hypothetical protein CARUB_v10010450mg [Capsella rubella]
Length=174

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C SV++S++FY  VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSVDESMNFYHKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM  VEK+L++MEIEYV+  VEEGG+ VDQL
Sbjct  61   HLLRSPEPEKLPKKTAINPKDNHISFQCESMGAVEKKLEDMEIEYVRSLVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>gb|EMT20922.1| hypothetical protein F775_15409 [Aegilops tauschii]
Length=186

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVCSSVE+SL FY NVLGF PIRRPGSF+F GAWLFNYGIGIHLLQ ++ 
Sbjct  7    LPLASLNHISIVCSSVEESLRFYMNVLGFIPIRRPGSFNFNGAWLFNYGIGIHLLQCEEP  66

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             +LP  T INPKDNHISFQCESM  VE+RLKE+ I Y++  VEEGG++VDQ+FFHDPDG 
Sbjct  67   RSLPGKTEINPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEGGIYVDQIFFHDPDGF  126

Query  422  MIEICNCDNLPVIPLSGEPLRP  487
            MIEICNCDNLPVIPL+     P
Sbjct  127  MIEICNCDNLPVIPLADHTSSP  148



>ref|XP_010459070.1| PREDICTED: uncharacterized protein LOC104740226 isoform X1 [Camelina 
sativa]
Length=175

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C SV++S+ FY  VLGF PIRRP S +F GAWLF +GIGI
Sbjct  1    MKENAGNPLHLTSLNHVSLLCRSVDESMSFYHKVLGFIPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL++ +   LPK T INPKDNHISFQCESM  VEK+L++MEI+YV+  VEEGG+ VDQL
Sbjct  61   HLLRSPEPEKLPKKTAINPKDNHISFQCESMGAVEKKLEDMEIKYVRALVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>gb|EPS70220.1| hypothetical protein M569_04537, partial [Genlisea aurea]
Length=152

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            NPL L SLNHIS+VC SVE+S DFYQNVLGF PIRRPGS  F G+WL  +GIGIHLLQ++
Sbjct  2    NPLHLSSLNHISLVCRSVEESTDFYQNVLGFVPIRRPGSLKFDGSWLNGHGIGIHLLQSE  61

Query  242  D--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
            D  ++ K   INPKDNHISFQCESM MVEK+L EM I++VK RVEEGG++VDQLFFHDPD
Sbjct  62   DPESMRKKKVINPKDNHISFQCESMGMVEKKLNEMGIDWVKQRVEEGGIYVDQLFFHDPD  121

Query  416  GMMIEICNCDNLPVIPLSGEPLR  484
            G MIEICNCD++PV+PL+G  +R
Sbjct  122  GFMIEICNCDDMPVVPLAGNVVR  144



>emb|CDX83979.1| BnaC08g16660D [Brassica napus]
Length=174

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPL L SLNH+S++C S+E+S++FY+ VLGFFPIRRP S +F GAWLF +GIGI
Sbjct  1    MKENPGNPLHLTSLNHVSLLCRSIEESMNFYRKVLGFFPIRRPESLNFEGAWLFGHGIGI  60

Query  224  HLLQA--DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL+A   + L     INPKDNHISFQCESM  VEK+L+EMEI+YV+ +VEEGG+ VDQL
Sbjct  61   HLLRALEPEKLSTKNEINPKDNHISFQCESMGAVEKKLEEMEIDYVRSKVEEGGIQVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG MIEICNCD+LP++PL G  +R
Sbjct  121  FFHDPDGFMIEICNCDSLPIVPLVGGMVR  149



>ref|NP_001149571.1| lactoylglutathione lyase [Zea mays]
 gb|ACF84216.1| unknown [Zea mays]
 gb|ACG35892.1| lactoylglutathione lyase [Zea mays]
 gb|AFW81390.1| lactoylglutathione lyase [Zea mays]
Length=221

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNHISIVC SVE SL FY +VLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++D 
Sbjct  18   LPLASLNHISIVCRSVEASLRFYTDVLGFVPIRRPGSFDFGGAWLFNYGIGIHLLQSEDP  77

Query  248  L---PKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
                P+   INPKDNHISFQCESM  VE+RLKE+ I YV+  VEEGG++VDQ+FFHDPDG
Sbjct  78   GSLPPEKGEINPKDNHISFQCESMVAVERRLKEIGIPYVQRCVEEGGINVDQIFFHDPDG  137

Query  419  MMIEICNCDNLPVIPLSGE  475
             MIEICNCDNLPV+PL+G+
Sbjct  138  FMIEICNCDNLPVVPLAGD  156



>gb|AGT16646.1| lactoylglutathione lyase [Saccharum hybrid cultivar R570]
Length=232

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L +LNHIS+VC  +E SL FY++VLGF PIRRPGSFDF GAWLFNYGIG+HLLQA+D 
Sbjct  15   LPLAALNHISVVCRCLESSLRFYRDVLGFVPIRRPGSFDFDGAWLFNYGIGVHLLQAEDP  74

Query  248  L---PKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
                PK T INPKDNHISFQCESM  V++RLKE+ I YV+ RVEEGG++VDQLFFHDPDG
Sbjct  75   ASMPPKKTEINPKDNHISFQCESMEAVQRRLKELGIRYVQRRVEEGGIYVDQLFFHDPDG  134

Query  419  MMIEICNCDNLPVIPLSGE  475
             M+E+C CDNLP++PL  E
Sbjct  135  FMVEVCTCDNLPIVPLVPE  153



>ref|XP_010250045.1| PREDICTED: uncharacterized protein LOC104592394 [Nelumbo nucifera]
Length=197

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 6/149 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV+KSL FYQ+VLGF P+RRP S +F GAWLF YGIGIHLLQA   
Sbjct  11   LHLTSLNHVSMLCRSVKKSLHFYQHVLGFIPVRRPESLNFEGAWLFAYGIGIHLLQAGNP  70

Query  242  DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
            ++LP  + INPKDNHISFQCE+M +VE++LKEM IEYV+ RVEEGG++VDQLFFHDPDG 
Sbjct  71   ESLPTKSEINPKDNHISFQCENMTVVERKLKEMGIEYVQNRVEEGGIYVDQLFFHDPDGF  130

Query  422  MIEICNCDNLPVIPLSGEPLRPPAGLTCT  508
            MIEICNC+NLPV+ L GE    PAG  C+
Sbjct  131  MIEICNCENLPVVYLDGE----PAGAVCS  155



>ref|XP_010254369.1| PREDICTED: uncharacterized protein LOC104595363 [Nelumbo nucifera]
Length=195

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            M   M  PLRL SLNHISIVC SVE+SL FYQ+VLGF P+RRP S  F GAWLF YGIGI
Sbjct  1    MLGAMGGPLRLTSLNHISIVCRSVEESLKFYQDVLGFIPVRRPESLKFEGAWLFGYGIGI  60

Query  224  HLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++  + +P+ + INPKDNHISFQCESM  VE +LKE+ IEYV+  V+EGG++VDQL
Sbjct  61   HLLQSENPEGMPRKSEINPKDNHISFQCESMVAVEVKLKEIGIEYVQRTVKEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPL  481
            FFHDPDG M+E+CNC+NLPV+ L+GEP+
Sbjct  121  FFHDPDGFMVELCNCENLPVVDLNGEPI  148



>ref|XP_002457260.1| hypothetical protein SORBIDRAFT_03g004330 [Sorghum bicolor]
 gb|EES02380.1| hypothetical protein SORBIDRAFT_03g004330 [Sorghum bicolor]
Length=233

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L +LNHIS+VC  +E SL FY++VLGF PIRRPGSFDF GAWLFNYGIG+HLLQA+D 
Sbjct  16   LPLAALNHISVVCRCLESSLRFYRDVLGFVPIRRPGSFDFHGAWLFNYGIGVHLLQAEDP  75

Query  248  L---PKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
                PK T INPKDNHISFQCESM  V++RLKE+ I YV+ RVEEGG++VDQLFFHDPDG
Sbjct  76   ASMPPKKTEINPKDNHISFQCESMEAVQRRLKELGIRYVQRRVEEGGIYVDQLFFHDPDG  135

Query  419  MMIEICNCDNLPVIPLSGE  475
             M+E+C CDNLP++PL  E
Sbjct  136  FMVEVCTCDNLPIVPLVPE  154



>ref|XP_003565402.1| PREDICTED: uncharacterized protein LOC100842326 [Brachypodium 
distachyon]
Length=228

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD--NLP  253
            SLNH+S+VC S+E SL FY+NVLGF PIRRPGSF F GAWLFN+GIG+HLLQA+D  N+P
Sbjct  28   SLNHVSLVCRSLESSLAFYRNVLGFVPIRRPGSFGFDGAWLFNFGIGVHLLQAEDPANMP  87

Query  254  -KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIE  430
             K   INPKDNHISF CESM  V++RLKEM I YV+ RVEEGG++VDQLFFHDPDG MIE
Sbjct  88   AKKAEINPKDNHISFTCESMETVQRRLKEMGIRYVQRRVEEGGIYVDQLFFHDPDGFMIE  147

Query  431  ICNCDNLPVIPLSGEP  478
            +C CDNLPVIPL   P
Sbjct  148  VCTCDNLPVIPLLDAP  163



>ref|XP_006346650.1| PREDICTED: uncharacterized protein LOC102599142 [Solanum tuberosum]
Length=171

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MK N  NPL L SLNHIS VC+S+E+S+DFY+NVLGF P+RRP SF+F GAWLF +GIGI
Sbjct  1    MKGNNGNPLALTSLNHISRVCTSLEESIDFYKNVLGFIPVRRPTSFNFNGAWLFGHGIGI  60

Query  224  HLLQADDNL--PKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL  +++   PK T INPKDNH+SFQCES+  VEK+L EM IEYVK  VEEGG++VDQL
Sbjct  61   HLLLLEESEKLPKKTEINPKDNHMSFQCESIDGVEKKLTEMGIEYVKQLVEEGGIYVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            FFHDPDG M+EICNCD LP+IPL GE  R
Sbjct  121  FFHDPDGFMVEICNCDKLPIIPLVGEMTR  149



>emb|CAP72290.1| Glyoxalase [Triticum aestivum]
 emb|CDM81975.1| unnamed protein product [Triticum aestivum]
Length=243

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNHIS+VC S+E SL FY++VLGF  IRRPGSFDF GAWLFN+GIG+HLLQA+D 
Sbjct  23   LPLASLNHISVVCRSLESSLSFYRDVLGFIQIRRPGSFDFDGAWLFNFGIGVHLLQAEDR  82

Query  248  L---PKVTNINPKDNHISFQ-CESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
                PK   INPKDNHISF  CESM  V++RLKE+ I YV+ RVEEGG+HVDQ+FFHDPD
Sbjct  83   ASLPPKKAEINPKDNHISFTTCESMEAVQRRLKELGIRYVQRRVEEGGIHVDQIFFHDPD  142

Query  416  GMMIEICNCDNLPVIPL  466
            G MIE+C CDNLPVIPL
Sbjct  143  GFMIEVCTCDNLPVIPL  159



>gb|KDO80293.1| hypothetical protein CISIN_1g036243mg, partial [Citrus sinensis]
Length=146

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 12/153 (8%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            M+NPL LKSLNH S+VC SVEKSLDFYQNV+GF PIRRPGSFDF GAW +          
Sbjct  1    MQNPLSLKSLNHFSLVCRSVEKSLDFYQNVIGFLPIRRPGSFDFHGAWKY----------  50

Query  236  ADDNLPKVTNI-NPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
              D +P +  I NPKDNHISFQCE+MA VE++L EM+IEYVK RVEEGG++VDQ+FFHDP
Sbjct  51   -PDRMPSIGKIINPKDNHISFQCENMATVERKLTEMKIEYVKSRVEEGGIYVDQVFFHDP  109

Query  413  DGMMIEICNCDNLPVIPLSGEPLRPPAGLTCTM  511
            DG MIEICNCD LPV+PL+G+ +R  + + C +
Sbjct  110  DGSMIEICNCDVLPVVPLAGDTIRSCSIVNCNI  142



>ref|NP_001152619.1| lactoylglutathione lyase [Zea mays]
 gb|ACG48601.1| lactoylglutathione lyase [Zea mays]
 gb|AFW77327.1| lactoylglutathione lyase [Zea mays]
Length=222

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L SLNHISIVC SVE SL FY +VLGF PIRRPGSFDF GAWLFNYGIG+HLLQ++D 
Sbjct  16   LPLASLNHISIVCRSVEASLRFYADVLGFVPIRRPGSFDFDGAWLFNYGIGVHLLQSEDP  75

Query  245  -NLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
             +LP+    INPKDNHISFQCESM  VE+RLKEM I YV+  VEEGG++VDQ+FFHDPD 
Sbjct  76   GSLPENKGEINPKDNHISFQCESMVAVERRLKEMGIPYVQRCVEEGGINVDQIFFHDPDA  135

Query  419  MMIEICNCDNLPVIPL  466
             MIE+CNCDNLPV+PL
Sbjct  136  FMIEVCNCDNLPVVPL  151



>ref|XP_003597871.1| Metallothiol transferase fosB [Medicago truncatula]
 gb|AES68122.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=171

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 121/156 (78%), Gaps = 3/156 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE + NPLRLKS+NHIS++C SV +S+ FY+ VLGF  I RPGSFDF GAWLF YGIGI
Sbjct  1    MKEIVGNPLRLKSVNHISLICKSVNESVSFYEKVLGFISIVRPGSFDFEGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQC-ESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQA+D  N+P+   INPKDNHISFQC ESM  VEK L + +I   +  VEE G+ VDQ
Sbjct  61   HLLQAEDPENIPRKNEINPKDNHISFQCDESMDTVEKYLNDKKIGCKRAMVEENGIQVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGLT  502
            LFFHDPDG MIEICNCD+LPVIPL+GE +R  + L 
Sbjct  121  LFFHDPDGFMIEICNCDSLPVIPLAGEMVRSCSRLN  156



>ref|XP_004968374.1| PREDICTED: uncharacterized protein LOC101776223 [Setaria italica]
Length=227

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L +LNHIS+VC S++ S  FY++VLGF PIRRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  16   LPLAALNHISVVCRSLDSSQRFYRDVLGFIPIRRPGSFDFDGAWLFNYGIGIHLLQAEDP  75

Query  248  ---LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
                PK T INPKDNHISFQCESM  V++RLKE+ + YV+ RVEEGG++VDQLFFHDPDG
Sbjct  76   ESMPPKKTEINPKDNHISFQCESMEAVQRRLKELGVRYVQRRVEEGGIYVDQLFFHDPDG  135

Query  419  MMIEICNCDNLPVIPL  466
             M+E+C CD LPV+PL
Sbjct  136  FMVEVCTCDKLPVVPL  151



>gb|AFK47501.1| unknown [Medicago truncatula]
Length=149

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE + NPLRLKS+NHIS++C SV +S+ FY+ VLGF  I RPGSFDF GAWLF YGIGI
Sbjct  1    MKEIVGNPLRLKSVNHISLICKSVNESVSFYEKVLGFISIVRPGSFDFEGAWLFGYGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQC-ESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQA+D  N+P+   INPKDNHISFQC ESM  VEK L + +I   +  VEE G+ VDQ
Sbjct  61   HLLQAEDPENIPRKNEINPKDNHISFQCDESMDTVEKYLNDKKIGCKRAMVEENGIQVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGE  475
            LFFHDPDG MIEICNCD+LPVIPL+GE
Sbjct  121  LFFHDPDGFMIEICNCDSLPVIPLAGE  147



>gb|KCW79803.1| hypothetical protein EUGRSUZ_C01137 [Eucalyptus grandis]
Length=149

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            +NPL LK LNHIS+ C SVE+S++FY NVLGF  IRRP SFDF GAWLFNYGIGIHL+++
Sbjct  5    KNPLHLKCLNHISMQCRSVEESINFYCNVLGFVSIRRPSSFDFDGAWLFNYGIGIHLIKS  64

Query  239  DD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
            +D   LP+V  INPKD HISFQCESM  VEK+L+EM+IE+V  +V EGG+ VDQLFFHDP
Sbjct  65   EDLDGLPEVGQINPKDRHISFQCESMETVEKKLREMKIEFVNGQVVEGGIAVDQLFFHDP  124

Query  413  DGMMIEICNCDNLPVIPL  466
            DG+MIE+CNC+N+PV+ L
Sbjct  125  DGLMIEVCNCENIPVVAL  142



>gb|KHN22460.1| hypothetical protein glysoja_024969 [Glycine soja]
Length=156

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 15/143 (10%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN+ NPL LKS+NHIS++C+SV++S++FYQN+LGFFPIRRPGSFDF GAWLF YGIGI
Sbjct  1    MKENVGNPLHLKSVNHISLICTSVKESINFYQNLLGFFPIRRPGSFDFDGAWLFGYGIGI  60

Query  224  HLLQADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFF  403
            HLLQA+D           DN     CESM  VEK+L EMEIEYV   VEEGG+ VDQLFF
Sbjct  61   HLLQAED----------PDN-----CESMGAVEKKLGEMEIEYVHATVEEGGIKVDQLFF  105

Query  404  HDPDGMMIEICNCDNLPVIPLSG  472
            HDPDG MIEICNCD+LPVIPL+ 
Sbjct  106  HDPDGFMIEICNCDSLPVIPLAA  128



>ref|XP_006842870.1| hypothetical protein AMTR_s00081p00168190 [Amborella trichopoda]
 gb|ERN04545.1| hypothetical protein AMTR_s00081p00168190 [Amborella trichopoda]
Length=171

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWL--FNYGI  217
            M   ++ PL L SLNHIS++C SVE+SLDFYQN+LGF PIRRP SFDF GAWL  FNY +
Sbjct  1    MVGTVKVPLPLTSLNHISLICRSVEESLDFYQNILGFIPIRRP-SFDFNGAWLYNFNYSM  59

Query  218  GIHLLQAD--DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            GIHLLQA+  D+LPK T INPKDNHISFQCESMA V + LK+M I+Y++  VEEGG+ V 
Sbjct  60   GIHLLQAENPDSLPKKTEINPKDNHISFQCESMAAVARGLKDMGIKYIEREVEEGGIFVS  119

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSG  472
            Q+FFHDPDG M+EIC+C+NLPV+PL+ 
Sbjct  120  QIFFHDPDGFMVEICDCENLPVVPLAA  146



>ref|XP_008673641.1| PREDICTED: uncharacterized protein LOC103649687 [Zea mays]
 tpg|DAA53228.1| TPA: lactoylglutathione lyase [Zea mays]
Length=239

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 3/133 (2%)
 Frame = +2

Query  86   NHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNL---PK  256
            NHIS+VC  +E SL FY++VLGF PIRRPGSFDF GAWLFNYGIGIHLLQA+D     PK
Sbjct  29   NHISVVCRCLESSLRFYRDVLGFAPIRRPGSFDFDGAWLFNYGIGIHLLQAEDPASMPPK  88

Query  257  VTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEIC  436
             T INPKDNH+SFQCESM  V++RL E+ I YV+ RVEEGG++VDQLFFHDPDG M+E+C
Sbjct  89   KTEINPKDNHVSFQCESMEAVQRRLTELGIRYVQRRVEEGGIYVDQLFFHDPDGFMVEVC  148

Query  437  NCDNLPVIPLSGE  475
             CDNLP++PL  E
Sbjct  149  TCDNLPIVPLVPE  161



>ref|XP_010065333.1| PREDICTED: uncharacterized protein LOC104452578 [Eucalyptus grandis]
 gb|KCW62752.1| hypothetical protein EUGRSUZ_G00342 [Eucalyptus grandis]
Length=220

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S VC SV +++ FY+ VLGF  I+RP SFDF GAWLFNYGIGIHLL+ +D 
Sbjct  35   LPLLSLNHVSFVCKSVAETVRFYERVLGFVLIKRPSSFDFEGAWLFNYGIGIHLLEVEDV  94

Query  248  LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMI  427
              K   INPKDNHISFQC  M +V K+L+EM IEYV   VEEGG+ VDQLFFHDPDG MI
Sbjct  95   PAKKAAINPKDNHISFQCSDMKLVMKKLEEMNIEYVTAVVEEGGIQVDQLFFHDPDGYMI  154

Query  428  EICNCDNLPVIPLSGEPLRPP  490
            EICNCDNLPV+PLS  PL+ P
Sbjct  155  EICNCDNLPVLPLSSCPLKLP  175



>ref|NP_001042158.1| Os01g0173600 [Oryza sativa Japonica Group]
 dbj|BAB62552.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF04072.1| Os01g0173600 [Oryza sativa Japonica Group]
Length=215

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L +LNH+S+VC S+  SL FY++ LGF  +RRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  17   LPLSTLNHVSLVCRSLSTSLTFYRDFLGFVSVRRPGSFDFDGAWLFNYGIGIHLLQAEDP  76

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             ++P    INPKDNHISF CESM  V++RLKEM + YV+ RVEEGGV+VDQ+FFHDPDG 
Sbjct  77   ESMPPNKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEGGVYVDQIFFHDPDGF  136

Query  422  MIEICNCDNLPVIPL  466
            MIEIC CD LPV+PL
Sbjct  137  MIEICTCDKLPVVPL  151



>gb|EAZ10730.1| hypothetical protein OsJ_00566 [Oryza sativa Japonica Group]
Length=215

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L L +LNH+S+VC S+  SL FY++ LGF  +RRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  17   LPLSTLNHVSLVCRSLSTSLTFYRDFLGFVSVRRPGSFDFDGAWLFNYGIGIHLLQAEDP  76

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             ++P    INPKDNHISF CESM  V++RLKEM + YV+ RVEEGGV+VDQ+FFHDPDG 
Sbjct  77   ESMPPNKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEGGVYVDQIFFHDPDGF  136

Query  422  MIEICNCDNLPVIPL  466
            MIEIC CD LPV+PL
Sbjct  137  MIEICTCDKLPVVPL  151



>gb|ABR17137.1| unknown [Picea sitchensis]
Length=204

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 2/137 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD-  244
            L LKSLNH+S VC S+E S+ FY+NVLGF  ++RPGSFDF GAWLFNYGIGIHLLQ+ D 
Sbjct  15   LSLKSLNHVSFVCRSIEDSIKFYENVLGFVRVKRPGSFDFNGAWLFNYGIGIHLLQSKDP  74

Query  245  -NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
             +LPK T INP+DNHISFQCE + +VE++L+EM ++YVK  VE+GG++VDQLF HDPDG 
Sbjct  75   DSLPKKTEINPRDNHISFQCEDVQVVERKLQEMNVKYVKRIVEDGGIYVDQLFIHDPDGF  134

Query  422  MIEICNCDNLPVIPLSG  472
            M+E+CNC+N PV P+ G
Sbjct  135  MVEVCNCENFPVEPIVG  151



>ref|XP_007223440.1| hypothetical protein PRUPE_ppa011519mg [Prunus persica]
 gb|EMJ24639.1| hypothetical protein PRUPE_ppa011519mg [Prunus persica]
Length=207

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP-KV  259
            LNH+S VC SV KS+ FY+ VLGF  I+RP SF F GAWLFNYGIGIHLL++D N+P K 
Sbjct  24   LNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKNIPEKK  83

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M MV ++L+EM+IEYV  +VEEGGV VDQLFFHDPDG M+EICN
Sbjct  84   GKINPKDNHISFQCSDMGMVMQKLEEMKIEYVTAKVEEGGVIVDQLFFHDPDGYMVEICN  143

Query  440  CDNLPVIPLSGEPLR  484
            C NLPV+P+S  P++
Sbjct  144  CQNLPVLPISSCPIK  158



>gb|ABK26885.1| unknown [Picea sitchensis]
Length=197

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +2

Query  47   KENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIH  226
             E    PL L S+NHIS+VC SV+ S+DFY++VLGFFPI+RPGSF+F GAWLF+YG+GIH
Sbjct  11   AEGAAGPLPLVSVNHISLVCRSVQDSMDFYEHVLGFFPIKRPGSFNFDGAWLFSYGMGIH  70

Query  227  LLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLF  400
            LLQ+ +   +PK   INP DNH+SFQCESM +VE +L EM I++VK  VEEGG+ VDQLF
Sbjct  71   LLQSPNPGAMPKKQEINPMDNHMSFQCESMQVVESKLVEMNIKFVKRTVEEGGISVDQLF  130

Query  401  FHDPDGMMIEICNCDNLPV  457
            FHDPD  MIEICNCDNLPV
Sbjct  131  FHDPDDFMIEICNCDNLPV  149



>ref|XP_008218742.1| PREDICTED: uncharacterized protein LOC103319028 isoform X1 [Prunus 
mume]
Length=216

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP-KV  259
            LNH+S VC SV KS+ FY+ VLGF  I+RP SF F GAWLFNYGIGIHLL++D N+P K 
Sbjct  24   LNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKNIPEKK  83

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M MV ++L+EM IEYV  +VEEGGV VDQLFFHDPDG M+EICN
Sbjct  84   GKINPKDNHISFQCSDMGMVIQKLEEMRIEYVTAKVEEGGVIVDQLFFHDPDGYMVEICN  143

Query  440  CDNLPVIPLSGEPLR  484
            C NLPV+P+S  P++
Sbjct  144  CQNLPVLPISSCPIK  158



>ref|XP_008218743.1| PREDICTED: uncharacterized protein LOC103319028 isoform X2 [Prunus 
mume]
Length=213

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP-KV  259
            LNH+S VC SV KS+ FY+ VLGF  I+RP SF F GAWLFNYGIGIHLL++D N+P K 
Sbjct  24   LNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKNIPEKK  83

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M MV ++L+EM IEYV  +VEEGGV VDQLFFHDPDG M+EICN
Sbjct  84   GKINPKDNHISFQCSDMGMVIQKLEEMRIEYVTAKVEEGGVIVDQLFFHDPDGYMVEICN  143

Query  440  CDNLPVIPLSGEPLR  484
            C NLPV+P+S  P++
Sbjct  144  CQNLPVLPISSCPIK  158



>ref|XP_010545777.1| PREDICTED: uncharacterized protein LOC104818034 [Tarenaya hassleriana]
Length=170

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKE+  N L L S+NH+S+VC  VEKS++FYQNVLGF  +RRP S D  GAWLF +GIGI
Sbjct  1    MKESAGNLLHLTSVNHVSLVCRCVEKSIEFYQNVLGFSLVRRPRSLDSHGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLLQ++D  N+P    INPKDNHISFQCESM  VEK L+ M ++YV   VEEG VHVDQL
Sbjct  61   HLLQSEDPENVPSKKEINPKDNHISFQCESMGRVEKELERMGVKYVHGTVEEGSVHVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAGL  499
            FFHDP+G MIEICNCD+ P++P +    R  A L
Sbjct  121  FFHDPNGFMIEICNCDSFPLVPETMRTNRSRANL  154



>gb|KHN31586.1| hypothetical protein glysoja_043029 [Glycine soja]
Length=184

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +2

Query  38   EKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGI  217
            EKM E  E PL L SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLFNYGI
Sbjct  2    EKM-ELAETPLPLLSLNHVSFVCKSVSESVKFYEDVLGFLLIKRPSSFKFEGAWLFNYGI  60

Query  218  GIHLLQADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            GIHLL+++    K   INPK+NHISFQC  M ++ ++L  M+IEYV   VEEGG+ VDQL
Sbjct  61   GIHLLESEKVPVKKREINPKENHISFQCSDMKVIMQKLDAMKIEYVTAVVEEGGIKVDQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            FFHDPDG MIEICNC NLPV+P+S  PL+   G
Sbjct  121  FFHDPDGYMIEICNCQNLPVLPISSCPLKQLGG  153



>ref|XP_006416913.1| hypothetical protein EUTSA_v10008912mg [Eutrema salsugineum]
 gb|ESQ35266.1| hypothetical protein EUTSA_v10008912mg [Eutrema salsugineum]
Length=174

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            MKEN  NPLRL SLNH+S++C S+E++++FYQ VLGF PIRRP S +F GAWLF +GIG+
Sbjct  1    MKENAGNPLRLTSLNHVSLLCRSIEETMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGV  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQL  397
            HLL A +   LPK T IN KDNHISFQCESM  VEK+L+E+EIEY +  VEEGG+ V+QL
Sbjct  61   HLLCAPEPEKLPKKTTINTKDNHISFQCESMGAVEKKLEELEIEYARSIVEEGGIQVEQL  120

Query  398  FFHDPDGMMIEICNCDNLPVIPLSG  472
            FFHDPDG MIEICNCD+LPV+PL G
Sbjct  121  FFHDPDGFMIEICNCDSLPVVPLVG  145



>ref|NP_001236582.1| uncharacterized protein LOC100305781 [Glycine max]
 gb|ACU13640.1| unknown [Glycine max]
Length=181

 Score =   196 bits (498),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +2

Query  50   ENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHL  229
            E  E PL L SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLFNYGIGIHL
Sbjct  2    ELAETPLPLLSLNHVSFVCKSVSESVKFYEDVLGFLLIKRPSSFKFEGAWLFNYGIGIHL  61

Query  230  LQADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            L+++    +   INPK+NHISFQC  M ++ ++L  M+IEYV   VEEGGV VDQLFFHD
Sbjct  62   LESEKVPVRKREINPKENHISFQCSDMKVIMQKLDAMKIEYVTAVVEEGGVKVDQLFFHD  121

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            PDG MIEICNC NLPV+P+S  PL+   G
Sbjct  122  PDGYMIEICNCQNLPVLPISSCPLKQLGG  150



>gb|AEW07933.1| hypothetical protein 0_14804_01, partial [Pinus radiata]
 gb|AFG69122.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69123.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69124.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69125.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69126.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69127.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69128.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69129.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69130.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69132.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69133.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69134.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69135.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69136.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
 gb|AFG69137.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
Length=140

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD  244
             L LKSLNH+S+VC S+E S+ FY+NVLGF  ++RPGSFDF GAWLFNYGIGIHLLQ+ D
Sbjct  10   ALSLKSLNHVSLVCRSIEDSIKFYENVLGFVRVKRPGSFDFNGAWLFNYGIGIHLLQSAD  69

Query  245  --NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
              N+PK T INP+DNHISFQC+S+  VE++L+E++I+YVK  VE+GG++VDQLF HDPDG
Sbjct  70   PDNVPKKTEINPRDNHISFQCDSVQSVERKLQELKIKYVKRIVEDGGIYVDQLFIHDPDG  129

Query  419  MMIEICNCDNL  451
             M+EICNC+N 
Sbjct  130  FMLEICNCENF  140



>gb|EAY72730.1| hypothetical protein OsI_00595 [Oryza sativa Indica Group]
Length=216

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L +LNH+S++C S+  SL FY++ LGF  +RRPGSFDF GAWLFNYGIGIHLLQA+D 
Sbjct  17   LPLSTLNHVSLLCRSLSTSLTFYRDFLGFVSVRRPGSFDFDGAWLFNYGIGIHLLQAEDP  76

Query  248  ---LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
                P    INPKDNHISF CESM  V++RLKEM + YV+ RVEEGGV+VDQ+FFHDPD 
Sbjct  77   ESMPPNKKEINPKDNHISFTCESMEAVQRRLKEMGVRYVQRRVEEGGVYVDQIFFHDPDS  136

Query  419  MMIEICNCDNLPVIPL  466
             MIEIC CD LPV+PL
Sbjct  137  FMIEICTCDKLPVVPL  152



>ref|XP_007041249.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOX97080.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=201

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S VC SV +S+ FY+ VLGF  I+RP SF F GAWLFNYGIGIHLL+++  
Sbjct  20   LPLLSLNHVSFVCKSVSRSVRFYEEVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESESV  79

Query  248  LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMI  427
              K   INPKDNHISFQC  M +V ++L+EM IEYV   VEEGG+ VDQLFFHDPDG M+
Sbjct  80   PTKKEKINPKDNHISFQCSDMNLVMQKLEEMNIEYVTAVVEEGGIKVDQLFFHDPDGYMV  139

Query  428  EICNCDNLPVIPLSGEPLRPP  490
            EICNC NLPV+PLS  PL+ P
Sbjct  140  EICNCQNLPVLPLSSCPLKLP  160



>ref|XP_006598804.1| PREDICTED: uncharacterized protein LOC102662470 [Glycine max]
Length=182

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD  244
            PL L SLNH+S VC SV +S+ FYQ+VLGF  I+RP SF F GAWLFNYGIGIHLL+++ 
Sbjct  6    PLPLLSLNHVSFVCKSVSESVKFYQDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESEK  65

Query  245  NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMM  424
               +   INPK+NHISFQC  M ++ ++L  M+IEYV+  VEEGG+ VDQLFFHDPDG M
Sbjct  66   VPVEKREINPKENHISFQCSDMKVIMQKLDAMKIEYVRAVVEEGGIKVDQLFFHDPDGYM  125

Query  425  IEICNCDNLPVIPLSGEPLRPPAGLTCT  508
            IEICNC NLPV+P+S  PL+  A    T
Sbjct  126  IEICNCQNLPVLPISSCPLKQLAAGEAT  153



>gb|KHN39666.1| Metallothiol transferase fosB, partial [Glycine soja]
Length=187

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD  244
            PL L SLNH+S VC SV +S+ FYQ+VLGF  I+RP SF F GAWLFNYGIGIHLL+++ 
Sbjct  11   PLPLLSLNHVSFVCKSVSESVKFYQDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESEK  70

Query  245  NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMM  424
               +   INPK+NHISFQC  M ++ ++L  M+IEYV+  VEEGG+ VDQLFFHDPDG M
Sbjct  71   VPVEKREINPKENHISFQCSDMKVIMQKLDAMKIEYVRAVVEEGGIKVDQLFFHDPDGYM  130

Query  425  IEICNCDNLPVIPLSGEPLRPPAGLTCT  508
            IEICNC NLPV+P+S  PL+  A    T
Sbjct  131  IEICNCQNLPVLPISSCPLKQLAAGEAT  158



>ref|XP_006349333.1| PREDICTED: uncharacterized protein LOC102593019 [Solanum tuberosum]
Length=221

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            EN + L +LNH+S VC SV KS  FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  
Sbjct  32   ENRMPLLALNHVSYVCKSVPKSAQFYEQVLGFVLIKRPSSFDFDGAWLFNHGIGIHLLGK  91

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   K   INPKDNHISFQC  M ++ +RL +M +EYV   V+EGGV VDQLFFHDPDG
Sbjct  92   EDVQSKTGKINPKDNHISFQCTDMDLIIQRLNDMNVEYVTATVKEGGVTVDQLFFHDPDG  151

Query  419  MMIEICNCDNLPVIPLSGEPLR  484
             MIEICNC NLPV+PLS  PL+
Sbjct  152  NMIEICNCQNLPVLPLSSCPLK  173



>gb|KHG29618.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=200

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S VC SV KS+ FY+ VLGF  I+RP SF+F GAWLFNYGIGIHLL+++  
Sbjct  23   LPLLSLNHVSFVCKSVSKSVRFYEQVLGFVLIKRPSSFNFEGAWLFNYGIGIHLLESESV  82

Query  248  LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMI  427
              K   INPKDNHISFQC  M  V ++L+ M+IEYV   VEEGG+ VDQLFFHDPDG MI
Sbjct  83   PTKKEKINPKDNHISFQCSDMEQVIRKLEAMKIEYVTGVVEEGGIQVDQLFFHDPDGYMI  142

Query  428  EICNCDNLPVIPLSGEPLRPPAG  496
            EICNC NLPV+PL+   L+ P+ 
Sbjct  143  EICNCQNLPVLPLTSCTLKLPSS  165



>gb|ABK24179.1| unknown [Picea sitchensis]
Length=170

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD-  241
            PL L SLNHIS+VC SVE+S +FY+ VLGF  ++RP SFDF GAWLF+YG+GIHLLQ+  
Sbjct  9    PLPLTSLNHISLVCKSVEESRNFYEKVLGFVTVKRPASFDFDGAWLFSYGVGIHLLQSRN  68

Query  242  -DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
             ++L + + INP+DNH+SFQCESM + ++RL++M I+YVK RVEE G++VDQLF HDPDG
Sbjct  69   PEDLGEKSEINPRDNHVSFQCESMQLAKRRLQDMRIKYVKRRVEEEGLYVDQLFIHDPDG  128

Query  419  MMIEICNCDNLPVIPLSG  472
             MIE+C C+NLPV+PL+ 
Sbjct  129  FMIEMCTCENLPVVPLAS  146



>gb|AFG69131.1| hypothetical protein 0_14804_01, partial [Pinus taeda]
Length=140

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD  244
             L LKSLNH+S+VC S+E S+ FY+NVLGF  ++RPGSFDF GAWLFNYGIGIHLLQ+ D
Sbjct  10   ALSLKSLNHVSLVCRSIEDSIKFYENVLGFVRVKRPGSFDFNGAWLFNYGIGIHLLQSAD  69

Query  245  --NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
              N+PK T INP+DNHISFQC+S+  VE++L+E++I+YVK  VE+GG++VDQLF HDPD 
Sbjct  70   PDNVPKKTEINPRDNHISFQCDSVQSVERKLQELKIKYVKRIVEDGGIYVDQLFIHDPDR  129

Query  419  MMIEICNCDNL  451
             M+EICNC+N 
Sbjct  130  FMLEICNCENF  140



>ref|XP_010271470.1| PREDICTED: uncharacterized protein LOC104607512 [Nelumbo nucifera]
Length=191

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ--  235
              L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF+F GAWLFNYG+GIHLL+  
Sbjct  10   TSLPLLSLNHVSLLCRSVSTSVRFYEDVLGFILIKRPSSFNFHGAWLFNYGVGIHLLENN  69

Query  236  -ADDNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
              D ++P V+  INPKDNHISFQC  + +V+ RL+EM ++YV   VEEGG+ VDQ+FFHD
Sbjct  70   SVDAHIPSVSRPINPKDNHISFQCTDVGLVKMRLREMGMKYVTAVVEEGGIKVDQVFFHD  129

Query  410  PDGMMIEICNCDNLPVIPLSGEPLR  484
            PDG MIEICNCDN+PV+PLS  PLR
Sbjct  130  PDGYMIEICNCDNIPVVPLSSCPLR  154



>ref|XP_010256292.1| PREDICTED: uncharacterized protein LOC104596717 [Nelumbo nucifera]
Length=207

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            E  + L SLNH+S +C SV+KS+ FY+ VLGF  I+RP SF F GAWLFNYGIGIHLL+ 
Sbjct  24   EATMPLMSLNHVSFLCKSVKKSVKFYEEVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLEC  83

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               +D   K   INPKDNHISFQC  M +V ++L+ M I+YV   VEEGG+ VDQLFFHD
Sbjct  84   SSPNDKREKKAVINPKDNHISFQCTDMKLVMRKLEVMNIDYVTAVVEEGGLKVDQLFFHD  143

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRP  487
            PDG MIEICNCDNLPV+PLS  PL+P
Sbjct  144  PDGYMIEICNCDNLPVLPLSSCPLKP  169



>ref|XP_004230457.1| PREDICTED: uncharacterized protein LOC101243831 [Solanum lycopersicum]
Length=224

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            EN + L +LNH+S VC SV KS  FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  
Sbjct  35   ENRMPLLALNHVSYVCKSVPKSAQFYEQVLGFVLIKRPSSFDFDGAWLFNHGIGIHLLGK  94

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   K   INPKDNHISFQC  M ++ +RL +M +EYV   V+EGGV VDQLFFHDPDG
Sbjct  95   EDVQSKRGKINPKDNHISFQCTDMDLIIQRLNDMNVEYVTATVKEGGVTVDQLFFHDPDG  154

Query  419  MMIEICNCDNLPVIPLSGEPLRPPAGLT  502
             MIEICNC NLPV+PLS  PL+  +  T
Sbjct  155  NMIEICNCQNLPVLPLSSCPLKKMSSPT  182



>ref|XP_006385027.1| hypothetical protein POPTR_0004s23200g [Populus trichocarpa]
 gb|ABK93481.1| unknown [Populus trichocarpa]
 gb|ERP62824.1| hypothetical protein POPTR_0004s23200g [Populus trichocarpa]
Length=213

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            +LNHIS VC SV +S+ FY +VLGF  I+RP SF F GAWLFNYGIGIHLL++D    K 
Sbjct  33   ALNHISFVCKSVAESVGFYYDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKAPAKK  92

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  93   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGHMVEICN  152

Query  440  CDNLPVIPLSGEPLRPP  490
            C NLPV+PLS  P++ P
Sbjct  153  CQNLPVLPLSACPIKLP  169



>ref|XP_008781506.1| PREDICTED: uncharacterized protein LOC103701277 [Phoenix dactylifera]
Length=204

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  53   NMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLL  232
            N   PL L SLNH+S VC SV +S+ FY+ VLGF  I+RP SF+F GAWLFNYG+GIHLL
Sbjct  11   NAALPLPLMSLNHVSFVCRSVSRSVKFYEEVLGFVSIKRPSSFNFHGAWLFNYGVGIHLL  70

Query  233  QAD--DNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFF  403
            Q +  D++PK    INPKDNHISFQC  + +++++LKEM IEYV   VE+ G+ VDQLFF
Sbjct  71   QCNSPDDVPKKKGVINPKDNHISFQCSDINLLKRKLKEMGIEYVTAVVEDSGIQVDQLFF  130

Query  404  HDPDGMMIEICNCDNLPVIPLSGEPLRPP  490
            HDPDG M+EICNC+NLP++PLS  PL+ P
Sbjct  131  HDPDGYMVEICNCENLPMLPLSSCPLKFP  159



>ref|XP_010912492.1| PREDICTED: uncharacterized protein LOC105038392 [Elaeis guineensis]
Length=204

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  53   NMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLL  232
            N   PL L SLNH+S VC SV +S+ FY+ VLGF  ++RP SF+F GAWLFNYG+GIHLL
Sbjct  11   NAALPLPLMSLNHVSFVCRSVSRSVKFYEEVLGFVSVKRPSSFNFHGAWLFNYGVGIHLL  70

Query  233  QAD--DNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFF  403
            Q +  D++PK    INPKDNHISFQC  + +++++L+EM IEYV   VE+ G+ VDQLFF
Sbjct  71   QCNSLDDVPKKKGVINPKDNHISFQCSDINLLKRKLEEMGIEYVTAVVEDSGIQVDQLFF  130

Query  404  HDPDGMMIEICNCDNLPVIPLSGEPLRPP  490
            HDPDG M+EICNC+NLPV+PLS  PL+ P
Sbjct  131  HDPDGYMVEICNCENLPVLPLSSFPLKFP  159



>ref|XP_011028328.1| PREDICTED: uncharacterized protein LOC105128389 isoform X2 [Populus 
euphratica]
 ref|XP_011028329.1| PREDICTED: uncharacterized protein LOC105128389 isoform X2 [Populus 
euphratica]
 ref|XP_011028330.1| PREDICTED: uncharacterized protein LOC105128389 isoform X2 [Populus 
euphratica]
Length=218

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            +LNHIS VC SV +S++FY +VLGF  I+RP SF F GAWLFNYGIGIHLL++D    K 
Sbjct  33   ALNHISFVCKSVAESVEFYYDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKAPAKK  92

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  93   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGHMVEICN  152

Query  440  CDNLPVIPLSGEPLRPP  490
            C NLPV+PLS  P+  P
Sbjct  153  CQNLPVLPLSACPINLP  169



>ref|XP_010313702.1| PREDICTED: uncharacterized protein LOC101264403 isoform X2 [Solanum 
lycopersicum]
Length=129

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 2/108 (2%)
 Frame = +2

Query  56   MENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ  235
            MENPL LKSLNHISIVC S+EKSLDFYQN+LGFFPIRRPGSF+F GAWLFNYGIGIHLLQ
Sbjct  1    MENPLHLKSLNHISIVCRSLEKSLDFYQNILGFFPIRRPGSFNFDGAWLFNYGIGIHLLQ  60

Query  236  ADD--NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEE  373
            ++D  N+PK+  INPKDNHISFQCESM MVE RLKEME EY+KCRVEE
Sbjct  61   SEDPNNMPKINIINPKDNHISFQCESMTMVENRLKEMETEYIKCRVEE  108



>ref|XP_010271473.1| PREDICTED: uncharacterized protein LOC104607514 isoform X1 [Nelumbo 
nucifera]
Length=193

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +2

Query  47   KENMEN-PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            KEN+ N PL L SLNH+S +C SV ++  FYQ VLGF  I+RP SFDF GAWLFNYGIGI
Sbjct  6    KENIVNSPLPLFSLNHVSFLCKSVTETAKFYQEVLGFVLIKRPSSFDFEGAWLFNYGIGI  65

Query  224  HLLQ---ADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQ    +D   K   INPKDNHISFQC  + +V+K+L+EM +EYV   VE+GG+ VDQ
Sbjct  66   HLLQCNSVNDVRKKPPFINPKDNHISFQCTDVEVVKKKLEEMGMEYVTTVVEDGGIEVDQ  125

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLRPP  490
            LFFHDPDG MIEICNC  LPV+P+S  PL+ P
Sbjct  126  LFFHDPDGYMIEICNCHKLPVLPISACPLKVP  157



>ref|XP_011028327.1| PREDICTED: uncharacterized protein LOC105128389 isoform X1 [Populus 
euphratica]
Length=222

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            +LNHIS VC SV +S++FY +VLGF  I+RP SF F GAWLFNYGIGIHLL++D    K 
Sbjct  37   ALNHISFVCKSVAESVEFYYDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKAPAKK  96

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  97   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGHMVEICN  156

Query  440  CDNLPVIPLSGEPLRPP  490
            C NLPV+PLS  P+  P
Sbjct  157  CQNLPVLPLSACPINLP  173



>ref|XP_011028331.1| PREDICTED: uncharacterized protein LOC105128389 isoform X3 [Populus 
euphratica]
Length=217

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            +LNHIS VC SV +S++FY +VLGF  I+RP SF F GAWLFNYGIGIHLL++D    K 
Sbjct  37   ALNHISFVCKSVAESVEFYYDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKAPAKK  96

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  97   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGHMVEICN  156

Query  440  CDNLPVIPLSGEPLRPP  490
            C NLPV+PLS  P+  P
Sbjct  157  CQNLPVLPLSACPINLP  173



>ref|XP_010087426.1| hypothetical protein L484_018453 [Morus notabilis]
 gb|EXB29036.1| hypothetical protein L484_018453 [Morus notabilis]
Length=247

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = +2

Query  35   QEKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYG  214
            +   + N+ + + L SLNH+S VC SV  S  FY+ VLGF  I+RP SF F GAWLFNYG
Sbjct  16   RSNTRTNLSSKMPLLSLNHVSFVCKSVSNSARFYEQVLGFVLIKRPSSFKFEGAWLFNYG  75

Query  215  IGIHLLQADDNLPKV-TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            IGIHLL+++   PK    INPKDNHISFQC  M +V ++L+EM IEY    VEE GV VD
Sbjct  76   IGIHLLESNTIPPKKGKKINPKDNHISFQCSDMKLVMQKLEEMNIEYATAVVEECGVTVD  135

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            QLFFHDPDG MIEICNC NLPV+PLS  PL+ P+ 
Sbjct  136  QLFFHDPDGYMIEICNCQNLPVLPLSACPLKLPSS  170



>ref|XP_010271474.1| PREDICTED: uncharacterized protein LOC104607514 isoform X2 [Nelumbo 
nucifera]
Length=159

 Score =   190 bits (483),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = +2

Query  47   KENMEN-PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            KEN+ N PL L SLNH+S +C SV ++  FYQ VLGF  I+RP SFDF GAWLFNYGIGI
Sbjct  6    KENIVNSPLPLFSLNHVSFLCKSVTETAKFYQEVLGFVLIKRPSSFDFEGAWLFNYGIGI  65

Query  224  HLLQ---ADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLLQ    +D   K   INPKDNHISFQC  + +V+K+L+EM +EYV   VE+GG+ VDQ
Sbjct  66   HLLQCNSVNDVRKKPPFINPKDNHISFQCTDVEVVKKKLEEMGMEYVTTVVEDGGIEVDQ  125

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNC  LPV+P+S  PL+
Sbjct  126  LFFHDPDGYMIEICNCHKLPVLPISACPLK  155



>gb|KDP42432.1| hypothetical protein JCGZ_00229 [Jatropha curcas]
Length=208

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNH+S VC SV +S+ FY++VLGF  I+RP SFDF GAWLFN+G+GIHLL+A++   K 
Sbjct  30   SLNHVSFVCKSVPESVRFYEDVLGFVLIKRPSSFDFEGAWLFNHGVGIHLLEAENAPHKK  89

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M ++ +RL+E +IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  90   GAINPKDNHISFQCSDMDLLVRRLEEKKIEYVTATVEEGGITVDQLFFHDPDGYMVEICN  149

Query  440  CDNLPVIPLSGEPLRPP  490
            C NLPV+PLS  PL+ P
Sbjct  150  CQNLPVLPLSVCPLKLP  166



>ref|XP_006389541.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
 gb|ERP48455.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
Length=209

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLF+YGIGIHLL++D    K 
Sbjct  29   SLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFKFEGAWLFSYGIGIHLLESDKAPTKK  88

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  89   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGYMVEICN  148

Query  440  CDNLPVIPLSGEPL  481
            C NLPV+PLS  PL
Sbjct  149  CQNLPVLPLSSCPL  162



>ref|XP_008784259.1| PREDICTED: uncharacterized protein LOC103703257 [Phoenix dactylifera]
Length=204

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  53   NMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLL  232
            N   P  L SLNH+S VC SV +S+ FY+ VLGF  ++RP SF+F GAWLFNYG+GIHLL
Sbjct  11   NATLPPPLMSLNHVSFVCRSVSRSVKFYEEVLGFVSVKRPSSFNFHGAWLFNYGVGIHLL  70

Query  233  QAD--DNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFF  403
            Q +  D++PK    INPKDNHISFQC  +++++++LKEM IEYV   VE+  + VDQLFF
Sbjct  71   QCNSPDDVPKKKGVINPKDNHISFQCSDISLLKRKLKEMSIEYVTSVVEDSAIQVDQLFF  130

Query  404  HDPDGMMIEICNCDNLPVIPLSGEPLRPP  490
            HDPDG M+EICNC+NLPV+PLS  PL+ P
Sbjct  131  HDPDGYMVEICNCENLPVLPLSSFPLKFP  159



>ref|XP_009801533.1| PREDICTED: uncharacterized protein LOC104247275 [Nicotiana sylvestris]
Length=212

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            + L +LNH+S VC SV KS+ FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  +D 
Sbjct  27   MPLLALNHVSFVCKSVPKSVQFYEQVLGFVLIQRPSSFDFDGAWLFNHGIGIHLLGKEDA  86

Query  248  LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMI  427
              K   INPKDNHISFQC  M ++ +RL+E++IEYV   V+EGGV VDQLFFHDPDG MI
Sbjct  87   PSKKGKINPKDNHISFQCSDMNLIIERLEELKIEYVTATVKEGGVTVDQLFFHDPDGNMI  146

Query  428  EICNCDNLPVIPLSGEPLR  484
            EICNC N+P++PLS  PL+
Sbjct  147  EICNCQNIPILPLSSCPLK  165



>ref|XP_009785992.1| PREDICTED: uncharacterized protein LOC104234167 [Nicotiana sylvestris]
Length=222

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            E  + L +LNH+S VC SV +S  FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  
Sbjct  33   EKRMPLLALNHVSYVCKSVARSAQFYEQVLGFVLIKRPSSFDFDGAWLFNHGIGIHLLGK  92

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   K   INPKDNHISFQC  M ++ +RL E++IEYV   V+EGGV VDQLFFHDPDG
Sbjct  93   EDAQSKKGKINPKDNHISFQCSDMDLIIERLDELKIEYVTATVKEGGVTVDQLFFHDPDG  152

Query  419  MMIEICNCDNLPVIPLSGEPLRPPAGLT  502
             MIEICNC N+P++PLS  PL+  A  T
Sbjct  153  NMIEICNCQNIPILPLSSCPLKKFATPT  180



>ref|XP_006471156.1| PREDICTED: uncharacterized protein LOC102612635 [Citrus sinensis]
Length=210

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            N + + SLNH+S V  SVEKS+ FY+ VLGF  I+RP SF+F GAWLFN+GIGIHLL++D
Sbjct  21   NTMPILSLNHVSFVSKSVEKSVMFYEQVLGFVMIKRP-SFNFEGAWLFNHGIGIHLLESD  79

Query  242  DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
                K   INPKDNHISFQC  M +V ++L+EM IEY    V+EGG+ VDQLFFHDPDG 
Sbjct  80   KAPEKKGKINPKDNHISFQCSDMKLVMRKLEEMNIEYETAVVDEGGIQVDQLFFHDPDGY  139

Query  422  MIEICNCDNLPVIPLSGEPLRPPAG  496
            MIEICNC NLPV+PLS  PL+ P+ 
Sbjct  140  MIEICNCQNLPVLPLSSCPLKLPSA  164



>gb|ABK93893.1| unknown [Populus trichocarpa]
Length=209

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLF+YGIGIHLL++D    K 
Sbjct  29   SLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFKFEGAWLFSYGIGIHLLESDKAPTKK  88

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  89   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGYMVEICN  148

Query  440  CDNLPVIPLSGEPL  481
            C NLPV+PLS  PL
Sbjct  149  CQNLPVLPLSSCPL  162



>ref|XP_010930831.1| PREDICTED: uncharacterized protein LOC105051884 isoform X1 [Elaeis 
guineensis]
Length=204

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD-  241
            PL L SLNH+S VC SV +S+ FY+ VLGF  I+RP SF+F GAWLFNYG+GIHLLQ + 
Sbjct  15   PLPLMSLNHVSFVCRSVGRSVKFYEEVLGFVSIKRPASFNFHGAWLFNYGVGIHLLQCNS  74

Query  242  -DNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
             D++PK    INPKDNHISFQC  + +++ +L+EM IEYV   VE+ G+ VDQLFFHDPD
Sbjct  75   PDDVPKKKGVINPKDNHISFQCSDINLLKHKLEEMGIEYVTAVVEDSGIQVDQLFFHDPD  134

Query  416  GMMIEICNCDNLPVIPLSGEPLRPP  490
            G M+EICNC+NLPV+PLS  PL+ P
Sbjct  135  GYMVEICNCENLPVLPLSSCPLKFP  159



>ref|XP_006389542.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
 gb|ERP48456.1| hypothetical protein POPTR_0022s00750g [Populus trichocarpa]
Length=228

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLF+YGIGIHLL++D    K 
Sbjct  29   SLNHVSFVCKSVPESVKFYEDVLGFVLIKRPSSFKFEGAWLFSYGIGIHLLESDKAPTKK  88

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K+L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  89   SKINPKDNHISFQCSDMNLVIKKLEEKNIEYVTAVVEEGGITVDQLFFHDPDGYMVEICN  148

Query  440  CDNLPVIPLSGEPL  481
            C NLPV+PLS  PL
Sbjct  149  CQNLPVLPLSSCPL  162



>ref|XP_009621424.1| PREDICTED: uncharacterized protein LOC104113047 [Nicotiana tomentosiformis]
Length=223

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            E  + L +LNH+S VC SV +S  FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  
Sbjct  33   EKRMPLLALNHVSYVCKSVARSAQFYEQVLGFVLIKRPSSFDFDGAWLFNHGIGIHLLGK  92

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   K   INPKDNHISFQC  M ++ +RL+E++IEYV   V+EGGV VDQLFFHDPDG
Sbjct  93   EDAEAKKGKINPKDNHISFQCSDMDLIIERLEELKIEYVTATVKEGGVTVDQLFFHDPDG  152

Query  419  MMIEICNCDNLPVIPLSGEPLR  484
             MIEICNC N+P++PLS  PL+
Sbjct  153  NMIEICNCQNIPILPLSSCPLK  174



>ref|XP_010930832.1| PREDICTED: uncharacterized protein LOC105051884 isoform X2 [Elaeis 
guineensis]
Length=203

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD-  241
            PL L SLNH+S VC SV +S+ FY+ VLGF  I+RP SF+F GAWLFNYG+GIHLLQ + 
Sbjct  15   PLPLMSLNHVSFVCRSVGRSVKFYEEVLGFVSIKRPASFNFHGAWLFNYGVGIHLLQCNS  74

Query  242  -DNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
             D++PK    INPKDNHISFQC  + +++ +L+EM IEYV   VE+ G+ VDQLFFHDPD
Sbjct  75   PDDVPKKKGVINPKDNHISFQCSDINLLKHKLEEMGIEYVTAVVEDSGIQVDQLFFHDPD  134

Query  416  GMMIEICNCDNLPVIPLSGEPLRPP  490
            G M+EICNC+NLPV+PLS  PL+ P
Sbjct  135  GYMVEICNCENLPVLPLSSCPLKFP  159



>ref|XP_009770635.1| PREDICTED: uncharacterized protein LOC104221297 [Nicotiana sylvestris]
Length=222

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +2

Query  53   NMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLL  232
            N E  + L +LNH+S VC SV  S+ FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL
Sbjct  32   NEETRMPLLALNHVSYVCKSVPTSVQFYEQVLGFVLIQRPSSFDFEGAWLFNHGIGIHLL  91

Query  233  QADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
              +D   K   INPKDNHISFQC  M +  +RL EM+IEYV   V+EGGV VDQLFFHDP
Sbjct  92   GKEDAESKKGKINPKDNHISFQCSDMDLSIQRLDEMKIEYVTATVKEGGVTVDQLFFHDP  151

Query  413  DGMMIEICNCDNLPVIPLSGEPLR  484
            DG MIEICNC N+P++PLS  PL+
Sbjct  152  DGNMIEICNCQNIPILPLSSCPLK  175



>emb|CDO97602.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S VC SV +S+ FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL+  D 
Sbjct  47   LPLLSLNHVSFVCKSVSRSVRFYEEVLGFVLIKRPSSFDFEGAWLFNHGIGIHLLEVTDV  106

Query  248  LPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMI  427
              K   INPKDNHISFQC ++ ++ ++L++M IEYV   V+EGG+ VDQLFFHDPDG MI
Sbjct  107  PSKKGKINPKDNHISFQCTNVEVIMQKLEDMNIEYVTAVVKEGGITVDQLFFHDPDGYMI  166

Query  428  EICNCDNLPVIPLSGEPLR  484
            EICNC NLPV+PLS  PL+
Sbjct  167  EICNCQNLPVLPLSSCPLK  185



>ref|XP_006431676.1| hypothetical protein CICLE_v10002584mg [Citrus clementina]
 gb|ESR44916.1| hypothetical protein CICLE_v10002584mg [Citrus clementina]
Length=190

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNH+S VC SV++S+ FY+ VLGF  I+RP SF+F GAWLFN+GIGIHLL++D    K 
Sbjct  5    SLNHVSFVCKSVKRSVMFYEQVLGFVIIKRP-SFNFEGAWLFNHGIGIHLLESDKAPEKR  63

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M +V ++L+EM IEY    VEEGG+ VDQLFFHDPDG MIEICN
Sbjct  64   GKINPKDNHISFQCSDMKLVMRKLEEMNIEYETAVVEEGGIRVDQLFFHDPDGYMIEICN  123

Query  440  CDNLPVIPLSGEPLRPPA  493
            C NLPV+PLS  PL+ P+
Sbjct  124  CQNLPVLPLSSCPLKLPS  141



>gb|EYU26486.1| hypothetical protein MIMGU_mgv1a013702mg [Erythranthe guttata]
Length=212

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP  253
            L +LNH+S VC S++KS++FY  VLGF  I+RP SFDF GAWLFN+GIGIHLLQA++   
Sbjct  34   LLALNHVSFVCKSIKKSVEFYVQVLGFVLIKRPSSFDFEGAWLFNHGIGIHLLQAENIEK  93

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K + INPKD HISFQC  M ++  +L+EM IEYV   V EGG+ VDQ+FFHDPDG M+EI
Sbjct  94   KKSKINPKDCHISFQCTDMNLIISQLEEMNIEYVTAVVTEGGIIVDQIFFHDPDGYMVEI  153

Query  434  CNCDNLPVIPLSGEPLR  484
            CNC NLPV+PLS  PL+
Sbjct  154  CNCQNLPVLPLSSCPLK  170



>ref|XP_009608053.1| PREDICTED: uncharacterized protein LOC104102125 [Nicotiana tomentosiformis]
Length=220

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP  253
            L +LNH+S VC SV KS+ FY+ VLGF  I+RP SFDF GAWLFN+GIGIHLL  +D   
Sbjct  37   LLALNHVSFVCKSVSKSVQFYEQVLGFVLIQRPSSFDFDGAWLFNHGIGIHLLGKEDAAS  96

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQC  M ++ +RL+E++IEYV   V+EG V VDQLFFHDPDG MIEI
Sbjct  97   KKGKINPKDNHISFQCSDMDLIIERLEELKIEYVTTTVKEGRVTVDQLFFHDPDGNMIEI  156

Query  434  CNCDNLPVIPLSGEPLR  484
            CNC N+P++PLS  PL+
Sbjct  157  CNCQNIPILPLSSCPLK  173



>ref|XP_002526462.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF35957.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=234

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP  253
            L SLNH+S VC SV +S+ FY++VLGF  I+RP SF+F GAWLFNYGIGIHLL+A+D   
Sbjct  25   LLSLNHVSFVCKSVAESVRFYEDVLGFVLIQRPSSFNFEGAWLFNYGIGIHLLEAEDVPH  84

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQ   M +V + L+E  IEYV   VEEGG+ VDQLFFHDPDG M+EI
Sbjct  85   KKGPINPKDNHISFQTSDMDLVVRNLEEKNIEYVTAVVEEGGITVDQLFFHDPDGYMVEI  144

Query  434  CNCDNLPVIPLSGEPLRPP  490
            CNC NLPV+PLS  PL+ P
Sbjct  145  CNCQNLPVLPLSACPLKLP  163



>ref|XP_002263444.1| PREDICTED: uncharacterized protein LOC100266411 [Vitis vinifera]
Length=202

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +2

Query  86   NHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKVTN  265
            NH+S VC SV KS+ FY+ VLGF  I+RP SFDF GAWLFNYGIGIHLL++++   K   
Sbjct  33   NHVSFVCKSVPKSVKFYEEVLGFVLIKRPSSFDFEGAWLFNYGIGIHLLESEEVPAKKGA  92

Query  266  INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICNCD  445
            INPKDNHISFQ   M +V K+L EM+IEYV   V+EGGV VDQLFFHDPDG M+EICNC 
Sbjct  93   INPKDNHISFQSSDMGLVVKKLGEMKIEYVTAVVKEGGVKVDQLFFHDPDGYMVEICNCQ  152

Query  446  NLPVIPLSGEPL  481
            NLPV+PLS  P+
Sbjct  153  NLPVLPLSSCPI  164



>emb|CBI29715.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +2

Query  86   NHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKVTN  265
            NH+S VC SV KS+ FY+ VLGF  I+RP SFDF GAWLFNYGIGIHLL++++   K   
Sbjct  20   NHVSFVCKSVPKSVKFYEEVLGFVLIKRPSSFDFEGAWLFNYGIGIHLLESEEVPAKKGA  79

Query  266  INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICNCD  445
            INPKDNHISFQ   M +V K+L EM+IEYV   V+EGGV VDQLFFHDPDG M+EICNC 
Sbjct  80   INPKDNHISFQSSDMGLVVKKLGEMKIEYVTAVVKEGGVKVDQLFFHDPDGYMVEICNCQ  139

Query  446  NLPVIPLSGEPL  481
            NLPV+PLS  P+
Sbjct  140  NLPVLPLSSCPI  151



>ref|XP_004231328.1| PREDICTED: glyoxalase domain-containing protein 5-like [Solanum 
lycopersicum]
Length=201

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            +LNH+S +C SV KS+ FY+ VLGF  I+RP SF F GAWLFN+GIGIHLL  +D   K 
Sbjct  17   ALNHVSYICKSVPKSVKFYEQVLGFSLIQRPSSFQFEGAWLFNHGIGIHLLGKEDVQSKR  76

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
              INPKDNHISFQC  M ++ +RL EM +EYV   V+EGGV+VDQLFFHDPDG MIEICN
Sbjct  77   GKINPKDNHISFQCTDMDLIIQRLNEMNVEYVTATVKEGGVNVDQLFFHDPDGNMIEICN  136

Query  440  CDNLPVIPLSGEPLRPPAGL  499
            C N+P+IPLS  P++  + L
Sbjct  137  CQNIPIIPLSSCPIKKLSNL  156



>ref|XP_003597869.1| hypothetical protein MTR_2g103460 [Medicago truncatula]
 gb|AES68120.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=171

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            M   + NPLRLKS+NHIS++C SV+ ++ FY+NVLGF  I RPGSF+F GAWLF +GIGI
Sbjct  1    MDAIVGNPLRLKSVNHISLICRSVDVTVAFYENVLGFVSIVRPGSFNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCE-SMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            HLL+A+D   +P+   IN KDNHISFQC+ S+  VEK L + +I   +  VEE G+ VDQ
Sbjct  61   HLLKAEDPEKIPRKKEINTKDNHISFQCDGSIDAVEKYLNDKKIVCKRALVEENGIQVDQ  120

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGE  475
            LFFHDPDG MIEICNCD+LPVIPL+GE
Sbjct  121  LFFHDPDGFMIEICNCDSLPVIPLAGE  147



>ref|XP_011047942.1| PREDICTED: uncharacterized protein LOC105142135 [Populus euphratica]
Length=211

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +2

Query  80   SLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKV  259
            SLNHIS VC SV +S+ FY++VLGF  I+RP SF F GAWLFNYGIGIHLL++D    K 
Sbjct  31   SLNHISFVCKSVPESVKFYEDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESDKAPTKK  90

Query  260  TNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICN  439
            + INPKDNHISFQC  M +V K L++  IEYV   VEEGG+ VDQLFFHDPDG M+EICN
Sbjct  91   SKINPKDNHISFQCSDMNLVIKELEKKNIEYVTAVVEEGGITVDQLFFHDPDGYMVEICN  150

Query  440  CDNLPVIPLSGEPL  481
            C NLPV+PL   PL
Sbjct  151  CQNLPVLPLPSCPL  164



>ref|XP_003592932.1| Metallothiol transferase fosB [Medicago truncatula]
 gb|AES63183.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=181

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD-  241
            PL L SLNH+S VC S+++S+ FY+NVLGF  I+RP SF F+GAWLFNYGIGIHLL+ + 
Sbjct  2    PLPLLSLNHVSFVCRSLQESVKFYENVLGFVLIKRPSSFKFQGAWLFNYGIGIHLLETES  61

Query  242  DNLP-KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            D +P K   IN K+NHISFQC  M ++ K L EM IEY    VE+GG+ VDQLFFHDPDG
Sbjct  62   DKVPVKRGEINTKENHISFQCSDMKLIMKNLDEMNIEYKTAVVEDGGIKVDQLFFHDPDG  121

Query  419  MMIEICNCDNLPVIPLSGEPLRPPA  493
             MIE+CNC NLPV+P+S  PL+ P 
Sbjct  122  YMIEMCNCQNLPVLPISTCPLKQPT  146



>ref|XP_009606733.1| PREDICTED: uncharacterized protein LOC104101037 [Nicotiana tomentosiformis]
Length=221

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLP  253
            L +LNH+S VC SV  S+ F++ VLGF  I+RP SFDF GAWLFN+GIGIHLL  +D   
Sbjct  38   LLALNHVSYVCKSVPTSVQFFEQVLGFVLIQRPSSFDFEGAWLFNHGIGIHLLGKEDAKS  97

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQC  M ++ +RLKE++IEYV   V+EGGV VDQLFFHDPDG MIEI
Sbjct  98   KKERINPKDNHISFQCSDMDLIIERLKELKIEYVTATVKEGGVTVDQLFFHDPDGNMIEI  157

Query  434  CNCDNLPVIPLSGEPLR  484
            CNC  +P++PLS  PL+
Sbjct  158  CNCQTIPILPLSSCPLK  174



>ref|XP_007148556.1| hypothetical protein PHAVU_006G218600g [Phaseolus vulgaris]
 gb|ESW20550.1| hypothetical protein PHAVU_006G218600g [Phaseolus vulgaris]
Length=231

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD  244
            P+ L SLNH+S VC SV +S+ FY++VLGF  I+RP SF F GAWLFNYGIGIHLL++  
Sbjct  54   PMPLLSLNHVSFVCKSVSESVKFYEDVLGFVLIKRPSSFKFEGAWLFNYGIGIHLLESAK  113

Query  245  NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMM  424
               K   INPK+NHISFQC  M ++ ++L  M+I YV   VEEGG+ VDQLFFHDPDG M
Sbjct  114  IPVKKREINPKENHISFQCSDMRLIMQKLDAMDIVYVTAVVEEGGIQVDQLFFHDPDGYM  173

Query  425  IEICNCDNLPVIPLSGEPLR  484
            IEICNC NLPV+P+S  PL+
Sbjct  174  IEICNCQNLPVLPISSCPLK  193



>ref|XP_006349336.1| PREDICTED: uncharacterized protein LOC102593899 [Solanum tuberosum]
Length=207

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
            N + + +LNH+S +C SV KS+ FY+ VLGF  I+RP SF F GAWLFN+GIGIHLL  +
Sbjct  18   NSMPMLALNHVSYICKSVPKSVKFYEQVLGFTLIQRPSSFQFEGAWLFNHGIGIHLLGKE  77

Query  242  DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
            D       INPKDNHISFQC  M ++ +RL +M +EYV   V+EGG  VDQLFFHDPDG 
Sbjct  78   DAQSNKGKINPKDNHISFQCTDMDIIIQRLNDMNVEYVTATVKEGGATVDQLFFHDPDGN  137

Query  422  MIEICNCDNLPVIPLSGEPLRPPAGL  499
            MIEICNC N+P+IPLS  PL   + L
Sbjct  138  MIEICNCQNIPIIPLSSCPLNKLSNL  163



>ref|XP_010263899.1| PREDICTED: uncharacterized protein LOC104602043 [Nelumbo nucifera]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ--  235
            + L L SLNH+S +C S+  S+ FY++VLGF  I+RP SF F GAWLFNYG+GIHLL+  
Sbjct  11   STLPLLSLNHVSFLCRSISTSVRFYEDVLGFASIKRPSSFKFNGAWLFNYGVGIHLLENT  70

Query  236  -ADDNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
              D N+ K +  INPKDNHISFQC  + +V+ +LKE  ++YV   VEEGG+ VDQ+FFHD
Sbjct  71   SVDANILKESRPINPKDNHISFQCTDVEVVKMKLKEWGMKYVTAVVEEGGIKVDQVFFHD  130

Query  410  PDGMMIEICNCDNLPVIPLSGEPLR  484
            PDG MIEICNCDNLPV+PLS  PLR
Sbjct  131  PDGYMIEICNCDNLPVLPLSSCPLR  155



>ref|XP_009355289.1| PREDICTED: uncharacterized protein LOC103946346 [Pyrus x bretschneideri]
Length=226

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD---NLP  253
            LNH+S VC SV KS+ FY++VLGF  I+RP SF F GAWLFN+G+GIHLL++D       
Sbjct  38   LNHVSFVCKSVSKSVRFYEDVLGFVLIQRPSSFKFEGAWLFNHGVGIHLLESDTINAAEK  97

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQC  MA+V ++L+EM++EYV  +VEEGGV VDQLFFHDPDG M+EI
Sbjct  98   KCRKINPKDNHISFQCSDMAVVVQKLEEMKVEYVTAQVEEGGVTVDQLFFHDPDGYMLEI  157

Query  434  CNCDNLPVIPLSG  472
            CNC NLPV+P+S 
Sbjct  158  CNCHNLPVLPISS  170



>ref|XP_010033467.1| PREDICTED: uncharacterized protein LOC104422744 [Eucalyptus grandis]
 gb|KCW53107.1| hypothetical protein EUGRSUZ_J02400 [Eucalyptus grandis]
Length=196

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 112/148 (76%), Gaps = 5/148 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ----  235
            L L SLNH+S++C SV +S+ FY++VLGF  I+RP SFDF GAWL+NYGIGIHL++    
Sbjct  19   LPLLSLNHVSLMCRSVRESVRFYEDVLGFVLIKRPSSFDFNGAWLYNYGIGIHLIENPSI  78

Query  236  -ADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
              +D + +   INPKDNH+SFQC  + +V++RL+EM + YV   VEE GV VDQ+FFHDP
Sbjct  79   EENDAIDEPRPINPKDNHMSFQCTDVGLVKRRLQEMGMRYVTAVVEEAGVKVDQVFFHDP  138

Query  413  DGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            DG MIEICNCDN+P++P+S  P +P  G
Sbjct  139  DGYMIEICNCDNIPILPISSCPFKPKLG  166



>ref|XP_008365316.1| PREDICTED: uncharacterized protein LOC103428958 [Malus domestica]
Length=272

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD---NLP  253
            LNH+S VC SV KS+ FY++VLGF  I+RP SF F GAWLFN+G+GIHLL++D    +  
Sbjct  78   LNHVSFVCKSVSKSVRFYEDVLGFVLIQRPSSFKFEGAWLFNHGVGIHLLESDTINASEK  137

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQC  MA+V ++L+EM+IEYV  +VEEGGV VDQLFFHDPDG M+EI
Sbjct  138  KCRKINPKDNHISFQCSDMAVVVQKLEEMKIEYVTAQVEEGGVTVDQLFFHDPDGYMLEI  197

Query  434  CNCDNLPVIPLSGE  475
            CNC NLPV+P+S  
Sbjct  198  CNCHNLPVLPISSS  211



>ref|XP_011088117.1| PREDICTED: uncharacterized protein LOC105169423 [Sesamum indicum]
Length=141

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  47   KENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIH  226
            KE  E P    +LNH+S VC SV KS++FY+ VLGF  I+RP SFDF GAWLFN+GIGIH
Sbjct  10   KEMREMPFL--ALNHVSFVCKSVAKSVEFYEQVLGFVLIKRPSSFDFEGAWLFNHGIGIH  67

Query  227  LLQADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFH  406
            LLQAD+   K   INPKDNHISFQC  M M+ K+L+EM+IEYVK  V EGG+ VDQ+FFH
Sbjct  68   LLQADNVAGKKGKINPKDNHISFQCSDMDMIMKQLEEMKIEYVKAVVREGGIIVDQIFFH  127

Query  407  DPDGMMIEICNC  442
            DPDG MIEICNC
Sbjct  128  DPDGYMIEICNC  139



>ref|XP_010263898.1| PREDICTED: uncharacterized protein LOC104602042 [Nelumbo nucifera]
Length=197

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +2

Query  44   MKENMEN-PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            ++E +EN  L   SLNH+S +C SV ++  FYQ VLGF  ++RP SFDF GAWLFNYGIG
Sbjct  3    IREELENSALPFLSLNHVSFLCKSVTETAKFYQEVLGFVLVKRPSSFDFEGAWLFNYGIG  62

Query  221  IHLLQ---ADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            IHLLQ    DD L K + I PKDNHISFQC  + +V+++L+EM ++YV    EEG + VD
Sbjct  63   IHLLQCDSVDDVLQKPSIIKPKDNHISFQCTDVELVKRKLEEMGMKYVTAVDEEGEIKVD  122

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            QLFFHDPDG MIEICNC+ LPV+PLS   L+
Sbjct  123  QLFFHDPDGYMIEICNCEKLPVLPLSSCSLK  153



>ref|XP_010277693.1| PREDICTED: uncharacterized protein LOC104612074 [Nelumbo nucifera]
Length=215

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--DN  247
            L +LNH+S VC SV++S+ FY+  LGF  I+RP SF F GAWLFNYGIGIHLLQ +  D+
Sbjct  39   LLALNHVSFVCRSVKESVRFYEEALGFVMIKRPSSFKFEGAWLFNYGIGIHLLQCNSPDD  98

Query  248  LP-KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMM  424
            +P K   INPKDNHISFQC  M +V K+L+++ I+YV   VE+ G+ VDQLFFHDPDG M
Sbjct  99   VPEKKEVINPKDNHISFQCSDMRLVMKKLEKVNIDYVTAVVEDSGIKVDQLFFHDPDGYM  158

Query  425  IEICNCDNLPVIPLSGEPLRPP  490
            +EICNCDNLPV+PL   PL+ P
Sbjct  159  VEICNCDNLPVLPLYSCPLKLP  180



>ref|XP_009403272.1| PREDICTED: uncharacterized protein LOC103986843 [Musa acuminata 
subsp. malaccensis]
Length=181

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +2

Query  62   NPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD  241
             PL + SLNH+S +CSS+ +S+ FY+ VLGF  IRRP SFDF+GAW +NYGIGIHL+Q+ 
Sbjct  13   TPLPVVSLNHVSFLCSSLHESVRFYEEVLGFQLIRRPSSFDFQGAWFYNYGIGIHLVQSP  72

Query  242  DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
            + + K + INPK NHISFQC  M  V++RL +M I YV   V EGG+ VDQLFFHDPD  
Sbjct  73   EAVSKPSEINPKANHISFQCADMGRVKQRLDQMGISYVTAVVTEGGIRVDQLFFHDPDNN  132

Query  422  MIEICNCDNLPVIPLS--GEPLRPPAGLT  502
            MIEIC+C+ LP++PLS    PL+ P   T
Sbjct  133  MIEICDCEKLPIVPLSFPFAPLKTPQFCT  161



>gb|ABK22105.1| unknown [Picea sitchensis]
 gb|ABK25204.1| unknown [Picea sitchensis]
 gb|ABK25471.1| unknown [Picea sitchensis]
 gb|ABK26824.1| unknown [Picea sitchensis]
 gb|ABR17047.1| unknown [Picea sitchensis]
 gb|ACN40589.1| unknown [Picea sitchensis]
Length=199

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  35   QEKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYG  214
            +E+++ +  +PL L SLNH+S VC SV+ S  FY+ +LGF  ++RP SFDF G WLFNYG
Sbjct  3    KEEVQISRPSPLPLLSLNHVSFVCKSVKASTKFYETILGFQVVKRPSSFDFEGVWLFNYG  62

Query  215  IGIHLLQA--DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHV  388
            +GIHLLQ    D++PK + INP+DNHISFQC  +  VE +L+E++I+Y K  VE+ G+ V
Sbjct  63   VGIHLLQCKPSDDIPKKSVINPRDNHISFQCPDIFSVESKLQELDIKYEKRIVEDDGLFV  122

Query  389  DQLFFHDPDGMMIEICNCDNLPVIPL  466
            +QLFFHDPDG M+EICNC+NLPVIPL
Sbjct  123  NQLFFHDPDGYMVEICNCENLPVIPL  148



>ref|XP_009415753.1| PREDICTED: glyoxalase domain-containing protein 5-like [Musa 
acuminata subsp. malaccensis]
Length=158

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +2

Query  47   KENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIH  226
            +E M +   L SLNH+S +C SV +S+ FYQ VLGF  I+RP SF F+GAWLFNYGIGIH
Sbjct  8    EEAMSSMPPLMSLNHVSFMCRSVSQSVKFYQEVLGFVSIKRPSSFSFKGAWLFNYGIGIH  67

Query  227  LLQ---ADDNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            LLQ   +++NLPK    INPKDNHISFQC +M ++  +LK+M +EYV  +VEE G+ VDQ
Sbjct  68   LLQCNTSEENLPKRKGVINPKDNHISFQCSNMKLLMLKLKKMGVEYVTAKVEEEGIQVDQ  127

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            LFFHDPDG MIEICNCDNLPV+PLS   LR
Sbjct  128  LFFHDPDGNMIEICNCDNLPVLPLSPCRLR  157



>ref|XP_009402807.1| PREDICTED: uncharacterized protein LOC103986514 [Musa acuminata 
subsp. malaccensis]
Length=207

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = +2

Query  41   KMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIG  220
            +M+E  E PL   SLNH+S VC SV +S+ FY+ VLGF  I+RP SF+F GAWLFNYGIG
Sbjct  2    EMQEVEETPL--VSLNHVSFVCRSVTRSVKFYEEVLGFASIKRPSSFNFHGAWLFNYGIG  59

Query  221  IHLLQ--ADDNLPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVD  391
            IHLLQ  +++ +PK    INPK++HISFQC +M  ++++L+   +EYV   VEEG V V 
Sbjct  60   IHLLQCNSEEGMPKKKAVINPKEDHISFQCSNMQALKRKLERTGVEYVTAVVEEGSVQVR  119

Query  392  QLFFHDPDGMMIEICNCDNLPVIPLSGEPLR  484
            QLFFHDPDG MIEICNC++LPV+PLS  P++
Sbjct  120  QLFFHDPDGHMIEICNCEDLPVLPLSSCPVK  150



>ref|XP_010459071.1| PREDICTED: uncharacterized protein LOC104740226 isoform X2 [Camelina 
sativa]
Length=148

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +2

Query  125  LDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD--NLPKVTNINPKDNHISFQ  298
            + FY  VLGF PIRRP S +F GAWLF +GIGIHLL++ +   LPK T INPKDNHISFQ
Sbjct  1    MSFYHKVLGFIPIRRPESLNFEGAWLFGHGIGIHLLRSPEPEKLPKKTAINPKDNHISFQ  60

Query  299  CESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICNCDNLPVIPLSG  472
            CESM  VEK+L++MEI+YV+  VEEGG+ VDQLFFHDPDG MIEICNCD+LPV+PL G
Sbjct  61   CESMGAVEKKLEDMEIKYVRALVEEGGIQVDQLFFHDPDGFMIEICNCDSLPVVPLVG  118



>ref|XP_006383134.1| hypothetical protein POPTR_0005s11890g [Populus trichocarpa]
 gb|ERP60931.1| hypothetical protein POPTR_0005s11890g [Populus trichocarpa]
Length=192

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF+F GAWL+NYGIGIHL++    
Sbjct  14   LPLLSLNHVSLLCRSVWASVRFYEDVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIENPSI  73

Query  242  ----DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
                D + +   INPKDNH+SFQC  + +V++RL+EM + YV   VEE G+ VDQ+FFHD
Sbjct  74   DHEFDTIVEPRPINPKDNHMSFQCTDVGLVKRRLQEMGMRYVTAVVEEDGIMVDQVFFHD  133

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            PDG M+EICNCDN+P++PLS  PL+P  G
Sbjct  134  PDGYMVEICNCDNIPILPLSSCPLKPRMG  162



>ref|XP_008357640.1| PREDICTED: uncharacterized protein LOC103421393 [Malus domestica]
Length=337

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +2

Query  83   LNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADD---NLP  253
            LNH+S VC SV KS+ FY++VLGF  I+RP SF F GAWLFN+G+GIHLL++D    +  
Sbjct  78   LNHVSFVCKSVSKSVRFYEDVLGFVLIQRPSSFKFEGAWLFNHGVGIHLLESDTIXASEK  137

Query  254  KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
            K   INPKDNHISFQC  MA+V ++L+EM+IEYV  +VEEGGV VDQLFFHDPD  M+EI
Sbjct  138  KCRKINPKDNHISFQCSDMAVVVQKLEEMKIEYVTAQVEEGGVTVDQLFFHDPDXYMLEI  197

Query  434  CNCDNLPVIPLSG  472
            CNC NLPV+P+S 
Sbjct  198  CNCHNLPVLPISS  210



>gb|EMS60611.1| hypothetical protein TRIUR3_34137 [Triticum urartu]
Length=285

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  95   SIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--DNLPKVTNI  268
            ++V   V +SLDFY NVLGF PIRRPGSFDF GAWLFNYGIGIHLLQ++  ++LP    I
Sbjct  11   TLVSMWVGESLDFYMNVLGFTPIRRPGSFDFDGAWLFNYGIGIHLLQSEHPESLPAKKEI  70

Query  269  NPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEICNCDN  448
            NPKDNHISFQCESM  VE+RLKE+ I Y++  VEEGG++VDQ+FFHDPDG MIEICNC  
Sbjct  71   NPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEGGIYVDQIFFHDPDGFMIEICNCAK  130

Query  449  LPVI  460
            LP +
Sbjct  131  LPAL  134


 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +2

Query  200  LFNYGIGIHLLQADDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGG  379
            L +Y   I  ++A   L       PKDNHISFQCESM  VE+RLKE+ I Y++  VEEGG
Sbjct  168  LISYTGRILHVRASRELTGEEGDQPKDNHISFQCESMVAVERRLKELGIPYIQRCVEEGG  227

Query  380  VHVDQLFFHDPDGMMIEICNCDNLPVIPLSGE  475
            ++VDQ+FFHDPDG MIEICNCD LPV+PL+G+
Sbjct  228  IYVDQIFFHDPDGFMIEICNCDKLPVVPLAGQ  259



>ref|XP_004512116.1| PREDICTED: uncharacterized protein LOC101496496 [Cicer arietinum]
Length=202

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++CSSV  S+ FY+ VLGF PI+RP SF F GAW +NYGIGIHL+Q    
Sbjct  25   LPLLSLNHVSLLCSSVLDSMKFYEEVLGFVPIKRPSSFKFNGAWFYNYGIGIHLIQNPEI  84

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  ++YV   V+EGG+ VDQ+FFHD
Sbjct  85   DEFDTYINESRPINPKDNHISFQCTDVELVKKRLEEKGMKYVTAVVDEGGIQVDQVFFHD  144

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRP  487
            PDG MIE+CNC+N+P+IP+S    +P
Sbjct  145  PDGYMIELCNCENIPIIPVSSCSFKP  170



>gb|ABD28405.2| Glyoxalase/bleomycin resistance protein/dioxygenase [Medicago 
truncatula]
Length=183

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 15/159 (9%)
 Frame = +2

Query  44   MKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            M   + NPLRLKS+NHIS++C SV+ ++ FY+NVLGF  I RPGSF+F GAWLF +GIGI
Sbjct  1    MDAIVGNPLRLKSVNHISLICRSVDVTVAFYENVLGFVSIVRPGSFNFEGAWLFGHGIGI  60

Query  224  HLLQADD--NLPKVTNINPKDNHISFQCE-------------SMAMVEKRLKEMEIEYVK  358
            HLL+A+D   +P+   IN KDNHISFQ               S+  VEK L + +I   +
Sbjct  61   HLLKAEDPEKIPRKKEINTKDNHISFQARLIDFNSIHCRCDGSIDAVEKYLNDKKIVCKR  120

Query  359  CRVEEGGVHVDQLFFHDPDGMMIEICNCDNLPVIPLSGE  475
              VEE G+ VDQLFFHDPDG MIEICNCD+LPVIPL+GE
Sbjct  121  ALVEENGIQVDQLFFHDPDGFMIEICNCDSLPVIPLAGE  159



>ref|XP_011028775.1| PREDICTED: uncharacterized protein LOC105128688 [Populus euphratica]
Length=192

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 11/162 (7%)
 Frame = +2

Query  44   MKENMENP-----LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFN  208
            MK  +E P     L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF+F GAWL+N
Sbjct  1    MKVEIEEPSSHEALPLLSLNHVSLLCRSVWASVRFYEDVLGFVLIKRPSSFNFNGAWLYN  60

Query  209  YGIGIHLLQAD------DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVE  370
            YGIGIHL++        D + +   INPKDNH+SFQC  + +V++RL+EM + YV   VE
Sbjct  61   YGIGIHLIENPSIDHEFDTIVEPRPINPKDNHMSFQCTDVGLVKRRLQEMGMRYVTAVVE  120

Query  371  EGGVHVDQLFFHDPDGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            E G+ VDQ+FFHDPDG M+EICNCD++P++PLS  P++P  G
Sbjct  121  EDGIMVDQVFFHDPDGYMVEICNCDSIPILPLSSCPVKPRMG  162



>ref|XP_002310845.1| hypothetical protein POPTR_0007s13840g [Populus trichocarpa]
 gb|EEE91295.1| hypothetical protein POPTR_0007s13840g [Populus trichocarpa]
Length=191

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV  S  FY++VLGF  I+RP SF+F GAWL+NYGIGIHL++    
Sbjct  14   LPLLSLNHVSLLCRSVWASARFYEHVLGFVHIKRPSSFNFNGAWLYNYGIGIHLIENPSI  73

Query  242  ---DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
               D++ +   INPKDNH+SFQC  + +V+++L+EM + YV   VEE G+ VDQ+FFHDP
Sbjct  74   DEFDSIVEPRPINPKDNHMSFQCTDVGLVKRKLQEMGMRYVTAVVEEDGIKVDQVFFHDP  133

Query  413  DGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            DG M+EICNCDN+P++PLS  P +P  G
Sbjct  134  DGYMVEICNCDNIPILPLSSCPFKPRTG  161



>ref|XP_007157944.1| hypothetical protein PHAVU_002G111300g [Phaseolus vulgaris]
 gb|AGV54703.1| lactoylglutathione lyase [Phaseolus vulgaris]
 gb|ESW29938.1| hypothetical protein PHAVU_002G111300g [Phaseolus vulgaris]
Length=194

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 109/146 (75%), Gaps = 6/146 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV +S+ FY++VLGF PI+RP SF+F GAW +NYG+GIHL++    
Sbjct  16   LPLLSLNHVSLLCRSVWESMRFYEDVLGFVPIKRPSSFNFTGAWFYNYGVGIHLIENPHI  75

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  + YV   VEEGG  VDQ+FFHD
Sbjct  76   DEFDTCVNEFRPINPKDNHISFQCTDVELVKKRLEEKGMRYVTAVVEEGGAKVDQVFFHD  135

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRP  487
            PDG MIE+CNC+N+P+IP+S   L+P
Sbjct  136  PDGYMIELCNCENIPIIPISSCSLKP  161



>ref|NP_001237480.1| uncharacterized protein LOC100305841 [Glycine max]
 gb|ACU13717.1| unknown [Glycine max]
 gb|KHN41915.1| hypothetical protein glysoja_003655 [Glycine soja]
Length=192

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV +S+ FY++VLGF PI+RP SF F GAW +NYGIGIHL++    
Sbjct  14   LPLLSLNHVSLLCRSVWESMRFYEDVLGFVPIKRPSSFKFTGAWFYNYGIGIHLIENPNI  73

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  + YV   VEEGG+ VDQ+FFHD
Sbjct  74   DEFDTCVVEERPINPKDNHISFQCTDVELVKKRLEERGMRYVTAVVEEGGIQVDQVFFHD  133

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRP  487
            PDG MIE+CNC+N+P+IP+S    +P
Sbjct  134  PDGYMIELCNCENIPIIPISSCSFKP  159



>ref|XP_010271469.1| PREDICTED: uncharacterized protein LOC104607511 [Nelumbo nucifera]
Length=210

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +2

Query  86   NHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDNLPKVTN  265
            NH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWLFNYG+GIHLL+       V N
Sbjct  19   NHVSLLCRSVSNSVRFYEQVLGFVSIKRPSSFNFHGAWLFNYGVGIHLLENTSENANVPN  78

Query  266  ----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGMMIEI  433
                INPKDNHISFQC  + +V+ +L+EM ++YV   VEE G  VDQ+FFHDPDG MIEI
Sbjct  79   QSRPINPKDNHISFQCTDVGIVKMKLQEMGMKYVTALVEEEGNKVDQVFFHDPDGYMIEI  138

Query  434  CNCDNLPVIPLSGEPLR  484
            CNC+N+PV+PLS  PLR
Sbjct  139  CNCENIPVVPLSACPLR  155



>ref|XP_006425532.1| hypothetical protein CICLE_v10026552mg [Citrus clementina]
 ref|XP_006466913.1| PREDICTED: lactoylglutathione lyase-like [Citrus sinensis]
 gb|ESR38772.1| hypothetical protein CICLE_v10026552mg [Citrus clementina]
 gb|KDO71122.1| hypothetical protein CISIN_1g029033mg [Citrus sinensis]
Length=191

 Score =   176 bits (446),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ--AD  241
            L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF+F GAWL+NYGIGIHL++  + 
Sbjct  14   LPLLSLNHVSLLCRSVWDSVRFYEDVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIENPSI  73

Query  242  DNLPKVTN---INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
            D+   VT    INPKDNHISFQC  +A+V++RL++M + YV   VE+ G  VDQ+FFHDP
Sbjct  74   DDFDTVTEPRPINPKDNHISFQCTDVALVKRRLEDMGMRYVTAVVEDDGTRVDQVFFHDP  133

Query  413  DGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            DG MIE+CNC+N+P+IPL     +P  G
Sbjct  134  DGYMIELCNCENIPIIPLYSCSFKPRMG  161



>ref|XP_010919439.1| PREDICTED: uncharacterized protein LOC105043568 [Elaeis guineensis]
Length=184

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 3/138 (2%)
 Frame = +2

Query  65   PLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA--  238
            PL L SLNH+S +C+S++ S+ FYQ VLGF  ++RP S DF GAWL+ YGIGIHLLQ   
Sbjct  13   PLPLGSLNHVSFLCASIKDSVKFYQEVLGFDLVKRPASLDFEGAWLYKYGIGIHLLQRGP  72

Query  239  -DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPD  415
              D L K + INPKDNHISFQC  M MV K+L++M I +V   V+EG + VDQ+FFHDPD
Sbjct  73   NSDALAKSSAINPKDNHISFQCTDMGMVRKKLEDMGINFVNGVVKEGNLEVDQVFFHDPD  132

Query  416  GMMIEICNCDNLPVIPLS  469
              MIEIC+C  LPV+PLS
Sbjct  133  DNMIEICDCQKLPVVPLS  150



>ref|XP_002531512.1| lactoylglutathione lyase, putative [Ricinus communis]
 gb|EEF30866.1| lactoylglutathione lyase, putative [Ricinus communis]
Length=189

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 108/148 (73%), Gaps = 5/148 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ--AD  241
            L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF+F GAWL+NYGIGIHL++  A 
Sbjct  12   LPLLSLNHVSLLCRSVWASVRFYEDVLGFVMIKRPSSFNFNGAWLYNYGIGIHLIENPAL  71

Query  242  DNLPKVTN---INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
            D    +     INPKDNHISFQC  + +V++RL+EM + YV   VE+ G  VDQ+FFHDP
Sbjct  72   DEFDPIIEPRPINPKDNHISFQCTDVGLVKRRLQEMGMRYVTAVVEDAGNKVDQVFFHDP  131

Query  413  DGMMIEICNCDNLPVIPLSGEPLRPPAG  496
            DG M+EICNC+N+P+IPLS    RP  G
Sbjct  132  DGYMVEICNCENIPIIPLSSCIFRPSMG  159



>ref|NP_001238378.1| uncharacterized protein LOC100499688 [Glycine max]
 gb|ACU13250.1| unknown [Glycine max]
Length=192

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV  S+ FY++VLGF PI+RP SF F GAW +NYGIGIHL++    
Sbjct  14   LPLLSLNHVSLLCRSVRVSMRFYEDVLGFVPIKRPSSFKFTGAWFYNYGIGIHLIENPNI  73

Query  242  DNLPKVTN----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
            D      N    INPKDNHISFQC  + +V+KRL+E  + YV   VEEGG+ VDQ+FFHD
Sbjct  74   DEFDTCVNEERPINPKDNHISFQCTDVELVKKRLEERGMRYVTAVVEEGGIQVDQVFFHD  133

Query  410  PDGMMIEICNCDNLPVIPLSGEPLRP  487
            PDG MIE+C+C+N+P+IP+S    +P
Sbjct  134  PDGYMIELCDCENIPIIPISSCSFKP  159



>ref|XP_007203893.1| hypothetical protein PRUPE_ppa012053mg [Prunus persica]
 gb|EMJ05092.1| hypothetical protein PRUPE_ppa012053mg [Prunus persica]
Length=185

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 109/145 (75%), Gaps = 9/145 (6%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  SL FY++VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWDSLRFYEDVLGFVVIKRPSSFNFNGAWLYNYGIGIHLIES---  68

Query  248  LPKVTN-----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
             P + +     INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDP
Sbjct  69   -PAMEDYESRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDP  127

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P+IP+S    +P
Sbjct  128  DGYMIELCNCENIPIIPISACAFKP  152



>ref|XP_002967188.1| hypothetical protein SELMODRAFT_439738 [Selaginella moellendorffii]
 gb|EFJ31787.1| hypothetical protein SELMODRAFT_439738 [Selaginella moellendorffii]
Length=174

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +2

Query  47   KENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIH  226
            K+    PL L SLNHIS  CS+V++S+DFY NVLGF P++RPG+ +F GAWL+NYGIGIH
Sbjct  4    KKWQSTPLPLASLNHISRNCSNVQESMDFYVNVLGFIPVKRPGALNFEGAWLYNYGIGIH  63

Query  227  LLQADDNLPKVTN----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQ  394
            LLQ +  +   TN    IN + +HISFQCE + +VEK+L E    +V+  VEE G+ V+Q
Sbjct  64   LLQREPGITYTTNKSDQINTRADHISFQCEDIDLVEKKLVEAGSAFVRRVVEEAGIEVEQ  123

Query  395  LFFHDPDGMMIEICNCDNLPVIPLSG  472
            +FFHDPDG MIE+C C+ LP+ PL G
Sbjct  124  IFFHDPDGFMIEVCTCEKLPLEPLIG  149



>ref|XP_009378199.1| PREDICTED: uncharacterized protein LOC103966725 [Pyrus x bretschneideri]
Length=184

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 109/145 (75%), Gaps = 9/145 (6%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWTSMRFYEEVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIES---  68

Query  248  LPKVTN-----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
             P + +     INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDP
Sbjct  69   -PAMEDYELRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDP  127

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P+IP+S   L+P
Sbjct  128  DGYMIELCNCENIPIIPISACSLKP  152



>ref|XP_009618674.1| PREDICTED: uncharacterized protein LOC104110822 [Nicotiana tomentosiformis]
Length=212

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            E  + L +LNH+S VC SV KS+ FY  VL F  ++RP SFDF GAWLFN+GIGIHLL  
Sbjct  25   EKRMPLLALNHVSYVCKSVPKSVQFYVEVLDFVLVQRPSSFDFEGAWLFNHGIGIHLLGK  84

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   K   INPKDNHISFQC+ M ++ ++L +M IEYV   V++  + VDQLFFHDPDG
Sbjct  85   EDVQQKKGKINPKDNHISFQCKGMDLIMQKLGDMNIEYVTATVKDNEIIVDQLFFHDPDG  144

Query  419  MMIEICNCDNLPVIPLSGEPL  481
             MIEICNC N P++PLS  PL
Sbjct  145  NMIEICNCQNFPLLPLSSCPL  165



>ref|XP_009338642.1| PREDICTED: uncharacterized protein LOC103930963 [Pyrus x bretschneideri]
Length=184

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 109/145 (75%), Gaps = 9/145 (6%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWTSMRFYEEVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIES---  68

Query  248  LPKVTN-----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
             P + +     INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDP
Sbjct  69   -PAMEDYELRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDP  127

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P+IP+S   L+P
Sbjct  128  DGYMIELCNCENIPIIPISACYLKP  152



>ref|XP_004287830.1| PREDICTED: uncharacterized protein LOC101304803 [Fragaria vesca 
subsp. vesca]
Length=192

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  14   LPLLSLNHVSLLCRSVWDSMRFYEEVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIESPAA  73

Query  248  LP--KVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDGM  421
            +   ++  INPKDNHISFQC  + +V+++L+EM + YV   VE+ GV VDQ+FFHDPDG 
Sbjct  74   MEDCELRPINPKDNHISFQCTDVGLVKRKLQEMGMRYVTAVVEDDGVKVDQVFFHDPDGY  133

Query  422  MIEICNCDNLPVIPLSGEPLRP  487
            MIE+CNC+N+P+IP+S    +P
Sbjct  134  MIELCNCENIPIIPVSSCAFKP  155



>gb|AES95089.2| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=207

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV +S+ FY++VLGF PI+RP SF F GAW +NYGIGIHL+Q    
Sbjct  25   LPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPSSFKFTGAWFYNYGIGIHLIQNPDI  84

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  + YV   VE+ G+ VDQ+FFHD
Sbjct  85   DEFDTYMNESRPINPKDNHISFQCTDVELVKKRLEEKGMRYVTALVEDEGIKVDQVFFHD  144

Query  410  PDGMMIEICNCDNLPVIPLSG  472
            PDG MIE+CNC+N+P+IP+S 
Sbjct  145  PDGYMIELCNCENIPIIPISS  165



>ref|XP_003612131.1| Lactoylglutathione lyase [Medicago truncatula]
Length=194

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV +S+ FY++VLGF PI+RP SF F GAW +NYGIGIHL+Q    
Sbjct  12   LPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPSSFKFTGAWFYNYGIGIHLIQNPDI  71

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  + YV   VE+ G+ VDQ+FFHD
Sbjct  72   DEFDTYMNESRPINPKDNHISFQCTDVELVKKRLEEKGMRYVTALVEDEGIKVDQVFFHD  131

Query  410  PDGMMIEICNCDNLPVIPLSG  472
            PDG MIE+CNC+N+P+IP+S 
Sbjct  132  PDGYMIELCNCENIPIIPISS  152



>gb|AFK47459.1| unknown [Medicago truncatula]
Length=207

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV +S+ FY++VLGF PI+RP SF F GAW +NYGIGIHL+Q    
Sbjct  25   LPLLSLNHVSLLCRSVLESMQFYEDVLGFVPIKRPSSFKFTGAWFYNYGIGIHLIQNPDI  84

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+KRL+E  + YV   VE+ G+ VDQ+FFHD
Sbjct  85   DEFDTYMNESRPINPKDNHISFQCTDVELVKKRLEEKGMRYVTTLVEDEGIKVDQVFFHD  144

Query  410  PDGMMIEICNCDNLPVIPLSG  472
            PDG MIE+CNC+N+P+IP+S 
Sbjct  145  PDGYMIELCNCENIPIIPISS  165



>ref|XP_008241797.1| PREDICTED: lactoylglutathione lyase-like [Prunus mume]
Length=185

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  SL FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWNSLRFYEEVLGFVVIKRPSSFNFNGAWLYNYGIGIHLIES---  68

Query  248  LPKVTN-----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
             P + +     INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDP
Sbjct  69   -PAMEDYESRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDP  127

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG M+E+CNC+N+P+IP+S    +P
Sbjct  128  DGYMVELCNCENIPIIPISACAFKP  152



>ref|XP_008372764.1| PREDICTED: uncharacterized protein LOC103436125 [Malus domestica]
Length=184

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQADDN  247
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWTSMRFYEEVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIES---  68

Query  248  LPKVTN-----INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
             P + +     INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDP
Sbjct  69   -PAMEDYELRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDP  127

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P+IP+S    +P
Sbjct  128  DGXMIELCNCENIPIIPISACYFKP  152



>ref|XP_002970945.1| hypothetical protein SELMODRAFT_94230 [Selaginella moellendorffii]
 ref|XP_002991167.1| hypothetical protein SELMODRAFT_133006 [Selaginella moellendorffii]
 gb|EFJ07813.1| hypothetical protein SELMODRAFT_133006 [Selaginella moellendorffii]
 gb|EFJ28271.1| hypothetical protein SELMODRAFT_94230 [Selaginella moellendorffii]
Length=167

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 110/143 (77%), Gaps = 3/143 (2%)
 Frame = +2

Query  50   ENMENP--LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGI  223
            E+++NP  L L S+NH+S  C  +++SL FY +VLGF P++RP + + RGAWL+NYGIGI
Sbjct  15   ESLQNPQPLPLSSVNHLSRNCRDIQESLKFYVDVLGFVPVKRPNALEVRGAWLYNYGIGI  74

Query  224  HLLQADD-NLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLF  400
            HLLQ ++   P+  +INP+D+HISFQCE +A+V+KRL +  I+Y K  V+E G+ V+Q+F
Sbjct  75   HLLQQENAGPPQEHSINPRDDHISFQCEDLALVQKRLGDAGIKYEKRIVQERGIEVEQIF  134

Query  401  FHDPDGMMIEICNCDNLPVIPLS  469
            FHDPDG MIEIC C+ LPV PLS
Sbjct  135  FHDPDGFMIEICTCERLPVEPLS  157



>ref|XP_007046744.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
 gb|EOX90901.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma 
cacao]
Length=190

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQ--AD  241
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF F GAWL+NYGIGIHL++  A 
Sbjct  13   LPLLSLNHVSLLCRSVWDSVRFYEEVLGFVLIKRPSSFKFNGAWLYNYGIGIHLIENPAI  72

Query  242  DNLPKVTN---INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
            D+   +     INPKDNHISFQC  + +V++RL+EM ++YV   VE+ G  VDQ+FFHDP
Sbjct  73   DDFDTIVEPRPINPKDNHISFQCTDVGLVKRRLQEMGMKYVTAVVEDDGNRVDQVFFHDP  132

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P++PLS    +P
Sbjct  133  DGYMIELCNCENIPILPLSSCSFKP  157



>ref|XP_008372762.1| PREDICTED: lactoylglutathione lyase-like [Malus domestica]
 ref|XP_008356303.1| PREDICTED: lactoylglutathione lyase-like [Malus domestica]
Length=184

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+S++C SV  S+ FY+ VLGF  I+RP SF+F GAWL++YGIGIHL+++   
Sbjct  12   LPLLSLNHVSLLCRSVWTSMRFYEEVLGFVLIKRPSSFNFNGAWLYSYGIGIHLIESPAM  71

Query  239  DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDPDG  418
            +D   ++  INPKDNHISFQC  + +V++RL++M + YV   VE+ GV VDQ+FFHDPDG
Sbjct  72   EDY--ELRPINPKDNHISFQCTDVGLVKRRLQDMGMRYVTAVVEDDGVKVDQVFFHDPDG  129

Query  419  MMIEICNCDNLPVIPLSGEPLRP  487
             MIE+CNC+N+P+IP+S    +P
Sbjct  130  YMIELCNCENIPIIPISACSFKP  152



>ref|XP_010113383.1| hypothetical protein L484_026715 [Morus notabilis]
 gb|EXC35390.1| hypothetical protein L484_026715 [Morus notabilis]
Length=192

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 108/147 (73%), Gaps = 7/147 (5%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV +S  FY+ VLGF  I+RP SF+F GAWL+NYGIGIHL++    
Sbjct  13   LPLLSLNHVSLLCRSVWESTRFYEEVLGFVLIKRPSSFNFNGAWLYNYGIGIHLIENPAL  72

Query  242  ----DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVE-EGGVHVDQLFFH  406
                D + +   INPKDNHISFQC  + +V++RL+EM + YV   VE + G+ VDQ+FFH
Sbjct  73   VDEYDTMNEPRPINPKDNHISFQCTDVGLVKRRLQEMGMRYVTALVEADDGIKVDQVFFH  132

Query  407  DPDGMMIEICNCDNLPVIPLSGEPLRP  487
            DPDG MIE+CNC+N+P++PLS  P +P
Sbjct  133  DPDGYMIELCNCENIPILPLSSCPFKP  159



>gb|AFK38981.1| unknown [Lotus japonicus]
Length=189

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA---  238
            L L SLNH+SI+C SV +S+ FY+ VLGF  I+RP SF F GAWL++YGIGIHLL+    
Sbjct  12   LSLLSLNHVSILCRSVWESVRFYEEVLGFVLIKRPSSFKFNGAWLYSYGIGIHLLENPDI  71

Query  239  ---DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHD  409
               D  + +   INPKDNHISFQC  + +V+ RL++M + YV   VE+GG+ VDQ+FFHD
Sbjct  72   DEFDTPMNESRPINPKDNHISFQCTDVGLVKSRLEDMGMRYVTAVVEDGGIKVDQVFFHD  131

Query  410  PDGMMIEICNCDNLPVIPLSG  472
            PDG MIE+CNC+N+P++P+S 
Sbjct  132  PDGYMIELCNCENIPIVPVSS  152



>ref|XP_002880927.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57186.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA--DDN  247
            L +LNH+S +C  V+KSL+FY  VLGF  I RP SFDF GAWLFNYG+GIHL+QA   D 
Sbjct  18   LMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPASFDFNGAWLFNYGVGIHLVQAKDQDK  77

Query  248  LPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRV-EEGGVHVDQLFFHDPDGM  421
            LP  TN ++P DNHISFQCE M  +EKR+KE++++Y+K  V +E    +DQLFF+DPDG 
Sbjct  78   LPSDTNHLDPMDNHISFQCEDMEALEKRIKEVKVKYIKRTVGDEKDAAIDQLFFNDPDGF  137

Query  422  MIEICNCDNLPVIP  463
            M+EICNC+NL ++P
Sbjct  138  MVEICNCENLELVP  151



>ref|NP_029429.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis 
thaliana]
 gb|AAD20684.1| expressed protein [Arabidopsis thaliana]
 gb|AEC08120.1| lactoylglutathione lyase / glyoxalase I-like protein [Arabidopsis 
thaliana]
Length=184

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA--DDN  247
            L +LNH+S +C  V+KSL+FY  VLGF  I RP SFDF GAWLFNYG+GIHL+QA   D 
Sbjct  18   LMALNHVSRLCKDVKKSLEFYTKVLGFVEIERPASFDFDGAWLFNYGVGIHLVQAKDQDK  77

Query  248  LPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRV-EEGGVHVDQLFFHDPDGM  421
            LP  T+ ++P DNHISFQCE M  +EKRLKE++++Y+K  V +E    +DQLFF+DPDG 
Sbjct  78   LPSDTDHLDPMDNHISFQCEDMEALEKRLKEVKVKYIKRTVGDEKDAAIDQLFFNDPDGF  137

Query  422  MIEICNCDNLPVIPL-SGEPLRPP  490
            M+EICNC+NL ++P  S + +R P
Sbjct  138  MVEICNCENLELVPCHSADAIRLP  161



>ref|XP_003629350.1| Lactoylglutathione lyase [Medicago truncatula]
 gb|AET03826.1| lactoylglutathione lyase/glyoxalase I family protein [Medicago 
truncatula]
Length=193

 Score =   169 bits (428),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 105/143 (73%), Gaps = 6/143 (4%)
 Frame = +2

Query  59   ENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA  238
            E PL L SLNH+SI+C SV  S+ FY+ +LGF  I+RP SF F GAWL+NYG GIHLL+ 
Sbjct  10   EAPLPLLSLNHVSILCRSVLDSMRFYEEILGFGLIKRPSSFKFNGAWLYNYGFGIHLLEN  69

Query  239  ------DDNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLF  400
                  D  + +   INPKDNHISFQC  + +V+ RL++M ++YV   VE+ G+ V+Q+F
Sbjct  70   PNYDEFDTPMSESRPINPKDNHISFQCTDVGLVKMRLEDMGMKYVTALVEDEGIKVEQVF  129

Query  401  FHDPDGMMIEICNCDNLPVIPLS  469
            FHDPDG MIE+CNC+N+P++P+S
Sbjct  130  FHDPDGYMIELCNCENIPIVPIS  152



>gb|AAK97724.1| At2g28420/T1B3.6 [Arabidopsis thaliana]
 gb|AAL31129.1| At2g28420/T1B3.6 [Arabidopsis thaliana]
Length=184

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = +2

Query  74   LKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQA--DDN  247
            L +LNH+S +C  V+KSL FY  VLGF  I RP SFDF GAWLFNYG+GIHL+QA   D 
Sbjct  18   LMALNHVSRLCKDVKKSLKFYTKVLGFVEIERPASFDFDGAWLFNYGVGIHLVQAKDQDK  77

Query  248  LPKVTN-INPKDNHISFQCESMAMVEKRLKEMEIEYVKCRV-EEGGVHVDQLFFHDPDGM  421
            LP  T+ ++P DNHISFQCE M  +EKRLKE++++Y+K  V +E    +DQLFF+DPDG 
Sbjct  78   LPSDTDHLDPMDNHISFQCEDMEALEKRLKEVKVKYIKRTVGDEKDAAIDQLFFNDPDGF  137

Query  422  MIEICNCDNLPVIPL-SGEPLRPP  490
            M+EICNC+NL ++P  S + +R P
Sbjct  138  MVEICNCENLELVPCHSADAIRLP  161



>gb|KHG15596.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=190

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 5/150 (3%)
 Frame = +2

Query  38   EKMKENMENPLRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGI  217
            + ++ N    L L SLNH+S++C SV  S+ FY++VLGF  I+RP SF F GAWL+NYGI
Sbjct  3    DSVEANNFEALPLLSLNHVSLLCRSVWDSVRFYEDVLGFVSIKRPSSFKFNGAWLYNYGI  62

Query  218  GIHLLQAD-----DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGV  382
            GIHL++       D + +   INPKDNHISFQC  + +V +RL++M ++YV   VE+ G 
Sbjct  63   GIHLIENPSIDDFDTIVEPRPINPKDNHISFQCTDVGLVMRRLQDMGMKYVTAVVEDQGN  122

Query  383  HVDQLFFHDPDGMMIEICNCDNLPVIPLSG  472
             VDQ+FFHDPDG M+E+CNC+N+P+IPLS 
Sbjct  123  RVDQVFFHDPDGYMVELCNCENIPIIPLSS  152



>gb|KHG30040.1| Metallothiol transferase fosB [Gossypium arboreum]
Length=192

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 106/145 (73%), Gaps = 5/145 (3%)
 Frame = +2

Query  68   LRLKSLNHISIVCSSVEKSLDFYQNVLGFFPIRRPGSFDFRGAWLFNYGIGIHLLQAD--  241
            L L SLNH+S++C SV  S+ FY+ VLGF PI+RP SF F GAWL+NYGIGIHL++    
Sbjct  13   LPLLSLNHVSLLCRSVWDSMRFYEEVLGFVPIKRPSSFKFNGAWLYNYGIGIHLIENPLI  72

Query  242  ---DNLPKVTNINPKDNHISFQCESMAMVEKRLKEMEIEYVKCRVEEGGVHVDQLFFHDP  412
               D + +   INPKDNHISFQC  + +V+ RL++M ++YV   VE+ G  VDQ+FFHDP
Sbjct  73   DDFDTIIEPRPINPKDNHISFQCRDVEIVKGRLEDMGMKYVTAVVEDEGNTVDQVFFHDP  132

Query  413  DGMMIEICNCDNLPVIPLSGEPLRP  487
            DG MIE+CNC+N+P++PLS    +P
Sbjct  133  DGYMIELCNCENIPILPLSACLFKP  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1389194222792