BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22373_g3_i1 len=1398 path=[1:0-718 3662:719-743 745:744-772
774:773-1391 1393:1392-1397]

Length=1398
                                                                      Score     E

ref|XP_009763212.1|  PREDICTED: transcription factor bHLH71-like        322   5e-103   
ref|XP_009631535.1|  PREDICTED: transcription factor bHLH71             322   7e-103   
ref|NP_001265931.1|  Hop-interacting protein THI018                     317   9e-101   
ref|XP_006352865.1|  PREDICTED: transcription factor bHLH71-like        312   4e-99    
ref|XP_002278824.1|  PREDICTED: transcription factor bHLH71             309   6e-98    Vitis vinifera
gb|KHN45285.1|  Transcription factor bHLH71                             308   1e-97    
emb|CDP13044.1|  unnamed protein product                                308   1e-97    
ref|NP_001242622.1|  uncharacterized protein LOC100783542               303   8e-96    
ref|XP_007156419.1|  hypothetical protein PHAVU_003G284500g             297   2e-93    
ref|XP_006385664.1|  hypothetical protein POPTR_0003s09200g             296   3e-93    
gb|KHG10560.1|  Transcription factor bHLH71 -like protein               296   4e-93    
gb|KDP33097.1|  hypothetical protein JCGZ_13618                         296   5e-93    
gb|KHG15048.1|  Transcription factor bHLH96 -like protein               293   5e-92    
ref|XP_010096553.1|  hypothetical protein L484_001866                   294   6e-92    
ref|XP_003531959.1|  PREDICTED: transcription factor bHLH71-like ...    291   3e-91    
gb|KHN10161.1|  Transcription factor bHLH96-like protein                290   1e-90    
ref|XP_007039472.1|  Basic helix-loop-helix DNA-binding superfami...    286   3e-89    
ref|XP_011018549.1|  PREDICTED: transcription factor bHLH71-like ...    285   8e-89    
ref|XP_006368389.1|  hypothetical protein POPTR_0001s02350g             285   8e-89    
ref|XP_004509733.1|  PREDICTED: transcription factor bHLH71-like        285   1e-88    
gb|EYU18780.1|  hypothetical protein MIMGU_mgv1a010772mg                281   3e-87    
ref|XP_010055312.1|  PREDICTED: transcription factor bHLH71             281   7e-87    
ref|XP_006585890.1|  PREDICTED: transcription factor bHLH71-like ...    278   3e-86    
ref|XP_007210615.1|  hypothetical protein PRUPE_ppa017746mg             278   3e-86    
ref|XP_008238226.1|  PREDICTED: transcription factor bHLH71             278   5e-86    
ref|XP_011028170.1|  PREDICTED: transcription factor bHLH71             278   5e-86    
ref|XP_011070274.1|  PREDICTED: transcription factor bHLH71             276   9e-86    
ref|XP_003628791.1|  Transcription factor bHLH96                        276   4e-85    
ref|XP_004136191.1|  PREDICTED: transcription factor bHLH94-like        272   2e-83    
ref|XP_008465984.1|  PREDICTED: transcription factor bHLH71             268   6e-82    
emb|CBI83256.1|  basic helix-loop-helix transcription factor            267   1e-81    
ref|XP_006385665.1|  hypothetical protein POPTR_0003s09200g             262   3e-80    
ref|XP_004300408.1|  PREDICTED: transcription factor bHLH71-like        258   2e-78    
ref|XP_010695562.1|  PREDICTED: transcription factor bHLH71-like        256   1e-77    
ref|XP_010240870.1|  PREDICTED: transcription factor bHLH71-like        253   2e-76    
ref|XP_008796282.1|  PREDICTED: transcription factor bHLH71-like        252   3e-76    
ref|XP_009381950.1|  PREDICTED: transcription factor bHLH96-like ...    251   1e-75    
ref|XP_011018548.1|  PREDICTED: transcription factor bHLH71-like ...    250   3e-75    
gb|EPS66017.1|  hypothetical protein M569_08759                         247   4e-75    
ref|XP_010919940.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    248   1e-74    
ref|XP_002527666.1|  DNA binding protein, putative                      247   2e-74    Ricinus communis
ref|XP_009371214.1|  PREDICTED: transcription factor bHLH71-like        244   5e-73    
ref|XP_010273153.1|  PREDICTED: transcription factor bHLH94-like        243   1e-72    
ref|XP_002285733.2|  PREDICTED: transcription factor bHLH96             238   1e-70    Vitis vinifera
gb|AIA82920.1|  bHLH2                                                   234   2e-69    
ref|XP_010266731.1|  PREDICTED: transcription factor bHLH94-like        234   9e-69    
ref|XP_008786321.1|  PREDICTED: transcription factor bHLH94-like        232   1e-68    
ref|XP_010934113.1|  PREDICTED: transcription factor bHLH94-like        231   2e-68    
ref|XP_009384704.1|  PREDICTED: transcription factor bHLH96-like        231   7e-68    
ref|XP_010272971.1|  PREDICTED: transcription factor bHLH96-like        231   9e-68    
ref|XP_004237957.1|  PREDICTED: transcription factor bHLH94-like        228   3e-66    
gb|KDP41432.1|  hypothetical protein JCGZ_15839                         226   7e-66    
ref|XP_011082359.1|  PREDICTED: transcription factor bHLH71-like        224   2e-65    
ref|XP_008373582.1|  PREDICTED: transcription factor bHLH71             224   3e-65    
dbj|BAJ88793.1|  predicted protein                                      224   7e-65    
ref|XP_006433906.1|  hypothetical protein CICLE_v10001811mg             223   9e-65    
ref|XP_009381949.1|  PREDICTED: transcription factor bHLH94-like ...    224   9e-65    
gb|KDO81070.1|  hypothetical protein CISIN_1g020210mg                   223   1e-64    
ref|XP_006472540.1|  PREDICTED: transcription factor bHLH96-like        223   1e-64    
emb|CBI33152.3|  unnamed protein product                                222   2e-64    
ref|XP_006338108.1|  PREDICTED: transcription factor bHLH96-like        223   2e-64    
ref|XP_010652690.1|  PREDICTED: transcription factor bHLH94-like        221   3e-64    
ref|XP_007223282.1|  hypothetical protein PRUPE_ppa009461mg             219   8e-64    
gb|EYU34532.1|  hypothetical protein MIMGU_mgv1a013373mg                217   1e-63    
gb|KHG10117.1|  Transcription factor bHLH96 -like protein               221   1e-63    
ref|XP_003526566.1|  PREDICTED: transcription factor bHLH96-like        220   2e-63    
ref|XP_007018123.1|  DNA binding protein, putative                      220   2e-63    
gb|KHN27371.1|  Transcription factor bHLH96                             219   2e-63    
emb|CDP01118.1|  unnamed protein product                                220   3e-63    
ref|XP_009781858.1|  PREDICTED: transcription factor bHLH94-like        219   7e-63    
ref|XP_008219358.1|  PREDICTED: transcription factor bHLH94-like        218   1e-62    
gb|KHN35482.1|  Transcription factor bHLH96                             214   2e-62    
ref|XP_003522778.1|  PREDICTED: transcription factor bHLH96             217   2e-62    
ref|XP_004152621.1|  PREDICTED: transcription factor bHLH96-like        216   2e-62    
ref|XP_004164228.1|  PREDICTED: transcription factor bHLH96-like        216   3e-62    
ref|XP_002319028.2|  hypothetical protein POPTR_0013s02680g             217   3e-62    Populus trichocarpa [western balsam poplar]
gb|KDP23545.1|  hypothetical protein JCGZ_23378                         216   4e-62    
ref|XP_010106856.1|  hypothetical protein L484_003559                   217   4e-62    
ref|XP_008444872.1|  PREDICTED: transcription factor bHLH96             216   5e-62    
ref|XP_008782180.1|  PREDICTED: transcription factor bHLH94-like        215   9e-62    
ref|XP_006653718.1|  PREDICTED: transcription factor bHLH96-like        215   1e-61    
ref|XP_004953510.1|  PREDICTED: transcription factor bHLH96-like        214   4e-61    
ref|XP_003544814.1|  PREDICTED: transcription factor bHLH96-like        213   5e-61    
gb|KHG29471.1|  Transcription factor bHLH94 -like protein               213   5e-61    
ref|XP_010926342.1|  PREDICTED: transcription factor bHLH94-like        213   5e-61    
ref|XP_010675612.1|  PREDICTED: transcription factor bHLH94-like        214   7e-61    
ref|XP_010916699.1|  PREDICTED: transcription factor bHLH94-like        213   8e-61    
ref|XP_009403078.1|  PREDICTED: transcription factor bHLH94-like        212   1e-60    
ref|XP_002513985.1|  DNA binding protein, putative                      213   1e-60    Ricinus communis
emb|CAH67958.1|  OSIGBa0142I02-OSIGBa0101B20.1                          213   1e-60    Oryza sativa [red rice]
ref|XP_009625368.1|  PREDICTED: transcription factor bHLH96-like        211   1e-60    
ref|XP_009784356.1|  PREDICTED: transcription factor bHLH96-like        211   2e-60    
ref|XP_009615601.1|  PREDICTED: transcription factor bHLH96-like        213   2e-60    
ref|XP_010045474.1|  PREDICTED: transcription factor bHLH96             213   2e-60    
dbj|BAD07690.1|  putative basic-helix-loop-helix transcription fa...    213   2e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454447.1|  hypothetical protein SORBIDRAFT_04g031250          212   2e-60    Sorghum bicolor [broomcorn]
ref|XP_006829211.1|  hypothetical protein AMTR_s00001p00272070          213   2e-60    
gb|EAY87138.1|  hypothetical protein OsI_08539                          213   3e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_007136288.1|  hypothetical protein PHAVU_009G033800g             211   3e-60    
ref|XP_011100183.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   4e-60    
ref|XP_008363563.1|  PREDICTED: transcription factor bHLH96-like        210   5e-60    
ref|XP_006647713.1|  PREDICTED: transcription factor bHLH96-like        211   6e-60    
ref|XP_004299687.1|  PREDICTED: transcription factor bHLH96-like        211   6e-60    
gb|ADL36599.1|  BHLH domain class transcription factor                  209   9e-60    
gb|ABR16546.1|  unknown                                                 214   1e-59    Picea sitchensis
ref|XP_009619568.1|  PREDICTED: transcription factor bHLH96-like ...    209   1e-59    
gb|KHG15004.1|  Transcription factor bHLH96 -like protein               210   1e-59    
gb|KHN08964.1|  Transcription factor bHLH96                             205   2e-59    
ref|XP_009373431.1|  PREDICTED: transcription factor bHLH96-like        209   2e-59    
gb|KFK31444.1|  hypothetical protein AALP_AA6G112500                    209   2e-59    
ref|XP_008804795.1|  PREDICTED: transcription factor bHLH94-like        209   3e-59    
ref|XP_003626318.1|  Transcription factor bHLH96                        208   3e-59    
ref|XP_003602850.1|  Transcription factor bHLH96                        208   3e-59    
emb|CDY04811.1|  BnaC05g17780D                                          208   3e-59    
ref|XP_010415952.1|  PREDICTED: transcription factor bHLH96-like ...    208   4e-59    
ref|XP_010415951.1|  PREDICTED: transcription factor bHLH96-like ...    208   4e-59    
gb|KHG17314.1|  Transcription factor bHLH96 -like protein               208   5e-59    
ref|XP_004494635.1|  PREDICTED: transcription factor bHLH94-like        207   5e-59    
ref|XP_002302324.2|  hypothetical protein POPTR_0002s10230g             208   5e-59    Populus trichocarpa [western balsam poplar]
gb|AES82536.2|  transcription factor                                    207   6e-59    
ref|XP_010428088.1|  PREDICTED: transcription factor bHLH96 isofo...    207   7e-59    
ref|XP_010559298.1|  PREDICTED: transcription factor bHLH71             207   7e-59    
ref|XP_010414846.1|  PREDICTED: transcription factor bHLH96-like        207   9e-59    
ref|XP_011023550.1|  PREDICTED: transcription factor bHLH94-like        207   1e-58    
emb|CDX68274.1|  BnaA07g23140D                                          207   1e-58    
ref|XP_002893233.1|  hypothetical protein ARALYDRAFT_335492             206   1e-58    
ref|XP_011016877.1|  PREDICTED: transcription factor bHLH94             207   1e-58    
ref|XP_007147072.1|  hypothetical protein PHAVU_006G093900g             207   1e-58    
ref|XP_009104863.1|  PREDICTED: transcription factor bHLH96-like        206   2e-58    
ref|XP_010098698.1|  hypothetical protein L484_026077                   207   2e-58    
ref|XP_003554664.1|  PREDICTED: transcription factor bHLH96-like        206   2e-58    
emb|CDY50447.1|  BnaC06g24170D                                          206   3e-58    
ref|XP_006471948.1|  PREDICTED: transcription factor bHLH96-like        206   3e-58    
gb|ABD32380.2|  Helix-loop-helix DNA-binding                            206   4e-58    Medicago truncatula
ref|XP_008776945.1|  PREDICTED: transcription factor bHLH94-like        206   5e-58    
ref|XP_006302555.1|  hypothetical protein CARUB_v10020657mg             205   5e-58    
ref|XP_009123119.1|  PREDICTED: transcription factor bHLH94-like        204   5e-58    
emb|CDY21365.1|  BnaA09g30620D                                          204   6e-58    
ref|XP_004250124.1|  PREDICTED: transcription factor bHLH96-like        204   7e-58    
emb|CDP01524.1|  unnamed protein product                                204   7e-58    
ref|NP_001140356.1|  putative HLH DNA-binding domain superfamily ...    206   7e-58    Zea mays [maize]
ref|XP_003561963.1|  PREDICTED: transcription factor bHLH94-like        206   7e-58    
ref|NP_564171.1|  transcription factor bHLH94                           204   8e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141222.1|  hypothetical protein PHAVU_008G177500g             204   9e-58    
gb|ADL36598.1|  BHLH domain class transcription factor                  204   1e-57    
ref|XP_006304982.1|  hypothetical protein CARUB_v10011476mg             204   1e-57    
gb|AAM65775.1|  unknown                                                 204   1e-57    Arabidopsis thaliana [mouse-ear cress]
gb|KHN04014.1|  Transcription factor bHLH96                             204   1e-57    
ref|XP_010471241.1|  PREDICTED: transcription factor bHLH96-like ...    204   1e-57    
ref|XP_010939706.1|  PREDICTED: transcription factor bHLH94-like        204   1e-57    
gb|ACN21653.1|  putative basic helix-loop-helix protein BHLH26          203   2e-57    Lotus japonicus
ref|XP_009400115.1|  PREDICTED: transcription factor bHLH94-like        203   2e-57    
ref|XP_010942629.1|  PREDICTED: transcription factor bHLH96-like        204   2e-57    
ref|XP_006827950.1|  hypothetical protein AMTR_s00008p00198780          202   2e-57    
ref|XP_006577251.1|  PREDICTED: transcription factor bHLH96-like ...    204   2e-57    
ref|XP_007144754.1|  hypothetical protein PHAVU_007G181900g             204   3e-57    
ref|XP_002281083.2|  PREDICTED: transcription factor bHLH94             203   3e-57    Vitis vinifera
gb|AFZ78610.1|  helix-loop-helix protein                                204   3e-57    
ref|XP_003556500.1|  PREDICTED: transcription factor bHLH96-like        203   4e-57    
ref|XP_009409290.1|  PREDICTED: transcription factor bHLH94-like        203   5e-57    
ref|XP_011048906.1|  PREDICTED: transcription factor bHLH94-like        203   7e-57    
ref|XP_004983211.1|  PREDICTED: transcription factor bHLH96-like        201   8e-57    
ref|XP_006382653.1|  hypothetical protein POPTR_0005s04160g             203   8e-57    
emb|CBI33874.3|  unnamed protein product                                197   1e-56    
gb|EMT20093.1|  Transcription factor bHLH96                             203   1e-56    
gb|KFK44344.1|  hypothetical protein AALP_AA1G245600                    201   1e-56    
ref|XP_009381484.1|  PREDICTED: transcription factor bHLH94-like        201   1e-56    
ref|XP_009785047.1|  PREDICTED: transcription factor bHLH96-like        201   1e-56    
ref|NP_177366.1|  transcription factor bHLH96                           201   2e-56    Arabidopsis thaliana [mouse-ear cress]
gb|EPS59989.1|  hypothetical protein M569_14814                         198   2e-56    
emb|CAN61676.1|  hypothetical protein VITISV_018325                     201   2e-56    Vitis vinifera
ref|XP_010251348.1|  PREDICTED: transcription factor bHLH67-like        204   2e-56    
gb|KFK41642.1|  hypothetical protein AALP_AA2G154300                    201   2e-56    
dbj|BAJ34641.1|  unnamed protein product                                201   3e-56    
ref|XP_010106299.1|  hypothetical protein L484_019813                   201   3e-56    
ref|XP_006398364.1|  hypothetical protein EUTSA_v10000961mg             201   4e-56    
ref|XP_004501682.1|  PREDICTED: transcription factor bHLH96-like        199   4e-56    
gb|EAZ24688.1|  hypothetical protein OsJ_08458                          201   4e-56    Oryza sativa Japonica Group [Japonica rice]
emb|CDY37634.1|  BnaCnng08490D                                          197   6e-56    
ref|XP_002512342.1|  DNA binding protein, putative                      201   7e-56    Ricinus communis
ref|XP_003572839.2|  PREDICTED: transcription factor bHLH96-like        197   1e-55    
ref|XP_009391332.1|  PREDICTED: transcription factor bHLH94-like        199   1e-55    
ref|XP_010441558.1|  PREDICTED: transcription factor bHLH71-like        199   1e-55    
ref|XP_010460004.1|  PREDICTED: transcription factor bHLH94-like ...    198   2e-55    
ref|XP_003591068.1|  Transcription factor bHLH94                        198   3e-55    
ref|XP_006660228.1|  PREDICTED: transcription factor bHLH96-like        199   3e-55    
gb|EMS58688.1|  Transcription factor bHLH96                             199   4e-55    
ref|XP_008681358.1|  PREDICTED: putative HLH DNA-binding domain s...    198   4e-55    
gb|EAY87600.1|  hypothetical protein OsI_09011                          198   5e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_009105879.1|  PREDICTED: transcription factor bHLH96-like        197   5e-55    
gb|AES61319.2|  basic helix loop helix (BHLH) DNA-binding family ...    198   5e-55    
ref|XP_006390686.1|  hypothetical protein EUTSA_v10018867mg             197   7e-55    
ref|XP_010494850.1|  PREDICTED: transcription factor bHLH71             197   7e-55    
ref|XP_010025414.1|  PREDICTED: transcription factor bHLH96             196   7e-55    
ref|NP_001242465.1|  uncharacterized protein LOC100811408               197   8e-55    
ref|XP_009101500.1|  PREDICTED: transcription factor bHLH71-like        197   9e-55    
ref|XP_002309955.2|  hypothetical protein POPTR_0007s04950g             196   9e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010043101.1|  PREDICTED: transcription factor bHLH96-like ...    196   1e-54    
emb|CDX96382.1|  BnaA07g29930D                                          196   1e-54    
ref|XP_009365813.1|  PREDICTED: transcription factor bHLH94-like        194   1e-54    
emb|CDX72877.1|  BnaC06g33250D                                          196   2e-54    
gb|ACN33786.1|  unknown                                                 193   3e-54    Zea mays [maize]
ref|XP_006426315.1|  hypothetical protein CICLE_v10026131mg             195   3e-54    
ref|XP_007030915.1|  Basic helix-loop-helix DNA-binding superfami...    196   3e-54    
gb|KHN16145.1|  Transcription factor bHLH96                             195   3e-54    
ref|XP_008235259.1|  PREDICTED: transcription factor bHLH94             195   4e-54    
emb|CDX77682.1|  BnaC07g19360D                                          195   4e-54    
ref|XP_010535287.1|  PREDICTED: transcription factor bHLH96             194   1e-53    
ref|XP_006466564.1|  PREDICTED: transcription factor bHLH96-like        193   1e-53    
ref|XP_004288157.1|  PREDICTED: transcription factor bHLH96-like        194   1e-53    
ref|XP_011022838.1|  PREDICTED: transcription factor bHLH96-like ...    193   1e-53    
emb|CAE04872.2|  OSJNBa0086O06.20                                       195   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006375773.1|  hypothetical protein POPTR_0013s02680g             193   2e-53    
ref|XP_011022837.1|  PREDICTED: transcription factor bHLH96-like ...    193   2e-53    
ref|XP_010481425.1|  PREDICTED: transcription factor bHLH71-like        193   2e-53    
ref|XP_004517115.1|  PREDICTED: transcription factor bHLH94-like        192   3e-53    
ref|XP_007047843.1|  Basic helix-loop-helix DNA-binding superfami...    194   3e-53    
ref|NP_001049217.1|  Os03g0188400                                       193   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009335628.1|  PREDICTED: transcription factor bHLH96-like        192   3e-53    
ref|XP_006280777.1|  hypothetical protein CARUB_v10026748mg             193   4e-53    
ref|NP_001064473.1|  Os10g0376900                                       192   4e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004495746.1|  PREDICTED: transcription factor bHLH96-like        192   4e-53    
gb|EAY88844.1|  hypothetical protein OsI_10315                          192   4e-53    Oryza sativa Indica Group [Indian rice]
emb|CDX82171.1|  BnaC02g21190D                                          192   4e-53    
ref|XP_009617734.1|  PREDICTED: transcription factor bHLH96-like        192   4e-53    
ref|NP_001062077.1|  Os08g0483900                                       193   5e-53    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ43119.1|  hypothetical protein OsJ_27709                          192   6e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581588.1|  PREDICTED: transcription factor bHLH96-like        192   7e-53    
ref|XP_009401227.1|  PREDICTED: transcription factor bHLH94-like        190   7e-53    
gb|EAY78264.1|  hypothetical protein OsI_33312                          192   8e-53    Oryza sativa Indica Group [Indian rice]
ref|XP_007208193.1|  hypothetical protein PRUPE_ppa020862mg             191   9e-53    
ref|XP_008678968.1|  PREDICTED: transcription factor bHLH94-like ...    192   1e-52    
ref|NP_001281057.1|  transcription factor bHLH96-like                   191   1e-52    
ref|XP_003519184.1|  PREDICTED: transcription factor bHLH96-like        192   1e-52    
ref|XP_009103235.1|  PREDICTED: transcription factor bHLH94-like        191   1e-52    
ref|XP_004139191.1|  PREDICTED: transcription factor bHLH96-like        191   1e-52    
ref|XP_010521172.1|  PREDICTED: transcription factor bHLH96-like        191   2e-52    
ref|XP_008454918.1|  PREDICTED: transcription factor bHLH94-like        190   2e-52    
ref|XP_009127909.1|  PREDICTED: transcription factor bHLH96-like        191   2e-52    
ref|XP_009110135.1|  PREDICTED: transcription factor bHLH94-like        189   3e-52    
emb|CDY41479.1|  BnaA08g20810D                                          189   3e-52    
ref|NP_568666.1|  transcription factor bHLH71                           190   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477508.1|  PREDICTED: transcription factor bHLH94 isofo...    189   3e-52    
ref|XP_009417602.1|  PREDICTED: transcription factor bHLH94-like        189   3e-52    
ref|XP_009803283.1|  PREDICTED: transcription factor bHLH94-like        190   4e-52    
ref|XP_006649528.1|  PREDICTED: transcription factor bHLH96-like        190   4e-52    
gb|AAM65023.1|  bHLH DNA-binding protein-like protein                   190   4e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865169.1|  BHLH071                                            190   4e-52    
emb|CDX91680.1|  BnaC08g05990D                                          188   5e-52    
ref|XP_009373972.1|  PREDICTED: transcription factor bHLH94-like ...    189   7e-52    
emb|CDY03650.1|  BnaA02g15870D                                          189   7e-52    
ref|XP_010043100.1|  PREDICTED: transcription factor bHLH96-like ...    188   9e-52    
ref|XP_002468361.1|  hypothetical protein SORBIDRAFT_01g044640          189   1e-51    Sorghum bicolor [broomcorn]
emb|CDP15548.1|  unnamed protein product                                189   1e-51    
gb|ACG24088.1|  DNA binding protein                                     188   2e-51    Zea mays [maize]
ref|XP_008651833.1|  PREDICTED: transcription factor bHLH96-like        188   2e-51    
ref|XP_009380224.1|  PREDICTED: transcription factor bHLH94-like ...    187   2e-51    
ref|XP_010528862.1|  PREDICTED: transcription factor bHLH96-like        188   3e-51    
tpg|DAA61871.1|  TPA: putative HLH DNA-binding domain superfamily...    187   3e-51    
ref|XP_002489234.1|  hypothetical protein SORBIDRAFT_0012s004780        186   3e-51    Sorghum bicolor [broomcorn]
ref|XP_004985409.1|  PREDICTED: transcription factor bHLH96-like        187   4e-51    
ref|XP_008388591.1|  PREDICTED: transcription factor bHLH94-like        187   5e-51    
ref|XP_007205850.1|  hypothetical protein PRUPE_ppa011095mg             184   5e-51    
ref|XP_010498720.1|  PREDICTED: transcription factor bHLH94-like        186   6e-51    
ref|XP_007218040.1|  hypothetical protein PRUPE_ppa006041mg             189   7e-51    
ref|XP_008244210.1|  PREDICTED: transcription factor bHLH67             189   7e-51    
ref|XP_010460005.1|  PREDICTED: transcription factor bHLH94-like ...    186   8e-51    
ref|XP_007135328.1|  hypothetical protein PHAVU_010G120000g             188   8e-51    
gb|AES98151.2|  basic helix loop helix (BHLH) DNA-binding family ...    185   1e-50    
ref|NP_001132188.2|  uncharacterized protein LOC100193615               187   1e-50    Zea mays [maize]
ref|XP_010523351.1|  PREDICTED: transcription factor bHLH99             184   1e-50    
ref|XP_004302452.1|  PREDICTED: transcription factor bHLH96-like        186   1e-50    
ref|XP_006360298.1|  PREDICTED: transcription factor bHLH94-like        185   1e-50    
ref|XP_004957080.1|  PREDICTED: transcription factor bHLH96-like        186   2e-50    
ref|NP_001146738.1|  uncharacterized protein LOC100280340               186   2e-50    Zea mays [maize]
ref|XP_009114335.1|  PREDICTED: transcription factor bHLH71-like ...    185   3e-50    
ref|XP_007047844.1|  Basic helix-loop-helix DNA-binding superfami...    183   1e-49    
ref|XP_009413578.1|  PREDICTED: transcription factor bHLH94-like ...    183   1e-49    
ref|XP_006416194.1|  hypothetical protein EUTSA_v10009836mg             181   1e-49    
gb|EEC77890.1|  hypothetical protein OsI_17190                          182   1e-49    
gb|AFW89425.1|  putative HLH DNA-binding domain superfamily protein     184   2e-49    
ref|NP_001141780.1|  uncharacterized protein LOC100273916               183   2e-49    
ref|XP_004953984.1|  PREDICTED: transcription factor bHLH96-like        183   2e-49    
gb|KHN06372.1|  Transcription factor bHLH70                             184   3e-49    
ref|XP_010694628.1|  PREDICTED: transcription factor bHLH94-like        183   3e-49    
ref|XP_008246511.1|  PREDICTED: transcription factor bHLH96-like        182   3e-49    
gb|EEE61586.1|  hypothetical protein OsJ_15970                          182   4e-49    
ref|XP_010471242.1|  PREDICTED: transcription factor bHLH96-like ...    181   4e-49    
ref|XP_004306611.1|  PREDICTED: transcription factor bHLH57-like        179   7e-49    
ref|XP_006598867.1|  PREDICTED: transcription factor bHLH70-like ...    182   7e-49    
emb|CBI38719.3|  unnamed protein product                                182   8e-49    
ref|XP_006577252.1|  PREDICTED: transcription factor bHLH96-like ...    181   9e-49    
ref|XP_006361869.1|  PREDICTED: transcription factor bHLH96-like        181   9e-49    
ref|XP_010661504.1|  PREDICTED: transcription factor bHLH70 isofo...    182   9e-49    
gb|EYU30963.1|  hypothetical protein MIMGU_mgv11b019145mg               177   1e-48    
ref|XP_003528761.1|  PREDICTED: transcription factor bHLH67-like        182   1e-48    
ref|XP_010688515.1|  PREDICTED: transcription factor bHLH67             183   2e-48    
ref|XP_004230172.1|  PREDICTED: transcription factor bHLH96-like ...    179   3e-48    
ref|XP_006598866.1|  PREDICTED: transcription factor bHLH70-like ...    181   3e-48    
ref|XP_002267819.2|  PREDICTED: transcription factor bHLH67 isofo...    182   3e-48    
ref|XP_003615193.1|  Transcription factor bHLH96                        184   6e-48    
ref|XP_010477509.1|  PREDICTED: transcription factor bHLH94 isofo...    176   2e-47    
emb|CDY12528.1|  BnaC07g13680D                                          176   2e-47    
ref|XP_010025161.1|  PREDICTED: transcription factor bHLH94-like        177   3e-47    
ref|XP_002460373.1|  hypothetical protein SORBIDRAFT_02g027210          177   4e-47    
ref|XP_006660722.1|  PREDICTED: transcription factor bHLH94-like        177   4e-47    
ref|XP_009404031.1|  PREDICTED: transcription factor bHLH96-like        176   6e-47    
gb|KEH43072.1|  basic helix loop helix (BHLH) DNA-binding family ...    176   7e-47    
gb|KDP29733.1|  hypothetical protein JCGZ_18668                         174   1e-46    
ref|NP_001137026.1|  putative HLH DNA-binding domain superfamily ...    176   1e-46    
ref|NP_001151793.1|  DNA binding protein                                175   2e-46    
ref|XP_003573068.1|  PREDICTED: transcription factor bHLH96-like        174   2e-46    
gb|ABF94381.1|  Helix-loop-helix DNA-binding domain containing pr...    174   2e-46    
ref|XP_008376237.1|  PREDICTED: transcription factor bHLH57-like ...    177   3e-46    
ref|XP_008376236.1|  PREDICTED: transcription factor bHLH57-like ...    177   3e-46    
emb|CDY46652.1|  BnaA07g10440D                                          172   4e-46    
gb|AFW59111.1|  putative HLH DNA-binding domain superfamily protein     174   5e-46    
gb|AIB05336.1|  bHLH transcription factor                               174   5e-46    
ref|XP_008666449.1|  PREDICTED: transcription factor bHLH96-like        171   6e-46    
ref|NP_001175879.1|  Os09g0468700                                       173   1e-45    
ref|XP_004976648.1|  PREDICTED: transcription factor bHLH96-like ...    172   1e-45    
ref|XP_008678967.1|  PREDICTED: transcription factor bHLH96-like ...    174   1e-45    
gb|EAZ09437.1|  hypothetical protein OsI_31709                          173   1e-45    
ref|XP_008358042.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    175   2e-45    
ref|XP_009390274.1|  PREDICTED: transcription factor bHLH96-like ...    170   2e-45    
gb|ACF80037.1|  unknown                                                 172   2e-45    
ref|XP_003576627.2|  PREDICTED: transcription factor bHLH94-like        168   2e-45    
emb|CAN75452.1|  hypothetical protein VITISV_028014                     177   2e-45    
ref|XP_009366589.1|  PREDICTED: transcription factor bHLH57-like ...    174   3e-45    
ref|XP_009366590.1|  PREDICTED: transcription factor bHLH57-like ...    174   3e-45    
ref|XP_004973718.1|  PREDICTED: transcription factor bHLH94-like        171   9e-45    
ref|XP_004976647.1|  PREDICTED: transcription factor bHLH96-like ...    171   1e-44    
ref|XP_009413580.1|  PREDICTED: transcription factor bHLH96-like ...    169   1e-44    
ref|XP_007051418.1|  Basic helix-loop-helix DNA-binding superfami...    171   2e-44    
gb|KHG29346.1|  Transcription factor bHLH94 -like protein               168   2e-44    
emb|CAN66481.1|  hypothetical protein VITISV_030617                     170   3e-44    
ref|XP_010235229.1|  PREDICTED: transcription factor bHLH96-like        168   4e-44    
gb|KDP28406.1|  hypothetical protein JCGZ_14177                         168   7e-44    
ref|XP_010241047.1|  PREDICTED: transcription factor bHLH57 isofo...    169   7e-44    
ref|XP_011031077.1|  PREDICTED: transcription factor bHLH94-like ...    167   9e-44    
emb|CDY65719.1|  BnaC09g51650D                                          167   9e-44    
gb|KEH28106.1|  basic helix loop helix (BHLH) DNA-binding family ...    167   1e-43    
ref|XP_006301198.1|  hypothetical protein CARUB_v10021596mg             166   2e-43    
ref|XP_009113413.1|  PREDICTED: transcription factor bHLH96-like        165   3e-43    
ref|XP_004308405.1|  PREDICTED: transcription factor bHLH70-like        169   3e-43    
gb|AAO45750.1|  helix-loop-helix-like protein                           165   3e-43    
emb|CDY41734.1|  BnaA09g15620D                                          165   3e-43    
ref|XP_006444719.1|  hypothetical protein CICLE_v10020360mg             168   4e-43    
ref|XP_008797639.1|  PREDICTED: transcription factor bHLH57             167   5e-43    
gb|KDO86628.1|  hypothetical protein CISIN_1g013752mg                   167   9e-43    
ref|XP_011025361.1|  PREDICTED: transcription factor bHLH67-like        166   1e-42    
ref|XP_011097523.1|  PREDICTED: transcription factor bHLH96-like        164   1e-42    
ref|XP_009380223.1|  PREDICTED: transcription factor bHLH94-like ...    165   1e-42    
ref|XP_002992527.1|  hypothetical protein SELMODRAFT_430716             169   1e-42    
ref|XP_002990162.1|  hypothetical protein SELMODRAFT_428659             169   1e-42    
ref|XP_002894606.1|  hypothetical protein ARALYDRAFT_892725             164   2e-42    
ref|XP_009382232.1|  PREDICTED: transcription factor bHLH57-like        165   2e-42    
ref|XP_002301446.2|  hypothetical protein POPTR_0002s18100g             164   2e-42    
ref|XP_010414924.1|  PREDICTED: transcription factor bHLH94-like        163   2e-42    
ref|XP_010511217.1|  PREDICTED: transcription factor bHLH94-like        163   2e-42    
gb|AHL46674.1|  transcription factor FAMA                               160   3e-42    
ref|XP_010480197.1|  PREDICTED: transcription factor bHLH94-like        163   4e-42    
ref|XP_002539136.1|  DNA binding protein, putative                      158   5e-42    
ref|XP_002447020.1|  hypothetical protein SORBIDRAFT_06g026970          163   5e-42    
gb|AHL46673.1|  transcription factor FAMA                               159   7e-42    
ref|XP_004173070.1|  PREDICTED: transcription factor bHLH94-like        158   7e-42    
gb|AHL46672.1|  transcription factor FAMA                               159   8e-42    
ref|NP_001167769.1|  uncharacterized protein LOC100381462               160   1e-41    
ref|XP_010463194.1|  PREDICTED: transcription factor bHLH99-like        160   1e-41    
ref|XP_006365482.1|  PREDICTED: transcription factor FAMA-like          163   1e-41    
ref|XP_010312561.1|  PREDICTED: transcription factor bHLH94-like ...    162   1e-41    
ref|XP_011031076.1|  PREDICTED: transcription factor bHLH94-like ...    161   1e-41    
ref|XP_010484378.1|  PREDICTED: transcription factor bHLH99-like ...    160   2e-41    
ref|XP_006281758.1|  hypothetical protein CARUB_v10027920mg             160   2e-41    
dbj|BAB08913.1|  unnamed protein product                                159   3e-41    
ref|XP_004514916.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    162   3e-41    
ref|XP_009114337.1|  PREDICTED: transcription factor bHLH71-like ...    159   4e-41    
ref|XP_002515085.1|  DNA binding protein, putative                      162   5e-41    
ref|XP_009795997.1|  PREDICTED: transcription factor FAMA isoform X1    161   6e-41    
gb|KHF97772.1|  Transcription factor bHLH57 -like protein               161   7e-41    
ref|XP_009114336.1|  PREDICTED: transcription factor bHLH71-like ...    158   1e-40    
ref|XP_011091424.1|  PREDICTED: transcription factor FAMA isoform X2    160   2e-40    
ref|XP_009623659.1|  PREDICTED: transcription factor FAMA               159   2e-40    
ref|XP_011091423.1|  PREDICTED: transcription factor FAMA isoform X1    160   3e-40    
gb|ACJ85411.1|  unknown                                                 154   3e-40    
ref|XP_004240213.1|  PREDICTED: transcription factor FAMA-like          159   5e-40    
emb|CAA09459.1|  hypothetical protein                                   152   6e-40    
ref|XP_006392485.1|  hypothetical protein EUTSA_v10023998mg             156   7e-40    
ref|XP_009402067.1|  PREDICTED: transcription factor bHLH57-like        158   8e-40    
gb|KEH16413.1|  transcription factor                                    158   8e-40    
ref|XP_009412842.1|  PREDICTED: transcription factor bHLH94-like        160   9e-40    
ref|XP_009390273.1|  PREDICTED: transcription factor bHLH96-like ...    155   1e-39    
ref|XP_002866665.1|  basic helix-loop-helix family protein              154   2e-39    
gb|KCW60058.1|  hypothetical protein EUGRSUZ_H02788                     155   2e-39    
emb|CDY35175.1|  BnaA09g18120D                                          154   2e-39    
ref|XP_010107141.1|  hypothetical protein L484_019623                   156   2e-39    
ref|XP_004490291.1|  PREDICTED: transcription factor FAMA-like is...    156   5e-39    
ref|NP_192055.1|  transcription factor bHLH57                           154   5e-39    
ref|XP_010556635.1|  PREDICTED: transcription factor bHLH57-like ...    154   5e-39    
ref|XP_010919038.1|  PREDICTED: transcription factor bHLH57             156   6e-39    
ref|XP_010556634.1|  PREDICTED: transcription factor bHLH57-like ...    154   7e-39    
ref|XP_010673433.1|  PREDICTED: transcription factor FAMA               157   1e-38    
gb|KCW85163.1|  hypothetical protein EUGRSUZ_B02000                     152   1e-38    
ref|XP_010694945.1|  PREDICTED: transcription factor FAMA-like          157   1e-38    
ref|XP_010026737.1|  PREDICTED: transcription factor FAMA               155   2e-38    
ref|XP_008775533.1|  PREDICTED: transcription factor FAMA               154   2e-38    
ref|XP_009130507.1|  PREDICTED: transcription factor bHLH99             151   2e-38    
ref|XP_011045659.1|  PREDICTED: transcription factor FAMA isoform X2    154   2e-38    
ref|XP_009387118.1|  PREDICTED: transcription factor FAMA-like          155   2e-38    
ref|XP_002300174.2|  hypothetical protein POPTR_0001s32160g             154   3e-38    
ref|XP_011045658.1|  PREDICTED: transcription factor FAMA isoform X1    154   3e-38    
ref|XP_009111381.1|  PREDICTED: transcription factor bHLH57             152   4e-38    
ref|XP_010909228.1|  PREDICTED: transcription factor FAMA               154   4e-38    
ref|XP_010444538.1|  PREDICTED: transcription factor bHLH99-like ...    150   5e-38    
ref|XP_007034384.1|  Basic helix-loop-helix DNA-binding superfami...    154   5e-38    
ref|XP_006418807.1|  hypothetical protein EUTSA_v10002558mg             153   6e-38    
ref|XP_006418808.1|  hypothetical protein EUTSA_v10002558mg             152   6e-38    
ref|XP_009135876.1|  PREDICTED: transcription factor FAMA isoform X2    152   7e-38    
ref|XP_009135875.1|  PREDICTED: transcription factor FAMA isoform X1    153   7e-38    
ref|XP_011039383.1|  PREDICTED: transcription factor bHLH70-like ...    151   9e-38    
ref|XP_009106193.1|  PREDICTED: transcription factor FAMA-like          152   9e-38    
ref|XP_009385236.1|  PREDICTED: transcription factor bHLH57-like        151   9e-38    
ref|XP_008380575.1|  PREDICTED: transcription factor FAMA               153   1e-37    
ref|XP_009374601.1|  PREDICTED: transcription factor FAMA               153   1e-37    
emb|CDY33966.1|  BnaC02g43710D                                          149   2e-37    
gb|KDP39376.1|  hypothetical protein JCGZ_01133                         152   2e-37    
ref|XP_006375390.1|  hypothetical protein POPTR_0014s10190g             150   2e-37    
ref|XP_011039375.1|  PREDICTED: transcription factor bHLH57-like ...    151   2e-37    
ref|XP_009764528.1|  PREDICTED: transcription factor FAMA-like          148   3e-37    
ref|XP_010488493.1|  PREDICTED: transcription factor FAMA-like          151   3e-37    
ref|XP_002320235.2|  hypothetical protein POPTR_0014s10190g             149   3e-37    
ref|XP_010231276.1|  PREDICTED: transcription factor FAMA               152   3e-37    
gb|KDO61162.1|  hypothetical protein CISIN_1g014477mg                   151   3e-37    
ref|XP_006420896.1|  hypothetical protein CICLE_v10005031mg             151   4e-37    
ref|XP_006493805.1|  PREDICTED: transcription factor FAMA-like is...    151   4e-37    
ref|XP_007224326.1|  hypothetical protein PRUPE_ppa020429mg             151   5e-37    
ref|XP_006493804.1|  PREDICTED: transcription factor FAMA-like is...    150   6e-37    
ref|XP_001764869.1|  predicted protein                                  145   7e-37    
ref|XP_008224493.1|  PREDICTED: transcription factor FAMA isoform X1    150   7e-37    
ref|XP_006574999.1|  PREDICTED: transcription factor FAMA-like is...    150   8e-37    
ref|XP_006375391.1|  hypothetical protein POPTR_0014s10190g             149   9e-37    
ref|XP_009628530.1|  PREDICTED: transcription factor FAMA-like          147   9e-37    
ref|XP_008224494.1|  PREDICTED: transcription factor FAMA isoform X2    150   1e-36    
ref|XP_004247954.2|  PREDICTED: transcription factor FAMA isoform X2    146   1e-36    
ref|XP_002518108.1|  DNA binding protein, putative                      149   1e-36    
ref|NP_201335.1|  transcription factor bHLH99                           147   2e-36    
gb|EMT26125.1|  Transcription factor FAMA                               150   2e-36    
ref|XP_010326822.1|  PREDICTED: transcription factor FAMA isoform X1    145   3e-36    
emb|CDX92996.1|  BnaA03g37180D                                          148   3e-36    
emb|CDX94841.1|  BnaC03g43470D                                          148   3e-36    
ref|XP_011041874.1|  PREDICTED: transcription factor FAMA-like is...    148   4e-36    
ref|XP_011041873.1|  PREDICTED: transcription factor FAMA-like is...    148   5e-36    
ref|XP_006575000.1|  PREDICTED: transcription factor FAMA-like is...    148   5e-36    
ref|XP_010544881.1|  PREDICTED: transcription factor bHLH67-like ...    146   1e-35    
ref|XP_010934164.1|  PREDICTED: transcription factor bHLH57-like        146   3e-35    
ref|XP_002970868.1|  hypothetical protein SELMODRAFT_451148             146   4e-35    
gb|AFW59110.1|  putative HLH DNA-binding domain superfamily protein     142   4e-35    
ref|XP_010513159.1|  PREDICTED: transcription factor FAMA               145   5e-35    
ref|XP_008783538.1|  PREDICTED: transcription factor bHLH57-like ...    145   6e-35    
ref|XP_008783537.1|  PREDICTED: transcription factor bHLH57-like ...    145   7e-35    
ref|XP_010507966.1|  PREDICTED: transcription factor bHLH70-like ...    142   7e-35    
gb|KDO86627.1|  hypothetical protein CISIN_1g013752mg                   144   8e-35    
ref|NP_850735.1|  transcription factor bHLH67                           142   8e-35    
ref|XP_006444720.1|  hypothetical protein CICLE_v10020360mg             144   8e-35    
ref|XP_006292401.1|  hypothetical protein CARUB_v10018614mg             143   1e-34    
ref|XP_006394047.1|  hypothetical protein EUTSA_v10004772mg             140   1e-34    
ref|XP_010107771.1|  hypothetical protein L484_021591                   144   1e-34    
gb|AHL46670.1|  transcription factor SPCH                               141   2e-34    
ref|XP_010484379.1|  PREDICTED: transcription factor bHLH99-like ...    139   2e-34    
emb|CDX85167.1|  BnaC07g07390D                                          143   2e-34    
gb|AHL46669.1|  transcription factor SPCH                               141   2e-34    
ref|XP_002876647.1|  basic helix-loop-helix family protein              142   2e-34    
ref|XP_008438368.1|  PREDICTED: transcription factor FAMA               143   2e-34    
ref|XP_008662100.1|  PREDICTED: uncharacterized protein LOC100381...    142   2e-34    
ref|XP_009102547.1|  PREDICTED: transcription factor FAMA               142   3e-34    
ref|NP_567121.1|  transcription factor bHLH67                           142   3e-34    
gb|AAM67059.1|  unknown                                                 142   3e-34    
ref|XP_006397873.1|  hypothetical protein EUTSA_v10001803mg             141   3e-34    
ref|XP_010507965.1|  PREDICTED: transcription factor bHLH70-like ...    142   3e-34    
gb|KHN43750.1|  Transcription factor FAMA                               141   4e-34    
ref|XP_002323771.2|  hypothetical protein POPTR_0017s08160g             141   4e-34    
ref|XP_006573288.1|  PREDICTED: transcription factor FAMA-like          142   7e-34    
gb|EMT32746.1|  hypothetical protein F775_27706                         137   8e-34    
emb|CDY07143.1|  BnaCnng01580D                                          139   1e-33    
dbj|BAM14091.1|  basic helix-loop-helix DNA-binding superfamily p...    139   2e-33    
emb|CDX77460.1|  BnaA07g05980D                                          139   2e-33    
emb|CDY68483.1|  BnaA04g27520D                                          139   2e-33    
gb|KFK35381.1|  hypothetical protein AALP_AA5G277900                    139   2e-33    
ref|NP_182204.1|  transcription factor bHLH70                           139   2e-33    
ref|XP_004966795.1|  PREDICTED: transcription factor bHLH96-like        139   2e-33    
ref|XP_010527480.1|  PREDICTED: transcription factor FAMA-like          140   2e-33    
emb|CAB71902.1|  putative protein                                       139   2e-33    
ref|XP_006396347.1|  hypothetical protein EUTSA_v10028815mg             138   3e-33    
ref|XP_010507775.1|  PREDICTED: transcription factor bHLH70-like        139   6e-33    
ref|XP_008805918.1|  PREDICTED: transcription factor bHLH94-like        133   8e-33    
ref|XP_010518358.1|  PREDICTED: transcription factor bHLH70-like ...    137   1e-32    
ref|XP_010518359.1|  PREDICTED: transcription factor bHLH70-like ...    137   1e-32    
gb|ACJ85412.1|  unknown                                                 130   2e-32    
ref|XP_010469002.1|  PREDICTED: transcription factor bHLH67-like        135   3e-32    
ref|XP_002880266.1|  hypothetical protein ARALYDRAFT_904152             135   3e-32    



>ref|XP_009763212.1| PREDICTED: transcription factor bHLH71-like [Nicotiana sylvestris]
Length=314

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 235/339 (69%), Gaps = 44/339 (13%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHN-EASETTNLAAVAPKQPgqdlcggdgggldA  489
             MALEALS+NEL N IIYDT SATP  S+N + S + N A+                  + 
Sbjct  1     MALEALSSNELLNFIIYDTISATPFTSNNLDPSSSENAAS----------GTLLLDHENG  50

Query  490   CSSMP----AWRRRHSAGA--EMITPHSRAQQNLAV-QgggrkkrrrrpkICKNKEEAET  648
               ++P       +++S  +  E  T  +R ++NLAV QGGGRKKRRRRPK+CKNKEEAE 
Sbjct  51    LLTLPQHFCGHEQQYSTASVPETTTTTTRREKNLAVAQGGGRKKRRRRPKVCKNKEEAEN  110

Query  649   QRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA  828
             QR+THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH+LQSLEA
Sbjct  111   QRMTHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHILQSLEA  170

Query  829   EKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCS  1008
             +K  L +Q                               + F  PF QFF+YPQYT  CS
Sbjct  171   QKFLLLQQGGGDGEVPSE---------------------KYFPTPFAQFFSYPQYT--CS  207

Query  1009  SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLN  1188
                +PN  TSK+ AA ADIEVTLIETHANVRILS  R+ RQLSK+VAAFQ++ +SVLHLN
Sbjct  208   Q--LPNIYTSKSKAAIADIEVTLIETHANVRILSR-RRFRQLSKLVAAFQSLYLSVLHLN  264

Query  1189  VTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VTT D LVLYSISAKVE GCQL+SAD+IA AVHH+LR+I
Sbjct  265   VTTLDPLVLYSISAKVEEGCQLNSADDIAGAVHHMLRII  303



>ref|XP_009631535.1| PREDICTED: transcription factor bHLH71 [Nicotiana tomentosiformis]
Length=327

 Score =   322 bits (825),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 234/340 (69%), Gaps = 33/340 (10%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHN-EASETTNLAAVAPKQPgqdlcggdgggldA  489
             MALEALS+NEL N IIYDT SATP  S+N + S + N A+                  + 
Sbjct  1     MALEALSSNELLNFIIYDTISATPFTSNNLDPSSSENAAS----------GTLLLDHENG  50

Query  490   CSSMPAWRRRH-------SAGAEMITPHSRAQQNLAV-QgggrkkrrrrpkICKNKEEAE  645
               ++P     H       S      T  +R ++NLAV QGGGRKKRRRRPK+CKNKEEAE
Sbjct  51    LLTLPQDFYGHEQQYSTASVPETTTTTTTRREKNLAVAQGGGRKKRRRRPKVCKNKEEAE  110

Query  646   TQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLE  825
              QR+THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH+LQSLE
Sbjct  111   NQRMTHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHILQSLE  170

Query  826   AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSC  1005
             A+K  L +Q      G    T A                G+ F  PF QFF+YPQYT  C
Sbjct  171   AQKFLLLQQGGGDGEGPSETTIAGDAVAAT---------GKYFPTPFAQFFSYPQYT--C  219

Query  1006  SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHL  1185
             S   +P+K TSK+ AA ADIEVTLIE HANVRILS  R+ RQLSK+VAAF ++ +SVLHL
Sbjct  220   S--QLPSKYTSKSKAAIADIEVTLIEAHANVRILSR-RRFRQLSKLVAAFPSLYLSVLHL  276

Query  1186  NVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             NVTT D LVLYSISAKVE GCQL+SAD+IA AVHH+LR+I
Sbjct  277   NVTTLDPLVLYSISAKVEEGCQLNSADDIAGAVHHMLRII  316



>ref|NP_001265931.1| Hop-interacting protein THI018 [Solanum lycopersicum]
 gb|AEW69789.1| Hop-interacting protein THI018 [Solanum lycopersicum]
Length=328

 Score =   317 bits (811),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 224/349 (64%), Gaps = 46/349 (13%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPA-------LSHN----EASETTNLAAVAPKQPgqdl  459
             MALEALSTNEL N IIYDT S T         L  N    +  E  N   + P+      
Sbjct  1     MALEALSTNELLNFIIYDTISTTTTTTNSNNNLDENALFFDNHEENNAFLLKPQD-----  55

Query  460   cggdgggldACSSMPAWRRRHSAGAEMITPHS-RAQQNLAVQgggrkkrrrrp------k  618
                       C++ P   +++S  A +  P S R + NL+V          R       K
Sbjct  56    ---------FCTTTP-LEQQYSIAASVPRPESSREKNNLSVAAQSGGGGGGRKKRRRRPK  105

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             ICKNKEEAE QR+THIAVERNRRKQMNEHL+VLRSLMPESYVQRGDQASIVGGAIEFVKE
Sbjct  106   ICKNKEEAENQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQRGDQASIVGGAIEFVKE  165

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH+LQSLEA+K  L +QQQ+           +  +D          K      PF QFF
Sbjct  166   LEHILQSLEAQKFVLLQQQQEG--------GTSNDNDDCDGGKREVSKADYVGTPFAQFF  217

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             +YPQYT  C    +PNK TSK+ AA ADIEVTLIETHANVRILS  R+ RQLSK+VAAFQ
Sbjct  218   SYPQYTC-CE---LPNKYTSKSKAAIADIEVTLIETHANVRILSR-RRFRQLSKLVAAFQ  272

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++ +SVLHLNVTT D LVLYSIS KVE GCQL+SAD+IA AVHH+LR+I
Sbjct  273   SLYISVLHLNVTTLDPLVLYSISVKVEEGCQLNSADDIAGAVHHMLRII  321



>ref|XP_006352865.1| PREDICTED: transcription factor bHLH71-like [Solanum tuberosum]
Length=330

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 220/346 (64%), Gaps = 40/346 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPA-----LSHN----EASETTNLAAVAPKQPgqdlcg  465
             MALEALSTNEL N IIYDT S T       L  N    +  E  N   + P+        
Sbjct  1     MALEALSTNELLNFIIYDTISTTTNNNNNNLDENALFFDNHEENNAFLLKPQD-------  53

Query  466   gdgggldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrp------kICK  627
                     C++ P  ++  +A +       R + NL+V          R       KICK
Sbjct  54    -------FCTTTPLEQQYSTAASVPRQDTCREKNNLSVAAQSGGGGGGRKKRRRRPKICK  106

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEEAE QR+THIAVERNRRKQMNEHL+VLRSLMPESYVQRGDQASIVGGAIEFVKELEH
Sbjct  107   NKEEAENQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  166

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             +LQSLEA+K  L +QQ  + +               V+             PF QFF+YP
Sbjct  167   ILQSLEAQKFVLLQQQGGTTSNTGDGCDGYDVGKTEVS------SAEYVGTPFAQFFSYP  220

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QYT  C    +PNK TSK+ AA ADIEVTLIETHANVRILS  R+ RQLSK+VAAFQ++ 
Sbjct  221   QYTC-CE---LPNKYTSKSKAAIADIEVTLIETHANVRILSR-RRFRQLSKLVAAFQSLY  275

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +SVLHLNVTT D LVLYSISAKVE GCQL+SAD+IA AVHH+LR+I
Sbjct  276   ISVLHLNVTTLDPLVLYSISAKVEEGCQLNSADDIAGAVHHMLRII  321



>ref|XP_002278824.1| PREDICTED: transcription factor bHLH71 [Vitis vinifera]
Length=315

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 222/332 (67%), Gaps = 26/332 (8%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLA-AVAPKQPgqdlcggdgggldA  489
             MALEALS+N+L N IIY+T SATP   H       +L   + P+  G  L          
Sbjct  1     MALEALSSNDLLNFIIYETISATPYTCHAPLEAGFSLENPLKPQDLGGALDTPSTVMDPR  60

Query  490   CSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIA  669
             CS  P    R              +QNLAVQG  +++RR R  +CKNKEEAETQR+THIA
Sbjct  61    CSMGPETSNR--------------KQNLAVQGRKKRRRRAR--VCKNKEEAETQRMTHIA  104

Query  670   VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQR  849
             VERNRR+QMNEHLA+LRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA K ++  
Sbjct  105   VERNRRRQMNEHLAILRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKHKM--  162

Query  850   QQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNK  1029
                Q    +   ++++ +      + +G    +    PF QFF YPQYT     S +PNK
Sbjct  163   --VQGVRENVDDSSSSSSSSTGTGTGTGITANKFMPPPFSQFFVYPQYTW----SQMPNK  216

Query  1030  CTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLL  1209
              TSK+ AA ADIEVTLIETHAN+RILS  +  R LSKMV  FQT+ +++LHLNVTT D L
Sbjct  217   YTSKSKAAVADIEVTLIETHANLRILSH-KSPRLLSKMVTGFQTLYLTILHLNVTTVDPL  275

Query  1210  VLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VLYSISAKVE GCQL+S D+IA AVHH+LR+I
Sbjct  276   VLYSISAKVEEGCQLTSVDDIAGAVHHMLRII  307



>gb|KHN45285.1| Transcription factor bHLH71 [Glycine soja]
Length=303

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 188/330 (57%), Positives = 212/330 (64%), Gaps = 40/330 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHN--EASETTNLAAVAPKQPgqdlcggdgggld  486
             MALE L++NE  N IIYDT SATP  SH   EAS   +L       P             
Sbjct  1     MALETLASNEFSNFIIYDTISATPFSSHGSPEASFLESLVNYQEHDP-------------  47

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
             A  +     R H AG +      R Q  + VQ  GRKKRRR+P++CKNKEEAETQRITHI
Sbjct  48    AFDNSALRTRNHQAGEQESV--GRRQNVVGVQVQGRKKRRRKPRVCKNKEEAETQRITHI  105

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
              VERNRRKQMNEHL VLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA KL+L 
Sbjct  106   TVERNRRKQMNEHLVVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKLQLL  165

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
              Q+                    V +       +    PF QFF+YPQYT S +    PN
Sbjct  166   HQE-------------------VVQANENTAISKLMQPPFAQFFSYPQYTWSQT----PN  202

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT AA ADIEVTLIETHAN+RIL+      QL+K+VA FQT+C++VLHLNVTT D 
Sbjct  203   KYTSKTKAAIADIEVTLIETHANLRILTRRNSPGQLTKLVAGFQTLCLTVLHLNVTTIDP  262

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             LV YSISAKVE G QL S D IA A+HH+L
Sbjct  263   LVFYSISAKVEEGFQLCSVDGIATAIHHLL  292



>emb|CDP13044.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 229/340 (67%), Gaps = 33/340 (10%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASE------TTNLAAVAPKQPgqdlcggdg  474
             MALEALS+NEL N IIYDT SATP  S N+++       T  L      +         G
Sbjct  1     MALEALSSNELLNFIIYDTISATP-FSSNDSNNSCHENSTNFLLDNGGLKTDNCGGAEAG  59

Query  475   ggldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQR  654
             GGL+ CS M                  R Q +LAVQG  +++RR+R  +CKNKEEAETQR
Sbjct  60    GGLENCSCM--------PPPPPPVQSQRQQNSLAVQGRKKRRRRQR--VCKNKEEAETQR  109

Query  655   ITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEK  834
             +THIAVERNRRKQMNEHLAVLR+LMPESYVQRGDQASIVGGAIEFVKELEH LQSLEA++
Sbjct  110   MTHIAVERNRRKQMNEHLAVLRALMPESYVQRGDQASIVGGAIEFVKELEHHLQSLEAQR  169

Query  835   LRLQRQQQQSaagddgataatktddgavasvsggvKGRSF---TNPFWQFFAYPQYTTSC  1005
               L +Q   +           KT     A+++     + F     PF QFFAYPQYT   
Sbjct  170   FLLLQQHGGA---------NDKTTTTMAAAIATATGNKCFPPAPTPFAQFFAYPQYTC--  218

Query  1006  SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHL  1185
              S+ +PNK TSK+ AA ADIEVTLIETHANVRILS  R+ RQLSKMV   QT+ +++LHL
Sbjct  219   -SAQLPNKYTSKSKAAIADIEVTLIETHANVRILSR-RRVRQLSKMVTGLQTLYLTILHL  276

Query  1186  NVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             N+TT D LVLYSISAKVE GC L+SAD+IA AVHHILR+I
Sbjct  277   NITTLDPLVLYSISAKVEEGCLLNSADDIAGAVHHILRII  316



>ref|NP_001242622.1| uncharacterized protein LOC100783542 [Glycine max]
 gb|ACU18640.1| unknown [Glycine max]
Length=303

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 187/330 (57%), Positives = 211/330 (64%), Gaps = 40/330 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHN--EASETTNLAAVAPKQPgqdlcggdgggld  486
             MALE L++NE  N IIYDT SATP  SH   EAS   +L       P  D          
Sbjct  1     MALETLASNEFSNFIIYDTISATPFSSHGSPEASFLESLVNYQEHDPAFDNS--------  52

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
                   A R R+   +E  +   R Q  + VQ  GRKKRRR+P++CKNKEEAETQRITH 
Sbjct  53    ------ALRTRNHQASEQESV-GRRQNVVGVQVQGRKKRRRKPRVCKNKEEAETQRITHT  105

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
              VERNRRKQMNEHL VLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA KL+L 
Sbjct  106   TVERNRRKQMNEHLVVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKLQLL  165

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
              Q+                    V +       +    PF QFF+YPQYT     S  PN
Sbjct  166   HQE-------------------VVQANENTAISKLMRPPFAQFFSYPQYTW----SQTPN  202

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT AA ADIEVTLIETHAN+RIL+      QL+K+VA FQT+C++VLHLNVTT D 
Sbjct  203   KYTSKTKAAIADIEVTLIETHANLRILTRRNSPGQLTKLVAGFQTLCLTVLHLNVTTIDP  262

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             LV YSISAKVE G QL S D IA A+HH+L
Sbjct  263   LVFYSISAKVEEGFQLCSVDGIATAIHHLL  292



>ref|XP_007156419.1| hypothetical protein PHAVU_003G284500g [Phaseolus vulgaris]
 ref|XP_007156420.1| hypothetical protein PHAVU_003G284500g [Phaseolus vulgaris]
 gb|ESW28413.1| hypothetical protein PHAVU_003G284500g [Phaseolus vulgaris]
 gb|ESW28414.1| hypothetical protein PHAVU_003G284500g [Phaseolus vulgaris]
Length=326

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 215/331 (65%), Gaps = 41/331 (12%)
 Frame = +1

Query  307   ISMALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggld  486
             I+MALE L +NE  N ++YDT SATP  SH+ +SE + L +    Q              
Sbjct  25    ITMALETLPSNEFSNFMVYDTISATPFSSHD-SSEASFLESFGNYQEHDPSLDN------  77

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
              CS     R+R ++  E I    R Q  + VQG  +++R+ R  +CKNKEEAETQRITHI
Sbjct  78    -CSMRT--RKRQASEPEGI---DRKQNVVGVQGRKKRRRKPR--VCKNKEEAETQRITHI  129

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
              VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQ+LEA KL+L 
Sbjct  130   TVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQTLEARKLQLL  189

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +Q+                      +       +    PF QFF YPQYT S +    PN
Sbjct  190   QQE-------------------VAQTNENTAISKLMQPPFAQFFLYPQYTWSQN----PN  226

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKT-RQLSKMVAAFQTMCMSVLHLNVTTFD  1203
             K TSKT AA ADIEVTLIETHAN+RIL  TRKT  QL+K+V+ FQ + ++VLHLNVTT D
Sbjct  227   KYTSKTKAAIADIEVTLIETHANLRIL--TRKTPAQLTKLVSGFQNLHLTVLHLNVTTID  284

Query  1204  LLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              LV YSISAKVE G QL S D IA AVHH+L
Sbjct  285   PLVFYSISAKVEEGFQLGSVDGIASAVHHLL  315



>ref|XP_006385664.1| hypothetical protein POPTR_0003s09200g [Populus trichocarpa]
 gb|ERP63461.1| hypothetical protein POPTR_0003s09200g [Populus trichocarpa]
Length=303

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 180/334 (54%), Positives = 222/334 (66%), Gaps = 41/334 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAA--VAPKQPgqdlcggdgggld  486
             MAL+ALS+NE  N I+YDT SATP  SH  + ETT+L    + P+  G  +         
Sbjct  1     MALQALSSNEFLNFILYDTISATPCSSH-ASLETTSLLLENLIPQDHGVSVNSSSLMTGQ  59

Query  487   ACS-SMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITH  663
              CS    A  RRH+               LAVQG  +++R+ R  +CKN+E+AETQR+TH
Sbjct  60    RCSMGREAVNRRHNL--------------LAVQGKKKRRRKPR--VCKNREDAETQRMTH  103

Query  664   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRL  843
             IAVERNRRK MNEHLAVLRSLMPESYV+RGDQASIVGGAIEFVKE+EH LQSLEA+KL+L
Sbjct  104   IAVERNRRKLMNEHLAVLRSLMPESYVRRGDQASIVGGAIEFVKEMEHFLQSLEAKKLKL  163

Query  844   QRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIP  1023
             +++        + AT  ++                    PF QFF  PQYT     S IP
Sbjct  164   KQELTGPNYSAENATTTSEFPQP----------------PFSQFFVSPQYTW----SQIP  203

Query  1024  NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFD  1203
             +K TSKT A+ ADIE TLIETHAN+RILS  R  RQLSK+V+ F T+ ++VLH+NVTT D
Sbjct  204   SKFTSKTAASIADIEATLIETHANLRILSR-RSPRQLSKLVSGFHTLYLTVLHINVTTMD  262

Query  1204  LLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              LVLYSISAK+E GCQL+S D++A AVHH+LR+I
Sbjct  263   PLVLYSISAKLEEGCQLTSVDDLAGAVHHMLRII  296



>gb|KHG10560.1| Transcription factor bHLH71 -like protein [Gossypium arboreum]
Length=303

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 217/333 (65%), Gaps = 40/333 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LE LS+N+L N +IYDT SATP  S N++  TT             +          C
Sbjct  1     MTLETLSSNDLLNFVIYDTISATP-YSGNDSFMTT-----------FSMEEQSTSTALNC  48

Query  493   SSM--PAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
               M  P    R +A     T     + NLAVQG  +++R+ R  +CKNKEEAETQR+THI
Sbjct  49    FPMVTPPQCCRSTA-----TEAVERRPNLAVQGRKKRRRKPR--LCKNKEEAETQRMTHI  101

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
             AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQ+LEAEK R+ 
Sbjct  102   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQTLEAEKFRVL  161

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +Q   +AA ++  T                      + PF QF   PQYT     S IPN
Sbjct  162   QQVTPAAAANEETTNTNSKMLS--------------SPPFAQFLMQPQYTW----SQIPN  203

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT A+ ADIEVTLIETHAN+RIL     T QLSK+VA FQ++ +S+LHLNVTT D 
Sbjct  204   KYTSKTKASIADIEVTLIETHANLRILLRKGPT-QLSKLVAGFQSLFLSILHLNVTTLDP  262

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              VLYSISAKV+ GCQLSS D+IA AVHH++R+I
Sbjct  263   FVLYSISAKVDEGCQLSSVDDIARAVHHMIRII  295



>gb|KDP33097.1| hypothetical protein JCGZ_13618 [Jatropha curcas]
Length=302

 Score =   296 bits (757),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 220/335 (66%), Gaps = 45/335 (13%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEALS++E  N IIYDT SATP  + +++ ET+ L   + K P       +       
Sbjct  1     MTLEALSSSEFLNFIIYDTISATPCSNSHDSLETSPLLETSLK-PQNHGTSSNS------  53

Query  493   SSMPAWRRRH---SAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITH  663
             SS+ A +RR     AG          +Q+L VQG  +++R+ R  +CKNKEEAETQR+TH
Sbjct  54    SSLTAQQRRFRELDAG--------EWKQSLGVQGRKKRRRKPR--VCKNKEEAETQRMTH  103

Query  664   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRL  843
             IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQ LEA+KL+L
Sbjct  104   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQYLEAKKLQL  163

Query  844   QRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIP  1023
             Q                            G    +  T PF QFF YPQYT     S +P
Sbjct  164   QN------------------GLRGDNDEDGSTDSKFLTPPFSQFFVYPQYTW----SQMP  201

Query  1024  NKCTSKTTAATADIEVTLIETHANVRILSSTRKT-RQLSKMVAAFQTMCMSVLHLNVTTF  1200
             NK TSKT AA ADIEVTL+ETHAN+RILS  RK  RQLSK+V  FQT+ +++LH+NVT+ 
Sbjct  202   NKHTSKTKAAIADIEVTLVETHANLRILS--RKCYRQLSKLVTGFQTLHLTILHINVTSS  259

Query  1201  DLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +  VLYSISAK+E  CQL+  D+IA AVH +LR+I
Sbjct  260   EPFVLYSISAKLEEECQLTCVDDIAGAVHQMLRII  294



>gb|KHG15048.1| Transcription factor bHLH96 -like protein [Gossypium arboreum]
Length=295

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 214/336 (64%), Gaps = 54/336 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             MALE LS+NEL N IIYDT  ATP  SH+  S  T+ +     +             +A 
Sbjct  1     MALETLSSNELLNFIIYDTIFATPCSSHHHESLVTDFSM----ENSFSSLEQARNSGNAL  56

Query  493   SSMPAWRRRHSAGAEMITPHSRAQ----QNLAVQgggrkkrrrrpkICKNKEEAETQRIT  660
             S +P           M+TP  R++     NLAVQG  +++R+ R  +CKNK EAETQR+T
Sbjct  57    SCLP-----------MVTPKCRSKGMERSNLAVQGRKKRRRKPR--VCKNKAEAETQRMT  103

Query  661   HIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLR  840
             HIAVERNRRKQMNEHL VLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQ+LEA+K R
Sbjct  104   HIAVERNRRKQMNEHLTVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQTLEAQKHR  163

Query  841   LQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMI  1020
             ++  +   ++                              PF QFF +PQYT     S I
Sbjct  164   VETNKSLLSSSSSP--------------------------PFAQFFTHPQYTW----SQI  193

Query  1021  PNKCTSKTTAATADIEVTLIETHANVRILSSTRKT-RQLSKMVAAFQTMCMSVLHLNVTT  1197
             PNK T KT A+ ADIEVTLI+THAN+RIL  TRK  +QL K+VA   ++ +S+LHLNVT+
Sbjct  194   PNKHTPKTKASIADIEVTLIQTHANLRIL--TRKVHKQLPKLVAGLHSLYLSILHLNVTS  251

Query  1198  FDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              D  +LYSIS KVE GCQL+S D IA AVH++LR+I
Sbjct  252   MDTFILYSISVKVEEGCQLNSVDNIAGAVHNMLRII  287



>ref|XP_010096553.1| hypothetical protein L484_001866 [Morus notabilis]
 gb|EXB64912.1| hypothetical protein L484_001866 [Morus notabilis]
Length=337

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 221/353 (63%), Gaps = 46/353 (13%)
 Frame = +1

Query  313   MALEALST-NELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldA  489
             MALEALS+ NELFN +IYDT SATP+     + + TN + V            +   +  
Sbjct  1     MALEALSSSNELFNFVIYDTISATPS-----SYQDTNSSLVETTATFLYDDDNNNNNIST  55

Query  490   CSSM---PAWRRRHSAGAEMITPHS---------------RAQQNL---AVQgggrkkrr  606
              +S    P     H  G    T  S               RA Q +   A QG  RKKRR
Sbjct  56    TTSTFLRPQDHHHHQVGMNTGTTCSLTAKREPGAPECGDRRAAQKVVLGAAQGSVRKKRR  115

Query  607   rrpkICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIE  786
             R+ ++CKNKEEAETQR+THIAVERNRRKQMNEHL+VLRSLMPESYVQRGDQASIVGGAIE
Sbjct  116   RKARVCKNKEEAETQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQRGDQASIVGGAIE  175

Query  787   FVKELEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPF  966
             FVKELEHLLQSLEA+KL+L  Q   +                  +        +    PF
Sbjct  176   FVKELEHLLQSLEAQKLQLNLQGMNN--------------INGGSDHDLDQDSKLLPPPF  221

Query  967   WQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
              QFF YPQYT     S I NK TSKT AA ADIEVTLIETHA++RILS  R  +QLSK+V
Sbjct  222   AQFFVYPQYTW----SQISNKYTSKTKAAIADIEVTLIETHASLRILSR-RSLKQLSKLV  276

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             A FQT+ +++LH+NVTT + LVLYS+S KVE  C L+S D+IA AVHH+LR+I
Sbjct  277   AGFQTLHLTILHINVTTLNPLVLYSVSVKVEEACLLTSVDDIAAAVHHMLRII  329



>ref|XP_003531959.1| PREDICTED: transcription factor bHLH71-like isoform X1 [Glycine 
max]
Length=303

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 207/328 (63%), Gaps = 36/328 (11%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LE L +NE  N IIYDT SATP  SH  + E + L +    Q   D    D   +   
Sbjct  1     MTLETLQSNEFSNFIIYDTISATPFSSHG-SPEASFLESFVNYQEQHDHPTFDNCAMRT-  58

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                   R+R ++  E I    R Q ++AVQG  +++R+ R  +CKN EEAETQRITHI V
Sbjct  59    ------RKREASEPESI---GRRQNSVAVQGRKKRRRKPR--VCKNTEEAETQRITHITV  107

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA KL+L  Q
Sbjct  108   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKLQLLHQ  167

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             +                      +       +    PF   F+YPQYT     S  PNK 
Sbjct  168   E-------------------VAQTNENTAISKLMQPPFAHCFSYPQYTW----SQTPNKY  204

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
             TSKT AA ADIEVTLIETHAN+RIL+      QL+K+VA FQT+C++VLHLNVTT D LV
Sbjct  205   TSKTKAAIADIEVTLIETHANLRILTRRSSHGQLTKLVAGFQTLCLTVLHLNVTTIDPLV  264

Query  1213  LYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              YS SAKVE G QL S D IA AVHH+L
Sbjct  265   FYSFSAKVEEGFQLGSVDGIATAVHHLL  292



>gb|KHN10161.1| Transcription factor bHLH96-like protein [Glycine soja]
Length=303

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 207/328 (63%), Gaps = 36/328 (11%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LE L +NE  N IIYDT SATP  SH  + E + L +    Q   D    D   +   
Sbjct  1     MTLETLQSNEFSNFIIYDTISATPFSSHG-SPEASFLESFVNYQEQHDHPTFDNCAMRT-  58

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                   R+R ++  E I    R Q ++AVQG  +++R+ R  +CKN EEAETQRITHI V
Sbjct  59    ------RKREASEPESI---GRRQNSVAVQGRKKRRRKPR--VCKNTEEAETQRITHITV  107

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA KL+L  Q
Sbjct  108   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKLQLLHQ  167

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             +                      +       +    PF   F+YPQYT     S  PNK 
Sbjct  168   E-------------------VAQTNENTAISKLMQPPFAHCFSYPQYTW----SQTPNKY  204

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
             TSKT AA ADIEVTLIETHAN+RIL+      QL+K+VA FQT+C++VLHLNVTT D LV
Sbjct  205   TSKTKAAIADIEVTLIETHANLRILTRRSCHGQLTKLVAGFQTLCLTVLHLNVTTIDPLV  264

Query  1213  LYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              YS SAKVE G QL S D IA AVHH+L
Sbjct  265   FYSFSAKVEEGFQLGSVDGIATAVHHLL  292



>ref|XP_007039472.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY23973.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=304

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 221/342 (65%), Gaps = 57/342 (17%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLA---AVAPKQPgqdlcggdgggl  483
             MALE LS+NEL N IIYDT SATP  SH+      +L    +++ +Q             
Sbjct  1     MALETLSSNELLNFIIYDTISATPYSSHDSLVTDFSLENGFSISQEQ-------------  47

Query  484   dACSSMPAWRRRHSAGAEMITPHSRA--------QQNLAVQgggrkkrrrrpkICKNKEE  639
                SS+  +         ++TP  R+        + NLAVQG  +++R+ R  +CKNKEE
Sbjct  48    --ASSLNCF--------PLVTPQCRSTGVEAADRRPNLAVQGRKKRRRKPR--VCKNKEE  95

Query  640   AETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQS  819
             AETQR+THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQ+
Sbjct  96    AETQRMTHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQT  155

Query  820   LEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTT  999
             LEA+KL++ +Q + ++ G   +           A                      QYT 
Sbjct  156   LEAQKLQVLQQVRPASEGTTNSKLLPPPPPPPFAQFFMFP----------------QYTW  199

Query  1000  SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVL  1179
             S     IP+K TSKT A+ ADIEVTLIETHAN+RILS  +  R LSK+VA FQ++C+S+L
Sbjct  200   S----QIPSKFTSKTKASIADIEVTLIETHANLRILSR-KGPRHLSKLVAGFQSLCLSIL  254

Query  1180  HLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             HL+VTT   LVLYSISAKVE GCQLSS D+IA AVHH+LR+I
Sbjct  255   HLSVTTMYPLVLYSISAKVEEGCQLSSVDDIAGAVHHMLRII  296



>ref|XP_011018549.1| PREDICTED: transcription factor bHLH71-like isoform X2 [Populus 
euphratica]
Length=301

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 214/333 (64%), Gaps = 41/333 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN--LAAVAPKQPgqdlcggdgggld  486
             MALEALS+ E  N +I DT  ATP   H+ + ET    L  + P+  G  +         
Sbjct  1     MALEALSSTEFPNFVIDDTIPATPYNCHD-SLETAGFLLEDLKPQDHGVSVNTSSLMTQQ  59

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
              CS               +   SR Q  LAVQG  +++R  R  +CKN+EEAETQR+THI
Sbjct  60    RCS---------------VEATSRRQNLLAVQGKKKRRRTPR--VCKNREEAETQRMTHI  102

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
             AVERNRRK MN +LAVLRS MPES+VQRGDQASIVGGAI FVKELEHLLQSLEA+KL+L 
Sbjct  103   AVERNRRKLMNGYLAVLRSHMPESFVQRGDQASIVGGAIVFVKELEHLLQSLEAKKLKLH  162

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +         + ATA ++                    PF QFF YPQYT S     IPN
Sbjct  163   QGLTGPDYDIEDATATSEVPPP----------------PFAQFFVYPQYTWS----QIPN  202

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT A+ ADIEV LIETHAN+RILS  R+ RQLSK+VA FQT+ ++VLH+NVTT D 
Sbjct  203   KFTSKTKASIADIEVNLIETHANLRILSR-RRPRQLSKLVAGFQTLYLTVLHINVTTMDP  261

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             LVLYSISAK+E GC L+S D+IA AVHH+LR+I
Sbjct  262   LVLYSISAKLEEGCHLTSVDDIAGAVHHMLRII  294



>ref|XP_006368389.1| hypothetical protein POPTR_0001s02350g [Populus trichocarpa]
 gb|ERP64958.1| hypothetical protein POPTR_0001s02350g [Populus trichocarpa]
Length=303

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 217/333 (65%), Gaps = 39/333 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN--LAAVAPKQPgqdlcggdgggld  486
             MALEALS++E  N IIYDT  ATP   H ++ ET    L  + P+            G+ 
Sbjct  1     MALEALSSSEFLNFIIYDTIPATPYNCH-DSLETAGFLLENLKPQD----------HGVS  49

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
               SS    ++R S G E     +R Q  LAVQG  +++R+ R  +CKN+EEAETQR+THI
Sbjct  50    VNSSSLMTQQRCSMGREAT---NRRQNLLAVQGKKKRRRKPR--VCKNREEAETQRMTHI  104

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
             AVERNRRK MN +LAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA KL+L 
Sbjct  105   AVERNRRKLMNGYLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEARKLKLH  164

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +                                     PF QFF YPQYT     S IPN
Sbjct  165   Q----------------GLTGPDYDIEDATETSEFPPPPFAQFFVYPQYTW----SQIPN  204

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT A+ ADIEV LIETHAN+RILS  R  RQLSK+VA FQT+ ++VLH+NVTT D 
Sbjct  205   KFTSKTKASIADIEVNLIETHANLRILSR-RSPRQLSKLVAGFQTLYLTVLHINVTTMDP  263

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             LVLYSISAK+E GCQL+S D+IA AVHH+LR+I
Sbjct  264   LVLYSISAKLEEGCQLTSVDDIAGAVHHMLRII  296



>ref|XP_004509733.1| PREDICTED: transcription factor bHLH71-like [Cicer arietinum]
Length=315

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 212/330 (64%), Gaps = 28/330 (8%)
 Frame = +1

Query  313   MALEALST--NELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggld  486
             MALE LS+  N+  N IIYDT SATP  S        N+  +  +   +     +    D
Sbjct  1     MALETLSSSNNDFSNFIIYDTISATP-FSTTTTESHNNICFLENRMNNELAFDHNNNNYD  59

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
                 M   R+R  +             N      GRKKRRR+P++CKNKEEAETQRITHI
Sbjct  60    V---MMKNRKRQCSRENEEEEEEERIGNSKQMVQGRKKRRRKPRVCKNKEEAETQRITHI  116

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
              VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA+KL+L 
Sbjct  117   TVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAKKLQLL  176

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +Q+   +  DD + +                       PF QFF YPQYT S +    PN
Sbjct  177   QQEVAQSNEDDTSISKLMIRP-----------------PFAQFFVYPQYTWSQN----PN  215

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT AA ADIEVTLIETHAN+RIL+  R+T QL+K+VA FQT+ +++LHLNVTT D 
Sbjct  216   KYTSKTKAAIADIEVTLIETHANLRILTR-RRTGQLTKLVAGFQTLFLTILHLNVTTIDP  274

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             LV YSISAKVE G QL S D IA AVHHIL
Sbjct  275   LVFYSISAKVEEGFQLGSVDGIATAVHHIL  304



>gb|EYU18780.1| hypothetical protein MIMGU_mgv1a010772mg [Erythranthe guttata]
Length=302

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 217/339 (64%), Gaps = 55/339 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYD-TFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldA  489
             MALE LS++EL N I+YD T SA      +EA+ET                         
Sbjct  1     MALETLSSSELLNFIMYDSTVSAPTPFESSEAAET-------------------------  35

Query  490   CSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIA  669
                    R+ H   A             AVQG  +++RR +  +CKNKEEAETQR+THIA
Sbjct  36    -------RQSHPPPA----------TETAVQGRKKRRRRPK--VCKNKEEAETQRMTHIA  76

Query  670   VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQR  849
             VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH+LQSLEA+K  L  
Sbjct  77    VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHILQSLEAKKFTLLE  136

Query  850   QQQQSaagddgataatktddgavasvsggvKGRSFTN-------PFWQFFAYPQYTTSCS  1008
             QQ  +   +          +          +  S  N       PF QFFAYPQ+  SCS
Sbjct  137   QQGNNNNTNINNNINNNNSNNNNEDNYNPDQEISDDNSSIKQVSPFAQFFAYPQF--SCS  194

Query  1009  SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLN  1188
             ++ + NK TS++ AA ADIEVTLIETHAN+R + S R+ RQLSK+VA+F ++ +++LHLN
Sbjct  195   NNQMGNKYTSQSKAAIADIEVTLIETHANIR-ILSRRRLRQLSKIVASFHSVSLTILHLN  253

Query  1189  VTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VTT DLLVLYSISAKVE GCQLSSADEIA AVHH+LR+I
Sbjct  254   VTTLDLLVLYSISAKVEEGCQLSSADEIAGAVHHMLRII  292



>ref|XP_010055312.1| PREDICTED: transcription factor bHLH71 [Eucalyptus grandis]
 gb|KCW71778.1| hypothetical protein EUGRSUZ_E00273 [Eucalyptus grandis]
Length=346

 Score =   281 bits (720),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 170/229 (74%), Gaps = 9/229 (4%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKNKEEAETQR+THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE
Sbjct  120   VCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  179

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEHLLQSLEA+K  LQ  Q ++             +       +     +    PF QFF
Sbjct  180   LEHLLQSLEAQK--LQHSQYKA------GEDIASEEADTTNDTNNDDPSKILQPPFSQFF  231

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
              YPQYT S + S      TS T AA ADIEVTLIETHA++RILS  R TRQLS+++A F 
Sbjct  232   MYPQYTWSQAPSKYTASSTSTTGAAIADIEVTLIETHASLRILSR-RNTRQLSRLIAGFH  290

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             T+ +S+LHLNVTT D LVLYSISAKVE GCQL+S D+IA AVHH+LR+I
Sbjct  291   TLHLSILHLNVTTLDPLVLYSISAKVEEGCQLTSVDDIARAVHHMLRII  339



>ref|XP_006585890.1| PREDICTED: transcription factor bHLH71-like isoform X2 [Glycine 
max]
Length=300

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 204/328 (62%), Gaps = 39/328 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LE L +NE  N IIYDT SATP  SH  + E + L +    Q   D    D   +   
Sbjct  1     MTLETLQSNEFSNFIIYDTISATPFSSHG-SPEASFLESFVNYQEQHDHPTFDNCAMRT-  58

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                   R+R ++  E I    R Q ++AVQG  +++R+ R  +CKN EEAETQRITHI V
Sbjct  59    ------RKREASEPESI---GRRQNSVAVQGRKKRRRKPR--VCKNTEEAETQRITHITV  107

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRRKQMNEHLAVLRSLMPESYVQR   ASIVGGAIEFVKELEHLLQSLEA KL+L  Q
Sbjct  108   ERNRRKQMNEHLAVLRSLMPESYVQR---ASIVGGAIEFVKELEHLLQSLEARKLQLLHQ  164

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             +                      +       +    PF   F+YPQYT     S  PNK 
Sbjct  165   E-------------------VAQTNENTAISKLMQPPFAHCFSYPQYTW----SQTPNKY  201

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
             TSKT AA ADIEVTLIETHAN+RIL+      QL+K+VA FQT+C++VLHLNVTT D LV
Sbjct  202   TSKTKAAIADIEVTLIETHANLRILTRRSSHGQLTKLVAGFQTLCLTVLHLNVTTIDPLV  261

Query  1213  LYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              YS SAKVE G QL S D IA AVHH+L
Sbjct  262   FYSFSAKVEEGFQLGSVDGIATAVHHLL  289



>ref|XP_007210615.1| hypothetical protein PRUPE_ppa017746mg [Prunus persica]
 gb|EMJ11814.1| hypothetical protein PRUPE_ppa017746mg [Prunus persica]
Length=312

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 202/339 (60%), Gaps = 42/339 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             MALEAL++NE FN IIYDT SATP    + +  T+N        P           + + 
Sbjct  1     MALEALTSNEPFNFIIYDTISATPYSFQDSSGTTSNFI------PPDKNFCTSTSSMKSD  54

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpk-------ICKNKEEAETQ  651
                   R  +   A       + Q +L V     +++++  K       +CKNKEEAETQ
Sbjct  55    QDTQIKRALNLEAAAAGGGGRQKQSSLGVNNNNAQQQQQGRKKRRRKPRVCKNKEEAETQ  114

Query  652   RITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAE  831
             R+THIAVERNRRKQMNEHLA+LRSLMP+SY QRGDQASIVGGAIEFVKELEHLL SLEA+
Sbjct  115   RMTHIAVERNRRKQMNEHLAILRSLMPDSYAQRGDQASIVGGAIEFVKELEHLLHSLEAQ  174

Query  832   KLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTS-CS  1008
             KL+L      S +                         +    PF Q    PQYT S C 
Sbjct  175   KLQLLHNADVSTST-----------------------SKPAQTPFAQLLECPQYTWSHC-  210

Query  1009  SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLN  1188
                 PNK TSKT AA ADIEVTLIETHAN++I+S     RQLSK+V   Q++ +++LHL 
Sbjct  211   ----PNKFTSKTKAAIADIEVTLIETHANLKIMSRRISPRQLSKLVGGIQSLQLTILHLT  266

Query  1189  VTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VTT D  VLYSIS K+E GC LSS D+IA A+HH+LRVI
Sbjct  267   VTTMDPFVLYSISVKIEEGCLLSSVDDIATAIHHMLRVI  305



>ref|XP_008238226.1| PREDICTED: transcription factor bHLH71 [Prunus mume]
Length=314

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 204/341 (60%), Gaps = 42/341 (12%)
 Frame = +1

Query  307   ISMALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggld  486
             ++MALEAL++NE FN IIYDT SATP    + +  T+N        P           + 
Sbjct  1     MTMALEALTSNEPFNFIIYDTISATPYSFQDSSGTTSNFI------PPDKYFCTSTSSMK  54

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpk-------ICKNKEEAE  645
             +       R  +   A       + Q +L V     +++++  K       +CKNKEEAE
Sbjct  55    SDQDTQIKRALNLEAAAAGGGGKQKQSSLGVNNNNAQQQQQGRKKRRRKPRVCKNKEEAE  114

Query  646   TQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLE  825
             TQR+THIAVERNRRKQMNEHLA+LRSLMP+SYVQRGDQASIVGGAIE VKELEHLL S+E
Sbjct  115   TQRMTHIAVERNRRKQMNEHLAILRSLMPDSYVQRGDQASIVGGAIELVKELEHLLHSVE  174

Query  826   AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTS-  1002
             A+KL+L      S +                         +    PF Q    PQYT S 
Sbjct  175   AQKLQLLHNADVSTST-----------------------SKVVQTPFTQLLECPQYTWSH  211

Query  1003  CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLH  1182
             C     PNK TSKT AA ADIEVTLIETHAN++I+S     RQLSK+V   Q++ +++LH
Sbjct  212   C-----PNKFTSKTKAAIADIEVTLIETHANLKIMSRRISPRQLSKLVGGIQSLQLTILH  266

Query  1183  LNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L VTT D  VLYSIS K+E GC LSS D+IA A+HH+LRVI
Sbjct  267   LTVTTMDPYVLYSISVKIEEGCLLSSVDDIATAIHHMLRVI  307



>ref|XP_011028170.1| PREDICTED: transcription factor bHLH71 [Populus euphratica]
Length=303

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 217/334 (65%), Gaps = 41/334 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAA--VAPKQPgqdlcggdgggld  486
             MAL+ALS+NE  N I+YD+ SATP  SH  + ETT+L    + P+  G  +         
Sbjct  1     MALQALSSNEFLNFILYDSISATPCSSH-ASLETTSLLLENLIPQDHGISVNSSSLMTGQ  59

Query  487   ACS-SMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITH  663
              CS    A  RRH+               LAVQG  +++R+ R  +CKN+E+AETQR+TH
Sbjct  60    ICSMGREAVNRRHNL--------------LAVQGKKKRRRKPR--VCKNREDAETQRMTH  103

Query  664   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRL  843
             IAVERNRRK MNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEA+KL+L
Sbjct  104   IAVERNRRKLMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAKKLKL  163

Query  844   QRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIP  1023
             ++                       ++ +          PF QFF  PQYT     S IP
Sbjct  164   KQ----------------GLTGPNYSTENATTTSEFPPPPFSQFFVCPQYTW----SQIP  203

Query  1024  NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFD  1203
             +  TSKT A+ ADIE TLIETHAN+RILS  R   QLSK+V+ F  + ++VLH+NVTT D
Sbjct  204   SNFTSKTAASIADIEATLIETHANLRILSR-RSPTQLSKLVSGFHMLYLTVLHINVTTMD  262

Query  1204  LLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              LVLYSISAK+E GCQL+S D++A AVHH+LR+I
Sbjct  263   PLVLYSISAKLEEGCQLTSVDDLAGAVHHMLRII  296



>ref|XP_011070274.1| PREDICTED: transcription factor bHLH71 [Sesamum indicum]
Length=287

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 215/331 (65%), Gaps = 54/331 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             MALEALS+ ELFN I++D+ + TP  + N  S   +   +AP                  
Sbjct  1     MALEALSSTELFNFIMFDSAAPTP-FTCNNDSSEASPQEIAP------------------  41

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                   R  H    +                  RKKRRRRPK+CKNKEEAETQR+THIAV
Sbjct  42    ------RLSHPPPPQ--------------DTTTRKKRRRRPKVCKNKEEAETQRMTHIAV  81

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRRKQMNEHLAVLRSLMP+SYVQRGDQASIVGGAIEFVKELEH+LQSLEA+K  L  Q
Sbjct  82    ERNRRKQMNEHLAVLRSLMPDSYVQRGDQASIVGGAIEFVKELEHILQSLEAKKFTLLEQ  141

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             Q  +    + +                       ++PF QFFAYPQ+  SCS + + NK 
Sbjct  142   QVNNKDQYEKSDDQNYKQVMGS------------SSPFAQFFAYPQF--SCSHNQLGNKY  187

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
             TS++ AA ADIEVTLIETHAN+R + S R+ RQLSK+VA+F ++ +S+LHLNVTT D LV
Sbjct  188   TSQSKAAIADIEVTLIETHANIR-ILSRRRLRQLSKIVASFHSVFLSILHLNVTTLDSLV  246

Query  1213  LYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             LYSISAKVE GCQL+SAD+IA AVHH+LR+I
Sbjct  247   LYSISAKVEEGCQLNSADDIAGAVHHMLRII  277



>ref|XP_003628791.1| Transcription factor bHLH96 [Medicago truncatula]
 gb|AET03267.1| transcription factor [Medicago truncatula]
Length=312

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 209/349 (60%), Gaps = 50/349 (14%)
 Frame = +1

Query  313   MALEALST--NELFN--LIIYDTFSATPALSH-----NEASETTNLAAVAPKQPgqdlcg  465
             MALE LS+  NE  N   IIYDT SAT   S+     NE+S   N      +Q   +   
Sbjct  1     MALETLSSSCNEFSNSNFIIYDTISATSFSSNLIDTTNESSFLENTMNYDHEQAHHEADA  60

Query  466   gdgggldACSSMPAWRRRHSAGAE--MITPHSRAQQNLAVQgggrkkrrrrpkICKNKEE  639
                   + CS M + R+R S   E  M  P    ++    +             CKNKEE
Sbjct  61    AIFDQSN-CSMMNS-RKRQSMEQEETMNNPQVVQRKKRRRKPRV----------CKNKEE  108

Query  640   AETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQS  819
             AETQRITHI VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQS
Sbjct  109   AETQRITHITVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQS  168

Query  820   LEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTT  999
             LEA KL+L +Q+      D   +                        PF QFF YPQYT 
Sbjct  169   LEARKLQLVQQEVTQNNEDMAISKP----------------------PFAQFFVYPQYTW  206

Query  1000  SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVL  1179
                 S  PNK TSKT AA ADIEVTLIETHAN+RIL+ TR   QL+K+VA FQ + +S+L
Sbjct  207   ----SQTPNKYTSKTKAAIADIEVTLIETHANLRILTRTRPG-QLTKLVAGFQRLFLSIL  261

Query  1180  HLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVIeeeeeVT  1326
             HLNVTT   LV YSISAKVE G QL S D IA AVHH+L  IEEE  +T
Sbjct  262   HLNVTTIQPLVFYSISAKVEEGFQLGSVDGIATAVHHLLGRIEEEASLT  310



>ref|XP_004136191.1| PREDICTED: transcription factor bHLH94-like [Cucumis sativus]
 gb|KGN60373.1| hypothetical protein Csa_3G901180 [Cucumis sativus]
Length=321

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 215/342 (63%), Gaps = 39/342 (11%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALS------HNEASETTNLAAVAPKQPgqdlcggdg  474
             M+L+ALS+N+LFN IIYDT SATP  S      H+++SE T L+                
Sbjct  1     MSLDALSSNDLFNFIIYDTISATPNTSNNNVVPHHDSSENTFLS----------------  44

Query  475   ggldACSSMPAWRRRHSAGAEM----ITPHSRAQQNLAVQggg-rkkrrrrpkICKNKEE  639
                D CS  P  R+R ++  E+    + P S             +KKR+R+ K+CKNKEE
Sbjct  45    --DDKCSK-PNSRKRCTSEVEISNRVVVPLSTTTTTTTTTTQHGKKKRKRKAKVCKNKEE  101

Query  640   AETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQS  819
             AETQR+THIAVERNRRKQMNEHL+VLRSLMPESYVQRGDQASIVGGA+EFVKELEHLL +
Sbjct  102   AETQRMTHIAVERNRRKQMNEHLSVLRSLMPESYVQRGDQASIVGGAVEFVKELEHLLST  161

Query  820   LEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTT  999
             LEA+KL++    QQ             +      +     K  SF +          Y++
Sbjct  162   LEAKKLQI---LQQEVDQHQEQEMNEDSRIRKNDNNDNNNKLFSFASLLMNNSDQNNYSS  218

Query  1000  SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVL  1179
               S+     K TSK+ A++ADIEVTLIETHAN+RIL STR  RQL K++A  Q + +++L
Sbjct  219   QYST-----KYTSKSKASSADIEVTLIETHANLRIL-STRSHRQLLKLIAGLQALRLTIL  272

Query  1180  HLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             HLN+T F  LVLYSIS KVE GCQL S D+IA A HH++R+I
Sbjct  273   HLNLTDFHPLVLYSISLKVEEGCQLRSVDDIAAAAHHMVRII  314



>ref|XP_008465984.1| PREDICTED: transcription factor bHLH71 [Cucumis melo]
Length=316

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 218/339 (64%), Gaps = 38/339 (11%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPA--LSH-NEASETTNLAAVAPKQPgqdlcggdgggl  483
             M+L+ALS+N+LFN IIYDT SATP   + H +++SE T L+                   
Sbjct  1     MSLDALSSNDLFNFIIYDTISATPNNFVPHGHDSSENTFLS------------------D  42

Query  484   dACSSMPAWRRRHSAGAEM----ITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQ  651
             D CS  P  R+R  +  E+    + P S        Q G +K++R+   +CKNKEEAETQ
Sbjct  43    DKCSK-PNSRKRCPSEVEISNRVVVPLSTTTTTTTTQHGKKKRKRKAK-VCKNKEEAETQ  100

Query  652   RITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAE  831
             R+THIAVERNRRKQMNEHL+VLRSLMPESYVQRGDQASIVGGA+EFVKELEHLL +LEA+
Sbjct  101   RMTHIAVERNRRKQMNEHLSVLRSLMPESYVQRGDQASIVGGAVEFVKELEHLLSTLEAK  160

Query  832   KLR-LQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCS  1008
             KL+ LQ++  Q    +    +  + +D +  +           N   Q     QY+T   
Sbjct  161   KLQILQQEVDQHQEQEMNEDSRIRKNDNSDNNNKLFSFASLLMNNSDQNNYSSQYST---  217

Query  1009  SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLN  1188
                   K TSK+ A++ADIEVTLIETHAN+RIL STR  RQL K++A  Q + +++LHLN
Sbjct  218   ------KYTSKSKASSADIEVTLIETHANLRIL-STRSHRQLLKLIAGLQALRLTILHLN  270

Query  1189  VTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +T F  LVLYSIS KVE GCQL S D+IA A HH++R+I
Sbjct  271   LTDFHPLVLYSISLKVEEGCQLRSVDDIAAAAHHMVRII  309



>emb|CBI83256.1| basic helix-loop-helix transcription factor [Humulus lupulus]
Length=318

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 172/228 (75%), Gaps = 10/228 (4%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEEAETQR+THIAVERNRRKQMNEHLAVLRSLMP+SYVQRGDQASIVGGAIEFVKEL
Sbjct  91    CKNKEEAETQRMTHIAVERNRRKQMNEHLAVLRSLMPDSYVQRGDQASIVGGAIEFVKEL  150

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EHLLQSLEA+KL++ +    +    D      ++ +  V S    V+      PF QFF 
Sbjct  151   EHLLQSLEAQKLQVLQGMNNNRELVDDDDHNKESCNIDVGSSKFVVQ-----PPFAQFFL  205

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             YPQYT     S I NK TSKT AA ADIEVTLIETHA++RI +  R  RQLS+++A FQ+
Sbjct  206   YPQYTW----SQISNKYTSKTKAAIADIEVTLIETHASLRIFTR-RSPRQLSRLIAGFQS  260

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + ++VLHLNVTT + LVLYS+S KVE  C LSS D+IA AVHH+LR+I
Sbjct  261   LHLTVLHLNVTTLNPLVLYSVSVKVEEACLLSSVDDIAAAVHHMLRII  308



>ref|XP_006385665.1| hypothetical protein POPTR_0003s09200g [Populus trichocarpa]
 gb|ERP63462.1| hypothetical protein POPTR_0003s09200g [Populus trichocarpa]
Length=290

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 202/311 (65%), Gaps = 41/311 (13%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAA--VAPKQPgqdlcggdgggld  486
             MAL+ALS+NE  N I+YDT SATP  SH  + ETT+L    + P+  G  +         
Sbjct  1     MALQALSSNEFLNFILYDTISATPCSSH-ASLETTSLLLENLIPQDHGVSVNSSSLMTGQ  59

Query  487   ACS-SMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITH  663
              CS    A  RRH+               LAVQG  +++R+ R  +CKN+E+AETQR+TH
Sbjct  60    RCSMGREAVNRRHNL--------------LAVQGKKKRRRKPR--VCKNREDAETQRMTH  103

Query  664   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRL  843
             IAVERNRRK MNEHLAVLRSLMPESYV+RGDQASIVGGAIEFVKE+EH LQSLEA+KL+L
Sbjct  104   IAVERNRRKLMNEHLAVLRSLMPESYVRRGDQASIVGGAIEFVKEMEHFLQSLEAKKLKL  163

Query  844   QRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIP  1023
             +++        + AT  ++                    PF QFF  PQYT     S IP
Sbjct  164   KQELTGPNYSAENATTTSEFPQP----------------PFSQFFVSPQYTW----SQIP  203

Query  1024  NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFD  1203
             +K TSKT A+ ADIE TLIETHAN+RILS  R  RQLSK+V+ F T+ ++VLH+NVTT D
Sbjct  204   SKFTSKTAASIADIEATLIETHANLRILSR-RSPRQLSKLVSGFHTLYLTVLHINVTTMD  262

Query  1204  LLVLYSISAKV  1236
              LVLYSISAKV
Sbjct  263   PLVLYSISAKV  273



>ref|XP_004300408.1| PREDICTED: transcription factor bHLH71-like [Fragaria vesca subsp. 
vesca]
Length=321

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 210/347 (61%), Gaps = 49/347 (14%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPA-------------LSHNEASETTNLAAVAPKQPgq  453
             MALEA++++E FN IIYDT SATP              +  N A+ TT     A  Q   
Sbjct  1     MALEAIASSEPFNFIIYDTISATPYSCQDSPALAETSFIVENCAATTTPTMKAAGAQ---  57

Query  454   dlcggdgggldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNK  633
             D        L++CS++    R    G   +T           Q  GRKKR+R+P++CKNK
Sbjct  58    DQNQSGIVALESCSTLGTRSR----GLTSVT-----------QQQGRKKRKRKPRVCKNK  102

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EEAETQR+THIAVERNRRKQMNEHLA+LRSLMPESY QRGDQASIVGGAIEFVKELEHLL
Sbjct  103   EEAETQRMTHIAVERNRRKQMNEHLAILRSLMPESYAQRGDQASIVGGAIEFVKELEHLL  162

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP--  987
             QSLEA+KL+L                 +   +   ++ +     +    P  QF      
Sbjct  163   QSLEAQKLQL---------------LPSNVVNEDSSTTANSKVVQPIVTPLLQFLECDIS  207

Query  988   -QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
               + +S S    P+K TSKT A  ADIEVTLIETHAN+RI++     RQLSK+VA  QT+
Sbjct  208   QGHQSSWSQQQTPSKFTSKTKADIADIEVTLIETHANLRIVTQRISPRQLSKLVAGVQTL  267

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHL V T    VLYSIS K+E GC L+S D+IA A +H+LRVI
Sbjct  268   QLTILHLTVNTIYPFVLYSISVKIEEGCLLTSVDDIAAAFYHMLRVI  314



>ref|XP_010695562.1| PREDICTED: transcription factor bHLH71-like [Beta vulgaris subsp. 
vulgaris]
Length=305

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/336 (46%), Positives = 198/336 (59%), Gaps = 49/336 (15%)
 Frame = +1

Query  313   MALEAL-STNELFNLIIYDTFSATPALSHNEASETTNLAAVAP----KQPgqdlcggdgg  477
             MALEA+ + N++FN ++Y+T         N +    NL  +      ++P         G
Sbjct  1     MALEAIPNYNDIFNFMVYETL--------NSSQYGCNLGLMEDVPVHEKPQNLGGMSGLG  52

Query  478   gldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRI  657
              +  CS+     RR   G +      R  +                 +CKNKEEAETQR+
Sbjct  53    SMGQCSTRGIQNRRVDLGVQGRKKRRRRPK-----------------VCKNKEEAETQRM  95

Query  658   THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKL  837
             THI VERNRRKQMNEHLAVLRSLMPESY QRGDQASIVGGAIEFVKELEHL+ S E +KL
Sbjct  96    THITVERNRRKQMNEHLAVLRSLMPESYAQRGDQASIVGGAIEFVKELEHLVHSFEVQKL  155

Query  838   RLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSM  1017
                +Q              + T +     +    +  S   PF +FF+  ++T     S 
Sbjct  156   NFLKQ--------------SATMNSEPGGIPTTKENNSMLTPFAEFFSDSEHTF----SQ  197

Query  1018  IPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTT  1197
             +  K T  + A+ ADIEVTLIETHAN+RILS  +  RQ+SK+V+ FQT+ +++LHLNVTT
Sbjct  198   VGKKYTLMSKASIADIEVTLIETHANLRILSK-KNPRQISKLVSGFQTLRLTILHLNVTT  256

Query  1198  FDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              + LVLYSI+ KVE GCQ +S D IAEAVHH+LR+I
Sbjct  257   LNPLVLYSINVKVEEGCQFTSVDSIAEAVHHMLRII  292



>ref|XP_010240870.1| PREDICTED: transcription factor bHLH71-like [Nelumbo nucifera]
Length=308

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 204/337 (61%), Gaps = 42/337 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDT----FSATPALSHNEASETTNLAAVAPKQPgqdlcggdggg  480
             MALEALS+N+L N   YDT    F     +  +      +     P +            
Sbjct  1     MALEALSSNDLSNFN-YDTITSGFLPKNKIVSDGVGSNLHFDGFRPLELHPTFE------  53

Query  481   ldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRIT  660
                  S P  RR   A        +  + N A    GR+KRRR+P++CKNKEEAETQR+T
Sbjct  54    ----GSSPMMRRNPFASVA-----TDGRSNSATTTQGRRKRRRKPRVCKNKEEAETQRMT  104

Query  661   HIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLR  840
             HIAVERNRRKQMNEHLAVLRSLMPESY+QRGDQASIVGGAIEFVKELE LLQ LE +K +
Sbjct  105   HIAVERNRRKQMNEHLAVLRSLMPESYIQRGDQASIVGGAIEFVKELEQLLQFLEVQKRQ  164

Query  841   LQRQQQQSaagddgataatktddgavasvsggvKGRSFTN-PFWQFFAYPQYTTSCSSSM  1017
             L +Q++     +  ++                    +F + PF QFF YPQY+  C +  
Sbjct  165   LLQQREGPLDNNRSSSNNYSN---------------NFIDPPFVQFFTYPQYSW-CQA--  206

Query  1018  IPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNV-T  1194
              P +       A ADIEVTL+ETHAN+R+L+  R  RQL KMV  FQT+ +S+LHLNV T
Sbjct  207   -PREYPQDNRVAIADIEVTLVETHANLRVLTRWRP-RQLFKMVVGFQTLHLSILHLNVTT  264

Query  1195  TFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             T D LVLYS SAKVE GC L+S D+IA AVHH+LR+I
Sbjct  265   TLDSLVLYSFSAKVEEGCHLTSVDDIAGAVHHMLRII  301



>ref|XP_008796282.1| PREDICTED: transcription factor bHLH71-like [Phoenix dactylifera]
Length=293

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 164/228 (72%), Gaps = 15/228 (7%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEEAE+QR+THIAVERNRR+QMNEHL+VLRSLMPESY+QRGDQASIVGGAI+FVKEL
Sbjct  72    CKNKEEAESQRMTHIAVERNRRRQMNEHLSVLRSLMPESYIQRGDQASIVGGAIDFVKEL  131

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEA+K  LQ+Q+ ++         ++ ++                + PF QFFA
Sbjct  132   EQLLQSLEAQKRTLQQQKGKAEKTPRIEPGSSSSNTDDTD-----------SPPFAQFFA  180

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             YPQY    +    P     +  +A AD+EVTLIETHAN+RIL S R+  QL KMVA  Q+
Sbjct  181   YPQYVWCHAPRDYP---PPENRSAVADVEVTLIETHANLRIL-SPRRPGQLLKMVAGLQS  236

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +++LHLNVTT D +VLYS+S KV+ GC L++ D+IA AVHH+L +I
Sbjct  237   LRLTILHLNVTTLDSMVLYSLSTKVDEGCHLTTVDDIAAAVHHMLSLI  284



>ref|XP_009381950.1| PREDICTED: transcription factor bHLH96-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=323

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 205/332 (62%), Gaps = 19/332 (6%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN-LAAVAPKQPgqdlcggdgggldA  489
             M LEAL++ EL + +IYDT +A+P L H E S +++ L   A  +      G        
Sbjct  1     MTLEALASAELSSFLIYDTITASPLLHHAEPSSSSSFLFRSAGGEDAVGSLGIGPSRSGL  60

Query  490   CSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIA  669
                +PA +       E   P + A        G  K++RRR + CKN EEAE QR+THIA
Sbjct  61    VGGIPAAK-------EEPRPEAAA-------VGQGKRKRRRTRTCKNMEEAENQRMTHIA  106

Query  670   VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQR  849
             VERNRR+QMNEHLAVLRSLMPESY+QRGDQAS+VGGAI+FVKELE LLQSLEA+K  LQ 
Sbjct  107   VERNRRRQMNEHLAVLRSLMPESYIQRGDQASVVGGAIDFVKELEQLLQSLEAQKRTLQ-  165

Query  850   QQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNK  1029
               QQ+   +  +         + +  SG       + PF QFF++PQY+   ++    + 
Sbjct  166   --QQAGKQERSSYIGEAGSSSSSSGSSGSNSDVVDSPPFAQFFSFPQYSWCHTTQGQDHP  223

Query  1030  CTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLL  1209
              +     A ADIEVTLIETHANVRILS  R   QL KMVA    + +++LHLNVT  D +
Sbjct  224   PSENQLPALADIEVTLIETHANVRILSPKRPG-QLFKMVAGLHNLSLTILHLNVTALDSM  282

Query  1210  VLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VLYS+S KVE GC L++ D+IA A+HH+L +I
Sbjct  283   VLYSLSVKVEEGCSLTAVDDIAAAIHHLLSLI  314



>ref|XP_011018548.1| PREDICTED: transcription factor bHLH71-like isoform X1 [Populus 
euphratica]
Length=323

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 195/310 (63%), Gaps = 41/310 (13%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN--LAAVAPKQPgqdlcggdgggld  486
             MALEALS+ E  N +I DT  ATP   H ++ ET    L  + P+  G  +         
Sbjct  1     MALEALSSTEFPNFVIDDTIPATPYNCH-DSLETAGFLLEDLKPQDHGVSVNTSSLMTQQ  59

Query  487   ACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
              CS               +   SR Q  LAVQG  +++R  R  +CKN+EEAETQR+THI
Sbjct  60    RCS---------------VEATSRRQNLLAVQGKKKRRRTPR--VCKNREEAETQRMTHI  102

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
             AVERNRRK MN +LAVLRS MPES+VQRGDQASIVGGAI FVKELEHLLQSLEA+KL+L 
Sbjct  103   AVERNRRKLMNGYLAVLRSHMPESFVQRGDQASIVGGAIVFVKELEHLLQSLEAKKLKLH  162

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
             +         + ATA ++                    PF QFF YPQYT     S IPN
Sbjct  163   QGLTGPDYDIEDATATSEVPPP----------------PFAQFFVYPQYTW----SQIPN  202

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT A+ ADIEV LIETHAN+RILS  R+ RQLSK+VA FQT+ ++VLH+NVTT D 
Sbjct  203   KFTSKTKASIADIEVNLIETHANLRILSR-RRPRQLSKLVAGFQTLYLTVLHINVTTMDP  261

Query  1207  LVLYSISAKV  1236
             LVLYSISAKV
Sbjct  262   LVLYSISAKV  271



>gb|EPS66017.1| hypothetical protein M569_08759, partial [Genlisea aurea]
Length=232

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 166/229 (72%), Gaps = 25/229 (11%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKNKEEAETQR+THIAVERNRRKQMNEHLAVLRSLMPE+YVQRGDQASIVGGAIEFVKE
Sbjct  25    VCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLRSLMPETYVQRGDQASIVGGAIEFVKE  84

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH+LQSLEA+K  L    +   A  D                       S   PF QFF
Sbjct  85    LEHILQSLEAKKFSLMENNRDEIAEQDPTIPY------------------SSGTPFSQFF  126

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
              YPQ+      S + +K TS++ AA ADIEVTLIETHAN+R + S R+ RQLSK+V +F 
Sbjct  127   LYPQF------SQLGHKYTSQSKAAVADIEVTLIETHANIR-ILSRRRLRQLSKLVVSFH  179

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++ +S+LHLNVTT   L LYSISAKVE GC+L+SAD++A AVHH+LR+I
Sbjct  180   SLYLSILHLNVTTLHSLALYSISAKVEEGCRLNSADDLAGAVHHMLRII  228



>ref|XP_010919940.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH71-like 
[Elaeis guineensis]
Length=295

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 161/235 (69%), Gaps = 28/235 (12%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEEAE+QR+THIAVERNRR+QMNEHL+VLRSLMPESY+QRGDQASIVGGAI+FVKEL
Sbjct  73    CKNKEEAESQRMTHIAVERNRRRQMNEHLSVLRSLMPESYIQRGDQASIVGGAIDFVKEL  132

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTN-------  960
             E LLQSLEA+K  LQ+Q+ ++                          G S +N       
Sbjct  133   EQLLQSLEAQKRTLQQQKGKAEKKTPRIE-----------------PGSSCSNADDADSP  175

Query  961   PFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSK  1140
             PF QFFAYPQY    +    P     +  +  ADIEVTLIETHAN+RILS  R+  QL K
Sbjct  176   PFAQFFAYPQYIWCHAPRDYP---PPENRSPVADIEVTLIETHANLRILSP-RRPGQLLK  231

Query  1141  MVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             MVA  Q++ +++LHLNVTT D +VLYS+S KVE GC L++ D+IA A+HH+L + 
Sbjct  232   MVAGLQSLRLTILHLNVTTLDSMVLYSLSTKVEEGCNLTTVDDIAAAIHHMLSMF  286



>ref|XP_002527666.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF34737.1| DNA binding protein, putative [Ricinus communis]
Length=275

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 200/333 (60%), Gaps = 67/333 (20%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LE +S++E  N I+YDT SATP  S +++ +TT+L      +P             +C
Sbjct  1     MTLETVSSSEFLNFIVYDTISATPYSSSHDSLQTTSLLLETTLKPQNHGTAMR-----SC  55

Query  493   SSMPAWRRRHSAGAEMITPHSRAQ--QNLAVQgggrkkrrrrpkICKNKEEAETQRITHI  666
             S M   RR       +  P + A+  QNLAVQG  +++R+ R  +C+NKEEAETQR+THI
Sbjct  56    SLMTRQRR-------LKEPEAAAEWRQNLAVQGRKKRRRKPR--VCQNKEEAETQRMTHI  106

Query  667   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQ  846
             AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLE +K++L 
Sbjct  107   AVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEVQKMQLL  166

Query  847   RQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPN  1026
               Q++       A                    +    PF QFF YPQYT     S +PN
Sbjct  167   HGQREPNEDTCTA-------------------SKFLPPPFAQFFIYPQYTW----SQMPN  203

Query  1027  KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDL  1206
             K TSKT AA ADIEVTLIETHAN+RILS  R  R+L K++                    
Sbjct  204   KYTSKTIAAIADIEVTLIETHANLRILSR-RSPRKLPKVL--------------------  242

Query  1207  LVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                     ++E  CQL+SAD+IA AVHH+LR+I
Sbjct  243   -------MQLEEECQLTSADDIAGAVHHMLRII  268



>ref|XP_009371214.1| PREDICTED: transcription factor bHLH71-like [Pyrus x bretschneideri]
Length=321

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 206/324 (64%), Gaps = 24/324 (7%)
 Frame = +1

Query  346   FNLIIYDTFSATPALSH--NEASETTNLAAVAPKQPgqdlcggdgggldACSSMPAWRRR  519
             FN I+YDT SATP  S   + +SET N   + PK+        +     + +SM      
Sbjct  9     FNFIVYDTISATPYTSQAQDYSSETAN-NFIPPKK---FYYCNNAAAKSSNTSMMLEAAG  64

Query  520   HSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAVERNRRKQMN  699
                G +     S  Q     +G GRKKRRR+ ++CKNKEEAETQR+THIAVERNRRKQMN
Sbjct  65    GGGGKKTKQMSSHQQPQGQGEGQGRKKRRRKARVCKNKEEAETQRMTHIAVERNRRKQMN  124

Query  700   EHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQQQQSaagdd  879
             +HLA+LRSLMP+SY QRGDQASIVGGAIEFVKELEHLLQSLEA+KL+L + QQQ    D 
Sbjct  125   DHLAILRSLMPDSYAQRGDQASIVGGAIEFVKELEHLLQSLEAQKLQLFQHQQQHNPEDI  184

Query  880   gataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATA  1059
               T +                    ++PF Q   YPQ  +   S    NK TSKT  ATA
Sbjct  185   VTTPSKIVP----------------SSPFTQLLEYPQKHSWSHSHCPNNKYTSKTKGATA  228

Query  1060  DIEVTLIETHANVRILS--STRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAK  1233
             DIEVTLIETHAN++ILS  +     QL K+VA   ++ +++LHL V+T D  VLYSIS K
Sbjct  229   DIEVTLIETHANLKILSRRNIAGRSQLHKLVAGIHSLHLTILHLTVSTMDPFVLYSISLK  288

Query  1234  VEGGCQLSSADEIAEAVHHILRVI  1305
             +E GC LSSAD+IA ++HH+LRVI
Sbjct  289   IEEGCLLSSADDIAASLHHMLRVI  312



>ref|XP_010273153.1| PREDICTED: transcription factor bHLH94-like [Nelumbo nucifera]
Length=315

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 202/336 (60%), Gaps = 34/336 (10%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN-----LAAVAPKQPgqdlcggdgg  477
             MALEALS+N+L N I YD   +    SH    +T++     ++    K            
Sbjct  1     MALEALSSNDLSNFITYDALCSAQHYSHAPPLDTSSVDDKIISDGVNKSLHFGRFRPPEL  60

Query  478   gldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRI  657
                +  S P  RR   A   + T   R   N A    GRKKRRRRPK+CKNKEEAETQR+
Sbjct  61    HPTSEESSPMIRRNLLA---LETADGRP--NSATTTQGRKKRRRRPKVCKNKEEAETQRM  115

Query  658   THIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKL  837
             THIAVERNRRKQMNEHLAVLRSLMPESY+QRGDQASIVGGAIEFVKELE LLQ LE +K 
Sbjct  116   THIAVERNRRKQMNEHLAVLRSLMPESYIQRGDQASIVGGAIEFVKELEQLLQFLEVQKR  175

Query  838   RLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSM  1017
              LQ++    ++  + +                                YPQY+  C +  
Sbjct  176   LLQQKGPLKSSSSNNSINFFPPPFSQFF-------------------TYPQYSW-CQA--  213

Query  1018  IPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTT  1197
              P +   +  ++ ADIEVTLIETHAN+R+L+  R+ RQL KMV  FQT+ +++LHLNV+T
Sbjct  214   -PREYPQENRSSVADIEVTLIETHANLRVLTQ-RRPRQLLKMVLGFQTLRLTILHLNVST  271

Query  1198  FDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              D  VLYS S KVE GC L+S D+IA AVHH+LR+I
Sbjct  272   LDSFVLYSFSVKVEEGCHLTSVDDIASAVHHMLRMI  307



>ref|XP_002285733.2| PREDICTED: transcription factor bHLH96 [Vitis vinifera]
 emb|CBI19212.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 157/233 (67%), Gaps = 42/233 (18%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASI+GGAI FVKEL
Sbjct  108   CKNKEEVENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYTQRGDQASIIGGAINFVKEL  167

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEAEK      +QQ+                            S ++PF  FF 
Sbjct  168   EQLLQSLEAEK----SSKQQT--------------------------NNSVSSPFSNFFT  197

Query  982   YPQYTTSCSSSMIPNKCTSKTTA-----ATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             +PQY+T  +       CT  +       A ADIEVT++E+HAN++ILS  RKT+QL K+V
Sbjct  198   FPQYSTRAT------HCTKDSMMGDNRWAVADIEVTMVESHANIKILSK-RKTKQLLKIV  250

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             A FQ++ +++LHLNVTTFD +VLYS+S KVE  CQL++ DEIA AV+ +LR I
Sbjct  251   AGFQSLSLTILHLNVTTFDQMVLYSLSVKVEEECQLTTVDEIAAAVNQMLRRI  303



>gb|AIA82920.1| bHLH2 [Gentiana rigescens]
Length=286

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 191/314 (61%), Gaps = 38/314 (12%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSAT-------PALSHNEASETTNLAAVAPKQPgqdlcggd  471
             MALE LS+ EL N I+Y+T S++       P    +  +++++ + VA            
Sbjct  1     MALETLSSTELLNFIVYNTISSSNCNESSEPNFLFDTLAKSSDGSGVAG-----------  49

Query  472   gggldACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQ  651
                           +R  +G     P S  Q  L     GRKKRRRR ++CKNKEEAE Q
Sbjct  50    -----------VLEKRGRSGE----PES-VQMQLNTAVLGRKKRRRRERVCKNKEEAENQ  93

Query  652   RITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAE  831
             R+THIAVERNRRK MNEHLAVLRSLMPESY QRGDQAS+VGGAIEFVKELE  LQ+LEA+
Sbjct  94    RMTHIAVERNRRKMMNEHLAVLRSLMPESYAQRGDQASVVGGAIEFVKELEQHLQTLEAQ  153

Query  832   KLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSS  1011
             K  + +Q      G+ G    + T      + S      + T PF QFF YPQY  S   
Sbjct  154   KFLILQQGSGGGGGESGGATTSTTRFLPSTATSTATTISAATTPFSQFFTYPQYICSL--  211

Query  1012  SMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNV  1191
              + PN+C S    A ADIEVTLIETHANVRILS  R  +QLSK+V AF +M +++LHLNV
Sbjct  212   -LPPNQCKSNNKDAIADIEVTLIETHANVRILSRKR-VKQLSKLVTAFYSMYLTILHLNV  269

Query  1192  TTFDLLVLYSISAK  1233
             +T + +VLYSISAK
Sbjct  270   STLEPMVLYSISAK  283



>ref|XP_010266731.1| PREDICTED: transcription factor bHLH94-like [Nelumbo nucifera]
Length=329

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 160/238 (67%), Gaps = 41/238 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  116   CKNKEEVENQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIGGAINFVKEL  175

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E  LQSLEA+K    R +QQS A                           F++PF  FF+
Sbjct  176   EQHLQSLEAQK----RIKQQSDA--------------------------GFSSPFADFFS  205

Query  982   YPQYTTSCSSSMIP----------NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQ  1131
             +PQY++S +    P          N+ T++  +A ADIEVT++E+HAN+++LS  R+ +Q
Sbjct  206   FPQYSSSSTHCNNPAGSASSAAGSNESTAENRSAIADIEVTMVESHANLKVLSK-RRPKQ  264

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L KMVA F T+ +++LHLNVT+ D +VLYS S KVE  CQL+S DEIA AV+ +L  I
Sbjct  265   LLKMVAGFHTLRLTILHLNVTSVDQMVLYSFSVKVEDECQLTSVDEIATAVYQMLGRI  322



>ref|XP_008786321.1| PREDICTED: transcription factor bHLH94-like [Phoenix dactylifera]
Length=286

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 184/307 (60%), Gaps = 33/307 (11%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEAL+++EL   ++YDT SATP L H +AS  + L             G     L   
Sbjct  1     MTLEALASSELPIFLVYDTISATP-LHHPDASSCSRLLF------DNAGGGDGLSSLGVR  53

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
              SMPA       G+    P +   Q         +        CKNKEEAE+QR+THIAV
Sbjct  54    HSMPAML----GGSTDSRPSTMEGQGRRKWRRRPRS-------CKNKEEAESQRMTHIAV  102

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMNEHLAVLRSLMPESYVQRGDQAS+VGGAI+FVKELE LLQSLE +K  LQ+Q
Sbjct  103   ERNRRRQMNEHLAVLRSLMPESYVQRGDQASVVGGAIDFVKELEQLLQSLEVQKRTLQQQ  162

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             + ++          T ++              + + PF +FFAYPQY    +    P   
Sbjct  163   RSKAEKTPSIEPGCTSSNT-----------DETDSPPFARFFAYPQYIWCHAPGDSP---  208

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
               +  +A ADIEVTLIETHAN+RILS  R+ RQL KMVA  Q++ +++LHLNVTT D +V
Sbjct  209   PPENLSAVADIEVTLIETHANLRILSP-RRPRQLLKMVAGLQSLRLTILHLNVTTLDSMV  267

Query  1213  LYSISAK  1233
             LYS+SAK
Sbjct  268   LYSLSAK  274



>ref|XP_010934113.1| PREDICTED: transcription factor bHLH94-like [Elaeis guineensis]
Length=282

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 192/308 (62%), Gaps = 32/308 (10%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M  EAL++  L   ++YDT SATP L H +AS  ++L             G     L   
Sbjct  1     MTREALASKALPTFLVYDTISATP-LHHPDASSCSSLLF------DNGGGGDGLSSLGVG  53

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
              SMPA       G   + P SR        G GR+KRRRRP+ CKNKEEAE+QR+THIAV
Sbjct  54    HSMPAM-----LGGLAVAPDSRPS---TAAGQGRRKRRRRPRSCKNKEEAESQRMTHIAV  105

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMNEHLAVLRSLMPESYVQ+GDQAS+VGGAI+FVKELE LLQSLE +K  L++ 
Sbjct  106   ERNRRRQMNEHLAVLRSLMPESYVQKGDQASVVGGAIDFVKELEQLLQSLEVQKRTLRQH  165

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
             + ++       T +T +               + + PF QFFAYPQY    +    P  C
Sbjct  166   KSKAEKTPGIETRSTGSST-----------DETDSPPFAQFFAYPQYIWRHA----PRDC  210

Query  1033  -TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLL  1209
                +  +A ADIEVTL ETHAN+RILS TR  RQL KMVA  Q++ +++LHLNVTT D +
Sbjct  211   PPPENRSAVADIEVTLTETHANLRILSPTRP-RQLLKMVAGLQSLRLTILHLNVTTMDSM  269

Query  1210  VLYSISAK  1233
             VLYS+SAK
Sbjct  270   VLYSLSAK  277



>ref|XP_009384704.1| PREDICTED: transcription factor bHLH96-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 154/227 (68%), Gaps = 8/227 (4%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKE+AE QR+THIAVERNRR+QMNEHLAVLRSLMP+SY+QRGDQASIVGGAI+FVKELE
Sbjct  76    KNKEDAENQRMTHIAVERNRRRQMNEHLAVLRSLMPDSYIQRGDQASIVGGAIDFVKELE  135

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA+K  LQ++Q                   + +           + PF QFF +
Sbjct  136   QLLQSLEAQKRTLQQRQAGKPESSPATADGGSRSSSSHSHGVD-------SPPFAQFFTF  188

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY    +++    +   +   A ADIEVTLIETHANVRILS  R   QL K+V   Q +
Sbjct  189   PQYGWRHAAAHDYPQPEDQLLPALADIEVTLIETHANVRILSPKRP-HQLVKIVCGLQDL  247

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +S+LHL++TT D +VLYS+S KVE GC L++ D+IA A+H +L +I
Sbjct  248   KLSILHLSLTTLDAMVLYSLSVKVEEGCNLATVDDIAAAIHRMLCLI  294



>ref|XP_010272971.1| PREDICTED: transcription factor bHLH96-like [Nelumbo nucifera]
Length=326

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 160/239 (67%), Gaps = 43/239 (18%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  113   CKNKEEVENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKEL  172

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEA+K    R +QQS                             F++PF  FF 
Sbjct  173   EQLLQSLEAQK----RMKQQSDV--------------------------GFSSPFADFFT  202

Query  982   YPQYTTSCSS-----------SMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR  1128
             +PQY +SCS+           +   N+ +++  +A ADIEVT++E+HAN+++LS  R+ +
Sbjct  203   FPQY-SSCSTHCNNPATSASSATASNEASAENRSAIADIEVTMVESHANLKVLSK-RRPK  260

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QL KMVA FQT+ +++LHLNVT  D +VLYS S KVE  CQL+S DEIA AV+ +L  I
Sbjct  261   QLLKMVAGFQTLRLTILHLNVTAVDQMVLYSFSVKVEDECQLTSVDEIATAVYQMLGRI  319



>ref|XP_004237957.1| PREDICTED: transcription factor bHLH94-like [Solanum lycopersicum]
Length=346

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 159/241 (66%), Gaps = 37/241 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAV+RSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  122   CKNKEELENQRMTHIAVERNRRKQMNEYLAVIRSLMPPSYVQRGDQASIIGGAINFVKEL  181

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQ+LEA+K    ++Q+ S                          G S T PF  +FA
Sbjct  182   EHHLQTLEAQKRSHPQKQEHS-----------------------DNHGSSSTPPFADYFA  218

Query  982   YPQYTTSCSSS---------MIPNKCTS----KTTAATADIEVTLIETHANVRILSSTRK  1122
             +PQY+T   S+              C S    +  +A ADIEV++ E+HAN++ILS  R+
Sbjct  219   FPQYSTHSKSTSPTAAASDVAAAGSCNSPLATEKMSALADIEVSMAESHANLKILSK-RR  277

Query  1123  TRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRV  1302
              +QL K+VA  Q + ++VLHLNVTT D +VLYS+S K+E GCQL++ADEIA++V+ +L  
Sbjct  278   PKQLLKIVAGLQCLWLTVLHLNVTTVDHMVLYSLSLKLEEGCQLTTADEIADSVNQLLGR  337

Query  1303  I  1305
             I
Sbjct  338   I  338



>gb|KDP41432.1| hypothetical protein JCGZ_15839 [Jatropha curcas]
Length=338

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 153/225 (68%), Gaps = 28/225 (12%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE 
Sbjct  129   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELEQ  188

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ++EA K   + +QQQ+AA D                        + ++PF +FF +P
Sbjct  189   LLQTMEAHK---KSKQQQTAAADV----------------------NALSSPFAEFFTFP  223

Query  988   QYTTSCSSSMIPNKCTSKT--TAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S +        +    AA ADIEVT++E+HAN++ILS  R  RQL KMVA  Q 
Sbjct  224   QYSTRASPATAEESVADQNQWAAAVADIEVTMVESHANLKILSKKRP-RQLLKMVAGLQG  282

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + +SVLHLNVT  D LVLYS+S KVE GC L++ DEIA AV+ +L
Sbjct  283   LRLSVLHLNVTAVDQLVLYSVSVKVEEGCHLNTVDEIAAAVNQML  327



>ref|XP_011082359.1| PREDICTED: transcription factor bHLH71-like [Sesamum indicum]
Length=291

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 157/230 (68%), Gaps = 20/230 (9%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEEAETQR+THIAVERNRR+QMNEHLA+LRSLMP+SYVQRGDQASIVGGAIEFVKEL
Sbjct  65    CKNKEEAETQRMTHIAVERNRRRQMNEHLAMLRSLMPDSYVQRGDQASIVGGAIEFVKEL  124

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH+LQSLEA K   Q   +         T                   R   +    F  
Sbjct  125   EHILQSLEANKASSQLLLENKHTHLKCTTT-----------------SRDHDDAKQPFPP  167

Query  982   YPQYTTSCS-SSMIPNKCTS-KTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
                   SCS  + + +K TS +  AA AD++VTL+E HA++RI+S  R+ RQLSK+VAAF
Sbjct  168   NTPELCSCSRHNPLSSKYTSHRKAAAVADVQVTLVEAHASIRIVSG-RRVRQLSKLVAAF  226

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              ++ ++VLHLN+TT    +LYSISAKVE G  LSSA++I+ A+HH+LR++
Sbjct  227   HSLFLNVLHLNLTTSQSFILYSISAKVEEGSPLSSAEDISAALHHMLRIL  276



>ref|XP_008373582.1| PREDICTED: transcription factor bHLH71 [Malus domestica]
Length=321

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 206/326 (63%), Gaps = 28/326 (9%)
 Frame = +1

Query  346   FNLIIYDTFSATPALSH--NEASETTNLAAVAPKQPgqdlcggdgggldACSSMPAWRRR  519
             FN I+YDT SATP  S   + +SETTN   + PK+              +     A    
Sbjct  9     FNFIVYDTISATPYTSQAQDYSSETTN-NFIPPKKFYYCNNAAAKSSNTSVILEAAGGGG  67

Query  520   HSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAVERNRRKQMN  699
                  +M    S  Q     +G GRKKRRR+ ++CKNKEEAETQR+THIAVERNRRKQMN
Sbjct  68    GKKTKQM---SSNQQPQGQGEGQGRKKRRRKARVCKNKEEAETQRMTHIAVERNRRKQMN  124

Query  700   EHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQQQQSaagdd  879
             +HLA+LRSLMP+SY QRGDQASIVGGAIEFVKELEHLL SLEA+KL+L + QQQ    D 
Sbjct  125   DHLAILRSLMPDSYAQRGDQASIVGGAIEFVKELEHLLLSLEAQKLQLFQHQQQHNPEDI  184

Query  880   gataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATA  1059
              AT +                    ++PF Q   YPQ  +   S    NK TSKT  ATA
Sbjct  185   VATPSKIVP----------------SSPFTQLLEYPQKHSWSHSHCPNNKYTSKTKGATA  228

Query  1060  DIEVTLIETHANVRILSSTRKT----RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSIS  1227
             DIEVTLIETHAN++ILS  RK      QLSK++A   ++ +++LHL V+T D  VLYSIS
Sbjct  229   DIEVTLIETHANLKILS--RKNIAARSQLSKLIAGIHSLHLTILHLTVSTVDPFVLYSIS  286

Query  1228  AKVEGGCQLSSADEIAEAVHHILRVI  1305
              K+E GC LSSAD+IA ++HH+LRVI
Sbjct  287   LKIEEGCLLSSADDIAASLHHMLRVI  312



>dbj|BAJ88793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/236 (53%), Positives = 152/236 (64%), Gaps = 13/236 (6%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EEAE QR+THIAVERNRR+QMNE+L +LRSLMPESYVQRGDQASIVGGAI+FVKELE  L
Sbjct  95    EEAECQRMTHIAVERNRRRQMNEYLVLLRSLMPESYVQRGDQASIVGGAIDFVKELEQQL  154

Query  814   QSLEAEKLRLQRQQQ------------QSaagddgataatktddgavasvsggvKGRSFT  957
             QSLEA+K  L RQQQ            +++       AA        +S      G S  
Sbjct  155   QSLEAQKRALARQQQHKAGCDATPLPARASTSGGNGGAACVESTSNCSSSVTEADGASDA  214

Query  958   NPFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
              PF  FF YPQY    S          ++ A  ADIEV L+ETHA++R++ + R+  QL 
Sbjct  215   PPFAGFFTYPQYVWCQSPRDATTLSADESRAGVADIEVNLVETHASLRVM-APRRPGQLL  273

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +MVA  Q + ++VLHLNVT    LVLYS+S KVE GC L++AD+IA AVHH+L  I
Sbjct  274   RMVAGLQALRLTVLHLNVTALGSLVLYSLSLKVEEGCDLTTADDIAAAVHHVLCFI  329



>ref|XP_006433906.1| hypothetical protein CICLE_v10001811mg [Citrus clementina]
 gb|ESR47146.1| hypothetical protein CICLE_v10001811mg [Citrus clementina]
Length=329

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 151/228 (66%), Gaps = 30/228 (13%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LA+LRSLMP SYVQRGDQAS++GG+I FVKELE 
Sbjct  122   NKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQ  181

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+EA+K    R   Q                               ++PF  FF +P
Sbjct  182   LLQSMEAQK----RNTSQ----------------------LLKAGDNGVSSPFANFFTFP  215

Query  988   QYTT--SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S S+++ P+   S  T   ADIEV + E+HAN++IL+  R  RQL KMVA+FQ 
Sbjct  216   QYSTRSSQSNNLAPDH-ESSMTENVADIEVNMAESHANIKILTKKRP-RQLLKMVASFQN  273

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +SVLHLNV+T D +VLYS+S KVE G QL++ DEIA AVH IL  I
Sbjct  274   LRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQILLEI  321



>ref|XP_009381949.1| PREDICTED: transcription factor bHLH94-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=345

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 188/321 (59%), Gaps = 19/321 (6%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTN-LAAVAPKQPgqdlcggdgggldA  489
             M LEAL++ EL + +IYDT +A+P L H E S +++ L   A  +      G        
Sbjct  1     MTLEALASAELSSFLIYDTITASPLLHHAEPSSSSSFLFRSAGGEDAVGSLGIGPSRSGL  60

Query  490   CSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIA  669
                +PA +      A  +                 K++RRR + CKN EEAE QR+THIA
Sbjct  61    VGGIPAAKEEPRPEAAAVG--------------QGKRKRRRTRTCKNMEEAENQRMTHIA  106

Query  670   VERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQR  849
             VERNRR+QMNEHLAVLRSLMPESY+QRGDQAS+VGGAI+FVKELE LLQSLEA+K  LQ 
Sbjct  107   VERNRRRQMNEHLAVLRSLMPESYIQRGDQASVVGGAIDFVKELEQLLQSLEAQKRTLQ-  165

Query  850   QQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNK  1029
               QQ+   +  +         + +  SG       + PF QFF++PQY+   ++    + 
Sbjct  166   --QQAGKQERSSYIGEAGSSSSSSGSSGSNSDVVDSPPFAQFFSFPQYSWCHTTQGQDHP  223

Query  1030  CTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLL  1209
              +     A ADIEVTLIETHANVRILS  R   QL KMVA    + +++LHLNVT  D +
Sbjct  224   PSENQLPALADIEVTLIETHANVRILSPKRPG-QLFKMVAGLHNLSLTILHLNVTALDSM  282

Query  1210  VLYSISAKVEGGCQLSSADEI  1272
             VLYS+S KV   C   + D I
Sbjct  283   VLYSLSVKVRPQCSWINCDLI  303



>gb|KDO81070.1| hypothetical protein CISIN_1g020210mg [Citrus sinensis]
Length=329

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 150/225 (67%), Gaps = 30/225 (13%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LA+LRSLMP SYVQRGDQAS++GG+I FVKELE 
Sbjct  122   NKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQ  181

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+EA+K    R   Q                               ++PF  FF +P
Sbjct  182   LLQSMEAQK----RNTSQ----------------------LLKAGDNGVSSPFANFFTFP  215

Query  988   QYTT--SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S S+++ P+   S  T   ADIEV + E+HAN++IL+  R  RQL KMVA+FQ 
Sbjct  216   QYSTRSSQSNNLAPDH-ESSMTENVADIEVNMAESHANIKILTKKRP-RQLLKMVASFQN  273

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + +SVLHLNV+T D +VLYS+S KVE G QL++ DEIA AVH IL
Sbjct  274   LRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQIL  318



>ref|XP_006472540.1| PREDICTED: transcription factor bHLH96-like [Citrus sinensis]
Length=329

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 150/225 (67%), Gaps = 30/225 (13%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LA+LRSLMP SYVQRGDQAS++GG+I FVKELE 
Sbjct  122   NKEEIENQRMTHIAVERNRRKQMNEYLAILRSLMPPSYVQRGDQASVIGGSINFVKELEQ  181

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+EA+K    R   Q                               ++PF  FF +P
Sbjct  182   LLQSMEAQK----RNTSQ----------------------LLKAGDNGVSSPFADFFTFP  215

Query  988   QYTT--SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S S++  P+  +S  T   ADIEV + E+HAN++IL+  R  RQL KMVA+FQ 
Sbjct  216   QYSTRASQSNNFAPDHDSS-MTENVADIEVNMAESHANIKILTKKRP-RQLLKMVASFQN  273

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + +SVLHLNV+T D +VLYS+S KVE G QL++ DEIA AVH IL
Sbjct  274   LRLSVLHLNVSTVDQMVLYSVSVKVEEGSQLNTVDEIAAAVHQIL  318



>emb|CBI33152.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 148/224 (66%), Gaps = 34/224 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKE+ E QR+THIAVERNRR+QMNEHLAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  100   KNKEQVENQRMTHIAVERNRRRQMNEHLAVLRSLMPASYVQRGDQASIIGGAINFVKELE  159

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ LEA+KL  QR Q  S                              +  F  FF +
Sbjct  160   QLLQPLEAQKLMKQRSQTDS------------------------------STVFSNFFTF  189

Query  985   PQYTTSCS---SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             PQY+T  +   SS    +  ++  +A AD+EVT++ETHAN+R+LS TR  +QL KMVA  
Sbjct  190   PQYSTYSTHYNSSAATKESMAEKRSAIADVEVTMVETHANIRVLSRTRP-KQLFKMVAWL  248

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
              ++ +++LHLNVTT D +VLYS SAKVE  C LSS +EIA AV+
Sbjct  249   HSVRLTILHLNVTTVDHMVLYSFSAKVEDDCVLSSVNEIATAVY  292



>ref|XP_006338108.1| PREDICTED: transcription factor bHLH96-like [Solanum tuberosum]
Length=345

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 158/245 (64%), Gaps = 46/245 (19%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAV+RSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  122   CKNKEELENQRMTHIAVERNRRKQMNEYLAVIRSLMPPSYVQRGDQASIIGGAINFVKEL  181

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQ+LEA+K    ++Q+ S                          G S +  F  +FA
Sbjct  182   EHHLQTLEAQKRSHSQKQEHS-----------------------DNHGSSSSPLFADYFA  218

Query  982   YPQYTT-----------------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILS  1110
             +PQY+T                 SC S +   K      +A ADIEV++ E+HAN++ILS
Sbjct  219   FPQYSTHFKSTSPAAPASTAAVGSCDSPLATEK-----MSALADIEVSMAESHANLKILS  273

Query  1111  STRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHH  1290
               R+ +QL K+VA  Q + ++VLHLNVTT D +VLYS+S KVE GCQL++ADEIA++V+ 
Sbjct  274   K-RRPKQLLKIVAGLQCLWLTVLHLNVTTVDHMVLYSLSLKVEEGCQLTTADEIADSVNQ  332

Query  1291  ILRVI  1305
             +L  I
Sbjct  333   LLGRI  337



>ref|XP_010652690.1| PREDICTED: transcription factor bHLH94-like [Vitis vinifera]
Length=322

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 152/231 (66%), Gaps = 34/231 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKE+ E QR+THIAVERNRR+QMNEHLAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  116   VKNKEQVENQRMTHIAVERNRRRQMNEHLAVLRSLMPASYVQRGDQASIIGGAINFVKEL  175

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQ LEA+KL  QR Q  S+                            F+N    FF 
Sbjct  176   EQLLQPLEAQKLMKQRSQTDSSTV--------------------------FSN----FFT  205

Query  982   YPQYTTSCS---SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             +PQY+T  +   SS    +  ++  +A AD+EVT++ETHAN+R+LS TR  +QL KMVA 
Sbjct  206   FPQYSTYSTHYNSSAATKESMAEKRSAIADVEVTMVETHANIRVLSRTRP-KQLFKMVAW  264

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               ++ +++LHLNVTT D +VLYS SAKVE  C LSS +EIA AV+  +  I
Sbjct  265   LHSVRLTILHLNVTTVDHMVLYSFSAKVEDDCVLSSVNEIATAVYETVGRI  315



>ref|XP_007223282.1| hypothetical protein PRUPE_ppa009461mg [Prunus persica]
 gb|EMJ24481.1| hypothetical protein PRUPE_ppa009461mg [Prunus persica]
Length=291

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 149/237 (63%), Gaps = 48/237 (20%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY QRGDQASI+GGAI FVKELE
Sbjct  87    KNKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAQRGDQASIIGGAINFVKELE  146

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS+++ K                                     RS   P  +FF +
Sbjct  147   QLLQSMDSNK-------------------------------------RSKQQPLAEFFTF  169

Query  985   PQYTTSCSSSMI---------PNKCTSKTTA-ATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQ++T  + S           PN   S +   A ADIEVT++++HAN++ILS  R  RQL
Sbjct  170   PQFSTRATQSNNNSAGVQANEPNMAQSNSNQWAAADIEVTMVDSHANLKILSKKR-PRQL  228

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              KMVA FQ++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ +LR I
Sbjct  229   LKMVAGFQSLRLSVLHLNVTTVDEMVLYSVSVKIEEGCLLNTVDEIAAAVNQMLRRI  285



>gb|EYU34532.1| hypothetical protein MIMGU_mgv1a013373mg [Erythranthe guttata]
Length=222

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 153/215 (71%), Gaps = 14/215 (7%)
 Frame = +1

Query  694   MNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQQQQSaag  873
             MNEHL VLRSLMPESYVQRGDQASIVGGAIEFVKELEH+LQSLEA+K  L  QQ  +   
Sbjct  1     MNEHLPVLRSLMPESYVQRGDQASIVGGAIEFVKELEHILQSLEAKKFTLLEQQGNNNTN  60

Query  874   ddgataatktddgava---------svsggvKGRSF--TNPFWQFFAYPQYTTSCSSSMI  1020
             ++         +                      S    +PF QFFAYPQ+  SCS++ +
Sbjct  61    NNNNINNNNNSNNNNNNNNEDNYNPDQEISDDNSSIKQVSPFAQFFAYPQF--SCSNNQM  118

Query  1021  PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTF  1200
              NK TS++ AA ADIEVTLIETHAN+R + S R+ RQLSK+VA+F ++ +++LHLNVTT 
Sbjct  119   GNKYTSQSKAAIADIEVTLIETHANIR-ILSRRRLRQLSKIVASFHSVSLTILHLNVTTL  177

Query  1201  DLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             DLLVLYSISAKVE GCQLSSADEIA AVHH+LR+I
Sbjct  178   DLLVLYSISAKVEEGCQLSSADEIAGAVHHMLRII  212



>gb|KHG10117.1| Transcription factor bHLH96 -like protein [Gossypium arboreum]
Length=337

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 151/232 (65%), Gaps = 35/232 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LA +RSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  129   KNKEELENQRMTHIAVERNRRKQMNEYLAAIRSLMPASYVQRGDQASIIGGAINFVKELE  188

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ++EA K   Q  +                                  +PF +FFA+
Sbjct  189   QLLQTMEAHKRTTQHPEHNGD-----------------------------PSPFAEFFAF  219

Query  985   PQYTTSCSS--SMIPNKCTSKTTAAT---ADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQ++T  +S  +  P+   +    AT   ADIEVT++ETHAN++ILS  R  RQL K+VA
Sbjct  220   PQFSTRATSHCNNSPSSMAADQPMATESVADIEVTMVETHANLKILSKKRP-RQLLKLVA  278

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               Q++ +++LHLNV+T D + LYSIS KVE GC L++ DEIA AV+ +LR I
Sbjct  279   GIQSLSLTILHLNVSTVDEMALYSISVKVEEGCHLNTVDEIAAAVNQMLRSI  330



>ref|XP_003526566.1| PREDICTED: transcription factor bHLH96-like [Glycine max]
Length=334

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 154/231 (67%), Gaps = 29/231 (13%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  124   AKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKEL  183

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRS---FTNPFWQ  972
             E LLQS+E +K   Q ++                          G+ G S    T PF +
Sbjct  184   EQLLQSMEGQKRTNQGKEN-----------------------VVGLNGTSRTTTTTPFAE  220

Query  973   FFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             FFA+PQYTT   ++M  N    K   A ADIEVT+++ HAN+++LS  ++  Q+ K+V  
Sbjct  221   FFAFPQYTTR-GTTMAQNNQEQK-QWAVADIEVTMVDNHANLKVLSK-KQPGQIMKIVVG  277

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              Q++ +S+LHLNV+T D +VLYS+S KVE GC L++ DEIA AV+ +LR I
Sbjct  278   LQSLKLSILHLNVSTLDDMVLYSVSVKVEDGCLLNTVDEIAAAVNQLLRTI  328



>ref|XP_007018123.1| DNA binding protein, putative [Theobroma cacao]
 gb|EOY15348.1| DNA binding protein, putative [Theobroma cacao]
Length=332

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 149/230 (65%), Gaps = 33/230 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  126   KNKEELENQRMTHITVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELE  185

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS+EA K   Q+ +                                +++PF +FF +
Sbjct  186   QLLQSMEAHKRTTQQPEH-----------------------------NGYSSPFAEFFTF  216

Query  985   PQYT---TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             PQ++   T C++             + ADIEVT++ETHAN++ILS  R  RQL K+VA  
Sbjct  217   PQFSTHATQCNNPQSMAAEPMAAAESVADIEVTMVETHANLKILSKKRP-RQLLKLVAGL  275

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             Q++ +++LHLNVTT + + LYSIS KVE GC L++ DEIA AV+ +LR I
Sbjct  276   QSLRLTILHLNVTTVEEMALYSISVKVEEGCHLNTVDEIAAAVNQMLRGI  325



>gb|KHN27371.1| Transcription factor bHLH96 [Glycine soja]
Length=317

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 147/228 (64%), Gaps = 30/228 (13%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KN EE E QR THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  114   AKNTEEIENQRRTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKEL  173

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQS+E +K   Q Q+                               S T PF +FF 
Sbjct  174   EQLLQSMEGQKRTNQAQEN------------------------VVGLNGSTTTPFAEFFT  209

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQYTT   +         +   A ADIEVT++++HAN+++LS  ++  QL K+V   Q+
Sbjct  210   FPQYTTRGRT-----MAQEQKQWAVADIEVTMVDSHANLKVLSK-KQPGQLMKIVVGLQS  263

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +S+LHLNV+T D +VLYSIS KVE GC+L++ DEIA AV+ +LR I
Sbjct  264   LMLSILHLNVSTLDDMVLYSISVKVEDGCRLNTVDEIAAAVNQLLRTI  311



>emb|CDP01118.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 161/251 (64%), Gaps = 53/251 (21%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMN++LAV+RS+MP SYVQRGDQASI+GGAI FVKEL
Sbjct  128   CKNKEELENQRMTHIAVERNRRKQMNDYLAVIRSMMPPSYVQRGDQASIIGGAINFVKEL  187

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP--FWQF  975
             E  LQ+LEA++ R  +Q+Q++                              T+P  F  F
Sbjct  188   EQHLQTLEAQRRRNSQQEQENG-----------------------------TSPPLFADF  218

Query  976   FAYPQYTTSCSSSMI-------------------PNK-CTSKTTAATADIEVTLIETHAN  1095
             F +PQY+T  SS+ +                   P++  T +  +A ADIEVT+ E+HAN
Sbjct  219   FTFPQYSTRSSSTTLHSNTINSPVTTTTSDHQPQPSRAATDQNPSALADIEVTMAESHAN  278

Query  1096  VRILSSTRKTRQLSKMVAAFQTMCMSVLHLNV-TTFDLLVLYSISAKVEGGCQLSSADEI  1272
             ++ILS  R+ RQL K+VA  Q + ++VLHLNV TT D  VLYSIS K+E GCQL++ DEI
Sbjct  279   LKILSK-RRPRQLLKLVAGLQLLWLTVLHLNVTTTLDQKVLYSISVKLEEGCQLTTIDEI  337

Query  1273  AEAVHHILRVI  1305
             A+AV+H+L  I
Sbjct  338   ADAVNHLLGRI  348



>ref|XP_009781858.1| PREDICTED: transcription factor bHLH94-like [Nicotiana sylvestris]
Length=350

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 154/237 (65%), Gaps = 36/237 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAV+RSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  128   CKNKEELENQRMTHIAVERNRRKQMNEYLAVIRSLMPPSYVQRGDQASIIGGAINFVKEL  187

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQ+LEA+K    +QQQQS                          G   T  F  +F+
Sbjct  188   EHHLQTLEAQKRTHSQQQQQS-----------------------DCHGSLSTPLFADYFS  224

Query  982   YPQYTTSCSSS--------MIPNKCTSKTTA----ATADIEVTLIETHANVRILSSTRKT  1125
             +P+Y+T  + S             C S   A    A A+IEVT+ E+HAN++ILS  R+ 
Sbjct  225   FPRYSTRSNHSNSSTLADAAAATTCDSPLAAEKQLALAEIEVTMAESHANLKILSK-RRP  283

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             +QL KMVA  Q + ++VLHLNVTT D +VLYS+S  +E GCQL++ADEIA+ V+ +L
Sbjct  284   KQLLKMVAGLQCLWLTVLHLNVTTVDHMVLYSLSLMLEEGCQLTTADEIADVVNQLL  340



>ref|XP_008219358.1| PREDICTED: transcription factor bHLH94-like [Prunus mume]
Length=324

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 151/237 (64%), Gaps = 48/237 (20%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY QRGDQASI+GGAI FVKELE
Sbjct  120   KNKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAQRGDQASIIGGAINFVKELE  179

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS+++ K    R +QQ                                 P  +FF +
Sbjct  180   QLLQSMDSNK----RSKQQ---------------------------------PLAEFFTF  202

Query  985   PQYTTSCSSSMI---------PNKCTSKTTA-ATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQ++T  + S           PN   S +   A ADIEVT++++HAN++ILS  R  RQL
Sbjct  203   PQFSTRATQSNNNSAGVQANEPNMAQSNSNQWAAADIEVTMVDSHANLKILSEKR-PRQL  261

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              KMVA FQ++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ +LR I
Sbjct  262   LKMVAGFQSLRLSVLHLNVTTVDEMVLYSVSVKIEEGCLLNTVDEIAAAVNQMLRRI  318



>gb|KHN35482.1| Transcription factor bHLH96 [Glycine soja]
Length=226

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 145/239 (61%), Gaps = 44/239 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  13    KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELE  72

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ ++ +K                                    G S ++PF +FF +
Sbjct  73    QLLQCMKGQK-------------------------------RTKEGGFSDSSPFAEFFMF  101

Query  985   PQYTTSCSSSM------IPNKCTSKTTA------ATADIEVTLIETHANVRILSSTRKTR  1128
             PQY+T  + S        P  C +          A ADIEVTL++ HAN++ILS  R   
Sbjct  102   PQYSTRATQSSSSSSKGYPGTCEANNNIARNHSWAVADIEVTLVDGHANMKILSKKRPG-  160

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              L KMV   Q++ +S+LHLNVTT D +VL S+S KVE GCQL++ DEIA AVH + R +
Sbjct  161   LLLKMVVGLQSLGLSILHLNVTTVDDMVLTSVSVKVEEGCQLNTVDEIAAAVHQLSRTV  219



>ref|XP_003522778.1| PREDICTED: transcription factor bHLH96 [Glycine max]
Length=324

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 30/226 (13%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             N EE E QR THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE 
Sbjct  123   NTEEIENQRRTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELEQ  182

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+E +K   Q Q+                               S T PF +FF +P
Sbjct  183   LLQSMEGQKRTNQAQEN------------------------VVGLNGSTTTPFAEFFTFP  218

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QYTT   +         +   A ADIEVT++++HAN+++LS  ++  QL K+V   Q++ 
Sbjct  219   QYTTRGRT-----MAQEQKQWAVADIEVTMVDSHANLKVLSK-KQPGQLMKIVVGLQSLM  272

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +S+LHLNV+T D +VLYSIS KVE GC+L++ DEIA AV+ +LR I
Sbjct  273   LSILHLNVSTLDDMVLYSISVKVEDGCRLNTVDEIAAAVNQLLRTI  318



>ref|XP_004152621.1| PREDICTED: transcription factor bHLH96-like [Cucumis sativus]
 gb|KGN62718.1| hypothetical protein Csa_2G369200 [Cucumis sativus]
Length=307

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 148/232 (64%), Gaps = 42/232 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  106   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELE  165

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ ++  K                                     ++ T+PF  FF++
Sbjct  166   QQLQFIKVHK------------------------------------EQTDTSPFADFFSF  189

Query  985   PQYTTSCSSSMIPNKCTSKTTAA-----TADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+T  ++    N     ++ A       DIEVT+++THAN++ILS  R  RQL KMVA
Sbjct  190   PQYSTRATTQSKNNNSPHDSSIAHTQWPAGDIEVTMVDTHANLKILSQKRP-RQLLKMVA  248

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              FQ++ +++LHLNVTT D +VLYS+S KVE GCQL++ DEIA AV+ IL  I
Sbjct  249   GFQSLRLTILHLNVTTSDQMVLYSLSIKVEEGCQLNTVDEIAAAVNQILLSI  300



>ref|XP_004164228.1| PREDICTED: transcription factor bHLH96-like [Cucumis sativus]
Length=311

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 148/232 (64%), Gaps = 42/232 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  110   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELE  169

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ ++  K                                     ++ T+PF  FF++
Sbjct  170   QQLQFIKVHK------------------------------------EQTDTSPFADFFSF  193

Query  985   PQYTTSCSSSMIPNKCTSKTTAA-----TADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+T  ++    N     ++ A       DIEVT+++THAN++ILS  R  RQL KMVA
Sbjct  194   PQYSTRATTQSKNNNSPHDSSIAHTQWPAGDIEVTMVDTHANLKILSQKRP-RQLLKMVA  252

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              FQ++ +++LHLNVTT D +VLYS+S KVE GCQL++ DEIA AV+ IL  I
Sbjct  253   GFQSLRLTILHLNVTTSDQMVLYSLSIKVEEGCQLNTVDEIAAAVNQILLSI  304



>ref|XP_002319028.2| hypothetical protein POPTR_0013s02680g [Populus trichocarpa]
 gb|EEE94951.2| hypothetical protein POPTR_0013s02680g [Populus trichocarpa]
Length=343

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 153/235 (65%), Gaps = 39/235 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  132   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  191

Query  805   HLLQSLEA-----EKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFW  969
               LQ L A     EK     QQ  S+                               PF 
Sbjct  192   QKLQVLGACKEMKEKPNGDDQQHVSSL------------------------------PFS  221

Query  970   QFFAYPQYTTS---CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSK  1140
             +FF +PQYTTS   C SS   ++   K+ +A ADIEVT++E+HAN++I  S R+ +QL K
Sbjct  222   KFFIFPQYTTSSIHCESSAGKDEKLMKSQSAIADIEVTMVESHANLKI-RSKRRPKQLLK  280

Query  1141  MVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +V+A  +M ++VLHLNV+T D +VLYS+S KVE  C+LSS DEIA AV+ +L  I
Sbjct  281   VVSALHSMRLTVLHLNVSTVDQIVLYSLSVKVEDDCKLSSVDEIATAVYQMLGRI  335



>gb|KDP23545.1| hypothetical protein JCGZ_23378 [Jatropha curcas]
Length=326

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 157/235 (67%), Gaps = 32/235 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+L+VLRSLMP+SYVQRGDQASI+GGAI FVKELE 
Sbjct  120   NKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELEQ  179

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQ L  EK   Q ++++S                         +G     PF  FF +P
Sbjct  180   RLQLLGGEK---QVKEEKS-------------------------QGEECPLPFSDFFTFP  211

Query  988   QYTTSCSSSMIP--NKCTSKTT-AATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY+T+ S S +   N+  S TT ++ ADIEVT++E+HANV+I  S R+ +QL K+V+   
Sbjct  212   QYSTTRSDSSVTGVNETMSATTESSIADIEVTMVESHANVKI-RSKRRPKQLLKIVSGLH  270

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVIeeeeeV  1323
             +M +++LHLNVTT D +VLYS+S KVE  C LSS DEIA AV+ +L  I+EE  V
Sbjct  271   SMRLTILHLNVTTLDQIVLYSLSVKVEDDCNLSSVDEIATAVYEMLGRIQEEYSV  325



>ref|XP_010106856.1| hypothetical protein L484_003559 [Morus notabilis]
 gb|EXC12235.1| hypothetical protein L484_003559 [Morus notabilis]
Length=355

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 152/231 (66%), Gaps = 36/231 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKE+ E QR+THIAVERNRRKQMNE+LAVLRSLMP+SYVQRGDQASI+GGAI FVKELE
Sbjct  143   KNKEDIENQRMTHIAVERNRRKQMNEYLAVLRSLMPDSYVQRGDQASIIGGAINFVKELE  202

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               +Q L  +K  ++RQ                           G  G     PF +FF +
Sbjct  203   QQVQFLGVQK-EIKRQ---------------------------GSDGGVSDAPFSEFFTF  234

Query  985   PQYTTSCSSSM-------IPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             PQY+TS  +S        +    T +T++A ADIEVT++E+HAN++I  S R+ +QL KM
Sbjct  235   PQYSTSSGTSKTYHDSNPVAMAGTGETSSAIADIEVTMVESHANIKI-RSKRRPKQLLKM  293

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             V+  Q+M ++VLHLNVTT   +VLYS+S KVE  C+L+S D+IA AV+ IL
Sbjct  294   VSGLQSMRLTVLHLNVTTEQAIVLYSLSVKVEDDCKLTSVDDIATAVYQIL  344



>ref|XP_008444872.1| PREDICTED: transcription factor bHLH96 [Cucumis melo]
Length=310

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 149/232 (64%), Gaps = 42/232 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  109   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELE  168

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ ++  K                                     ++ T+PF  FF++
Sbjct  169   QQLQFIKVHK------------------------------------EQTDTSPFADFFSF  192

Query  985   PQYTTSCSSSMIPNKCTSKTTAATA-----DIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+T  ++    N     ++ A A     DIEVT+++THAN++ILS  R  RQL KMVA
Sbjct  193   PQYSTRATTQSKNNNSPHDSSIAHAQWPAGDIEVTMVDTHANLKILSQKRP-RQLLKMVA  251

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              FQ++ +++LHLNVTT D +VLYS+S KVE GCQL++ DEIA AV+ IL  I
Sbjct  252   GFQSLRLTILHLNVTTSDQMVLYSLSIKVEEGCQLNTVDEIAAAVNQILLSI  303



>ref|XP_008782180.1| PREDICTED: transcription factor bHLH94-like [Phoenix dactylifera]
Length=325

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 149/238 (63%), Gaps = 41/238 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+ HIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  111   KNKEEVESQRMIHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINYVKELE  170

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLE +K    R +Q+S A                            T PF  FFA+
Sbjct  171   QLLQSLEVQK----RLKQRSDAT-------------------------DLTPPFADFFAF  201

Query  985   PQYTTSCSSSMI-----------PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQ  1131
             PQY++  S S              N+  +K  +A ADIEVT++ETHAN+++LS  R+  Q
Sbjct  202   PQYSSCSSGSSSGTHTSSSSSSNANEVAAKNRSAMADIEVTMVETHANLKVLSR-RRPNQ  260

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L KMV   Q+  ++ LHLNVTT D LVLYS S KVE  CQ +S DEIA A + +L  I
Sbjct  261   LLKMVVGLQSTGLTTLHLNVTTVDRLVLYSFSLKVEDDCQFTSVDEIATAAYQMLGRI  318



>ref|XP_006653718.1| PREDICTED: transcription factor bHLH96-like [Oryza brachyantha]
Length=333

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 158/253 (62%), Gaps = 13/253 (5%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             E+AE+QR+THIAVERNRR+QMNE+LAVLRSLMPESYV RGDQASIVGGAI+FVKELE LL
Sbjct  89    EDAESQRMTHIAVERNRRRQMNEYLAVLRSLMPESYVHRGDQASIVGGAIDFVKELEQLL  148

Query  814   QSLEAEKLRL-----QRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             QSLEA+K  L                              A+ +   +  +   PF +FF
Sbjct  149   QSLEAQKRTLLMQQPPPPPPPPPPQKQQQQEVKPDATTTAATSAVDQEAAADGPPFARFF  208

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
              YPQY   C     P    ++  A  ADIEV+L+ETHA++R+++  R+  QL KMVA  Q
Sbjct  209   TYPQYVW-CHQP--PRDGGAENRAGVADIEVSLVETHASLRVMAP-RRPGQLLKMVAGLQ  264

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVIeeeeeVTIP*A  1338
              + ++VLHLNVT+   L LYSIS KVE GC +++ D+IA AVHH+L +I+ E       A
Sbjct  265   ALRLTVLHLNVTSLGSLALYSISVKVEEGCGMATVDDIAAAVHHVLCIIDAEAAG----A  320

Query  1339  HLLLPY*AGCKLG  1377
              LLL   AG   G
Sbjct  321   RLLLGGEAGGPFG  333



>ref|XP_004953510.1| PREDICTED: transcription factor bHLH96-like [Setaria italica]
Length=341

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 150/237 (63%), Gaps = 15/237 (6%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE ETQR+THIAVERNRR+QMNE+LAVLRSLMPE YVQRGDQASIVGGAIE+VKELE  L
Sbjct  90    EETETQRMTHIAVERNRRRQMNEYLAVLRSLMPEPYVQRGDQASIVGGAIEYVKELEQQL  149

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTN-----------  960
             Q LEA+K  L   Q ++A  D      + +     ++          ++           
Sbjct  150   QCLEAQKRTLLVHQHKAAMPDATPMHHSGSSTKTESATPPPTPSNCSSSVTEDAADHAPP  209

Query  961   -PFWQFFAYPQYTTSCSSSMIPNKCTSKTT-AATADIEVTLIETHANVRILSSTRKTRQL  1134
              PF QFF YPQY   C S   P            ADIEVTL+ETHA++R+++  R+  QL
Sbjct  210   PPFAQFFTYPQYVW-CHSPRGPAAAAEDAGRPGVADIEVTLVETHASLRVMTP-RRPGQL  267

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               +V   Q + ++VLHL+VTT D LVLY+IS K+E GC L++ D+IA AVHH+L +I
Sbjct  268   LGLVTGLQALRLAVLHLSVTTLDALVLYTISVKIEEGCGLATVDDIAAAVHHVLCII  324



>ref|XP_003544814.1| PREDICTED: transcription factor bHLH96-like [Glycine max]
Length=324

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 146/239 (61%), Gaps = 44/239 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  111   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELE  170

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ ++ +K                                    G S ++PF +FF +
Sbjct  171   QLLQCMKGQK-------------------------------RTKEGGFSDSSPFAEFFMF  199

Query  985   PQYTTSCSSSM------IPNKCTSKT------TAATADIEVTLIETHANVRILSSTRKTR  1128
             PQY+T  + S        P  C +        + A ADIEVTL++ HAN++ILS  R   
Sbjct  200   PQYSTRATQSSSSSSRGYPGTCEANNNIARNHSWAVADIEVTLVDGHANMKILSKKRPGL  259

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              L KMV   Q++ +S+LHLNVTT D +VL S+S KVE GCQL++ DEIA AVH + R +
Sbjct  260   LL-KMVVGLQSLGLSILHLNVTTVDDMVLTSVSVKVEEGCQLNTVDEIAAAVHQLSRTV  317



>gb|KHG29471.1| Transcription factor bHLH94 -like protein [Gossypium arboreum]
Length=314

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 153/228 (67%), Gaps = 32/228 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRR+QMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  105   KNKEEIENQRMTHIAVERNRRRQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  164

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H +Q L A+K   +R    ++                             ++PF +FF +
Sbjct  165   HCVQLLSAKKETKERPNGSNS---------------------------GCSSPFGEFFTF  197

Query  985   PQYTTSCS---SSMIP-NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+TS +   ++ IP N+   +T +A ADIEVT++E+HAN++I  S +   QL K+V+ 
Sbjct  198   PQYSTSSTRGDNNSIPMNESMVETRSAIADIEVTMVESHANLKI-RSKKGPAQLLKLVSG  256

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
               +M +++LHLNVTT D  VLYS+S KVE  C+L+S D+IA AV+ +L
Sbjct  257   LNSMRLNILHLNVTTVDQTVLYSLSVKVEDDCKLTSVDDIATAVNQLL  304



>ref|XP_010926342.1| PREDICTED: transcription factor bHLH94-like [Elaeis guineensis]
Length=321

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 147/237 (62%), Gaps = 40/237 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+ HIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  108   KNKEEVESQRMIHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINYVKELE  167

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLE +K   QR                                     PF  FF +
Sbjct  168   QLLQSLEVQKRLKQR-----------------------------SDATELAPPFAGFFTF  198

Query  985   PQY----------TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY          ++S SSS I N+  +K  +A ADIEVT++E+HAN+++LS  R+  QL
Sbjct  199   PQYSSCSSGSSHSSSSSSSSSIANEAAAKNRSAMADIEVTMVESHANLKVLSR-RRPNQL  257

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              KMV   Q   ++ LHLNVTT D LVLYS+S KVE  CQ +S DEIA AV+ +L  I
Sbjct  258   LKMVVGLQNTGLTTLHLNVTTVDQLVLYSLSLKVEDDCQFTSVDEIATAVYQMLGRI  314



>ref|XP_010675612.1| PREDICTED: transcription factor bHLH94-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 152/247 (62%), Gaps = 26/247 (11%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAV+RSLMP SYVQRGDQASIVGGAI +VKEL
Sbjct  126   CKNKEEVEQQRMTHIAVERNRRKQMNEYLAVIRSLMPSSYVQRGDQASIVGGAINYVKEL  185

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQS+EAEK   + Q+           +     D      S           F  FF+
Sbjct  186   EQLLQSMEAEKRSDKHQRHDEHQRQPSPPSGDDGGDRKFVGNSADTAAWPLL--FADFFS  243

Query  982   YPQYTTSCSSSMIPN-------------------KCTSKTTAATADIEVTLIETHANVRI  1104
             +PQY+T       PN                      + + ++  DIEVT++E+HANV+I
Sbjct  244   FPQYSTRSK----PNSPGSGSGSGSGSGSVLGSSNSVTSSNSSVGDIEVTMVESHANVKI  299

Query  1105  LSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAV  1284
             L+  ++ +QL K++A FQ + ++VLHLNVTT D  VLYS+S KVE GCQL+S D+I  A 
Sbjct  300   LAK-KQPKQLLKLIAGFQGLRLNVLHLNVTTVDSFVLYSLSLKVEDGCQLNSVDDIVAAA  358

Query  1285  HHILRVI  1305
             +HIL  I
Sbjct  359   NHILGQI  365



>ref|XP_010916699.1| PREDICTED: transcription factor bHLH94-like [Elaeis guineensis]
Length=324

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 150/237 (63%), Gaps = 40/237 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+ HIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  111   KNKEEVESQRMIHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINYVKELE  170

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLE +K    R +Q+S                               +PF  FFA+
Sbjct  171   QLLQSLEVQK----RLKQRS-------------------------DATGLVHPFANFFAF  201

Query  985   PQYTT----------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY++          + S+  I N+   +  +A ADIEVT++E++AN+++LS  R  +QL
Sbjct  202   PQYSSCSSGGSTTTHTSSNHNIANEMAVENRSAMADIEVTMVESYANLKVLSR-RWPKQL  260

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              KMV   Q M ++ LHLNVTT D LVLYS S KVE  CQ +S D+IA AV+ +L  I
Sbjct  261   LKMVMGLQNMRLTTLHLNVTTVDQLVLYSFSLKVEDDCQFTSVDDIATAVYQMLGRI  317



>ref|XP_009403078.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=304

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 147/233 (63%), Gaps = 39/233 (17%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KN+EE E QR+THIAVERNRRKQMNE+LAVL+SLMP SYVQRGDQASI+GGAI FVKE
Sbjct  97    VFKNQEEVENQRMTHIAVERNRRKQMNEYLAVLQSLMPASYVQRGDQASIIGGAINFVKE  156

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE L+QSLEA K R++++   +                                PF  FF
Sbjct  157   LEQLVQSLEARK-RVEKRMDAA--------------------------------PFADFF  183

Query  979   AYPQYTTSCSSSMIPNKCTSKTTA----ATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
              +PQY+T+ S S   N C  +       A ADIEVT++E+HAN+++LS  R+ +QL KMV
Sbjct  184   TFPQYSTTGSRS-ANNDCADEGATENRPAVADIEVTMVESHANLKVLSR-RRPKQLLKMV  241

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                Q + ++ LHLNVT+   +  YS S KVE  CQL+S DEIA AVH ++  I
Sbjct  242   LGLQNLRLTTLHLNVTSIAEMAFYSFSLKVEDDCQLTSVDEIATAVHQMVGTI  294



>ref|XP_002513985.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF48568.1| DNA binding protein, putative [Ricinus communis]
Length=338

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 148/229 (65%), Gaps = 30/229 (13%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             K+KEE E QR+THIAVERNRRK+MNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  130   KDKEEIENQRMTHIAVERNRRKRMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELE  189

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ++E  K   Q+Q   S                          G S ++PF  FF +
Sbjct  190   QLLQTMEGHKKTKQQQPDAS--------------------------GFS-SSPFADFFTF  222

Query  985   PQYTTSCSSSMIPNK--CTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             PQY+T    +          +   A ADIEVT++E HAN++ILS  R+ R+L K+VA  Q
Sbjct  223   PQYSTRNPPTTAEESLAVADQNQWAMADIEVTMVENHANLKILSK-RRPRKLLKVVAGLQ  281

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              + +SVLHLNVTT D +VLYS+S K+E GC L++ D+IA AV+ +L  I
Sbjct  282   GLRLSVLHLNVTTADQMVLYSVSVKIEEGCLLNTVDDIAAAVNQVLHTI  330



>emb|CAH67958.1| OSIGBa0142I02-OSIGBa0101B20.1 [Oryza sativa Indica Group]
Length=328

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 145/227 (64%), Gaps = 5/227 (2%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             E+AE+QR+THIAVERNRR+QMNE+LAVLRSLMPESYV RGDQASIVGGAI+FVKELE LL
Sbjct  88    EDAESQRMTHIAVERNRRRQMNEYLAVLRSLMPESYVHRGDQASIVGGAIDFVKELEQLL  147

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             QSLEA+K  L  Q                    A    +          PF +FF YPQY
Sbjct  148   QSLEAQKRTLLMQPPPPPQQQREPKCDAADSTSAADQETPAAAAAD-GPPFARFFTYPQY  206

Query  994   T---TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
                              ++  A  ADIEV+L+ETHA++R++++ R+  QL KMVA  Q +
Sbjct  207   VWCHNPAQDGGGGGGAAAENRAGVADIEVSLVETHASIRVMAA-RRPGQLLKMVAGLQAL  265

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              ++VLHLNVT    L LYSIS KVE GC +++ D+IA AVHH+L +I
Sbjct  266   RLTVLHLNVTALGSLALYSISVKVEEGCGMATVDDIAAAVHHVLCII  312



>ref|XP_009625368.1| PREDICTED: transcription factor bHLH96-like [Nicotiana tomentosiformis]
Length=291

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 145/229 (63%), Gaps = 31/229 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRR+QMN++LAVLRSLMP SY QRGDQASIVGGAI FVKELE 
Sbjct  83    NKEEIENQRMTHIAVERNRRRQMNDYLAVLRSLMPPSYAQRGDQASIVGGAINFVKELEQ  142

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ LEA K  +++Q                                +  +PF +FF +P
Sbjct  143   LLQFLEAHKQEVKKQ---------------------------SSPNNASQHPFSKFFTFP  175

Query  988   QYTTSCSSSM---IPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY T+ +  M        T +  +A ADIEVT++E+HANV++LS  R+ +QL K+V   Q
Sbjct  176   QYATANNHPMATAYDGATTEERRSAVADIEVTMVESHANVKVLSR-RRPKQLLKIVNWLQ  234

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              MC ++LHL V+T D  VLYS S KVE  CQL++  EIA A+H ++ +I
Sbjct  235   AMCFTILHLTVSTADHTVLYSFSVKVEDNCQLNTVSEIASAIHEMVAMI  283



>ref|XP_009784356.1| PREDICTED: transcription factor bHLH96-like [Nicotiana sylvestris]
Length=291

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 146/229 (64%), Gaps = 31/229 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRR+QMN++LAVLRSLMP SY QRGDQASIVGGAI FVKELE 
Sbjct  83    NKEEIENQRMTHIAVERNRRRQMNDYLAVLRSLMPPSYAQRGDQASIVGGAINFVKELEQ  142

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ LEA K +++ Q                                +  +PF +FF +P
Sbjct  143   LLQFLEAHKQQVRNQ---------------------------LSPNNASQHPFSKFFTFP  175

Query  988   QYTTSCSSSMI---PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY+T  +  M        T +  +A ADIEVT++E HANV++LS  R+ +QL K+V   Q
Sbjct  176   QYSTGNNHPMAAASDGTMTEERRSAVADIEVTMVENHANVKVLSR-RRPKQLLKIVNWLQ  234

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              MC+++LHL V+T D +VLYS S KVE  CQL++  +IA AVH ++ +I
Sbjct  235   AMCLTILHLTVSTADHMVLYSFSVKVEDNCQLNTVSDIASAVHEMVAMI  283



>ref|XP_009615601.1| PREDICTED: transcription factor bHLH96-like [Nicotiana tomentosiformis]
Length=349

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 154/240 (64%), Gaps = 34/240 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAV+RSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  125   CKNKEELENQRMTHIAVERNRRKQMNEYLAVIRSLMPPSYVQRGDQASIIGGAINFVKEL  184

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQ+LEA+K+                     T             G   T  F  +F+
Sbjct  185   EHHLQTLEAQKI---------------------THSQQQQQQQSDCHGSLSTPLFADYFS  223

Query  982   YPQY--------TTSCSSSMIPNKCTSKTTA----ATADIEVTLIETHANVRILSSTRKT  1125
             +PQY        +++ + +     C S   A    A A+IEVT+ E+HAN++ILS  R+ 
Sbjct  224   FPQYSTHSNHSNSSTPADAAAATTCDSPLAAEKQLALAEIEVTMAESHANLKILSK-RRP  282

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +QL KMVA  Q + ++VLHLNVTT D +VLYS+S K+E GCQL++ADEIA+AV+ +L  I
Sbjct  283   KQLLKMVAGLQCLWLTVLHLNVTTVDHMVLYSLSLKLEEGCQLTTADEIADAVNQLLGRI  342



>ref|XP_010045474.1| PREDICTED: transcription factor bHLH96 [Eucalyptus grandis]
 gb|KCW83091.1| hypothetical protein EUGRSUZ_B00048 [Eucalyptus grandis]
Length=359

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 151/241 (63%), Gaps = 36/241 (15%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASI+GGAI FVKELE 
Sbjct  132   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYSQRGDQASIIGGAINFVKELEQ  191

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS++  K + +  Q                   A A+ +         +PF +FF++P
Sbjct  192   LLQSMQTHKSKPKPLQD----------------LAAAANNNNDNSNNDVASPFAEFFSFP  235

Query  988   QYTTSCSSSMIPNKCTSKTTAAT---------------ADIEVTLIETHANVRILSSTRK  1122
             QY+T  +S+     C   T  AT               ADIEVT++E+HAN++I S  R 
Sbjct  236   QYSTRLASA----PCGGPTEPATALEDRSGGPHPQWVVADIEVTMVESHANMKIFSKKRP  291

Query  1123  TRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRV  1302
              RQL ++VA  Q + ++VLHLNVTT D  VLYS+S KVE GC L++ DEIA AVH +LR 
Sbjct  292   -RQLLQLVAGLQGLRLTVLHLNVTTVDDSVLYSVSVKVEEGCHLNTVDEIAAAVHELLRR  350

Query  1303  I  1305
             I
Sbjct  351   I  351



>dbj|BAD07690.1| putative basic-helix-loop-helix transcription factor [Oryza sativa 
Japonica Group]
 gb|EAZ24247.1| hypothetical protein OsJ_07997 [Oryza sativa Japonica Group]
Length=373

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 158/264 (60%), Gaps = 38/264 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CK++EE ETQR+THIAVERNRR+QMNE+LA+LRSLMPE YVQRGDQASIVGGAIEFVKEL
Sbjct  79    CKSREETETQRMTHIAVERNRRRQMNEYLAILRSLMPEPYVQRGDQASIVGGAIEFVKEL  138

Query  802   EHLLQSLEAEKLRLQRQQQ------------QSaagddgataatktddgavasvsggvKG  945
             E  LQSLEA+K  L    +              +    G      T     +S       
Sbjct  139   EQQLQSLEAQKRTLLPHHKARCDDATPMHNASGSNVGAGGCMEPTTTTSNCSSSVTEDAP  198

Query  946   RSFTNPFWQFFAYPQYTTSCSS------------------------SMIPNKCTSKTTAA  1053
              +   PF QFFAYPQY   C S                        + +     S+  + 
Sbjct  199   SADAPPFAQFFAYPQYVW-CHSPRDSTTTTTAASASASASASSSSPATVAAALQSEHRSG  257

Query  1054  TADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAK  1233
              ADIEV+L+ETHA+VR++S  R+  QL KM+A  Q + ++VLHLNVTT D LVLY++S K
Sbjct  258   LADIEVSLVETHASVRVMSP-RRPGQLLKMIAGLQALRLTVLHLNVTTLDSLVLYTLSVK  316

Query  1234  VEGGCQLSSADEIAEAVHHILRVI  1305
             VE GC L++ D+IA AVHH+L ++
Sbjct  317   VEEGCSLTTVDDIAAAVHHVLCIV  340



>ref|XP_002454447.1| hypothetical protein SORBIDRAFT_04g031250 [Sorghum bicolor]
 gb|EES07423.1| hypothetical protein SORBIDRAFT_04g031250 [Sorghum bicolor]
Length=349

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 152/241 (63%), Gaps = 19/241 (8%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE ETQR+THIAVERNRR+QMNE+L  LRS+MPE+YVQRGDQASIVGGAIEFVKELE  L
Sbjct  93    EETETQRMTHIAVERNRRRQMNEYLTALRSIMPETYVQRGDQASIVGGAIEFVKELEQQL  152

Query  814   QSLEAEKLRL---QRQQQQSaagddgataatktddgavasvsggvKGRSFTN--------  960
             Q LEA+K +L    R          G+ +       +  + +      S T         
Sbjct  153   QCLEAQKRKLLAAARPDATPMHASSGSGSTRTCCADSATAATTSNCSSSVTEDAAEHAHA  212

Query  961   ---PFWQFFAYPQYTTSCSSSMIPNKCTSKTTA---ATADIEVTLIETHANVRILSSTRK  1122
                PF QFF YPQY   C S+  P     +        AD+EVTL+ETHA+VR++ +TR+
Sbjct  213   PPPPFAQFFTYPQYVW-CHSARNPAAAEGEEDGRRSGVADVEVTLVETHASVRVM-TTRR  270

Query  1123  TRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRV  1302
               QL  +V   Q + ++VLHL+VTT D LVL+SIS KVE GC L++AD+IA AVHH+L +
Sbjct  271   PGQLLSLVTGLQALRLAVLHLSVTTLDALVLHSISVKVEEGCGLATADDIAAAVHHVLCI  330

Query  1303  I  1305
             I
Sbjct  331   I  331



>ref|XP_006829211.1| hypothetical protein AMTR_s00001p00272070 [Amborella trichopoda]
 gb|ERM96627.1| hypothetical protein AMTR_s00001p00272070 [Amborella trichopoda]
Length=389

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 149/236 (63%), Gaps = 35/236 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKN  E E+QR+THIAVERNRRKQMNEHL  LRSLMP S++QRGDQASI+GGAI+FVKEL
Sbjct  178   CKNSREVESQRMTHIAVERNRRKQMNEHLNALRSLMPASFIQRGDQASIIGGAIDFVKEL  237

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSL+A+K   Q ++  S                            S T PF  FF+
Sbjct  238   EQLLQSLQAKKQTRQSEEGYSPT--------------------------SSTVPFNGFFS  271

Query  982   YPQYTTSCSSSMI--------PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
              PQYTT  +   +         N+  ++  +A ADIEVTLI+THAN++IL S R+  QL 
Sbjct  272   SPQYTTYSNFKYMVDGLMDQRGNEFKAENKSAVADIEVTLIQTHANLKIL-SPRRPGQLL  330

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             K +AA + + +++LHLN+TT    VLYS + K+E GC+L SADEIA AVH I   I
Sbjct  331   KTIAALENLELTILHLNITTIQHSVLYSFNLKIEEGCKLGSADEIAAAVHQIFSFI  386



>gb|EAY87138.1| hypothetical protein OsI_08539 [Oryza sativa Indica Group]
Length=373

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 158/264 (60%), Gaps = 38/264 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CK++EE ETQR+THIAVERNRR+QMNE+LA+LRSLMPE YVQRGDQASIVGGAIEFVKEL
Sbjct  79    CKSREETETQRMTHIAVERNRRRQMNEYLAILRSLMPEPYVQRGDQASIVGGAIEFVKEL  138

Query  802   EHLLQSLEAEKLRLQRQQQ------------QSaagddgataatktddgavasvsggvKG  945
             E  LQSLEA+K  L    +              +    G      T     +S       
Sbjct  139   EQQLQSLEAQKRTLLPHHKARCDDATPMHNASGSNVGAGGCMEPTTTTSNCSSSVTEDAP  198

Query  946   RSFTNPFWQFFAYPQYTTSCSS------------------------SMIPNKCTSKTTAA  1053
              +   PF QFFAYPQY   C S                        + +     S+  + 
Sbjct  199   SADAPPFAQFFAYPQYVW-CHSPRDSTTTTTAASASASASASSSSPATVAAALQSEHRSG  257

Query  1054  TADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAK  1233
              ADIEV+L+ETHA+VR++S  R+  QL KM+A  Q + ++VLHLNVTT D LVLY++S K
Sbjct  258   LADIEVSLVETHASVRVMSP-RRPGQLLKMIAGLQALRLTVLHLNVTTLDSLVLYTLSVK  316

Query  1234  VEGGCQLSSADEIAEAVHHILRVI  1305
             VE GC L++ D+IA AVHH+L ++
Sbjct  317   VEEGCSLTTVDDIAAAVHHVLCIV  340



>ref|XP_007136288.1| hypothetical protein PHAVU_009G033800g [Phaseolus vulgaris]
 gb|ESW08282.1| hypothetical protein PHAVU_009G033800g [Phaseolus vulgaris]
Length=305

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 142/227 (63%), Gaps = 39/227 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  112   KNKEEIENQRTTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELE  171

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              +LQS+E EK R Q                                G      F +FF +
Sbjct  172   QVLQSMEGEKRRKQ--------------------------------GEENVGAFAEFFTF  199

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQYTT  +          +   A ADIEVT++++HAN++ILS  ++   L K+V   Q++
Sbjct  200   PQYTTRGTQKQ------EQKEWAVADIEVTMVDSHANLKILSK-KQPSHLMKIVLGLQSL  252

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT   +VLYSIS KVE GC+L++ DEIA AV+ +L  I
Sbjct  253   RLTILHLNVTTLHHMVLYSISVKVEEGCELNTVDEIAAAVNQLLGTI  299



>ref|XP_011100183.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH96-like 
[Sesamum indicum]
Length=286

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 146/227 (64%), Gaps = 37/227 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRR+QMN++LAVLRSLMP SY QRGDQASIVGGAI FVKELE
Sbjct  90    KNQEEMENQRMTHIAVERNRRRQMNDYLAVLRSLMPPSYSQRGDQASIVGGAINFVKELE  149

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ LEA K   Q+                                 + ++ F  FF +
Sbjct  150   QLLQFLEAHKPSNQQH-----------------------------PNAAHSSLFSNFFTF  180

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T   ++       ++  ++ AD+EV ++E+HAN++IL+  R  RQL KMVA FQ++
Sbjct  181   PQYSTXVQAA-------AERLSSVADVEVMMVESHANIKILTKKRP-RQLLKMVAGFQSI  232

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             C+++LHLN+TT D  VLYS S KVE  CQLS+ +EIA  VH I+ +I
Sbjct  233   CLTILHLNITTVDQSVLYSFSVKVEDECQLSTVNEIATTVHDIVGMI  279



>ref|XP_008363563.1| PREDICTED: transcription factor bHLH96-like [Malus domestica]
Length=315

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 153/238 (64%), Gaps = 49/238 (21%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY QRGDQASI+GGAI FVKELE
Sbjct  109   KNKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAQRGDQASIIGGAINFVKELE  168

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS+++ K    R +QQ                                 P  +FF +
Sbjct  169   QLLQSMDSNK----RSKQQ---------------------------------PLAEFFTF  191

Query  985   PQYTTSC-----SSSMIPNKCTS------KTTAATADIEVTLIETHANVRILSSTRKTRQ  1131
             PQ++T       S+ +  N+  +      +  AA ADIEVT++++HAN++ILS  R  RQ
Sbjct  192   PQFSTRATQCNQSAGLQANELNTTQFNNNQWAAAAADIEVTMVDSHANLKILSKKR-PRQ  250

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L KMVA FQ++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ +LR I
Sbjct  251   LLKMVAGFQSLRLSVLHLNVTTADEMVLYSVSVKIEEGCLLNTVDEIAAAVNQMLRSI  308



>ref|XP_006647713.1| PREDICTED: transcription factor bHLH96-like [Oryza brachyantha]
Length=353

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 155/252 (62%), Gaps = 26/252 (10%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CK++EE ETQR+THIAVERNRR+QMNE+LA+LRSLMPE YVQRGDQASIVGGAIEFVKEL
Sbjct  72    CKSREETETQRMTHIAVERNRRRQMNEYLAILRSLMPEPYVQRGDQASIVGGAIEFVKEL  131

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTN-------  960
             E  LQSLEA+K  L    +              ++ G     S      S +        
Sbjct  132   EQQLQSLEAQKRTLLPHHKSKCDDAMPTHNGGGSNAGGGCMESTTTSNCSSSVTEDAQHV  191

Query  961   ---PFWQFFAYPQYTTSCSS--------------SMIPNKCTSKTTAATADIEVTLIETH  1089
                P  QFFAYPQY   C S              S       ++  +  ADIEV+L+ETH
Sbjct  192   DAPPLAQFFAYPQYVW-CHSPRDSAGATAASSSSSSPTAGLQAEHRSGLADIEVSLVETH  250

Query  1090  ANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADE  1269
             A++R++S  R+  QL KM+A  Q + ++VLHLNVTT   LVLYS+S KVE GC L++ D+
Sbjct  251   ASIRVMSP-RRPGQLLKMIAGLQALRLTVLHLNVTTLGSLVLYSLSVKVEEGCNLTTVDD  309

Query  1270  IAEAVHHILRVI  1305
             IA AVHH+L ++
Sbjct  310   IAAAVHHVLCIV  321



>ref|XP_004299687.1| PREDICTED: transcription factor bHLH96-like [Fragaria vesca subsp. 
vesca]
Length=340

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 148/251 (59%), Gaps = 58/251 (23%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE
Sbjct  118   KNKEEMENQRMTHIVVERNRRKQMNEYLAVLRSLMPTSYVQRGDQASIIGGAINFVKELE  177

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS++    R  + +Q                                  P  +FF Y
Sbjct  178   QLLQSMDGSHKRTSKPEQV---------------------------------PLAEFFTY  204

Query  985   PQY----TTSC-------------------SSSMIP-NKCTSKTTAATADIEVTLIETHA  1092
             PQ+    TT C                     SM P +   +      ADIEVT++++HA
Sbjct  205   PQFSTYATTQCIRNSSSSSSSSSGCIQVNDEPSMAPRSNNNNDNQWPAADIEVTMVDSHA  264

Query  1093  NVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEI  1272
             N++ILS  R  RQL KMVA FQ++ ++VLHLNVTT D +VLYS+S K+E GC L++ DEI
Sbjct  265   NLKILSKKR-PRQLLKMVAGFQSLRLTVLHLNVTTVDEMVLYSVSVKMEEGCMLNTVDEI  323

Query  1273  AEAVHHILRVI  1305
             A AV+ +LR I
Sbjct  324   AAAVNEMLRRI  334



>gb|ADL36599.1| BHLH domain class transcription factor [Malus domestica]
Length=310

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 148/236 (63%), Gaps = 49/236 (21%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY  RGDQASIVGGAI FVKELE 
Sbjct  108   NKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAPRGDQASIVGGAINFVKELEQ  167

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             L QS+ + K    R +QQ                                 P   FF +P
Sbjct  168   LFQSMNSNK----RSKQQ---------------------------------PLADFFTFP  190

Query  988   QYTT-----SCSSSMIPN-----KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             Q++T     + S+ +  N     +C +   AA ADIEVT+++ HAN++ILS  R  RQL 
Sbjct  191   QFSTRATQNNNSAGVQANESNTTQCNNNQWAA-ADIEVTMVDNHANLKILSKKRP-RQLL  248

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             KMVA FQ++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ +LR I
Sbjct  249   KMVAGFQSLRLSVLHLNVTTADEMVLYSVSVKIEEGCPLNTVDEIAAAVNQMLRTI  304



>gb|ABR16546.1| unknown [Picea sitchensis]
Length=457

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 151/240 (63%), Gaps = 39/240 (16%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKN EE E+QR+THIAVERNRRKQMNEHL+VLRSLMP SY+QRGDQASI+GGAI+FVKEL
Sbjct  239   CKNSEEVESQRMTHIAVERNRRKQMNEHLSVLRSLMPGSYIQRGDQASIIGGAIDFVKEL  298

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSL+A+K + + ++   +                               PF  FF 
Sbjct  299   EQLLQSLQAQKRKRECEEFGCSPNS--------------------------PTPFNGFFL  332

Query  982   YPQYTT------------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKT  1125
              PQYT+              S +   N+  ++  +A ADIEVT+IETHA+++ILS  R +
Sbjct  333   SPQYTSYSAQWNSRYAVEKTSFNDTGNELIAENKSAVADIEVTMIETHASIKILSQKR-S  391

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              QL K +   Q++ M++LHLN+TT D  VLYS + K+E  CQL+SADEIA AVH I+  I
Sbjct  392   GQLMKTIDKLQSLHMTILHLNITTIDQTVLYSFNVKIEDECQLTSADEIATAVHEIINSI  451



>ref|XP_009619568.1| PREDICTED: transcription factor bHLH96-like isoform X1 [Nicotiana 
tomentosiformis]
Length=303

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 154/233 (66%), Gaps = 37/233 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L VLRSLMP SYVQR DQASI+GGAI FVK+LE
Sbjct  98    KNREELENQRMTHIAVERNRRKQMNEYLTVLRSLMPSSYVQRADQASIIGGAINFVKKLE  157

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP-FWQFFA  981
               LQ+LEA+K     QQQ                                ++P F  FF+
Sbjct  158   QHLQTLEAQKRTSTHQQQHE---------------------------NGISSPLFADFFS  190

Query  982   YPQYTTSCSS--SMIPNKCTSKTTAAT------ADIEVTLIETHANVRILSSTRKTRQLS  1137
             +PQY+T+ S+  +  P   T+ + +A       ADIEV L+E+HAN++ILS  R+ +QL 
Sbjct  191   FPQYSTTHSNHANSSPAAATNSSESAAENRSVMADIEVNLVESHANLKILSK-RRPKQLL  249

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             ++VA  Q + +++LHLNVTT D +VLY++SAKVE GCQL++ +EIA+AV+ +L
Sbjct  250   QIVAGLQCLSLTILHLNVTTVDQMVLYTLSAKVEEGCQLTTVEEIAQAVNQLL  302



>gb|KHG15004.1| Transcription factor bHLH96 -like protein [Gossypium arboreum]
Length=326

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 34/227 (15%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THI VERNRRKQMN++LA LRSLMP SYVQRGDQASI+GGAI+FVKELE 
Sbjct  121   NKEELENQRMTHITVERNRRKQMNQYLAALRSLMPPSYVQRGDQASIIGGAIDFVKELEQ  180

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LL+S+EA K   Q+ Q                               ++++PF +FF +P
Sbjct  181   LLKSMEAHKRTTQQPQHD-----------------------------AYSSPFAEFFTFP  211

Query  988   QYT---TSCSSSMIPNKCTSKTTA-ATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             Q++   T C+S+   +   +  TA + ADIEVT++E+HAN++ILS  ++ RQL K+VA  
Sbjct  212   QFSTRATQCNSNQQQHMAAATATAESVADIEVTMVESHANLKILSK-KQPRQLLKLVAGL  270

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             Q + + V HLNVTT + + LYS+S KVE GC LS+ DEIA AV+ +L
Sbjct  271   QGLRLVVQHLNVTTMNEMALYSVSVKVEEGCHLSTVDEIAAAVNQML  317



>gb|KHN08964.1| Transcription factor bHLH96 [Glycine soja]
Length=200

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 144/217 (66%), Gaps = 23/217 (11%)
 Frame = +1

Query  655   ITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEK  834
             +THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE LLQS+E +K
Sbjct  1     MTHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINFVKELEQLLQSMEGQK  60

Query  835   LRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSS  1014
                Q ++                          G    + T PF +FFA+PQYTT   ++
Sbjct  61    RTNQGKEN--------------------VVGLNGTSTTTTTTPFAEFFAFPQYTTR-GTT  99

Query  1015  MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVT  1194
             M  N    K   A ADIEVT+++ HAN+++LS  ++  Q+ K+V   Q++ +S+LHLNV+
Sbjct  100   MAQNNQEQKQ-WAVADIEVTMVDNHANLKVLSK-KQPGQIMKIVVGLQSLKLSILHLNVS  157

Query  1195  TFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             T D +VLYS+S KVE GC L++ DEIA AV+ +LR I
Sbjct  158   TLDDMVLYSVSVKVEDGCLLNTVDEIAAAVNQLLRTI  194



>ref|XP_009373431.1| PREDICTED: transcription factor bHLH96-like [Pyrus x bretschneideri]
Length=310

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 148/236 (63%), Gaps = 49/236 (21%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY QRGDQASIVGGAI FVKELE 
Sbjct  108   NKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAQRGDQASIVGGAINFVKELEQ  167

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             L QS+ + K    R +QQ                                 P   FF +P
Sbjct  168   LCQSMNSNK----RSKQQ---------------------------------PLADFFTFP  190

Query  988   QYTT-----SCSSSMIPN-----KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             Q++T     + S+ +  N     +C +   AA ADIEVT+++ HAN++ILS  R  RQL 
Sbjct  191   QFSTRATQNNNSAGVQANESNTTQCNNNQWAA-ADIEVTMVDNHANLKILSKKRP-RQLL  248

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             KMVA  Q++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ +LR I
Sbjct  249   KMVAGLQSLRLSVLHLNVTTADEMVLYSVSVKIEEGCPLNTVDEIAAAVNQMLRTI  304



>gb|KFK31444.1| hypothetical protein AALP_AA6G112500 [Arabis alpina]
Length=332

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 150/239 (63%), Gaps = 22/239 (9%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KE
Sbjct  78    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAQKGDQASIVGGAIDFIKE  137

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL+  +      +     +     +    ++               QFF
Sbjct  138   LEHQLLSLEAQKLQNAKLNHTVTSSTSQDSNGEPENPHQPSNSPSLSL--------SQFF  189

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR----------  1128
              +    +  +     N   S    A  D+EVTLIETHAN+RILS  R  R          
Sbjct  190   LHSHDPSQENR----NGSISSVKTAMEDLEVTLIETHANIRILSRRRGFRWTTVATTGPP  245

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLSK+VAA Q++ ++VLHL+VTT D   +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  246   QLSKLVAALQSLSLTVLHLSVTTLDNFAIYSISTKVEENCQLSSVDDIAGAVHHMLSII  304



>ref|XP_008804795.1| PREDICTED: transcription factor bHLH94-like [Phoenix dactylifera]
Length=326

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 145/241 (60%), Gaps = 44/241 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+ HIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  109   KNKEEVESQRMIHIAVERNRRKQMNEYLAVLRSLMPSSYVQRGDQASIIGGAINYVKELE  168

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLE +K   QR                                    +PF  FFA+
Sbjct  169   QLLQSLEVQKRLRQR-----------------------------SDATGLAHPFANFFAF  199

Query  985   PQYTT--------------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRK  1122
             PQY++              + S+  I N+  ++   A ADIEVT++E++AN+++ S  R 
Sbjct  200   PQYSSCSSGGSSNSSSTAHTSSNHSIANEMAAENRPAMADIEVTMVESYANLKVFSR-RW  258

Query  1123  TRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRV  1302
              +QL KMV   Q M ++ LHLN TT D LVLYS S KVE  CQ +S D+IA AV+ +L  
Sbjct  259   PKQLLKMVMGLQNMRLTTLHLNATTVDQLVLYSFSLKVEDDCQFTSVDDIATAVYQMLGR  318

Query  1303  I  1305
             I
Sbjct  319   I  319



>ref|XP_003626318.1| Transcription factor bHLH96 [Medicago truncatula]
Length=303

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 151/240 (63%), Gaps = 36/240 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVK+LE
Sbjct  93    KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKKLE  152

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ      L +Q+Q++                                  PF +FF +
Sbjct  153   QKLQF-----LGVQKQKEGKFDTIVENK----------------------NKPFSEFFTF  185

Query  985   PQYTTS---CSSS--MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+TS   C SS   +  +  S+     ADIEVT++E+HAN++I +  R  +QL KMV+
Sbjct  186   PQYSTSDGVCESSETKMGGEVQSRN---IADIEVTMVESHANLKIRTKKR-PKQLLKMVS  241

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVIeeeeeVTI  1329
             +   +C+++LHLNVTT D  V YS+S KVE  C+L S DEIA A++ IL  I++E  + I
Sbjct  242   SLHGLCLTILHLNVTTADEFVFYSLSVKVEDDCKLGSVDEIAAAIYQILESIQQESSINI  301



>ref|XP_003602850.1| Transcription factor bHLH96 [Medicago truncatula]
 emb|CBX31916.1| basic helix loop helix 1 [Medicago truncatula]
 gb|AES73101.1| basic helix loop helix (BHLH) DNA-binding family protein [Medicago 
truncatula]
Length=321

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 144/236 (61%), Gaps = 36/236 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THI VERNRRKQMNE+L VLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  105   AKNKEEIENQRMTHITVERNRRKQMNEYLNVLRSLMPSSYVQRGDQASIIGGAINFVKEL  164

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E  LQS+  +K                                    G +   PF +FF 
Sbjct  165   EQHLQSMGGQK---------------------------KTKEPNENIGLNNGPPFAEFFT  197

Query  982   YPQYTTSCSS--------SMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             +PQYTTS +         +M  +    +   A ADIEVT++++HAN++ILS  +K  QL 
Sbjct  198   FPQYTTSATQNNNNNNNVTMEQHNYQEQKQWAVADIEVTMVDSHANMKILSK-KKPGQLM  256

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             K+V   Q + +++LHLNVTT D +VLYS+S KVE G QL+S DEIA AV+ +LR +
Sbjct  257   KIVVGLQNLRLTILHLNVTTVDDMVLYSVSIKVEEGSQLNSVDEIAAAVNRLLRTV  312



>emb|CDY04811.1| BnaC05g17780D [Brassica napus]
Length=301

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 151/227 (67%), Gaps = 32/227 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  104   KNKEEIESQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELE  163

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +      +  ++                           S  +PF +FF Y
Sbjct  164   HILQSMEPRRTTTTTHEVDTSTS-------------------------SLMSPFSEFFTY  198

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  SS        ++ +++ A+IEVT+ E HAN++I+S  +K RQL K+V + Q++
Sbjct  199   PQYSTKSSS------SATENSSSPAEIEVTVAEGHANIKIMSK-KKPRQLLKLVDSIQSL  251

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE G QL++ D+IA A++ I+R I
Sbjct  252   RLTLLHLNVTTLDNSILYSISVKVEEGSQLNTVDDIATALNQIIRRI  298



>ref|XP_010415952.1| PREDICTED: transcription factor bHLH96-like isoform X2 [Camelina 
sativa]
Length=321

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 151/234 (65%), Gaps = 39/234 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  114   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAISYLKEL  173

Query  802   EHLLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP  963
             EH LQS+E      AE     R Q ++ A                          S + P
Sbjct  174   EHHLQSIEPPVKTAAEDNETGRDQTKTIAPT------------------------SSSGP  209

Query  964   FWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             F  FFA+PQY++  +S+              A+IEVT++E+HA+++IL+  R  +QL K+
Sbjct  210   FSDFFAFPQYSSQPTSAA--------AAEGMAEIEVTMVESHASLKILAKKR-PKQLLKL  260

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VA+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   VASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  314



>ref|XP_010415951.1| PREDICTED: transcription factor bHLH96-like isoform X1 [Camelina 
sativa]
Length=321

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 151/234 (65%), Gaps = 39/234 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  114   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAISYLKEL  173

Query  802   EHLLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP  963
             EH LQS+E      AE     R Q ++ A                          S + P
Sbjct  174   EHHLQSIEPPVKTAAEDNETGRDQTKTIAPT------------------------SSSGP  209

Query  964   FWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             F  FFA+PQY++  +S+              A+IEVT++E+HA+++IL+  R  +QL K+
Sbjct  210   FSDFFAFPQYSSQPTSAA--------AAEGMAEIEVTMVESHASLKILAKKR-PKQLLKL  260

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VA+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   VASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  314



>gb|KHG17314.1| Transcription factor bHLH96 -like protein [Gossypium arboreum]
 gb|KHG22666.1| Transcription factor bHLH96 -like protein [Gossypium arboreum]
Length=331

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 148/233 (64%), Gaps = 31/233 (13%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNK+E E QR+THIAVERNRRKQMN++L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  114   KNKQEIENQRMTHIAVERNRRKQMNDYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  173

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H LQ L AEK   +R    +                           RS ++ F +FF +
Sbjct  174   HRLQCLSAEKEVKERSNLTNGGR------------------------RSCSSVFDEFFTF  209

Query  985   PQYTTSC------SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+TS        S  + ++ T +T +A ADIEV ++E+H N+RI S  R   QL K+V
Sbjct  210   PQYSTSSKQGDRKDSISMNDQSTVETQSAIADIEVNMVESHVNLRIRSKKRPA-QLLKVV  268

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                  M +S+LHLNVTT D  VLYS+S KVE  C+L+S D+IA AV+ +L  I
Sbjct  269   CGLNCMRLSILHLNVTTLDQTVLYSLSVKVEEDCKLTSVDDIATAVNQLLGSI  321



>ref|XP_004494635.1| PREDICTED: transcription factor bHLH94-like [Cicer arietinum]
Length=317

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 145/236 (61%), Gaps = 46/236 (19%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  112   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  171

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTN---PFWQF  975
               LQ L  EK +                                 K  +  N   PF +F
Sbjct  172   QKLQFLGVEKEK-------------------------------EGKSETVANTKIPFSEF  200

Query  976   FAYPQYTTSCSSSMIPNKCTS------KTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             F +PQY+TS +     N C S      +  ++ ADIEVT++E+HAN++I S  R  +QL 
Sbjct  201   FTFPQYSTSGN-----NNCESSESNMGEVQSSIADIEVTMVESHANLKIRSKKR-PKQLL  254

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             K+V+    MC+++LHLNVTT    VLYS+S KVE  C+L S DEIA A++ +L  I
Sbjct  255   KIVSNLHGMCLTILHLNVTTSAEFVLYSLSVKVEDDCKLGSVDEIAAAIYQMLERI  310



>ref|XP_002302324.2| hypothetical protein POPTR_0002s10230g [Populus trichocarpa]
 gb|EEE81597.2| hypothetical protein POPTR_0002s10230g [Populus trichocarpa]
Length=326

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 140/228 (61%), Gaps = 31/228 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E+QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE 
Sbjct  121   NKEEIESQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELEQ  180

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ++   K   Q+                                      F +FF +P
Sbjct  181   LLQTMGTNKKNKQQPDDNGFPSRL----------------------------FAEFFTFP  212

Query  988   QYTTSCSSSMI--PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S   +        +   A  DIEVT++E+HAN++ILS  R   QL K++   Q 
Sbjct  213   QYSTRASQPSVTADESVADQNQRALGDIEVTMVESHANLKILSKKRPG-QLLKLMVGLQN  271

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +S+LHLNVTT D +VLYS+S KVE GC L++ DEIA AV+H+L  I
Sbjct  272   LRLSILHLNVTTVDQMVLYSVSVKVEEGCHLNTVDEIAAAVNHMLYRI  319



>gb|AES82536.2| transcription factor [Medicago truncatula]
Length=316

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 151/240 (63%), Gaps = 36/240 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVK+LE
Sbjct  106   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKKLE  165

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ      L +Q+Q++                                  PF +FF +
Sbjct  166   QKLQF-----LGVQKQKEGKFDTIVENK----------------------NKPFSEFFTF  198

Query  985   PQYTTS---CSSS--MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+TS   C SS   +  +  S+     ADIEVT++E+HAN++I +  R  +QL KMV+
Sbjct  199   PQYSTSDGVCESSETKMGGEVQSRN---IADIEVTMVESHANLKIRTKKR-PKQLLKMVS  254

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVIeeeeeVTI  1329
             +   +C+++LHLNVTT D  V YS+S KVE  C+L S DEIA A++ IL  I++E  + I
Sbjct  255   SLHGLCLTILHLNVTTADEFVFYSLSVKVEDDCKLGSVDEIAAAIYQILESIQQESSINI  314



>ref|XP_010428088.1| PREDICTED: transcription factor bHLH96 isoform X1 [Camelina sativa]
 ref|XP_010428089.1| PREDICTED: transcription factor bHLH96 isoform X2 [Camelina sativa]
Length=321

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 149/234 (64%), Gaps = 39/234 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  114   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAISYLKEL  173

Query  802   EHLLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP  963
             EH LQS+E      AE     R Q  +                            S + P
Sbjct  174   EHHLQSIEPPVKTAAEDNETGRDQTNTIVAA------------------------SSSGP  209

Query  964   FWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             F  FFA+PQY++  +S+              A+IEVT++E+HA+++IL+  R  +QL K+
Sbjct  210   FSDFFAFPQYSSQPTSAA--------AAEGMAEIEVTMVESHASLKILAKKR-PKQLLKL  260

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VA+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   VASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  314



>ref|XP_010559298.1| PREDICTED: transcription factor bHLH71 [Tarenaya hassleriana]
Length=296

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 196/331 (59%), Gaps = 53/331 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEALS+N+LF+ ++Y+T S TP             AA  P  P  D+           
Sbjct  1     MTLEALSSNDLFSFLLYETLSPTPFS-----------AAAVPNSPENDVIV---------  40

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                   R+  ++GA    P            G RK+RRR+P+ CKN+EEAETQR+THIAV
Sbjct  41    ------RKTTTSGARQEPP--------PASRGIRKRRRRKPRGCKNEEEAETQRMTHIAV  86

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMN+HL+ LRSLMP+SY Q+GDQASIVGGAI+F+KELEH LQSLEA+KL+L + 
Sbjct  87    ERNRRRQMNQHLSDLRSLMPQSYAQKGDQASIVGGAIDFIKELEHKLQSLEAQKLQLYQS  146

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
              +                  + ++     +  + T    QFF +  Y  S  +    N  
Sbjct  147   NR--------------GFPSSSSTSQDSGEAENHTQSLSQFFLH-SYDPSQENK---NGS  188

Query  1033  TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLV  1212
              S   AA AD+EVTLIETHAN+RIL   R T  LSK+VAA  ++ +SVLHL++TT     
Sbjct  189   RSFVRAAMADVEVTLIETHANIRILCRRRGT-MLSKLVAALHSLSLSVLHLSLTTTLTCA  247

Query  1213  LYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  248   VYSISTKVEESCQLSSGDDIAAAVHHMLSII  278



>ref|XP_010414846.1| PREDICTED: transcription factor bHLH96-like [Camelina sativa]
Length=321

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 149/234 (64%), Gaps = 39/234 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  114   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAITYLKEL  173

Query  802   EHLLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP  963
             EH LQS+E      AE     R Q  +                            S + P
Sbjct  174   EHHLQSIEPPVKTAAENNETGRDQTNTIVAA------------------------SSSGP  209

Query  964   FWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             F  FFA+PQY++  +S+              A+IEVT++E+HA+++IL+  R  +QL K+
Sbjct  210   FSDFFAFPQYSSQPTSAA--------AAEGMAEIEVTMVESHASLKILAKKR-PKQLLKL  260

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VA+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   VASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  314



>ref|XP_011023550.1| PREDICTED: transcription factor bHLH94-like [Populus euphratica]
Length=342

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 148/232 (64%), Gaps = 39/232 (17%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE  L
Sbjct  134   EEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEQKL  193

Query  814   QSLEA-----EKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             Q L A     EK     QQ  S+                               PF +FF
Sbjct  194   QVLGACKEMKEKPNGDDQQHVSSL------------------------------PFSKFF  223

Query  979   AYPQYTTS---CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
              +PQYTTS   C SS   ++   K+ +  ADIEVT++E+HAN++I  S R+ +QL K+V+
Sbjct  224   IFPQYTTSSIHCESSAGKDEKLMKSQSDIADIEVTMVESHANLKI-RSKRRPKQLLKVVS  282

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             A  +M +SVLHLNV+T   +VLYS+S KVE  C+LSS DEIA AV+ +L  I
Sbjct  283   ALHSMRLSVLHLNVSTVGQIVLYSLSVKVEDDCKLSSVDEIATAVYQMLGRI  334



>emb|CDX68274.1| BnaA07g23140D [Brassica napus]
Length=324

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 26/226 (12%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQAS+VGGAI ++KELEH
Sbjct  118   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASVVGGAINYLKELEH  177

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQS++                    +       G  A         S + PF  FFA+P
Sbjct  178   HLQSMDP-----------------TVSTPATKQAGDGAGDQMNTIAASSSGPFSDFFAFP  220

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QY+   SSS +           TA+IEVT++E+HANV+IL+  R  +QL K+VA+ Q++ 
Sbjct  221   QYSRRPSSSSV--------AEGTAEIEVTMVESHANVKILAKKR-PKQLLKLVASIQSLR  271

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++VLHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  272   LTVLHLNVTTRDDSVLYSISLKVEEGSQLNTVEDIAAAVNQILRRI  317



>ref|XP_002893233.1| hypothetical protein ARALYDRAFT_335492 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69492.1| hypothetical protein ARALYDRAFT_335492 [Arabidopsis lyrata subsp. 
lyrata]
Length=312

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 149/228 (65%), Gaps = 27/228 (12%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKEL
Sbjct  104   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKEL  163

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH+LQS+  ++ R                    T               S   PF  FF+
Sbjct  164   EHILQSMGPKRTR--------------------TTSTTHDPEGANTSTSSLVGPFSDFFS  203

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY+T  SS         +++++ A+IEVT+ E+HAN++IL   +K RQL K++A+ Q+
Sbjct  204   FPQYSTKSSSE------VPESSSSPAEIEVTVAESHANIKILVK-KKPRQLLKLIASLQS  256

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +++LHLNVTT    +LYSIS KVE G QL++ D+IA A++H +R I
Sbjct  257   LRLTLLHLNVTTLHNSILYSISVKVEEGSQLNTVDDIATALNHTIRRI  304



>ref|XP_011016877.1| PREDICTED: transcription factor bHLH94 [Populus euphratica]
Length=325

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 139/228 (61%), Gaps = 31/228 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE 
Sbjct  120   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELEQ  179

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ++   K   Q+                                      F +FF +P
Sbjct  180   LLQTMGTNKKNKQQPDDNGFPSRL----------------------------FAEFFTFP  211

Query  988   QYTTSCSSSMI--PNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             QY+T  S   +        +   A  DIEVT++E+HAN++ILS  R   QL K++   Q 
Sbjct  212   QYSTRASQPSVTADESVADQNQRALGDIEVTMVESHANLKILSKKRPG-QLLKLMVGLQN  270

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +S+LHLNVTT D ++LYS+S KVE GC L++ DEIA AV+H+L  I
Sbjct  271   LRLSILHLNVTTVDQMILYSVSVKVEEGCHLNTVDEIAAAVNHMLYRI  318



>ref|XP_007147072.1| hypothetical protein PHAVU_006G093900g [Phaseolus vulgaris]
 gb|ESW19066.1| hypothetical protein PHAVU_006G093900g [Phaseolus vulgaris]
Length=321

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 148/231 (64%), Gaps = 39/231 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  123   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  182

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L A+K +                                 +G+    PF +FF++
Sbjct  183   QRLQFLGAQKEK---------------------------------EGKPDV-PFSEFFSF  208

Query  985   PQYTTS----CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+TS    C +S   ++   +  +  ADIEVT++E+HAN++I S  R  +QL K+V++
Sbjct  209   PQYSTSASGGCDNSAAMSEQKGEVQSGIADIEVTMVESHANLKIRSKKR-PKQLLKIVSS  267

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                M +++LHLNVTT   +VLYS+S KVE  C+L S DEIA AV+ +L  I
Sbjct  268   LHGMRLTILHLNVTTTKEIVLYSLSVKVEEDCKLGSVDEIAAAVYQMLNRI  318



>ref|XP_009104863.1| PREDICTED: transcription factor bHLH96-like [Brassica rapa]
Length=324

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 26/226 (12%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQAS+VGGAI ++KELEH
Sbjct  118   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASVVGGAINYLKELEH  177

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQS++                    +       G  A         S + PF  FFA+P
Sbjct  178   HLQSMDP-----------------TVSTPATKQAGDGAGDQMNTIAASSSGPFSDFFAFP  220

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QY+   SSS +           TA+IEVT++E+HANV+IL+  R  +QL K+VA+ Q++ 
Sbjct  221   QYSRRPSSSSV--------AEGTAEIEVTMVESHANVKILAKKR-PKQLLKLVASIQSLR  271

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++VLHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  272   LTVLHLNVTTRDDSVLYSISLKVEEGSQLNTVEDIAVAVNQILRRI  317



>ref|XP_010098698.1| hypothetical protein L484_026077 [Morus notabilis]
 gb|EXB75601.1| hypothetical protein L484_026077 [Morus notabilis]
Length=366

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 152/240 (63%), Gaps = 34/240 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASIVGGAI FVKELE 
Sbjct  140   NKEELENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIVGGAINFVKELEQ  199

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQS+E++  R ++Q +         ++ + +                      +FF +P
Sbjct  200   FLQSMESQHKRAKKQDKDEDGFSSPVSSPSSSPLA-------------------EFFTFP  240

Query  988   QYTT--SCSSSMIPNKCTSKTTA------------ATADIEVTLIETHANVRILSSTRKT  1125
             QY+T  +  ++   N+ +S                A ADIEVT++++HAN++ILS  R  
Sbjct  241   QYSTRATAQNASTENRDSSVNNNNNNNNNNNSNRWAAADIEVTMVDSHANLKILSKKRP-  299

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             R L KMVA+ Q +  S+LHLNVTT D +VLYS+S K+E GCQL++ DEIA AV+ +L  I
Sbjct  300   RLLLKMVASLQALHFSILHLNVTTVDQMVLYSVSVKIEEGCQLNTVDEIAAAVNQMLGRI  359



>ref|XP_003554664.1| PREDICTED: transcription factor bHLH96-like [Glycine max]
 gb|KHN43269.1| Transcription factor bHLH96 [Glycine soja]
Length=322

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 148/233 (64%), Gaps = 43/233 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  120   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  179

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L  +K + ++                                     PF +FF++
Sbjct  180   QRLQFLGGQKEKEEKSDV----------------------------------PFSEFFSF  205

Query  985   PQYTTSC------SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+TS       S++M   KC +++    ADIEVT++E+HAN++I S  R  +QL K+V
Sbjct  206   PQYSTSAGGGCDNSTAMSEQKCEAQS--GIADIEVTMVESHANLKIRSKKR-PKQLLKIV  262

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++   M +++LHLNVTT   +VLYS+S KVE  C+L S DEIA AV+ +L  I
Sbjct  263   SSLHGMRLTILHLNVTTTGEIVLYSLSVKVEEDCKLGSVDEIAAAVYQMLDRI  315



>emb|CDY50447.1| BnaC06g24170D [Brassica napus]
Length=324

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 146/226 (65%), Gaps = 26/226 (12%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQAS+VGGAI ++KELEH
Sbjct  118   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASVVGGAINYLKELEH  177

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQS++                          + G  A         S + PF  FFA+P
Sbjct  178   HLQSMDP-----------------TVNTPATKEAGDGAGDLMNTIAASSSGPFSDFFAFP  220

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QY+   SSS +           TA+IEVT++E+HANV+IL+  R  +QL K+VA+ Q++ 
Sbjct  221   QYSRRPSSSSV--------AEGTAEIEVTMVESHANVKILAKKR-PKQLLKLVASIQSLR  271

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++VLHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  272   LTVLHLNVTTRDDSVLYSISLKVEEGSQLNTVEDIAAAVNQILRRI  317



>ref|XP_006471948.1| PREDICTED: transcription factor bHLH96-like [Citrus sinensis]
 gb|KDO59549.1| hypothetical protein CISIN_1g036531mg [Citrus sinensis]
Length=317

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 32/224 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L+VLRSLMP+SYVQRGDQASI+GGAI FVKELE
Sbjct  116   KNQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYVQRGDQASIIGGAINFVKELE  175

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQSL A K                                      S +  F +FFA+
Sbjct  176   QRLQSLGARK-------------------------------EIKENSESGSTLFAEFFAF  204

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+TS S S      +++T  + ADIEV ++E+HAN++I  S R+ +QL K+V+  Q+M
Sbjct  205   PQYSTSSSRSESEAIMSNETQNSIADIEVNMVESHANLKI-RSKRRPKQLLKLVSGLQSM  263

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              +++LH NVTT D +VLYS+S KVE  C L+S D+IA AV+ +L
Sbjct  264   RLTILHFNVTTADEIVLYSLSVKVEDDCNLTSGDDIATAVYQLL  307



>gb|ABD32380.2| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=315

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 145/229 (63%), Gaps = 36/229 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVK+LE
Sbjct  93    KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKKLE  152

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ      L +Q+Q++                                  PF +FF +
Sbjct  153   QKLQF-----LGVQKQKEGKFDTIVENK----------------------NKPFSEFFTF  185

Query  985   PQYTTS---CSSS--MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+TS   C SS   +  +  S+     ADIEVT++E+HAN++I +  R  +QL KMV+
Sbjct  186   PQYSTSDGVCESSETKMGGEVQSRN---IADIEVTMVESHANLKIRTKKR-PKQLLKMVS  241

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             +   +C+++LHLNVTT D  V YS+S KVE  C+L S DEIA A++ IL
Sbjct  242   SLHGLCLTILHLNVTTADEFVFYSLSVKVEDDCKLGSVDEIAAAIYQIL  290



>ref|XP_008776945.1| PREDICTED: transcription factor bHLH94-like [Phoenix dactylifera]
Length=341

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 150/239 (63%), Gaps = 47/239 (20%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR++HIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE 
Sbjct  130   NKEEVEYQRMSHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINYVKELEQ  189

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQSLEA+K RL                                K RS T PF  FF +P
Sbjct  190   LLQSLEAQK-RL--------------------------------KQRSDTAPFADFFTFP  216

Query  988   QY-------------TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR  1128
             QY             T + +++   +K  ++  +A ADIEVT++E+HAN+++LS  R+ +
Sbjct  217   QYSSCSSCSTNSTATTAAATATNNTSKVMAENQSAVADIEVTMVESHANLKVLSR-RRPK  275

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QL K+V   Q + ++ LHLNVTT D +VL+S S KVE  CQ +S DEIA AV+ ++  I
Sbjct  276   QLLKLVVGLQNLQLTTLHLNVTTMDQMVLFSFSLKVEDDCQYTSVDEIATAVYQMVGKI  334



>ref|XP_006302555.1| hypothetical protein CARUB_v10020657mg [Capsella rubella]
 gb|EOA35453.1| hypothetical protein CARUB_v10020657mg [Capsella rubella]
Length=322

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 149/233 (64%), Gaps = 41/233 (18%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KELEH
Sbjct  115   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAISYLKELEH  174

Query  808   LLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFW  969
              LQS+E      AE     R Q  + A                          S + PF 
Sbjct  175   HLQSIEPPVKTAAEDTEAGRDQTDTVAAA------------------------SSSGPFS  210

Query  970   QFFAYPQYTTSCSSSMIPNKCTSKTTA-ATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
              FFA+PQY+         N+ TS   A   A+IEVT++E+HA+++IL+  R  RQL K+V
Sbjct  211   DFFAFPQYS---------NQPTSAAAAEGMAEIEVTMVESHASLKILAKKR-PRQLLKLV  260

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             A+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   ASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  313



>ref|XP_009123119.1| PREDICTED: transcription factor bHLH94-like [Brassica rapa]
Length=301

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 32/227 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  104   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELE  163

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +      +  ++                           S  +PF +FF Y
Sbjct  164   HILQSMEPRRTTTTTHEVDTSTS-------------------------SLMSPFSEFFTY  198

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  SSS       ++ +++ A+IEVT+ E HAN++I+S  +K RQL K+V + Q++
Sbjct  199   PQYSTKSSSS------ATENSSSPAEIEVTVAEGHANIKIMSK-KKPRQLLKLVDSIQSL  251

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE   QL++ D+IA A++ I+R I
Sbjct  252   RLTLLHLNVTTLDDSILYSISVKVEEESQLNTVDDIATALNQIIRRI  298



>emb|CDY21365.1| BnaA09g30620D [Brassica napus]
Length=301

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 32/227 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  104   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELE  163

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +      +  ++                           S  +PF +FF Y
Sbjct  164   HILQSMEPRRTTTTTHEVDTSTS-------------------------SLMSPFSEFFTY  198

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  SSS       ++ +++ A+IEVT+ E HAN++I+S  +K RQL K+V + Q++
Sbjct  199   PQYSTKSSSS------ATENSSSPAEIEVTVAEGHANIKIMSK-KKPRQLLKLVDSIQSL  251

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE   QL++ D+IA A++ I+R I
Sbjct  252   RLTLLHLNVTTLDDSILYSISVKVEEESQLNTVDDIATALNQIIRRI  298



>ref|XP_004250124.1| PREDICTED: transcription factor bHLH96-like [Solanum lycopersicum]
Length=298

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 147/231 (64%), Gaps = 34/231 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE   QR+THIAVERNRR+QMN++LAVLRSLMP SY QRGDQASIVGGAI FVKELE
Sbjct  91    KNEEEIHNQRMTHIAVERNRRRQMNDYLAVLRSLMPPSYAQRGDQASIVGGAINFVKELE  150

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ LEA K  +   QQ                                   F +FF +
Sbjct  151   QLLQFLEAHKQVITTNQQHIQYSS-----------------------------FSKFFTF  181

Query  985   PQYTTSCS----SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+T  +    ++   N+ + +  +A ADIEVT++E+HANV++LS  R+ +QL K+V  
Sbjct  182   PQYSTGNNNHPLAATTSNEGSEERRSAVADIEVTMVESHANVKVLSR-RRPKQLLKIVNW  240

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              Q MC+++LHL+VTT D +VLY+ S KVE  C+L++  EIA AVH ++ +I
Sbjct  241   LQAMCLTILHLSVTTADHMVLYTFSVKVEENCELNTVSEIASAVHEMVAMI  291



>emb|CDP01524.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 148/232 (64%), Gaps = 36/232 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRR+QMN++LAVLRS+MP SY QRGDQASIVGGAI FVKELE
Sbjct  90    KNKEEMENQRMTHIAVERNRRRQMNDYLAVLRSMMPPSYAQRGDQASIVGGAINFVKELE  149

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQ L++ K   Q +QQ S                              +N F  FF +
Sbjct  150   QLLQFLQSHK---QVKQQSSTIH---------------------------SNLFDNFFTF  179

Query  985   PQYTT-----SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+T     +  +SM  +   ++  +  AD+EVT+ E HAN+++L+  R+ +QL  ++ 
Sbjct  180   PQYSTCPSRQNMDNSMAADDAMAEKHSTIADVEVTMAENHANIKLLTR-RRPKQLLTIIT  238

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              F ++ +++LHLN+TT D LVLYS S KVE  CQL+S +EIA AVH ++ +I
Sbjct  239   GFHSLSLAILHLNITTRDHLVLYSFSVKVEDDCQLTSVNEIATAVHDLVGMI  290



>ref|NP_001140356.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83660.1| unknown [Zea mays]
 gb|AFW72884.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04380.1| bHLH transcription factor, partial [Zea mays]
Length=344

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 158/245 (64%), Gaps = 22/245 (9%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE ETQR+THIAVERNRR+QMNE+LA LRS+MPE+YVQRGDQASIVGGAIEFVKELE  +
Sbjct  83    EETETQRMTHIAVERNRRRQMNEYLAALRSIMPEAYVQRGDQASIVGGAIEFVKELEQQV  142

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsgg----------vKGRSFTN-  960
             Q LEA+K +L   Q+ +AA    AT    +  GA A  +              G +  + 
Sbjct  143   QCLEAQKRKLLVHQRVAAAKPADATPMRASSSGARACCADSAAAAATTSNCSSGLTTEDA  202

Query  961   ---------PFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSS  1113
                      PF QFF YPQY    S++  P +      +  AD+EVTL+ETHA+VR++++
Sbjct  203   AADHALPPPPFAQFFTYPQYVWCHSAARDPAEEEDGRRSGVADVEVTLVETHASVRVMTA  262

Query  1114  TRKTRQLSKMVAAFQTMCMSVLHLNVTT-FDLLVLYSISAKVEGGCQLSSADEIAEAVHH  1290
              R+  QL  +V   Q + ++VLHL+V T  D LVLY+ S KVE GC L++AD+IA AVHH
Sbjct  263   -RRPGQLLSLVTGLQALRLAVLHLSVVTALDALVLYTTSVKVEEGCGLATADDIAAAVHH  321

Query  1291  ILRVI  1305
             +L +I
Sbjct  322   VLCII  326



>ref|XP_003561963.1| PREDICTED: transcription factor bHLH94-like [Brachypodium distachyon]
Length=355

 Score =   206 bits (524),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 144/236 (61%), Gaps = 36/236 (15%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KNKEE E QR THIAVERNRR+QMN++LA LRSLMP SY QRGDQASIVGGAI +VKE
Sbjct  133   VVKNKEEVECQRRTHIAVERNRRRQMNDYLAGLRSLMPPSYAQRGDQASIVGGAINYVKE  192

Query  799   LEHLLQSLEAEK-LRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQF  975
             LE LLQSLE +K +R  R   +S                          GRS   PF  F
Sbjct  193   LEQLLQSLEVQKSVRSSRDGSRS----------------------TDPGGRS---PFAGF  227

Query  976   FAYPQYTT-------SCSSSMIPNKCTS--KTTAATADIEVTLIETHANVRILSSTRKTR  1128
             F +PQY+T       S  SS + N C +  K  A  ADIEVT+ E HA++++L   R  R
Sbjct  228   FTFPQYSTIASSAHCSPDSSGVSNACHNVVKPEAGVADIEVTMAEGHASLKVL-VRRLPR  286

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             QL K+VA  Q + +  LHLNVTT D + LYS S KVE G +L S ++IA AVH IL
Sbjct  287   QLLKLVAGLQQLRVPALHLNVTTLDTMALYSFSLKVEDGSKLGSVEDIAAAVHEIL  342



>ref|NP_564171.1| transcription factor bHLH94 [Arabidopsis thaliana]
 sp|Q9SK91.2|BH094_ARATH RecName: Full=Transcription factor bHLH94; AltName: Full=Basic 
helix-loop-helix protein 94; Short=AtbHLH94; Short=bHLH 94; 
AltName: Full=Transcription factor EN 16; AltName: Full=bHLH 
transcription factor bHLH094 [Arabidopsis thaliana]
 gb|AEE30247.1| transcription factor bHLH94 [Arabidopsis thaliana]
Length=304

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 150/228 (66%), Gaps = 31/228 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKEL
Sbjct  104   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKEL  163

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH+LQS+E ++ R    +    +                          S   PF  FF+
Sbjct  164   EHILQSMEPKRTRTHDPKGDKTSTS------------------------SLVGPFTDFFS  199

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY+T  SS         +++++ A+IEVT+ E+HAN++I++  +K RQL K++ + Q+
Sbjct  200   FPQYSTKSSSD------VPESSSSPAEIEVTVAESHANIKIMTK-KKPRQLLKLITSLQS  252

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +++LHLNVTT    +LYSIS +VE G QL++ D+IA A++  +R I
Sbjct  253   LRLTLLHLNVTTLHNSILYSISVRVEEGSQLNTVDDIATALNQTIRRI  300



>ref|XP_007141222.1| hypothetical protein PHAVU_008G177500g [Phaseolus vulgaris]
 gb|ESW13216.1| hypothetical protein PHAVU_008G177500g [Phaseolus vulgaris]
Length=316

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 144/225 (64%), Gaps = 34/225 (15%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI FVKELE 
Sbjct  112   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINFVKELEQ  171

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ L+ +    QR ++                            G   ++PF +FF +P
Sbjct  172   LLQCLKGQ----QRTKENV--------------------------GGFDSSPFAEFFMFP  201

Query  988   QYTTSCS--SSMIPNKCTSKT-TAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY+T  +  S   P+ C ++  + A ADIEVTL++ HAN++IL+  +    L KMV   Q
Sbjct  202   QYSTRATQNSRGYPSTCEARNHSWAVADIEVTLVDGHANIKILTK-KLPGLLLKMVVGLQ  260

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHI  1293
             T+  ++LHLNVTT D +VL S+S K+E GC+  + DEIA AVH +
Sbjct  261   TLAFTILHLNVTTVDDMVLTSVSVKIEEGCEAKTVDEIAGAVHEL  305



>gb|ADL36598.1| BHLH domain class transcription factor [Malus domestica]
Length=314

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 149/233 (64%), Gaps = 49/233 (21%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+LAVLRSLMP+SY QRGDQASI+GGAI FVKELE
Sbjct  109   KNKEEIENQRMTHIVVERNRRKQMNEYLAVLRSLMPQSYAQRGDQASIIGGAINFVKELE  168

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQS+++ K    R +QQ                                 P  +FF +
Sbjct  169   QLLQSMDSNK----RSKQQ---------------------------------PLAEFFTF  191

Query  985   PQYTTSC-----SSSMIPNKCTS------KTTAATADIEVTLIETHANVRILSSTRKTRQ  1131
             PQ++T       S+ +  N+  +      +  AA ADIEVT++++HAN++ILS  R  RQ
Sbjct  192   PQFSTRATQCNQSAGLQANELNTTQFNNNQWAAAAADIEVTMVDSHANLKILSKKR-PRQ  250

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHH  1290
             L KMVA FQ++ +SVLHLNVTT D +VLYS+S K+E GC L++ DEIA AV+ 
Sbjct  251   LLKMVAGFQSLRLSVLHLNVTTADEMVLYSVSVKIEEGCLLNTVDEIAAAVNQ  303



>ref|XP_006304982.1| hypothetical protein CARUB_v10011476mg [Capsella rubella]
 gb|EOA37880.1| hypothetical protein CARUB_v10011476mg [Capsella rubella]
Length=313

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 153/228 (67%), Gaps = 28/228 (12%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKEL
Sbjct  109   SKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKEL  168

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH+LQS+  ++                 +                    S  +PF  FF+
Sbjct  169   EHILQSMGTKRTTTTSTTHDVEGATTSTS--------------------SLVSPFSDFFS  208

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQ++T   SS +P    +++++++ADIEVT+ ETHAN++I++  +K RQL K+VA+ Q+
Sbjct  209   FPQFST--KSSEVP----AESSSSSADIEVTVAETHANIKIMAK-KKPRQLIKLVASLQS  261

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHH-ILRV  1302
             + +++LHLNVTT    +LYSIS KVE G QL++ D+IA A++  I+R+
Sbjct  262   LKLTLLHLNVTTHHNSILYSISVKVEEGSQLNTVDDIATALNQTIMRI  309



>gb|AAM65775.1| unknown [Arabidopsis thaliana]
Length=308

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 150/228 (66%), Gaps = 31/228 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKEL
Sbjct  104   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKEL  163

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH+LQS+E ++ R    +    +                          S   PF  FF+
Sbjct  164   EHILQSMEPKRTRTHDPKGDKTSTI------------------------SLVGPFTDFFS  199

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY+T  SS         +++++ A+IEVT+ E+HAN++I++  +K RQL K++ + Q+
Sbjct  200   FPQYSTKSSSD------VPESSSSPAEIEVTVAESHANIKIMTK-KKPRQLLKLITSLQS  252

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +++LHLNVTT    +LYSIS +VE G QL++ D+IA A++  +R I
Sbjct  253   LRLTLLHLNVTTLHNSILYSISVRVEEGSQLNTVDDIATALNQTIRRI  300



>gb|KHN04014.1| Transcription factor bHLH96 [Glycine soja]
Length=319

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 149/233 (64%), Gaps = 43/233 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  117   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  176

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L A+K     ++ +S                                 F +FF++
Sbjct  177   QRLQFLGAQK----EKEAKSDVL------------------------------FSEFFSF  202

Query  985   PQYTTSC------SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+TS       S++M   KC +++    ADIEVT++E+HAN++I S  R  +QL K+V
Sbjct  203   PQYSTSASGGCDNSTAMSEQKCEAQS--GIADIEVTMVESHANLKIRSKKR-PKQLLKIV  259

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++   M +++LHLNVTT   +VLYS+S KVE  C+L S DEIA AV+ IL  I
Sbjct  260   SSLHGMRLTILHLNVTTTGEIVLYSLSVKVEEDCKLGSVDEIAAAVYQILDRI  312



>ref|XP_010471241.1| PREDICTED: transcription factor bHLH96-like isoform X1 [Camelina 
sativa]
Length=321

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 148/234 (63%), Gaps = 39/234 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  114   CKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAISYLKEL  173

Query  802   EHLLQSLE------AEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNP  963
             EH LQS+E      AE     R Q  +                            S + P
Sbjct  174   EHHLQSIEPPVKTAAEDNETGRDQTNTIV------------------------APSSSGP  209

Query  964   FWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             F  FFA+P Y++  +S+              A+IEVT++E+HA+++IL+  R  +QL K+
Sbjct  210   FSDFFAFPLYSSQPTSAA--------AAEGMAEIEVTMVESHASLKILAKKR-PKQLLKL  260

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VA+ Q++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  261   VASIQSLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  314



>ref|XP_010939706.1| PREDICTED: transcription factor bHLH94-like [Elaeis guineensis]
Length=327

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 148/243 (61%), Gaps = 51/243 (21%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+ +RSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  113   KNKEEVENQRMTHIAVERNRRKQMNEYLSSIRSLMPPSYVQRGDQASIIGGAINYVKELE  172

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLE +K RL                                K RS T PF  FF +
Sbjct  173   QLLQSLEVQK-RL--------------------------------KQRSDTVPFADFFTF  199

Query  985   PQYTTSCSS----------------SMIPNKCTSKTTAATADIEVTLIETHANVRILSST  1116
             PQY +SCSS                +    +  ++  +A ADIEV ++++HAN+++LS  
Sbjct  200   PQY-SSCSSQSANGAATTTTAAAAINTNATEIMAENRSAIADIEVMMVDSHANLKVLSR-  257

Query  1117  RKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             R+ +QL K+V   Q + ++ LHLNVTT D +VLYS S KVE  CQ +S DEIA AV+ ++
Sbjct  258   RRPKQLLKLVVGLQNLQLTTLHLNVTTMDEMVLYSFSLKVEDDCQYTSVDEIATAVYQMV  317

Query  1297  RVI  1305
               I
Sbjct  318   GKI  320



>gb|ACN21653.1| putative basic helix-loop-helix protein BHLH26 [Lotus japonicus]
Length=306

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 144/229 (63%), Gaps = 31/229 (14%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESY+QRGDQASI+GGAI FV+ELE 
Sbjct  99    NKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYIQRGDQASIIGGAINFVRELEQ  158

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQ L A+K    + + ++A                               PF +FF++P
Sbjct  159   RLQFLGAKKESEGKSENEAATASM---------------------------PFSEFFSFP  191

Query  988   QYTTS---CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY+TS   C  S    +      +  ADIEVT++E+HAN++I  S ++ +QL KMV    
Sbjct  192   QYSTSASGCDDSAAIGEHVGGVQSGIADIEVTMVESHANLKI-RSKKRPKQLLKMVTGLH  250

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             TM +++LH+NVTT   +VLY +S KVE  C+L S D+IA AV+ +L  I
Sbjct  251   TMRLTILHMNVTTTGEIVLYCLSVKVEEDCKLGSVDDIAAAVYQMLDRI  299



>ref|XP_009400115.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 143/225 (64%), Gaps = 41/225 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             K++EE E QR+THIAVERNRRKQMNE+LAVLRSLMP S+ QRGDQAS V GAI FV+ELE
Sbjct  93    KSEEEVENQRMTHIAVERNRRKQMNEYLAVLRSLMPASHSQRGDQASTVEGAINFVRELE  152

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              L+ SLEA K                                  VK RS  +PF  FF +
Sbjct  153   QLVHSLEARK---------------------------------RVKQRSKASPFSAFFTF  179

Query  985   PQYTTSCSSSMIPNKCT-SKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             PQY+++ S       CT ++++ A AD+EV +IE+HANV+I S  R+  QL K+V   Q+
Sbjct  180   PQYSSASS------PCTNTESSGAAADVEVIVIESHANVKIFSR-RRAGQLLKLVGGMQS  232

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + ++ LHLNVT  D +VLY +S KVE GCQL+S DEIA A+H IL
Sbjct  233   LRLTALHLNVTAVDEMVLYCLSVKVEDGCQLTSVDEIATAIHGIL  277



>ref|XP_010942629.1| PREDICTED: transcription factor bHLH96-like [Elaeis guineensis]
Length=335

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 149/241 (62%), Gaps = 48/241 (20%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR++HI VERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKELE
Sbjct  123   KNKEEVEYQRMSHITVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGAINYVKELE  182

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA+K RL++                                RS   PF  FF +
Sbjct  183   QLLQSLEAQK-RLKQ--------------------------------RSDAAPFADFFTF  209

Query  985   PQYTTSCSSSMIP--------------NKCTSKTTAATADIEVTLIETHANVRILSSTRK  1122
             PQY++S S S                  +  ++   A ADIEVT++E+HAN+++LS  R+
Sbjct  210   PQYSSSSSCSTHSTAITSAATATNNNIREAMAENWPAVADIEVTMVESHANLKVLSR-RR  268

Query  1123  TRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRV  1302
              +QL K+V   Q++ ++ LHLNVTT D +VLYS S KVE  C+ +S DEIA AV+ +L  
Sbjct  269   PKQLLKLVVGLQSLQLTTLHLNVTTMDQMVLYSFSLKVEDDCRYTSVDEIATAVYQMLGT  328

Query  1303  I  1305
             I
Sbjct  329   I  329



>ref|XP_006827950.1| hypothetical protein AMTR_s00008p00198780 [Amborella trichopoda]
 gb|ERM95366.1| hypothetical protein AMTR_s00008p00198780 [Amborella trichopoda]
Length=257

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 142/228 (62%), Gaps = 51/228 (22%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE E QR+THIA+ERNRRKQMNE+L+VLRSLMPESY+Q+GDQASIVGGAI+FVKEL
Sbjct  68    CKNKEEVENQRMTHIAIERNRRKQMNEYLSVLRSLMPESYIQKGDQASIVGGAIDFVKEL  127

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E L+Q+LEA+K   +R                                R    PF   FA
Sbjct  128   EQLVQTLEAQKRIKER--------------------------------RECPRPFGDLFA  155

Query  982   ---YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
                +PQ +  C               A  D+EVT+ ++HA +++LS  R+ RQL K+VAA
Sbjct  156   LPRHPQPSLEC---------------AFGDVEVTMADSHATLKVLSR-RRPRQLLKLVAA  199

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             F  + +++LHLN+TT D +VLYS S KVE  C+++S DEIA AV+ IL
Sbjct  200   FHNLRLTILHLNITTVDQMVLYSFSVKVEEECRITSVDEIASAVYEIL  247



>ref|XP_006577251.1| PREDICTED: transcription factor bHLH96-like isoform X1 [Glycine 
max]
Length=343

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 148/231 (64%), Gaps = 39/231 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  141   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  200

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L A+K     ++ +S                                 F +FF++
Sbjct  201   QRLQFLGAQK----EKEAKSDVL------------------------------FSEFFSF  226

Query  985   PQYTTS----CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+TS    C +S   ++  S+  +  ADIEVT++E+HAN++I S  R  +QL K+V++
Sbjct  227   PQYSTSASGGCDNSTAMSEQKSEAQSGIADIEVTMVESHANLKIRSKKR-PKQLLKIVSS  285

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                M +++LHLNVTT   +VLYS+S KVE  C+L S DEIA AV+ IL  I
Sbjct  286   LHGMRLTILHLNVTTTGEIVLYSLSVKVEEDCKLGSVDEIAAAVYQILDRI  336



>ref|XP_007144754.1| hypothetical protein PHAVU_007G181900g [Phaseolus vulgaris]
 gb|ESW16748.1| hypothetical protein PHAVU_007G181900g [Phaseolus vulgaris]
Length=337

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 33/231 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMP+SY+QRGDQASI+GGAI FVKELE
Sbjct  129   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYIQRGDQASIIGGAINFVKELE  188

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               L  L ++K                                    G +   PF +FFA+
Sbjct  189   QRLHFLGSQK----------------------------EGEGKSDAGGATNMPFSEFFAF  220

Query  985   PQYTTS----CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+TS      +S    +  ++     ADIEVT++E+HAN++I S  R  +QL K+V+ 
Sbjct  221   PQYSTSGGGGSDNSATIGEDVAEVKYGIADIEVTMVESHANLKIRSKKRP-KQLLKLVSG  279

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               TM +++LHLNVTT   +VLYS+S KVE  C+L S D+IAEAV+  L  I
Sbjct  280   LHTMRLTILHLNVTTTAEVVLYSLSVKVEDDCKLGSVDDIAEAVYQTLDRI  330



>ref|XP_002281083.2| PREDICTED: transcription factor bHLH94 [Vitis vinifera]
 emb|CBI36741.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/229 (49%), Positives = 146/229 (64%), Gaps = 35/229 (15%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             N+EE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE 
Sbjct  120   NQEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEQ  179

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQ L  +K +   +   SA                               PF +FF +P
Sbjct  180   RLQWLGGQKEKENGEAGSSA-------------------------------PFSEFFTFP  208

Query  988   QYTTSCS---SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             QY+TS +   +S+          A  ADIEVT++E+HAN++I  S R+ +QL +MV+  Q
Sbjct  209   QYSTSSTVSDNSVSMADTVGGNQAVIADIEVTMVESHANLKI-RSRRRPKQLLRMVSGLQ  267

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++ +++LHLNVTT D  VLYS+S KVE  C+L+S D+IA AV+ +L  I
Sbjct  268   SLHLTILHLNVTTIDQTVLYSLSVKVEDDCKLTSVDDIATAVYQMLGRI  316



>gb|AFZ78610.1| helix-loop-helix protein [Populus tomentosa]
Length=343

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 150/227 (66%), Gaps = 29/227 (13%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLR+LMPESYVQRGDQASI+GGAI FVKELE  +
Sbjct  135   EEIENQRMTHIAVERNRRKQMNEYLSVLRALMPESYVQRGDQASIIGGAINFVKELEQKM  194

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L A K    + ++ S   +    ++                      PF +FF +PQY
Sbjct  195   QVLGACK----KMKENSDGDNQQHVSSL---------------------PFSEFFTFPQY  229

Query  994   TTSC---SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             +TS     +S+  N+   KT +  ADIEVT++E+HAN++I  S R+ +QL K+V+   +M
Sbjct  230   STSSIHFENSVGKNEKLHKTQSTIADIEVTMVESHANLKI-RSKRRPKQLLKVVSGLHSM  288

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              ++VLHLNVTT D +VLYS+S KVE  C+LSS DEIA AV+ +L  I
Sbjct  289   RLTVLHLNVTTVDQIVLYSLSVKVEDDCKLSSVDEIATAVYQMLGRI  335



>ref|XP_003556500.1| PREDICTED: transcription factor bHLH96-like [Glycine max]
 gb|KHN20202.1| Transcription factor bHLH96 [Glycine soja]
Length=328

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 141/232 (61%), Gaps = 34/232 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMP+SY+QRGDQASI+GGAI FVKELE
Sbjct  119   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPDSYIQRGDQASIIGGAINFVKELE  178

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               +  L A+K    + +                             G +   PF +FF +
Sbjct  179   QRMHFLGAQKEGEGKSE----------------------------AGGATNMPFSEFFTF  210

Query  985   PQYTTSCSSSMIPNKC-----TSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             PQY+TS       N         +     ADIEVT++E+HAN++I S  R  +QL K+V+
Sbjct  211   PQYSTSGGGGCSDNSAAVGEDVGEVKCGIADIEVTMVESHANLKIRSKKRP-KQLLKLVS  269

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
                TM +++LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+ +L  I
Sbjct  270   GLHTMRLTILHLNVTTTGEVVLYSLSVKVEDDCKLGSVDDIAAAVYQMLDKI  321



>ref|XP_009409290.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=327

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 145/234 (62%), Gaps = 39/234 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+ HIAVERNRRKQ+NE+LAVLRSLMP SYVQRGDQASIVGGAI+FVK+LE
Sbjct  116   KNQEEVENQRMAHIAVERNRRKQINEYLAVLRSLMPASYVQRGDQASIVGGAIDFVKQLE  175

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               + SLEA K   QR                                 S  +PF  FF++
Sbjct  176   KFVHSLEAHKRVKQRSS-------------------------------SSPSPFADFFSF  204

Query  985   PQYTTS---CSSSMIPNKCTSKT----TAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             PQY+++   C+ S   +          +   A++EVT++ETHAN+++L STR+ +QL  M
Sbjct  205   PQYSSNSPCCAKSAADDSAGEPAVENHSPVVAEVEVTMVETHANLKVL-STRRPKQLQNM  263

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             V   Q++ ++ LHLNVTT   +VLYS S KVE  C L+SADEIA AVH ++  I
Sbjct  264   VVGLQSLHLTTLHLNVTTIADMVLYSFSLKVEDECLLTSADEIATAVHQMVAKI  317



>ref|XP_011048906.1| PREDICTED: transcription factor bHLH94-like [Populus euphratica]
 ref|XP_011048907.1| PREDICTED: transcription factor bHLH94-like [Populus euphratica]
Length=345

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 29/227 (13%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLR+LMPESYVQRGDQASI+GGAI FVKELE  +
Sbjct  137   EEIENQRMTHIAVERNRRKQMNEYLSVLRALMPESYVQRGDQASIIGGAINFVKELEQKM  196

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L A K    + ++ S   +    ++                      PF +FF +PQY
Sbjct  197   QVLGACK----KMKENSDGDNQQHVSSL---------------------PFSEFFTFPQY  231

Query  994   TTSC---SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             +TS     +S+  N+   KT +  ADIEVT++E+HAN++I  S R+ +QL K+V+   +M
Sbjct  232   STSSIHFENSVGKNEKLHKTQSTIADIEVTMVESHANLKI-RSKRRPKQLLKVVSGLHSM  290

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              ++VLHLNVTT D +VLYS+S KVE  C+L+S DEIA AV+ +L  I
Sbjct  291   RLTVLHLNVTTVDQIVLYSLSVKVEDDCKLTSVDEIATAVYQMLGRI  337



>ref|XP_004983211.1| PREDICTED: transcription factor bHLH96-like [Setaria italica]
Length=304

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 148/235 (63%), Gaps = 41/235 (17%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KN+EE E+QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +V+E
Sbjct  92    VIKNEEEIESQRMTHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVGGAINYVRE  151

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE LLQSLE ++  L+     S                              +NPF  FF
Sbjct  152   LEQLLQSLEVQR-SLKEHNSNS------------------------------SNPFASFF  180

Query  979   AYPQY-TTSCSSSMIPNKCTSKTTAA--------TADIEVTLIETHANVRILSSTRKTRQ  1131
             ++PQY  TS +     N    + T+A        TADIEV+++E HA+V++  + R+ RQ
Sbjct  181   SFPQYFATSATHCDAGNHTIEEDTSARRTPSSSVTADIEVSMVEGHASVKV-QAPRRPRQ  239

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             L ++ A  Q + +++LHLNV+T   +V+YS+S KVE  C+LSS +EIA AVH IL
Sbjct  240   LLRLAAGLQQLGLTILHLNVSTAGAMVMYSLSLKVEDECKLSSVEEIAAAVHEIL  294



>ref|XP_006382653.1| hypothetical protein POPTR_0005s04160g [Populus trichocarpa]
 gb|ERP60450.1| hypothetical protein POPTR_0005s04160g [Populus trichocarpa]
Length=345

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 150/227 (66%), Gaps = 29/227 (13%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLR+LMPESYVQRGDQASI+GGAI FVKELE  +
Sbjct  137   EEIENQRMTHIAVERNRRKQMNEYLSVLRALMPESYVQRGDQASIIGGAINFVKELEQKM  196

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L A K    + ++ S   +    ++                      PF +FF +PQY
Sbjct  197   QVLGACK----KMKENSDGDNQQHVSSL---------------------PFSEFFTFPQY  231

Query  994   TTSC---SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             +TS     +S+  N+   KT +  ADIEVT++E+HAN++I  S R+ +QL K+V+   +M
Sbjct  232   STSSIHFENSVGKNEKLHKTQSTIADIEVTMVESHANLKI-RSKRRPKQLLKVVSGLHSM  290

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              ++VLHLNVTT D +VLYS+S KVE  C+L+S DEIA AV+ +L  I
Sbjct  291   RLTVLHLNVTTVDQIVLYSLSVKVEDDCKLTSVDEIATAVYQMLGRI  337



>emb|CBI33874.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 124/193 (64%), Gaps = 35/193 (18%)
 Frame = +1

Query  727   MPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQQQQSaagddgataatktd  906
             MPESYVQRGDQASIVGGAIEFVKELEHLL S                             
Sbjct  1     MPESYVQRGDQASIVGGAIEFVKELEHLLHSTGTGT------------------------  36

Query  907   dgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIET  1086
                    +G    +    PF QFF YPQYT S     +PNK TSK+ AA ADIEVTLIET
Sbjct  37    ------GTGITANKFMPPPFSQFFVYPQYTWS----QMPNKYTSKSKAAVADIEVTLIET  86

Query  1087  HANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSAD  1266
             HAN+RILS  +  R LSKMV  FQT+ +++LHLNVTT D LVLYSISAKVE GCQL+S D
Sbjct  87    HANLRILSH-KSPRLLSKMVTGFQTLYLTILHLNVTTVDPLVLYSISAKVEEGCQLTSVD  145

Query  1267  EIAEAVHHILRVI  1305
             +IA AVHH+LR+I
Sbjct  146   DIAGAVHHMLRII  158



>gb|EMT20093.1| Transcription factor bHLH96 [Aegilops tauschii]
Length=367

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 145/226 (64%), Gaps = 18/226 (8%)
 Frame = +1

Query  655   ITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEK  834
             +THIAVERNRR+QMNE+LA LRSLMPESY  RGDQASIVGGAI+FVKELE LLQSLEA+K
Sbjct  1     MTHIAVERNRRRQMNEYLAALRSLMPESYAHRGDQASIVGGAIDFVKELEQLLQSLEAQK  60

Query  835   LRLQRQQQQSaagddgataatktddgavasvsggvKGRS------------FTNPFWQFF  978
               L  QQQQ         A         A+ +   +  S             + PF  FF
Sbjct  61    RTLLAQQQQDHKPPPIRDAMPSPSITVTAAATTTTRSGSGEGKQAAATRDGMSPPFAGFF  120

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
              YPQ+   C    +P +  +   A  ADIEVTL+ETHA+VR+++  R+  QL +MVA  +
Sbjct  121   TYPQFV--CR---LPPRDDADDHAGAADIEVTLVETHASVRVMAP-RRPGQLLRMVAGME  174

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              + ++VLHLNVTT   L LYS+S KVE GC L++AD+IA +VHH+L
Sbjct  175   ALRLTVLHLNVTTLGSLALYSLSVKVEEGCGLTTADDIAASVHHVL  220



>gb|KFK44344.1| hypothetical protein AALP_AA1G245600 [Arabis alpina]
Length=297

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 150/227 (66%), Gaps = 31/227 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  98    KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYTQRGDQASIVGGAINYVKELE  157

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +        ++                            S   PF  FF +
Sbjct  158   HILQSMEPNRTMTTTTTHEADTSTS-----------------------SLVGPFSDFFTF  194

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQ++T  SS        ++T+++ A+IEVT+ E+HAN++I++  +K RQL K+VA+ Q++
Sbjct  195   PQFSTKSSS-------VTETSSSPAEIEVTVAESHANIKIMAK-KKPRQLLKLVASIQSL  246

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE G +L++ D+IA A++ I+R I
Sbjct  247   RLTLLHLNVTTLDDSILYSISVKVEEGSKLNTVDDIATALNQIIRRI  293



>ref|XP_009381484.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 142/230 (62%), Gaps = 37/230 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L  LR LMP SYVQRGDQASI+GGAI FVKELE
Sbjct  103   KNQEEVENQRMTHIAVERNRRKQMNEYLGALRCLMPASYVQRGDQASIIGGAINFVKELE  162

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              L+QSLEA K R+++    +                                PF  FF +
Sbjct  163   QLVQSLEARK-RIEQTADAA--------------------------------PFADFFTF  189

Query  985   PQYTTSCS---SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             PQY+T+ S   ++    +   +   A ADIEVT++ETHAN+++LS  R+ +QL KMVA  
Sbjct  190   PQYSTTASRGANNGPAGEEAQENRPALADIEVTMVETHANLKVLSR-RRPKQLLKMVAGL  248

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               + +++LHLNVTT   +   S S KVE  CQLSS D+IA AVH ++  I
Sbjct  249   HDLRLTILHLNVTTVAEMAFCSFSLKVEDDCQLSSVDDIATAVHELVGTI  298



>ref|XP_009785047.1| PREDICTED: transcription factor bHLH96-like [Nicotiana sylvestris]
Length=312

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 148/235 (63%), Gaps = 34/235 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+ HIAVERNRRKQMNE+L VLRSLMP SYVQR DQASI+GGAI FVKELE
Sbjct  97    KNREELENQRMIHIAVERNRRKQMNEYLTVLRSLMPSSYVQRADQASIIGGAINFVKELE  156

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ+LE +K      Q                             G S    F  FF++
Sbjct  157   QHLQTLEVQKRSSTHDQ-------------------------LPENGISSLPLFADFFSF  191

Query  985   PQYTTSCSS--SMIPNKCTSKTTAAT------ADIEVTLIETHANVRILSSTRKTRQLSK  1140
             PQY+T+ S+  S  P   T+ +  A       ADIEV L+++HAN++ILS  R+ +QL K
Sbjct  192   PQYSTTHSNHVSSSPAAATNSSELAANNRSVMADIEVNLVDSHANLKILSK-RRPKQLLK  250

Query  1141  MVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++A  Q + +++LHLNV T D +VLY++SAKVE GCQL++ +EIA+AV+ +L  I
Sbjct  251   ILAGLQCLSLTILHLNVITVDQMVLYTLSAKVEEGCQLTTVEEIAQAVNQLLAGI  305



>ref|NP_177366.1| transcription factor bHLH96 [Arabidopsis thaliana]
 sp|Q9C7T4.1|BH096_ARATH RecName: Full=Transcription factor bHLH96; AltName: Full=Basic 
helix-loop-helix protein 96; Short=AtbHLH96; Short=bHLH 96; 
AltName: Full=Transcription factor EN 15; AltName: Full=bHLH 
transcription factor bHLH096 [Arabidopsis thaliana]
 gb|AAG51804.1|AC067754_20 unknown protein; 44011-46213 [Arabidopsis thaliana]
 emb|CAD30833.1| basic-helix-loop-helix transcription factor [Arabidopsis thaliana]
 gb|AAO41920.1| putative bHLH protein [Arabidopsis thaliana]
 gb|AAP04071.1| putative bHLH protein [Arabidopsis thaliana]
 gb|AEE35289.1| transcription factor bHLH96 [Arabidopsis thaliana]
Length=320

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 147/229 (64%), Gaps = 30/229 (13%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP  Y QRGDQASIVGGAI ++KEL
Sbjct  114   SKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPYYAQRGDQASIVGGAINYLKEL  173

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQS+E                       T T+D             S + PF  FFA
Sbjct  174   EHHLQSMEP-------------------PVKTATEDTGAGHDQTKTTSASSSGPFSDFFA  214

Query  982   YPQYTTSCSSSMIPNKCTSKTTA-ATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
             +PQY+         N+ TS   A   A+IEVT++E+HA+++IL+  R  RQL K+V++ Q
Sbjct  215   FPQYS---------NRPTSAAAAEGMAEIEVTMVESHASLKILAKKRP-RQLLKLVSSIQ  264

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++ +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  265   SLRLTLLHLNVTTRDDSVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  313



>gb|EPS59989.1| hypothetical protein M569_14814, partial [Genlisea aurea]
Length=216

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 141/230 (61%), Gaps = 34/230 (15%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKNKEE ETQR+THIAVERNRR+QMN++LAVLRSLMP SY  RGDQASIVGGAI FVKEL
Sbjct  19    CKNKEEMETQRMTHIAVERNRRRQMNDYLAVLRSLMPPSYAPRGDQASIVGGAINFVKEL  78

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E L+Q LEA+K   Q +                               R     F +FF 
Sbjct  79    EQLVQFLEAKKSSYQLR-------------------------------RDAAEAFSKFFN  107

Query  982   YPQYTTSCSSSMIPNKCTS--KTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             +PQYTT  ++   P+      +  +  AD+EV+++E HA+++ILS  R+ +QL K+VA  
Sbjct  108   FPQYTTRPAADEAPSGTDGGERQRSIVADVEVSMVEGHASIKILSE-RRPKQLLKLVAGL  166

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +  + VLH+NVT+ D  VLY+ S KVE  C  S+  EIA AVH ++ +I
Sbjct  167   HSFRLPVLHVNVTSADQSVLYTFSVKVEDECLFSTVHEIATAVHDMMGLI  216



>emb|CAN61676.1| hypothetical protein VITISV_018325 [Vitis vinifera]
Length=314

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 145/231 (63%), Gaps = 42/231 (18%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKE+ E QR+THIAVERNRR+QMNEHLAVLRSLMP SYVQRGDQASI+GGAI FVKEL
Sbjct  116   VKNKEQVENQRMTHIAVERNRRRQMNEHLAVLRSLMPASYVQRGDQASIIGGAINFVKEL  175

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQ LEA+KL  QR Q  S+                            F+N    FF 
Sbjct  176   EQLLQPLEAQKLMKQRSQTDSSTV--------------------------FSN----FFT  205

Query  982   YPQYTTSCS---SSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             +PQY+T  +   SS    +  ++  +A AD+EVT++ETHAN+R+LS TR  +QL KMVA 
Sbjct  206   FPQYSTYSTHYNSSAATKESMAEKRSAIADVEVTMVETHANIRVLSRTRP-KQLFKMVAW  264

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               ++ +++LHLNVTT D +        VE  C LSS +EIA AV+  +  I
Sbjct  265   LHSVRLTILHLNVTTVDHM--------VEDDCVLSSVNEIATAVYETVGRI  307



>ref|XP_010251348.1| PREDICTED: transcription factor bHLH67-like [Nelumbo nucifera]
Length=441

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 156/233 (67%), Gaps = 21/233 (9%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE ETQR+THIAVERNRR+QMN+HL  LRSLMP S++QRGDQASI+GGAI+FVKELE
Sbjct  221   KNKEEVETQRMTHIAVERNRRRQMNDHLNALRSLMPTSFIQRGDQASIIGGAIDFVKELE  280

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSL+A+K R+++ +++    +       +  D +               PF  FF  
Sbjct  281   QLLQSLQAQK-RIRKTEEEGNGDNSENHHNHRDPDSSAL-------------PFNGFFIS  326

Query  985   PQYTT--SCSSSMIP----NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQYTT  S +SS I      + T++  +A ADIEV +I TH N++ILS+ R+  QL K++
Sbjct  327   PQYTTYSSLASSDIKYTGEEEFTAENKSAVADIEVIVIHTHVNLKILSA-RRPGQLLKVI  385

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             AA + + +++LHLN+T+    VLYS + K+E  C+L SADEIA AVH +  +I
Sbjct  386   AALEDLRLTILHLNITSSQRSVLYSFNLKMEDDCKLGSADEIAAAVHQVFSLI  438



>gb|KFK41642.1| hypothetical protein AALP_AA2G154300 [Arabis alpina]
Length=320

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 148/226 (65%), Gaps = 28/226 (12%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+L+VLRS+MP SY QRGDQASIVGGAI ++KELEH
Sbjct  116   NKEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPPSYAQRGDQASIVGGAINYLKELEH  175

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
              LQS+E   ++    +  S      AT  +                   + PF  FFA+P
Sbjct  176   HLQSMEPSPVKTTTVEDGSDQSKTIATTTS-------------------SAPFSDFFAFP  216

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QY++           ++     TA+IEVT++E+HA++RIL   R+ RQL K+VA+ Q++ 
Sbjct  217   QYSSRP--------SSAAAAEGTAEIEVTMVESHASLRILVK-RRPRQLLKLVASIQSLR  267

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ ILR I
Sbjct  268   LTLLHLNVTTRDNFVLYSISVKVEEGSQLNTVEDIAAAVNQILRRI  313



>dbj|BAJ34641.1| unnamed protein product [Thellungiella halophila]
Length=324

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 187/341 (55%), Gaps = 55/341 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEALS+N L N ++ +T S TP  S         L  + P  P  D+           
Sbjct  1     MTLEALSSNGLLNFLLSETLSPTPFKS---------LVDLEPS-PENDIIISKNTIPAIS  50

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                P+ R+   A                        RRR+P++CKN+EEAE QR+THIAV
Sbjct  51    HQEPSSRQPPPASRGKKR------------------RRRKPRVCKNEEEAENQRMTHIAV  92

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KELEH L SLEA+KL+  + 
Sbjct  93    ERNRRRQMNQHLSVLRSLMPQPFAQKGDQASIVGGAIDFIKELEHQLLSLEAQKLQKAKL  152

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
              Q   +     T          +S               QFF Y  Y  S  +    N  
Sbjct  153   NQTVTSSTSQDTNGDPEIPHQPSS-------------LSQFFLY-SYDPSQENM---NGS  195

Query  1033  TSKTTAATADIEVTLIETHANVRILS----------STRKTRQLSKMVAAFQTMCMSVLH  1182
             TS    A  D+EVTLIETHAN+RILS          +T    QLSK+VAA Q++ +SVLH
Sbjct  196   TSSVKTAMEDLEVTLIETHANIRILSRRNGFRWTAVTTTGPPQLSKLVAALQSLSLSVLH  255

Query  1183  LNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L+VTT +   +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  256   LSVTTLETFAIYSISTKVEESCQLSSVDDIAGAVHHMLSII  296



>ref|XP_010106299.1| hypothetical protein L484_019813 [Morus notabilis]
 gb|EXC09716.1| hypothetical protein L484_019813 [Morus notabilis]
Length=330

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 141/227 (62%), Gaps = 31/227 (14%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THI VERNRRKQMN++ AVLRS+MP SYVQRGDQASIVGGAI FVKEL
Sbjct  122   VKNKEEVENQRMTHITVERNRRKQMNDYFAVLRSMMPSSYVQRGDQASIVGGAINFVKEL  181

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEA K   Q +   S                            +  + F  FF 
Sbjct  182   EQLLQSLEAHKRINQHELDHS----------------------------TVPSLFSDFFI  213

Query  982   YPQYTTSC--SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             +PQY T    + S+   K T++   A AD+EVT++E+HAN+++L   R  +QL KMV   
Sbjct  214   FPQYLTFSVNNKSVTEPKSTAEKRCAIADVEVTMVESHANIKVLLK-RHQKQLVKMVVGL  272

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             Q + + VLHLNVTT D +VLYS S KVE   +L+S +EIA +V+ ++
Sbjct  273   QFLRLVVLHLNVTTVDSMVLYSFSVKVEDDSELTSVNEIAASVYEMV  319



>ref|XP_006398364.1| hypothetical protein EUTSA_v10000961mg [Eutrema salsugineum]
 gb|ESQ39817.1| hypothetical protein EUTSA_v10000961mg [Eutrema salsugineum]
Length=324

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 187/341 (55%), Gaps = 55/341 (16%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEALS+N L N ++ +T S TP  S         L  + P  P  D+           
Sbjct  1     MTLEALSSNGLLNFLLSETLSPTPFKS---------LVDLEPS-PENDIIISKNTIPAIS  50

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                P+ R+   A                        RRR+P++CKN+EEAE QR+THIAV
Sbjct  51    HQEPSSRQPPPASRGKKR------------------RRRKPRVCKNEEEAENQRMTHIAV  92

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KELEH L SLEA+KL+  + 
Sbjct  93    ERNRRRQMNQHLSVLRSLMPQPFAQKGDQASIVGGAIDFIKELEHQLLSLEAQKLQKAKL  152

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQYTTSCSSSMIPNKC  1032
              Q   +     T          +S               QFF Y  Y  S  +    N  
Sbjct  153   NQTVTSSTSQDTNGDPEIPHQPSS-------------LSQFFLY-SYDPSQENM---NGS  195

Query  1033  TSKTTAATADIEVTLIETHANVRILS----------STRKTRQLSKMVAAFQTMCMSVLH  1182
             TS    A  D+EVTLIETHAN+RILS          +T    QLSK+VAA Q++ +SVLH
Sbjct  196   TSSVKTAMEDLEVTLIETHANIRILSRRNGFRWTAVTTAGPPQLSKLVAALQSLSLSVLH  255

Query  1183  LNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             L+VTT +   +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  256   LSVTTLETFAIYSISTKVEESCQLSSVDDIAGAVHHMLSII  296



>ref|XP_004501682.1| PREDICTED: transcription factor bHLH96-like [Cicer arietinum]
Length=292

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 144/226 (64%), Gaps = 38/226 (17%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THI VERNRRKQMN +L VLRSLMP SYVQRGDQASI+GGAI FVKELE LL
Sbjct  94    EEIENQRMTHITVERNRRKQMNHYLNVLRSLMPSSYVQRGDQASIIGGAINFVKELEQLL  153

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             QS+       Q + +Q                           G + T PF +FF +PQY
Sbjct  154   QSMGG-----QNKTKQI--------------------------GLNGT-PFAEFFTFPQY  181

Query  994   TTSCSSSMIPNKCTSKTTA--ATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             TT  + S   N  T +     A ADIEVT+++THAN++ILS  ++T QL K+V   QT+ 
Sbjct  182   TTGATQS---NTLTMEQHKQWAVADIEVTMVDTHANIKILSK-KQTGQLMKIVLGLQTLR  237

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +++LHLNVTT   +VL+S+S KVE G QL++ DEIA AV+ +LR +
Sbjct  238   LTILHLNVTTLADMVLFSLSVKVEEGSQLNTVDEIAAAVNQLLRTV  283



>gb|EAZ24688.1| hypothetical protein OsJ_08458 [Oryza sativa Japonica Group]
Length=334

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 140/236 (59%), Gaps = 40/236 (17%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KNKEEAE+QR  HIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIV GAI FVKE
Sbjct  126   VVKNKEEAESQRRNHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVAGAINFVKE  185

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE LLQSLEA+K R +                                      PF  FF
Sbjct  186   LEQLLQSLEAQKRRAEHAPP--------------------------------APPFAGFF  213

Query  979   AYPQYTT------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSK  1140
              +PQY+T      +  S     +         ADIEV + E+HANVR+L + R+ RQL +
Sbjct  214   TFPQYSTTVGDNNAAGSGAADGEGGCGARPGAADIEVAMAESHANVRVL-APRRPRQLLR  272

Query  1141  MVAAFQTMCMSVLHLNV-TTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             MV A Q + ++VLHLNV TT D L LYS S K+E  C+LSS DEIA AV+ ++  I
Sbjct  273   MVVALQCLGLTVLHLNVTTTADHLALYSFSLKMEDECRLSSVDEIAGAVNQMVTKI  328



>emb|CDY37634.1| BnaCnng08490D [Brassica napus]
Length=228

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 148/227 (65%), Gaps = 23/227 (10%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP  Y QRGDQASIVGGAI ++KEL+
Sbjct  18    KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPCYSQRGDQASIVGGAINYLKELQ  77

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H LQS+E   +++   +   A                           S + PF  FFA+
Sbjct  78    HQLQSMEP-PVKITATEDTGATAASAGDQNNTISA-------------SSSGPFSDFFAF  123

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY++  SSS +           TA+IEVT++E+HA+V+IL+  R  +QL K+VA+ Q++
Sbjct  124   PQYSSRPSSSSV--------AEGTAEIEVTMVESHASVKILAKKRP-KQLLKLVASIQSL  174

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ IL  I
Sbjct  175   RLTLLHLNVTTHDDSVLYSISLKVEEGSQLNTVEDIAAAVNQILMRI  221



>ref|XP_002512342.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF49794.1| DNA binding protein, putative [Ricinus communis]
Length=366

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 152/246 (62%), Gaps = 48/246 (20%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE 
Sbjct  153   NKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEQ  212

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTN---------  960
              LQ L   K                                  +KG+S            
Sbjct  213   RLQLLGGHK---------------------------------EIKGKSDHGEHHASNNPL  239

Query  961   PFWQFFAYPQYTT----SCSSSMIPNKCTSKTTAAT-ADIEVTLIETHANVRILSSTRKT  1125
             PF +FF +PQY+T    S +S    N+  S  T +T ADIEVT++E+HAN++I  S R+ 
Sbjct  240   PFSEFFTFPQYSTTSTRSDNSVAAANETMSSATQSTIADIEVTMVESHANLKI-RSKRRP  298

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +QL K+V+   T+ +++LHLNVTT + +VLY +S KVE  C+LSS DEIA AV+ +L  I
Sbjct  299   KQLLKVVSGLHTLRLTILHLNVTTTEQIVLYCLSVKVEDDCKLSSVDEIATAVYQMLGRI  358

Query  1306  eeeeeV  1323
             +++  V
Sbjct  359   QQDYSV  364



>ref|XP_003572839.2| PREDICTED: transcription factor bHLH96-like [Brachypodium distachyon]
Length=255

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 149/238 (63%), Gaps = 25/238 (11%)
 Frame = +1

Query  655   ITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEK  834
             +THIAVERNRR+QMNE+L VLRSLMP+SYVQRGDQASIVGGAI+FVKELE  LQSLEA+K
Sbjct  1     MTHIAVERNRRRQMNEYLVVLRSLMPDSYVQRGDQASIVGGAIDFVKELEQQLQSLEAQK  60

Query  835   LRLQRQQQQSaagddga-----------taatktddgavasvsggvKGRSFTNPFWQFFA  981
               L   QQ  AA  D                + +     +SV+      S   PF  FF 
Sbjct  61    RTLLVHQQHKAARHDAMPMPMRTDGNGCAVESSSTSNCSSSVTTEEHHASSEPPFAGFFT  120

Query  982   YPQYT------------TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKT  1125
             YPQY             +S  + M+         A  AD+EV+L+ETHA+VR++ + R+ 
Sbjct  121   YPQYVWCHASQQQAAGDSSSGTMMLSAAEDQGGRAGVADVEVSLVETHASVRVM-APRRP  179

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTT-FDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              QL +MVAA Q + ++VLHLNV +  D LVLYS+S KVE GC L++AD+IA AVHH+L
Sbjct  180   GQLLRMVAALQALRLAVLHLNVVSALDSLVLYSLSVKVEEGCGLTTADDIAAAVHHVL  237



>ref|XP_009391332.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=315

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 136/221 (62%), Gaps = 38/221 (17%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRK MNE+LAVLRSLMP SY QRGDQASIVGGAI FVKELEHL+
Sbjct  123   EEVENQRMTHIAVERNRRKLMNEYLAVLRSLMPASYAQRGDQASIVGGAINFVKELEHLV  182

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             QSLEA K                                  ++GRS   PF  FF +PQY
Sbjct  183   QSLEARK---------------------------------RIRGRSQAAPFADFFTFPQY  209

Query  994   TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMS  1173
             ++S SS+         T  A ADIEVT+ E+HAN++I S  R  RQL ++V   Q + ++
Sbjct  210   SSSPSSTAS----DGSTGDAVADIEVTIFESHANIKIFSRWRP-RQLLELVLGLQGLRLT  264

Query  1174  VLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              LHLNVTT D +VLY  S KVE  CQ +S D IA AVH I+
Sbjct  265   TLHLNVTTVDEMVLYCFSLKVEDDCQCTSVDVIATAVHQII  305



>ref|XP_010441558.1| PREDICTED: transcription factor bHLH71-like [Camelina sativa]
Length=329

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 153/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  78    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  137

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL   +  Q         +     +    + +S             QFF
Sbjct  138   LEHKLLSLEAQKLHNAKLNQSVTTSTSQDSNGEPENPHQQSPLS-----------ISQFF  186

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR----------  1128
              +  Y  S  S    N  TS    A  D+EVTLIETHAN+RILS  R  R          
Sbjct  187   LH-SYDPSQESR---NGSTSSVKTALEDLEVTLIETHANIRILSRRRGFRWITMATPRPP  242

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLS++VAA Q++ +SVLHL+VTT D  V+YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  243   QLSRLVAALQSLSLSVLHLSVTTMDTYVIYSISAKVEESCQLSSVDDIAGAVHHMLSII  301



>ref|XP_010460004.1| PREDICTED: transcription factor bHLH94-like isoform X1 [Camelina 
sativa]
Length=307

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 148/227 (65%), Gaps = 28/227 (12%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  105   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELE  164

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+  ++                 +                    S   PF  FF++
Sbjct  165   HILQSMGPKRTTTTSTTHDVEGAKTSTS--------------------SLAGPFSDFFSF  204

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQ++T  S   +P     ++++++A+IEVT+ E+HAN++IL+  +K RQL K+V + Q++
Sbjct  205   PQFSTKLSE--VP-----RSSSSSAEIEVTVAESHANIKILAK-KKPRQLIKLVTSLQSL  256

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT    +LYSIS KVE G QL++ D+IA A++  +R I
Sbjct  257   RLTLLHLNVTTHQNSILYSISVKVEEGSQLTTVDDIATALNQTIRRI  303



>ref|XP_003591068.1| Transcription factor bHLH94 [Medicago truncatula]
Length=324

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 140/230 (61%), Gaps = 46/230 (20%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L++LRSLMP+S++QRGDQASI+GGAI FVKELEH  
Sbjct  116   EEIENQRMTHIAVERNRRKQMNEYLSILRSLMPDSHIQRGDQASIIGGAINFVKELEHKF  175

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
               L A+K R+ +  +                            G S   PF +FF +PQY
Sbjct  176   HFLGAKKERVVKSDE---------------------------AGGSNNMPFSEFFTFPQY  208

Query  994   TTSCSSSMIPNKCTSKTTAAT------------ADIEVTLIETHANVRILSSTRKTRQLS  1137
             +TS S       C +  + AT            ADIEVT++E HAN++I S  R  +QL 
Sbjct  209   STSGSV------CDNSNSVATIGEKVGEIQSCIADIEVTMVENHANLKIRSRKRP-KQLL  261

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
             K+V+  Q M +++LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+
Sbjct  262   KIVSGLQNMRLTILHLNVTTIGEIVLYSLSVKVEDDCKLGSVDDIASAVY  311



>ref|XP_006660228.1| PREDICTED: transcription factor bHLH96-like [Oryza brachyantha]
Length=369

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 147/246 (60%), Gaps = 33/246 (13%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKE+E
Sbjct  127   KNKEEVESQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIGGAINYVKEME  186

Query  805   HLLQSLEAEK-LRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
              LLQSLEA++  R  R    +A        A      A               PF  FF 
Sbjct  187   QLLQSLEAQRHARCARTYDVAADAAAAGVDADAASAAAAL-------------PFAGFFT  233

Query  982   YPQYTTSCSSSMIPNKCTSKTT------------------AATADIEVTLIETHANVRIL  1107
             +PQY  S +S+       +                     +  ADIEVT++E+HAN+++L
Sbjct  234   FPQYCMSVTSTTARAAAAAAAAAENGNADDDDGDASGSKPSTVADIEVTMVESHANLKVL  293

Query  1108  SSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
             S  R+ RQL +MVA  Q   ++VLHLNV +   + LYS+S KVE  CQLSS D+IA AVH
Sbjct  294   SR-RRPRQLLRMVAGLQGHRLAVLHLNVASAGHMALYSLSLKVEDDCQLSSVDDIAAAVH  352

Query  1288  HILRVI  1305
              I+  +
Sbjct  353   EIVETV  358



>gb|EMS58688.1| Transcription factor bHLH96 [Triticum urartu]
Length=352

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 146/244 (60%), Gaps = 41/244 (17%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EEAE+QR+THIAVERNRRKQMNE+L VLRSLMP SYV RGDQASI+GGAI +VKELE
Sbjct  114   KNIEEAESQRMTHIAVERNRRKQMNEYLGVLRSLMPASYVHRGDQASIIGGAINYVKELE  173

Query  805   HLLQSLEAEK-LRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
              L+QSLEA +  RL+     S   D  A                         PF  FF 
Sbjct  174   QLVQSLEAHRHARLRDDCPVSGDVDSAAAV-----------------------PFVDFFT  210

Query  982   YPQYTTSC---------------SSSMIPNKCTSKTT-AATADIEVTLIETHANVRILSS  1113
             +PQYT S                S     N  TS +  +A ADIEVT++E+HA++++L S
Sbjct  211   FPQYTMSVRHAPATPAADASADGSGGNADNDGTSGSKQSAVADIEVTIVESHASLKVL-S  269

Query  1114  TRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHI  1293
              R+ RQL ++VA  Q   ++VLHLN T+   + LY +S KVE  C+LSS D+IA AVH I
Sbjct  270   RRRPRQLLRIVAGLQGHRLAVLHLNATSAGHMALYCLSLKVEDDCRLSSVDDIAAAVHRI  329

Query  1294  LRVI  1305
             +  I
Sbjct  330   VETI  333



>ref|XP_008681358.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|AFW72883.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=351

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 158/252 (63%), Gaps = 29/252 (12%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE ETQR+THIAVERNRR+QMNE+LA LRS+MPE+YVQRGDQASIVGGAIEFVKELE  +
Sbjct  83    EETETQRMTHIAVERNRRRQMNEYLAALRSIMPEAYVQRGDQASIVGGAIEFVKELEQQV  142

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsgg----------vKGRSFTN-  960
             Q LEA+K +L   Q+ +AA    AT    +  GA A  +              G +  + 
Sbjct  143   QCLEAQKRKLLVHQRVAAAKPADATPMRASSSGARACCADSAAAAATTSNCSSGLTTEDA  202

Query  961   ---------PFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSS  1113
                      PF QFF YPQY    S++  P +      +  AD+EVTL+ETHA+VR++++
Sbjct  203   AADHALPPPPFAQFFTYPQYVWCHSAARDPAEEEDGRRSGVADVEVTLVETHASVRVMTA  262

Query  1114  TRKTRQLSKMVAAFQTMCMSVLHLNVTT-FDLLVLYSISA-------KVEGGCQLSSADE  1269
              R+  QL  +V   Q + ++VLHL+V T  D LVLY+ S        KVE GC L++AD+
Sbjct  263   -RRPGQLLSLVTGLQALRLAVLHLSVVTALDALVLYTTSVKVHNCTKKVEEGCGLATADD  321

Query  1270  IAEAVHHILRVI  1305
             IA AVHH+L +I
Sbjct  322   IAAAVHHVLCII  333



>gb|EAY87600.1| hypothetical protein OsI_09011 [Oryza sativa Indica Group]
Length=334

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 140/236 (59%), Gaps = 40/236 (17%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KNKEEAE+QR  HIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIV GAI FVKE
Sbjct  126   VVKNKEEAESQRRNHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVAGAINFVKE  185

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE LLQSLEA+K R +                                      PF  FF
Sbjct  186   LEQLLQSLEAQKRRAEHAPP--------------------------------APPFAGFF  213

Query  979   AYPQYTTSCSSS------MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSK  1140
              +PQY+T+   +          +         ADIEV + E+HANVR+L + R+ RQL +
Sbjct  214   TFPQYSTTVGDNNAAGSGAGDGEGGCGARPGAADIEVAMAESHANVRVL-APRRPRQLLR  272

Query  1141  MVAAFQTMCMSVLHLNV-TTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             MV A Q + ++VLHLNV TT D L LYS S K+E  C+LSS DEIA AV+ ++  I
Sbjct  273   MVVALQCLGLTVLHLNVTTTADHLALYSFSLKMEDECRLSSVDEIAGAVNQMVTKI  328



>ref|XP_009105879.1| PREDICTED: transcription factor bHLH96-like [Brassica rapa]
Length=325

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 150/227 (66%), Gaps = 26/227 (11%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LA LRSLMP  Y QRGDQASIVGGAI ++KELE
Sbjct  118   KNKEEIENQRMTHIAVERNRRKQMNEYLAALRSLMPPCYSQRGDQASIVGGAINYLKELE  177

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H LQS+E +      ++ +S  GD   T                    S + PF  FFA+
Sbjct  178   HQLQSMEPQVKTTATKETRSTVGDKNNTITA-----------------SSSGPFSDFFAF  220

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY++  SSS +           TA+IEVT++E+HA+V+IL+  R  +QL K+VA+ Q++
Sbjct  221   PQYSSRPSSSSV--------AEGTAEIEVTMVESHASVKILAKKRP-KQLLKLVASIQSL  271

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ IL  I
Sbjct  272   RLTLLHLNVTTHDDSVLYSISLKVEEGSQLNTVEDIAAAVNQILMRI  318



>gb|AES61319.2| basic helix loop helix (BHLH) DNA-binding family protein [Medicago 
truncatula]
Length=337

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 140/230 (61%), Gaps = 46/230 (20%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L++LRSLMP+S++QRGDQASI+GGAI FVKELEH  
Sbjct  129   EEIENQRMTHIAVERNRRKQMNEYLSILRSLMPDSHIQRGDQASIIGGAINFVKELEHKF  188

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
               L A+K R+ +  +                            G S   PF +FF +PQY
Sbjct  189   HFLGAKKERVVKSDE---------------------------AGGSNNMPFSEFFTFPQY  221

Query  994   TTSCSSSMIPNKCTSKTTAAT------------ADIEVTLIETHANVRILSSTRKTRQLS  1137
             +TS S       C +  + AT            ADIEVT++E HAN++I S  R  +QL 
Sbjct  222   STSGSV------CDNSNSVATIGEKVGEIQSCIADIEVTMVENHANLKIRSRKRP-KQLL  274

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
             K+V+  Q M +++LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+
Sbjct  275   KIVSGLQNMRLTILHLNVTTIGEIVLYSLSVKVEDDCKLGSVDDIASAVY  324



>ref|XP_006390686.1| hypothetical protein EUTSA_v10018867mg [Eutrema salsugineum]
 gb|ESQ27972.1| hypothetical protein EUTSA_v10018867mg [Eutrema salsugineum]
Length=325

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 150/228 (66%), Gaps = 25/228 (11%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  117   SKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIVGGAINYLKEL  176

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E  LQS+E                    T     + GA A  S  +   S   PF  FFA
Sbjct  177   EQHLQSMEP----------------PVKTTDVAEEAGAAAGDSTNIIAASSLGPFSDFFA  220

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY++  SSS +           TA+IEVT++E+HA+V+IL+  R  RQL K+VA+ Q+
Sbjct  221   FPQYSSRPSSSSV--------AEGTAEIEVTMVESHASVKILAKKR-PRQLLKLVASIQS  271

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +++LHLNVTT D  VLYSIS KVE G QL++ ++IA A++ ILR I
Sbjct  272   LRLTLLHLNVTTRDNSVLYSISLKVEEGSQLNTVEDIAAAMNQILRRI  319



>ref|XP_010494850.1| PREDICTED: transcription factor bHLH71 [Camelina sativa]
Length=328

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 152/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  77    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  136

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL   +  Q         +     +    + +S             QFF
Sbjct  137   LEHKLLSLEAQKLHNAKLNQSVTTSTSQDSNGEPENPHQQSPLS-----------ISQFF  185

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR----------  1128
              +  Y  S  S    N  TS    A  D+EVTLIETHAN+RILS  R  R          
Sbjct  186   LH-SYDPSQESR---NGSTSSVKTALEDLEVTLIETHANIRILSRRRGFRWSTMATARPP  241

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLS++VAA Q++ +SVLHL+VTT D   +YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  242   QLSRLVAALQSLSLSVLHLSVTTMDTYAIYSISAKVEESCQLSSVDDIAGAVHHMLSII  300



>ref|XP_010025414.1| PREDICTED: transcription factor bHLH96 [Eucalyptus grandis]
 gb|KCW62068.1| hypothetical protein EUGRSUZ_H04738 [Eucalyptus grandis]
Length=300

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 147/229 (64%), Gaps = 31/229 (14%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             I KN++E E+QR+THIAVERNRRKQMN++LAVLRS+MP SYVQRGDQASI+ GAI FVKE
Sbjct  95    IVKNRDEVESQRMTHIAVERNRRKQMNDYLAVLRSMMPPSYVQRGDQASIIAGAINFVKE  154

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE  LQSL+++K   Q    +SA+  D                          +PF  FF
Sbjct  155   LEQHLQSLKSQKQPAQVNGPRSASPAD-------------------------DHPFSDFF  189

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQ  1158
              +PQY+T  SSS  P     +   A AD+EVTL+++HANV++LS   + +QL KMV    
Sbjct  190   TFPQYSTRASSSHRP-----EAQPAVADVEVTLVDSHANVKVLSRN-QPKQLLKMVHGLH  243

Query  1159  TMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++ ++VLHL +TT   +VLYS S KVE   QL+S +EIA AV+ ++  I
Sbjct  244   SLRLNVLHLTLTTVQNMVLYSFSVKVEDSSQLTSVNEIATAVYEMVGRI  292



>ref|NP_001242465.1| uncharacterized protein LOC100811408 [Glycine max]
 gb|ACU17837.1| unknown [Glycine max]
Length=319

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 140/231 (61%), Gaps = 33/231 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+L+VLRSLMP+SY+QRGDQASI+GGA+ FVKELE
Sbjct  111   KNKEEIENQRMTHIVVERNRRKQMNEYLSVLRSLMPDSYIQRGDQASIIGGAVNFVKELE  170

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               L  L A+K                                    G +   PF +FF +
Sbjct  171   QRLHFLGAQK----------------------------EGEGKSDDGGATNMPFSEFFTF  202

Query  985   PQYTT----SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAA  1152
             PQY+T       +S    +  S+     ADIEVT++E+HAN++I  S +  +QL K+V+ 
Sbjct  203   PQYSTGGGGGSDNSAAIGEDVSEVKCGIADIEVTMVESHANLKI-RSKKCPKQLLKLVSG  261

Query  1153  FQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               T+ +++LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+ +L  I
Sbjct  262   LHTVRLTILHLNVTTTGEVVLYSLSVKVEDDCKLGSVDDIAAAVYQMLDRI  312



>ref|XP_009101500.1| PREDICTED: transcription factor bHLH71-like [Brassica rapa]
 emb|CDY63053.1| BnaA06g40430D [Brassica napus]
Length=324

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 144/348 (41%), Positives = 189/348 (54%), Gaps = 69/348 (20%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATP---ALSHNEASETTNLAAVAPKQPgqdlcggdgggl  483
             M LEALS+N L N ++ ++ S TP    L    A E  N   + PK              
Sbjct  1     MTLEALSSNGLLNFLLSESLSPTPFKSLLDLEPAPE--NDIIIIPK--------------  44

Query  484   dACSSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITH  663
                +++P   ++  A  +   P SR ++    +            +CKN+EEAE QRITH
Sbjct  45    ---NTIPEMSQQEPASRQP-PPASRGKKRRRRKPR----------VCKNEEEAENQRITH  90

Query  664   IAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRL  843
             IAVERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KELEH L SLE +KL+ 
Sbjct  91    IAVERNRRRQMNQHLSVLRSLMPQPFSQKGDQASIVGGAIDFIKELEHQLLSLEVQKLQK  150

Query  844   QRQQQQSaagddgataatktddgavasvsggvKGRSFTNP---FWQFFAYPQYTTSCSSS  1014
              +  Q   +     +                       NP     QFF +  Y  S  + 
Sbjct  151   DKLSQTVTSSTSQDSNCEPE------------------NPHLSLSQFFLH-SYDPSQENR  191

Query  1015  MIPNKCTSKTTAATADIEVTLIETHANVRILS-----------STRKTRQLSKMVAAFQT  1161
                N  TS    A  D+EVTLIETHAN+RILS           +T    QLSK+VAA Q+
Sbjct  192   ---NGSTSSVKTAMEDLEVTLIETHANIRILSRRRGFQWTSVVATTGPPQLSKLVAALQS  248

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + +SVLHL+VTT +   +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  249   LSLSVLHLSVTTLETFAIYSISTKVEESCQLSSVDDIAGAVHHMLSII  296



>ref|XP_002309955.2| hypothetical protein POPTR_0007s04950g, partial [Populus trichocarpa]
 gb|EEE90405.2| hypothetical protein POPTR_0007s04950g, partial [Populus trichocarpa]
Length=297

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 141/240 (59%), Gaps = 43/240 (18%)
 Frame = +1

Query  631   KEEAET--QRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             K+EAE   QR+THI VERNRRKQMNE+LAV+RS++P SYVQR DQASIVGGAI FVKELE
Sbjct  79    KDEAEVAHQRMTHINVERNRRKQMNEYLAVIRSMLPPSYVQRADQASIVGGAINFVKELE  138

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA K                                    G  F++PF  FF +
Sbjct  139   KLLQSLEAHK---------------------------QIKKVISATGSDFSSPFSDFFTF  171

Query  985   PQYTTSCSSS-------------MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKT  1125
             PQY+T+ S +                 K   K + A AD+EVT+IE+HAN++I  S +  
Sbjct  172   PQYSTASSRNKHSNNSSSSTESIFADQKRDQKRSIAIADVEVTMIESHANLKI-QSRKHP  230

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +QL KMV    ++ + +LHLNVTT D + LYS S KVE  C+L+S DEIA AVH ++  I
Sbjct  231   KQLLKMVTGLHSLGLHILHLNVTTVDQMALYSFSVKVEDECKLTSVDEIAAAVHEMVGRI  290



>ref|XP_010043101.1| PREDICTED: transcription factor bHLH96-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW85162.1| hypothetical protein EUGRSUZ_B02000 [Eucalyptus grandis]
Length=288

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 151/230 (66%), Gaps = 30/230 (13%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNK+E E+QR+ HIA ERNRRKQMNEHL+VLRSLMP+S+VQ+ DQASI+GGAI +VKELE
Sbjct  84    KNKKEMESQRMAHIATERNRRKQMNEHLSVLRSLMPDSHVQKVDQASIIGGAINYVKELE  143

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L A K   + + Q S   DD +                       + PF +FF  
Sbjct  144   QQLQQLGAHK---EMEGQSSKCEDDIS-----------------------SPPFSEFFTC  177

Query  985   PQYTTS---CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             PQY+ S    + S+  N+ TS T +A ADIEVT++ETHAN+++  S R+ +QL ++V+  
Sbjct  178   PQYSASPGQGNDSVPMNEWTSLTQSAIADIEVTMVETHANLKV-RSKRRPKQLLRLVSGL  236

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             Q++ ++VLHLNVTT +  VLY ++ KVE GCQ++S DEIA A + IL  I
Sbjct  237   QSVGLTVLHLNVTTAEPFVLYCLTLKVEDGCQMTSGDEIAAAANQILSSI  286



>emb|CDX96382.1| BnaA07g29930D [Brassica napus]
Length=325

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 149/227 (66%), Gaps = 26/227 (11%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LA LRSLMP  Y QRGDQASIVGGAI ++KELE
Sbjct  118   KNKEEIENQRMTHIAVERNRRKQMNEYLAALRSLMPPCYSQRGDQASIVGGAINYLKELE  177

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H LQS+E +      ++  S  GD   T                    S + PF  FFA+
Sbjct  178   HQLQSMEPQVKTTATKETGSTVGDKNNTITA-----------------SSSGPFSDFFAF  220

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY++  SSS +           TA+IEVT++E+HA+V+IL+  R  +QL K+VA+ Q++
Sbjct  221   PQYSSRPSSSSV--------AEGTAEIEVTMVESHASVKILAKKR-PKQLLKLVASIQSL  271

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ IL  I
Sbjct  272   RLTLLHLNVTTHDDSVLYSISLKVEEGSQLNTVEDIAAAVNQILMRI  318



>ref|XP_009365813.1| PREDICTED: transcription factor bHLH94-like [Pyrus x bretschneideri]
Length=268

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 148/237 (62%), Gaps = 42/237 (18%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKE  ETQR+THIAVERNRRKQMN +LAVLRS+MP  Y QRGDQASI+GGAI FVKEL
Sbjct  50    IKNKEVMETQRMTHIAVERNRRKQMNVYLAVLRSMMPAPYAQRGDQASIIGGAINFVKEL  109

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQS+E ++    R +QQS                            +F + F  FFA
Sbjct  110   EQLLQSIEGQR----RTKQQSDHHL------------------------NFASIFSSFFA  141

Query  982   YPQYTTSCS----------SSM-IPNKCTS-KTTAATADIEVTLIETHANVRILSSTRKT  1125
             +PQY+T CS          SSM + N+ T+ K ++A AD+EV++ E+HAN+++L   ++ 
Sbjct  142   FPQYST-CSTNHGHGLYNNSSMELSNELTAEKRSSAIADVEVSMAESHANIKVLVK-KQP  199

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             RQL  MV    ++ + +LHLNVTT D ++ YS S K+E   QL+S +EIA  V+ ++
Sbjct  200   RQLLNMVLGLHSLRLMILHLNVTTVDSMIFYSFSVKIEDNSQLTSVNEIAADVYEMV  256



>emb|CDX72877.1| BnaC06g33250D [Brassica napus]
Length=328

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 148/227 (65%), Gaps = 23/227 (10%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP  Y QRGDQASIVGGAI ++KEL+
Sbjct  118   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPCYSQRGDQASIVGGAINYLKELQ  177

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H LQS+E   +++   +   A                           S + PF  FFA+
Sbjct  178   HQLQSMEP-PVKITATEDTGATAASAGDQNNTISA-------------SSSGPFSDFFAF  223

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY++  SSS +           TA+IEVT++E+HA+V+IL+  R  +QL K+VA+ Q++
Sbjct  224   PQYSSRPSSSSV--------AEGTAEIEVTMVESHASVKILAKKRP-KQLLKLVASIQSL  274

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  VLYSIS KVE G QL++ ++IA AV+ IL  I
Sbjct  275   RLTLLHLNVTTHDNSVLYSISLKVEEGSQLNTVEDIAAAVNQILMRI  321



>gb|ACN33786.1| unknown [Zea mays]
Length=255

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 152/238 (64%), Gaps = 22/238 (9%)
 Frame = +1

Query  655   ITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEK  834
             +THIAVERNRR+QMNE+LA LRS+MPE+YVQRGDQASIVGGAIEFVKELE  +Q LEA+K
Sbjct  1     MTHIAVERNRRRQMNEYLAALRSIMPEAYVQRGDQASIVGGAIEFVKELEQQVQCLEAQK  60

Query  835   LRLQRQQQQSaagddgataatktddgavasvsgg----------vKGRSFTN--------  960
              +L   Q+ +AA    AT    +  GA A  +              G +  +        
Sbjct  61    RKLLVHQRVAAAKPADATPMRASSSGARACCADSAAAAATTSNCSSGLTTEDAAADHALP  120

Query  961   --PFWQFFAYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
               PF QFF YPQY    S++  P +      +  AD+EVTL+ETHA+VR++++ R+  QL
Sbjct  121   PPPFAQFFTYPQYVWCHSAARDPAEEEDGRRSGVADVEVTLVETHASVRVMTA-RRPGQL  179

Query  1135  SKMVAAFQTMCMSVLHLNVTT-FDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               +V   Q + ++VLHL+V T  D LVLY+ S KVE GC L++AD+IA AVHH+L +I
Sbjct  180   LSLVTGLQALRLAVLHLSVVTALDALVLYTTSVKVEEGCGLATADDIAAAVHHVLCII  237



>ref|XP_006426315.1| hypothetical protein CICLE_v10026131mg [Citrus clementina]
 gb|ESR39555.1| hypothetical protein CICLE_v10026131mg [Citrus clementina]
Length=310

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 145/230 (63%), Gaps = 32/230 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EE E+QR+THI VERNRRKQM  +L+VLRSLMP SYVQRGDQASIVGGAI +VKELE
Sbjct  97    KNIEEVESQRMTHIFVERNRRKQMKNYLSVLRSLMPPSYVQRGDQASIVGGAINYVKELE  156

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              L+Q+LEA K R+   QQ      D A  +                    T+ F  FF++
Sbjct  157   QLVQTLEAHK-RIHILQQSDDHDHDDAGFS--------------------TSIFSNFFSF  195

Query  985   PQYT------TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+      +  SSS  P     K +   ADIEVT+ E++AN++IL STR  +QL KMV
Sbjct  196   PQYSDFRPNDSRESSSTAPK----KPSGPVADIEVTMAESNANIKIL-STRYPKQLFKMV  250

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
               F ++ + VLHLNV TFD  VLY+ S KVE GC L S +E+A AV+ ++
Sbjct  251   TGFHSLGLHVLHLNVATFDNQVLYTFSVKVEEGCHLRSMNEVAAAVYDMM  300



>ref|XP_007030915.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11417.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=335

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 146/227 (64%), Gaps = 31/227 (14%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELEH L
Sbjct  130   EEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEHRL  189

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L A+    +R    S++                               F +FF +PQY
Sbjct  190   QFLSAQNEVKERSDGGSSSSCSA---------------------------FAEFFTFPQY  222

Query  994   TTSCSSSMIP---NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             +TS + S      N+   +T +A ADIEVT++E+HAN++I  + R+  QL K+V+   +M
Sbjct  223   STSSTRSDSSISMNETMVETQSAIADIEVTMVESHANLKI-RAKRRPAQLLKVVSGLNSM  281

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +S+LHLNVTT D  VLYS+S KVE  C+L+S D+IA AV+ +L  I
Sbjct  282   RLSILHLNVTTVDQTVLYSLSVKVEDDCKLTSVDDIATAVNQLLGRI  328



>gb|KHN16145.1| Transcription factor bHLH96 [Glycine soja]
Length=321

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 140/233 (60%), Gaps = 35/233 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THI VERNRRKQMNE+L+VLRSLMP+SY+QRGDQASI+GGA+ FVKELE
Sbjct  111   KNKEEIENQRMTHIVVERNRRKQMNEYLSVLRSLMPDSYIQRGDQASIIGGAVNFVKELE  170

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               L  L A+K                                    G +   PF +FF +
Sbjct  171   QRLHFLGAQK----------------------------EGEGKSDDGGATNMPFSEFFTF  202

Query  985   PQYTT------SCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+T         +S    +  S+     ADIEVT++E+HAN++I  S +  +QL K+V
Sbjct  203   PQYSTGGGGGGGSDNSAAIGEDVSEVKCGIADIEVTMVESHANLKI-RSKKCPKQLLKLV  261

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +   T+ +++LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+ +L  I
Sbjct  262   SGLHTVRLTILHLNVTTTGEVVLYSLSVKVEDDCKLGSVDDIAAAVYQMLDRI  314



>ref|XP_008235259.1| PREDICTED: transcription factor bHLH94 [Prunus mume]
Length=325

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 38/233 (16%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKE+ ETQR+THIAVERNRRKQMN++LA LR++MP  Y QRGDQASI+GGAI FVKEL
Sbjct  111   IKNKEDMETQRMTHIAVERNRRKQMNDYLAALRAMMPACYAQRGDQASIIGGAINFVKEL  170

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLE  +    R +QQ                             +  + F  FF 
Sbjct  171   EQLLQSLEGHR----RTEQQPDHL-------------------------NLASIFSSFFT  201

Query  982   YPQYTTSC--------SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             +PQY+T          +SS+ PN+  ++  +A AD+EVT++E+HANV++L   +  RQL 
Sbjct  202   FPQYSTCLNSHGHGVYNSSVHPNELMAEKRSAIADVEVTMVESHANVKVLMK-KHPRQLL  260

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             KMV    ++ + +LH+NVTT D ++LY+ S KVE   QL+S +EIA  V+ ++
Sbjct  261   KMVLGLHSLGLMILHVNVTTADNMILYTFSVKVEDNSQLTSMNEIAADVYKMV  313



>emb|CDX77682.1| BnaC07g19360D [Brassica napus]
Length=324

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 185/345 (54%), Gaps = 63/345 (18%)
 Frame = +1

Query  313   MALEALSTNELFNLIIYDTFSATPALSHNEASETTNLAAVAPKQPgqdlcggdgggldAC  492
             M LEALS+N L N ++ ++ S TP  S         L  + P      +        +  
Sbjct  1     MTLEALSSNGLLNFLLSESLSPTPFKS---------LLDLDPSPENDIIIIPKNTIPEMS  51

Query  493   SSMPAWRRRHSAGAEMITPHSRAQQNLAVQgggrkkrrrrpkICKNKEEAETQRITHIAV  672
                PA R+   A                        RRR+P++CKN+EEAE QRITHIAV
Sbjct  52    QQEPASRQPPPASRGKKR------------------RRRKPRVCKNEEEAENQRITHIAV  93

Query  673   ERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLLQSLEAEKLRLQRQ  852
             ERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KELEH L SLEA+KL+  + 
Sbjct  94    ERNRRRQMNQHLSVLRSLMPQPFSQKGDQASIVGGAIDFIKELEHQLLSLEAQKLQKDKL  153

Query  853   QQQSaagddgataatktddgavasvsggvKGRSFTNP---FWQFFAYPQYTTSCSSSMIP  1023
              Q   +     +                       NP     QFF +  Y  S  +    
Sbjct  154   SQTVISSTSQDSNCEPE------------------NPHLSLSQFFLH-SYDPSQENR---  191

Query  1024  NKCTSKTTAATADIEVTLIETHANVRILS-----------STRKTRQLSKMVAAFQTMCM  1170
             N  TS    A  D+EVTLIETHAN+RILS           +T    QLSK+VAA  ++ +
Sbjct  192   NGSTSSVKTAMEDLEVTLIETHANIRILSRRRGFQWTSVVATTGPPQLSKLVAALHSLSL  251

Query  1171  SVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             SVLHL+VTT +   +YSIS KVE  CQLSS D+IA AVHH+L +I
Sbjct  252   SVLHLSVTTLETFAIYSISTKVEESCQLSSVDDIAGAVHHMLSII  296



>ref|XP_010535287.1| PREDICTED: transcription factor bHLH96 [Tarenaya hassleriana]
Length=320

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 143/226 (63%), Gaps = 29/226 (13%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASI+GGAI +VKELEH
Sbjct  117   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYAQRGDQASIIGGAINYVKELEH  176

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+E    R  R    +    +  ++++                            +P
Sbjct  177   LLQSMEPR--RKTRNDDVAMDDRNNTSSSSPPPFSDFF-------------------TFP  215

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QY++  S         S     TA+IEVT++E+HAN+RILS  R  RQL K+V++ Q++ 
Sbjct  216   QYSSRPS-------VESPAAEGTAEIEVTMVESHANLRILSRKR-PRQLVKLVSSIQSLS  267

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +++LHLNVT+    VLYSIS KVE G QL++ D+IA AV+ ILR I
Sbjct  268   LTLLHLNVTSLGHSVLYSISVKVEEGSQLNTVDDIAAAVNQILRRI  313



>ref|XP_006466564.1| PREDICTED: transcription factor bHLH96-like [Citrus sinensis]
 gb|KDO60649.1| hypothetical protein CISIN_1g043618mg [Citrus sinensis]
Length=310

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 144/230 (63%), Gaps = 32/230 (14%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EE E+QR+THI VERNRRKQM  +L+VLRSLMP SYVQRGDQASIVGGAI +VKELE
Sbjct  97    KNIEEVESQRMTHIFVERNRRKQMKNYLSVLRSLMPPSYVQRGDQASIVGGAINYVKELE  156

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              L+Q+LE  K R+   QQ      D A  +                    T+ F  FF++
Sbjct  157   QLVQTLEVHK-RIHILQQSDDHDHDDAGFS--------------------TSIFSNFFSF  195

Query  985   PQYT------TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+      +  SSS  P     K +   ADIEVT+ E++AN++IL STR  +QL KMV
Sbjct  196   PQYSDFRPNDSRESSSTAPK----KPSGPVADIEVTMAESNANIKIL-STRYPKQLFKMV  250

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
               F ++ + VLHLNV TFD  VLY+ S KVE GC L S +E+A AV+ ++
Sbjct  251   TGFHSLGLHVLHLNVATFDNQVLYTFSVKVEEGCHLRSMNEVAAAVYDMM  300



>ref|XP_004288157.1| PREDICTED: transcription factor bHLH96-like [Fragaria vesca subsp. 
vesca]
Length=335

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 146/243 (60%), Gaps = 48/243 (20%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E+QRITHIAVERNRRK MN++L+VLRS+MP SY QRGDQASI+GGAI FVKELE
Sbjct  116   KNKEEVESQRITHIAVERNRRKLMNDYLSVLRSMMPASYSQRGDQASIIGGAINFVKELE  175

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA +    R  QQS                               + F  FF +
Sbjct  176   QLLQSLEASR----RTNQQSDL--------------------------DLASIFSSFFTF  205

Query  985   PQYTTSCSSS---------------MIPNKCTS-KTTAATADIEVTLIETHANVRILSST  1116
             PQY+T CS+                + P++ T  K + A AD+EVT++E+HAN+++L   
Sbjct  206   PQYST-CSNKNTHGHGHSEYMNNNLVHPHEITGDKQSGAIADVEVTMVESHANIKVL-LK  263

Query  1117  RKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             R  RQL KMV    ++ + +LHLNVT+ D ++LYS S KVE   QL+S +EIA  V+ ++
Sbjct  264   RHPRQLLKMVLGLHSLRLVILHLNVTSMDSMILYSFSVKVEDNSQLTSMNEIAADVYEMV  323

Query  1297  RVI  1305
               I
Sbjct  324   GRI  326



>ref|XP_011022838.1| PREDICTED: transcription factor bHLH96-like isoform X2 [Populus 
euphratica]
Length=298

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 139/234 (59%), Gaps = 40/234 (17%)
 Frame = +1

Query  631   KEEAET--QRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             K+EAE   QR+THI VERNRRKQMNE+LAV+RS++P SYVQR DQASIVGGAI FVKELE
Sbjct  93    KDEAEVAHQRMTHINVERNRRKQMNEYLAVIRSMLPPSYVQRADQASIVGGAINFVKELE  152

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA K                                    G  F++PF  FF +
Sbjct  153   KLLQSLEAHK---------------------------QIKKVISATGSDFSSPFSDFFTF  185

Query  985   PQYTTSCSSSMIPNK----------CTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY+T+ S +   N              K + A AD+EVT+ E+HAN++I  S +  +QL
Sbjct  186   PQYSTASSRNKHSNNNSSSSTESIFADQKRSIAIADVEVTMTESHANLKI-QSRKHPKQL  244

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              KMV    ++ + +LHLNVTT D + LYS S KVE  C+L+S DEIA AVH ++
Sbjct  245   LKMVTGLHSLGLHILHLNVTTVDQMALYSFSVKVEDECKLTSVDEIAAAVHEMI  298



>emb|CAE04872.2| OSJNBa0086O06.20 [Oryza sativa Japonica Group]
Length=362

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 148/260 (57%), Gaps = 37/260 (14%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             E+AE+QR+THIAVERNRR+QMNE+LAVLRSLMPESYV RGDQASIVGGAI+FVKELE LL
Sbjct  88    EDAESQRMTHIAVERNRRRQMNEYLAVLRSLMPESYVHRGDQASIVGGAIDFVKELEQLL  147

Query  814   QSLEAEK---LRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             QSLEA+K   L       Q         A + +        +      +   PF +FF Y
Sbjct  148   QSLEAQKRTLLMQPPPPPQQQREPKCDAADSTSAADQETPAAAAAAAAADGPPFARFFTY  207

Query  985   PQYT---TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAF  1155
             PQY                 ++  A  ADIEV+L+ETHA++R++++ R+  QL KMVA  
Sbjct  208   PQYVWCHNPAQDGGGGGGAAAENRAGVADIEVSLVETHASIRVMAA-RRPGQLLKMVAGL  266

Query  1156  QTMCMSVLHLNVTTFDLLVLYSISAK------------------------------VEGG  1245
             Q + ++VLHLNVT    L LYSIS K                              VE G
Sbjct  267   QALRLTVLHLNVTALGSLALYSISVKRFHGGKAIASLGPLGVFFLCALYLWYSTTVVEEG  326

Query  1246  CQLSSADEIAEAVHHILRVI  1305
             C +++ D+IA AVHH+L +I
Sbjct  327   CGMATVDDIAAAVHHVLCII  346



>ref|XP_006375773.1| hypothetical protein POPTR_0013s02680g [Populus trichocarpa]
 gb|ERP53570.1| hypothetical protein POPTR_0013s02680g [Populus trichocarpa]
Length=320

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 137/212 (65%), Gaps = 39/212 (18%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE
Sbjct  132   KNKEEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELE  191

Query  805   HLLQSLEA-----EKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFW  969
               LQ L A     EK     QQ  S+                               PF 
Sbjct  192   QKLQVLGACKEMKEKPNGDDQQHVSSL------------------------------PFS  221

Query  970   QFFAYPQYTTS---CSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSK  1140
             +FF +PQYTTS   C SS   ++   K+ +A ADIEVT++E+HAN++I  S R+ +QL K
Sbjct  222   KFFIFPQYTTSSIHCESSAGKDEKLMKSQSAIADIEVTMVESHANLKI-RSKRRPKQLLK  280

Query  1141  MVAAFQTMCMSVLHLNVTTFDLLVLYSISAKV  1236
             +V+A  +M ++VLHLNV+T D +VLYS+S KV
Sbjct  281   VVSALHSMRLTVLHLNVSTVDQIVLYSLSVKV  312



>ref|XP_011022837.1| PREDICTED: transcription factor bHLH96-like isoform X1 [Populus 
euphratica]
Length=314

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 140/237 (59%), Gaps = 40/237 (17%)
 Frame = +1

Query  631   KEEAET--QRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             K+EAE   QR+THI VERNRRKQMNE+LAV+RS++P SYVQR DQASIVGGAI FVKELE
Sbjct  93    KDEAEVAHQRMTHINVERNRRKQMNEYLAVIRSMLPPSYVQRADQASIVGGAINFVKELE  152

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA K                                    G  F++PF  FF +
Sbjct  153   KLLQSLEAHK---------------------------QIKKVISATGSDFSSPFSDFFTF  185

Query  985   PQYTTSCSSSMIPNK----------CTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY+T+ S +   N              K + A AD+EVT+ E+HAN++I  S +  +QL
Sbjct  186   PQYSTASSRNKHSNNNSSSSTESIFADQKRSIAIADVEVTMTESHANLKI-QSRKHPKQL  244

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              KMV    ++ + +LHLNVTT D + LYS S KVE  C+L+S DEIA AVH ++  I
Sbjct  245   LKMVTGLHSLGLHILHLNVTTVDQMALYSFSVKVEDECKLTSVDEIAAAVHEMVGRI  301



>ref|XP_010481425.1| PREDICTED: transcription factor bHLH71-like [Camelina sativa]
Length=329

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 152/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+ MN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  78    VCKNEEEAENQRMTHIAVERNRRRLMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  137

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL   +  Q         + +   +    + +S             QFF
Sbjct  138   LEHKLLSLEAQKLHNAKLNQSVTTSTSQDSNSEPENPHQQSPLS-----------ISQFF  186

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR----------  1128
              +  Y  S  +    N  TS    A  D+EVTLIETHAN+RILS  R  R          
Sbjct  187   LH-SYDPSQENR---NGSTSSVKTALEDLEVTLIETHANIRILSRRRGFRWSTMATSRPP  242

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLS++VAA Q++ +SVLHL+VTT D   +YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  243   QLSRLVAALQSLSLSVLHLSVTTMDTYAIYSISAKVEESCQLSSVDDIAGAVHHMLSII  301



>ref|XP_004517115.1| PREDICTED: transcription factor bHLH94-like [Cicer arietinum]
Length=307

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 136/227 (60%), Gaps = 27/227 (12%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+ E E QR+THI VERNRRKQMNE+ AVLRSLMP SY QRGDQASIVGGAI FVKELE
Sbjct  108   KNEVEIENQRMTHITVERNRRKQMNEYFAVLRSLMPPSYAQRGDQASIVGGAINFVKELE  167

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LL  ++ EK + ++ Q+                                ++PF +FF +
Sbjct  168   QLLHCMKGEKKKNEQVQENGLIIG--------------------------SSPFAEFFTF  201

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  + S          + A +DIEVTL++ HAN++I+   R   Q+ KMV   Q +
Sbjct  202   PQYSTWLTQSNTCYISKQNQSRAMSDIEVTLVDNHANIKIILKKRHG-QVMKMVVGLQNL  260

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               +VLHLNV T D +VL S+S KVE GC  ++ DEIA AV+ + R I
Sbjct  261   GFNVLHLNVATADDMVLVSLSIKVEEGCHHNTGDEIAAAVNQLSRTI  307



>ref|XP_007047843.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX92000.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=352

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 147/231 (64%), Gaps = 37/231 (16%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRR+QMN++LAVL+S+MP SYVQRGDQASI+GGAI FVKELE
Sbjct  143   KNKEEIENQRMTHIAVERNRRRQMNDYLAVLKSMMPTSYVQRGDQASIIGGAINFVKELE  202

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
              LLQSLEA K R++++   S      +                               ++
Sbjct  203   QLLQSLEARK-RMEKRSDNSTLSSLFSDFF----------------------------SF  233

Query  985   PQYTTSCSSS-------MIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             PQY+T  +S+               K +++ AD+EVT++E+HAN++ILS  R  +QL KM
Sbjct  234   PQYSTGSTSTHRSYAAATSSQSMAEKRSSSVADVEVTMVESHANLKILSK-RHPKQLLKM  292

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             VA   ++ + VLHLNVT+ + +VLYS+S KVE  C+L++ +EIA AV+ ++
Sbjct  293   VAGLHSLGLCVLHLNVTSVEHMVLYSLSVKVEDNCELTTVNEIAAAVYEMV  343



>ref|NP_001049217.1| Os03g0188400 [Oryza sativa Japonica Group]
 gb|AAN64142.1| Unknown protein [Oryza sativa Japonica Group]
 gb|ABF94380.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11131.1| Os03g0188400 [Oryza sativa Japonica Group]
 dbj|BAG98084.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60278.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=329

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 144/246 (59%), Gaps = 48/246 (20%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE 
Sbjct  102   NKEEIECQRMTHIAVERNRRRQMNEYLAVLRSLMPASYSQRGDQASIVGGAINYVKELEQ  161

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQSLE +K    R     A                           +  +PF  FF++P
Sbjct  162   LLQSLEVQKSLKNRSGAMDA---------------------------AGDSPFAGFFSFP  194

Query  988   QYTTS----CS----------------SSMIPNKCTSKTTAATADIEVTLIETHANVRIL  1107
             QY+TS    CS                     +  + + +AA ADIEVT++E HA++++L
Sbjct  195   QYSTSPRTGCSAAASAGSSGSASSVVMDDTAGSAESGRQSAAIADIEVTMVEGHASLKVL  254

Query  1108  SSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
              + R+ +QL K+V   Q + +  LHLNVTT D +VLYS S KVE   +L S ++IA AVH
Sbjct  255   -ARRRPKQLLKLVVGLQQLRIPPLHLNVTTVDAMVLYSFSLKVEDDSKLGSVEDIATAVH  313

Query  1288  HILRVI  1305
              IL  I
Sbjct  314   QILGSI  319



>ref|XP_009335628.1| PREDICTED: transcription factor bHLH96-like [Pyrus x bretschneideri]
Length=320

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 142/234 (61%), Gaps = 50/234 (21%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L+VLRS+MPESYVQRGDQASI+GGAI FVKELE
Sbjct  115   KNEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPESYVQRGDQASIIGGAINFVKELE  174

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               +Q L  +K                                     R+   PF +FF +
Sbjct  175   QEVQFLGVQK----------------------------------PNNRA---PFSEFFTF  197

Query  985   PQYTTSCSSSM---------IP-NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY+T  +S           +P  +C S   A  ADIEVT++E+HA++++  S R  +QL
Sbjct  198   PQYSTRSTSDHESTVATMAELPLLECRSSNIA--ADIEVTMVESHASLKV-RSKRLPKQL  254

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              K+V+    M ++VLHLNV T D +VLYS+S KVE  C L+S DEIA AVH +L
Sbjct  255   LKIVSGLHDMHLTVLHLNVVTADDIVLYSLSLKVEDECMLTSVDEIATAVHEML  308



>ref|XP_006280777.1| hypothetical protein CARUB_v10026748mg [Capsella rubella]
 gb|EOA13675.1| hypothetical protein CARUB_v10026748mg [Capsella rubella]
Length=336

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 153/239 (64%), Gaps = 24/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ + Q+GDQASIVGGAI+F+KE
Sbjct  84    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFSQKGDQASIVGGAIDFIKE  143

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL   +  Q   +     +   + +    +S     +            
Sbjct  144   LEHKLLSLEAQKLHNAKSNQTVTSSTSQDSNGEQENPHQQSSSLSLSQFF----------  193

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILS----------STRKTR  1128
              +P Y  S  +    N  TS       D+EVTLIETHAN+RILS          ST +  
Sbjct  194   LHP-YDPSQENR---NGSTSSVKTPMEDLEVTLIETHANIRILSRRRGFHWNTMSTTRPP  249

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLSK+VAA Q++ +SVLHL+VTT D   +YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  250   QLSKLVAALQSLSLSVLHLSVTTLDTYAIYSISAKVEESCQLSSVDDIAGAVHHMLSII  308



>ref|NP_001064473.1| Os10g0376900 [Oryza sativa Japonica Group]
 gb|AAM08539.1|AC079935_11 Putative helix-loop-helix DNA-binding protein [Oryza sativa Japonica 
Group]
 gb|AAP53429.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26387.1| Os10g0376900 [Oryza sativa Japonica Group]
 gb|EAZ15885.1| hypothetical protein OsJ_31307 [Oryza sativa Japonica Group]
Length=328

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 140/239 (59%), Gaps = 44/239 (18%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             N+EE E+QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +V+ELE 
Sbjct  102   NREEIESQRMTHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVGGAINYVRELEQ  161

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ+LEA +                           +     G  G S  +PF  FFA+P
Sbjct  162   LLQTLEARR--------------------------TIKDHIDGGAGES-PSPFAGFFAFP  194

Query  988   QYTTSCSSSMIPNKCTSKTTA----------------ATADIEVTLIETHANVRILSSTR  1119
             QY+T+ S         S+                   A ADIE +++E HA+V++  + R
Sbjct  195   QYSTATSGHGGGGDAHSRIVVKPAETTTTAAGGGAGAAIADIEASMVEGHASVKV-QARR  253

Query  1120  KTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + RQL K+VA    + ++ LHLNVTT   + +YS S KVE GC+L S +EIA AVH IL
Sbjct  254   RPRQLLKLVAGLHQLGLTTLHLNVTTVAAMAMYSFSLKVEDGCKLGSVEEIATAVHEIL  312



>ref|XP_004495746.1| PREDICTED: transcription factor bHLH96-like [Cicer arietinum]
Length=326

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 138/224 (62%), Gaps = 32/224 (14%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMN++L+VLRSLMP+SY+QRGDQASI+GGAI FVKELE  L
Sbjct  128   EEIENQRMTHIAVERNRRKQMNQYLSVLRSLMPDSYIQRGDQASIIGGAINFVKELEQKL  187

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
               L ++K  ++                                G      F +FF++PQY
Sbjct  188   HFLGSKKEEVKSDD----------------------------VGEGSNKSFSEFFSFPQY  219

Query  994   TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMS  1173
             +TS  +S        +     ADIEVT++E+HAN++I  S ++ +QL KMV+    M ++
Sbjct  220   STSGGNSA---SVIGEKVGEIADIEVTMVESHANLKI-RSKKRPKQLLKMVSGLHNMHLT  275

Query  1174  VLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +LHLNVTT   +VLYS+S KVE  C+L S D+IA AV+ +L  I
Sbjct  276   ILHLNVTTTCEIVLYSLSVKVEDDCKLGSVDDIAAAVYQMLNRI  319



>gb|EAY88844.1| hypothetical protein OsI_10315 [Oryza sativa Indica Group]
Length=329

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 145/246 (59%), Gaps = 48/246 (20%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE 
Sbjct  102   NKEEIECQRMTHIAVERNRRRQMNEYLAVLRSLMPASYSQRGDQASIVGGAINYVKELEQ  161

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQSLE +K    R     A                           +  +PF  FF++P
Sbjct  162   LLQSLEVQKSLKNRSGAMDA---------------------------AGDSPFAGFFSFP  194

Query  988   QYTTS----CSSSMIPNKC----------------TSKTTAATADIEVTLIETHANVRIL  1107
             QY+TS    CS++                      + + +AA ADIEVT++E HA++++L
Sbjct  195   QYSTSPRTGCSAAASAGSSGSASSVVMDDTAGSAESGRQSAAIADIEVTMVEGHASLKVL  254

Query  1108  SSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
              + R+ +QL K+V   Q + +  LHLNVTT D +VLYS S KVE   +L S ++IA AVH
Sbjct  255   -ARRRPKQLLKLVVGLQQLRIPPLHLNVTTVDAMVLYSFSLKVEDDSKLGSVEDIATAVH  313

Query  1288  HILRVI  1305
              IL  I
Sbjct  314   QILGSI  319



>emb|CDX82171.1| BnaC02g21190D [Brassica napus]
Length=326

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 144/228 (63%), Gaps = 23/228 (10%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMN++LAVLRSLMP SY QRGDQASIV GAI ++KEL
Sbjct  117   SKNKEEIENQRMTHIAVERNRRKQMNDYLAVLRSLMPPSYAQRGDQASIVAGAINYLKEL  176

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQS+E                   AT    T   A A+        S    F +FFA
Sbjct  177   EHHLQSIEP--------------PLKSATVPVDTGSAAAAADQINTIAASSLGQFSEFFA  222

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY +  SSS +            A+IEVT++E+HA+V+IL+  R  +QL K+ A+ Q 
Sbjct  223   FPQYLSRPSSSSV--------AEGMAEIEVTMVESHASVKILAKKR-PKQLLKLAASIQN  273

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + ++VLHLNVTT D  VLYSIS KVE G QL++ ++IA  ++ ILR I
Sbjct  274   LKLTVLHLNVTTCDDSVLYSISLKVEEGSQLNTVEDIAAGMNQILRRI  321



>ref|XP_009617734.1| PREDICTED: transcription factor bHLH96-like [Nicotiana tomentosiformis]
Length=332

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 147/233 (63%), Gaps = 34/233 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E+QR+THIAVERNRRKQMNE+L+VLR+LMP+SYVQRGDQASIV GAI +VKELE
Sbjct  121   KNQEEVESQRMTHIAVERNRRKQMNEYLSVLRTLMPQSYVQRGDQASIVSGAINYVKELE  180

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L  +K     + Q                                T+PF +FF+ 
Sbjct  181   QQLQFLSGQKHSNDEKLQNVMGE---------------------------TSPFSEFFSI  213

Query  985   PQYTTSCSSSMIPNKCT------SKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMV  1146
             PQY+T+ +++   N  +      ++  AATADIEVT++E HAN++I  S R+ R L +++
Sbjct  214   PQYSTTMTAATSENGGSGNEYYRNQQLAATADIEVTMVENHANLKI-RSKRRPRLLPRII  272

Query  1147  AAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +  +++ +SVLHLNV+  D  VL S+S KVE  C+LSS ++IA  V+ IL  I
Sbjct  273   SGLESLMLSVLHLNVSKVDQFVLCSLSLKVEEDCKLSSVEDIAAVVNQILGRI  325



>ref|NP_001062077.1| Os08g0483900 [Oryza sativa Japonica Group]
 dbj|BAD09301.1| putative basic-helix-loop-helix (bHLH)transcription factor [Oryza 
sativa Japonica Group]
 dbj|BAD10700.1| putative basic-helix-loop-helix (bHLH)transcription factor [Oryza 
sativa Japonica Group]
 dbj|BAF23991.1| Os08g0483900 [Oryza sativa Japonica Group]
 dbj|BAG98110.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60273.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=363

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 145/252 (58%), Gaps = 54/252 (21%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KN+EE E+QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKE+
Sbjct  129   VKNREEVESQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIGGAINYVKEM  188

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEA +   + +   +AA                              PF  FF 
Sbjct  189   EQLLQSLEAHRHARRARTDAAAAL-----------------------------PFAGFFT  219

Query  982   YPQYTTS------------------------CSSSMIPNKCTSKTTAATADIEVTLIETH  1089
             +PQY+ S                         +        +    ++ ADIEVT++E+H
Sbjct  220   FPQYSMSAVPTTTTTTVAAAATENGNAVAGAGAGDDADADVSGSKPSSVADIEVTMVESH  279

Query  1090  ANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADE  1269
             AN+++L S R+ RQL +MVA  Q   ++VLHLNV +   + LYS+S KVE  CQL+S D+
Sbjct  280   ANLKVL-SRRRPRQLLRMVAGLQHHRLAVLHLNVASAGHMALYSLSLKVEEDCQLTSVDD  338

Query  1270  IAEAVHHILRVI  1305
             IA AVH I+  I
Sbjct  339   IAAAVHGIVETI  350



>gb|EAZ43119.1| hypothetical protein OsJ_27709 [Oryza sativa Japonica Group]
Length=330

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 145/252 (58%), Gaps = 54/252 (21%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KN+EE E+QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GGAI +VKE+
Sbjct  96    VKNREEVESQRMTHIAVERNRRKQMNEYLAVLRSLMPASYVQRGDQASIIGGAINYVKEM  155

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLEA +   + +   +AA                              PF  FF 
Sbjct  156   EQLLQSLEAHRHARRARTDAAAAL-----------------------------PFAGFFT  186

Query  982   YPQYTTS------------------------CSSSMIPNKCTSKTTAATADIEVTLIETH  1089
             +PQY+ S                         +        +    ++ ADIEVT++E+H
Sbjct  187   FPQYSMSAVPTTTTTTVAAAATENGNAVAGAGAGDDADADVSGSKPSSVADIEVTMVESH  246

Query  1090  ANVRILSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADE  1269
             AN+++L S R+ RQL +MVA  Q   ++VLHLNV +   + LYS+S KVE  CQL+S D+
Sbjct  247   ANLKVL-SRRRPRQLLRMVAGLQHHRLAVLHLNVASAGHMALYSLSLKVEEDCQLTSVDD  305

Query  1270  IAEAVHHILRVI  1305
             IA AVH I+  I
Sbjct  306   IAAAVHGIVETI  317



>ref|XP_003581588.1| PREDICTED: transcription factor bHLH96-like [Brachypodium distachyon]
Length=330

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 153/247 (62%), Gaps = 25/247 (10%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EEAE+QR+THIAVERNRR+QMNE+LAVLRSLMP+SY  RGDQASIVGGAI+FVKELE  L
Sbjct  66    EEAESQRMTHIAVERNRRRQMNEYLAVLRSLMPDSYAHRGDQASIVGGAIDFVKELEQQL  125

Query  814   QSLEAEKLRLQRQQQQ---------------SaagddgataatktddgavasvsggvKGR  948
             QSLEA+K  L   QQQ               +      AT ++          S      
Sbjct  126   QSLEAQKRALLSSQQQRKPPIRDAIPTTPSTAVTATAAATTSSGGTGAGEEPSSPPAHEE  185

Query  949   SFTNPFWQFFAYPQYT--------TSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRI  1104
                 PF +FF YPQY             +   P +     TAA ADIEV+L+ETHA+VR+
Sbjct  186   DAGAPFARFFTYPQYVWRQRRPREDYRPTEAEPEEKRGGGTAA-ADIEVSLVETHASVRV  244

Query  1105  LSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAV  1284
             ++  R+  QL +MVA  + + ++VLHLNVT  D L LYS+S KVE GC L++AD++A AV
Sbjct  245   MAP-RRPGQLLRMVAGMEALRLAVLHLNVTALDSLALYSLSLKVEEGCGLATADDVAAAV  303

Query  1285  HHILRVI  1305
             HH++ +I
Sbjct  304   HHVICII  310



>ref|XP_009401227.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 142/228 (62%), Gaps = 39/228 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CKN+EE E QR+THIAVERNRRKQMN++LAVLRSL+P SY+ RGDQAS++GGAI FVKEL
Sbjct  75    CKNQEEVENQRMTHIAVERNRRKQMNQYLAVLRSLIPASYLHRGDQASVIGGAINFVKEL  134

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E L+QSLEA K                                  +K RS + PF  FF 
Sbjct  135   EQLVQSLEARK---------------------------------RIKQRSNSAPFANFFT  161

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY+T  +     ++  ++  +  ADIEVT++E+HAN+++L+  R+ +QL KMV     
Sbjct  162   FPQYSTRNA-----DEAAAEQQSPVADIEVTMVESHANLKVLAQ-RRPKQLLKMVVGLHL  215

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + ++ LHLNVTT D +VLYS S K+E  C  +  DEIA  VH ++  I
Sbjct  216   LHLTTLHLNVTTIDAMVLYSFSLKMEDECHFTCVDEIAAEVHQMVGKI  263



>gb|EAY78264.1| hypothetical protein OsI_33312 [Oryza sativa Indica Group]
Length=329

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 140/239 (59%), Gaps = 44/239 (18%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             N+EE E+QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +V+ELE 
Sbjct  104   NREEIESQRMTHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVGGAINYVRELEQ  163

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ+LEA +                           +     G  G S  +PF  FFA+P
Sbjct  164   LLQTLEARR--------------------------TIKDHIDGGAGES-PSPFAGFFAFP  196

Query  988   QYTTSCSSSMIPNKCTSKTTA----------------ATADIEVTLIETHANVRILSSTR  1119
             QY+T+ S         S+                   A ADIE +++E HA+V++  + R
Sbjct  197   QYSTATSGHGGGGDAHSRIVVKPAETTTTAAGGGAGAAIADIEASMVEGHASVKV-QARR  255

Query  1120  KTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             + RQL K+VA    + ++ LHLNVTT   + +YS S KVE GC+L S +EIA AVH IL
Sbjct  256   RPRQLLKLVAGLHQLGLTTLHLNVTTVAAMAMYSFSLKVEDGCKLGSVEEIATAVHEIL  314



>ref|XP_007208193.1| hypothetical protein PRUPE_ppa020862mg [Prunus persica]
 gb|EMJ09392.1| hypothetical protein PRUPE_ppa020862mg [Prunus persica]
Length=323

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 145/236 (61%), Gaps = 40/236 (17%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKE+ ETQR+THIAVERNRRKQMN++LA LR++MP  Y QRGDQASI+GGAI FVKEL
Sbjct  111   IKNKEDMETQRMTHIAVERNRRKQMNDYLAALRAMMPACYAQRGDQASIIGGAINFVKEL  170

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             E LLQSLE  +    R +QQ                             +  + F  FF 
Sbjct  171   EQLLQSLEGHR----RTEQQHL---------------------------NLASIFSSFFT  199

Query  982   YPQYTTSC--------SSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLS  1137
             +PQY+T          +SS+  N+  ++  +A AD+EVT++E+HANV++L   ++ +QL 
Sbjct  200   FPQYSTCLNSHGHGVYNSSVHSNELMAEKQSAIADVEVTMVESHANVKVLMK-KQPKQLL  258

Query  1138  KMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             KMV    ++ + +LH+NVTT D ++LY+ S KVE   QL+S +EIA  V+ ++  I
Sbjct  259   KMVLGLHSLGLMILHVNVTTADNMILYTFSVKVEDNSQLTSMNEIAADVYEMVGRI  314



>ref|XP_008678968.1| PREDICTED: transcription factor bHLH94-like isoform X2 [Zea mays]
 gb|AFW63448.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04751.1| bHLH transcription factor, partial [Zea mays]
Length=332

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 158/246 (64%), Gaps = 19/246 (8%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
             CK++EEAETQR+THIAVERNRR+QMNE+LA LRS MPE+YVQRGDQASIVGGAI FV+EL
Sbjct  72    CKSREEAETQRMTHIAVERNRRRQMNEYLAALRSTMPEAYVQRGDQASIVGGAIVFVREL  131

Query  802   EHLLQSLEAEKLRL-------------QRQQQQSaagddgataatktddgavasvsggvK  942
             E  LQ LEA+K +L                   S      + AA+ ++  + +SV+    
Sbjct  132   EQQLQCLEAQKRKLLHVPAAAKPDATPAHASSSSTKIRVDSAAASTSNCSSSSSVTEDAA  191

Query  943   GRSFTNPFWQFFAYPQYTTSCSSSMIPNKCTSKTTA-----ATADIEVTLIETHANVRIL  1107
             G +   PF +FF YPQY    S+        ++          AD+EV L+E H ++R++
Sbjct  192   GHARPAPFARFFTYPQYLWCHSARGAAAAAAAEEEEDGRRLGVADVEVALVEAHGSIRVM  251

Query  1108  SSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVH  1287
             ++ R+  QL  +V A Q + ++VLHL+VTT D LVLYSIS KVE GC L++AD++A AVH
Sbjct  252   TA-RRPGQLVCLVTALQALRLAVLHLSVTTLDALVLYSISVKVEEGCGLATADDVAAAVH  310

Query  1288  HILRVI  1305
             H+L ++
Sbjct  311   HVLCIV  316



>ref|NP_001281057.1| transcription factor bHLH96-like [Malus domestica]
 gb|ADL36600.1| BHLH domain class transcription factor [Malus domestica]
Length=320

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 141/234 (60%), Gaps = 50/234 (21%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L+VLRS+MPESYVQRGDQASI+GGAI FVKELE
Sbjct  115   KNEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPESYVQRGDQASIIGGAINFVKELE  174

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               +Q L  +K                                      +   PF +FF +
Sbjct  175   QEVQFLGVQK-------------------------------------PNNCAPFSEFFTF  197

Query  985   PQYTTSCSSSM---------IP-NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQL  1134
             PQY+T  +S           +P  +C S   A  ADIEVT++E+HA++++  S R  +QL
Sbjct  198   PQYSTRSTSDHESTVAAMAELPLLECRSSNIA--ADIEVTMVESHASLKV-RSKRLPKQL  254

Query  1135  SKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              K+V+    M ++VLHLNV T D +VLYS+S KVE  C L+S DEIA AVH +L
Sbjct  255   LKIVSGLHDMHLTVLHLNVVTADDIVLYSLSLKVEDECMLTSVDEIATAVHEML  308



>ref|XP_003519184.1| PREDICTED: transcription factor bHLH96-like [Glycine max]
 gb|KHN26108.1| Transcription factor bHLH96 [Glycine soja]
Length=346

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 145/240 (60%), Gaps = 44/240 (18%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SYVQRGDQASI+GG I FVKELE 
Sbjct  130   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPSYVQRGDQASIIGGTINFVKELEQ  189

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQ ++ +K R +                                G S ++PF +FF +P
Sbjct  190   LLQCMKGQKKRTKE-----------------------------GSGFSDSSPFSEFFMFP  220

Query  988   QYTTSCSSSM-------IPNKCTSK-------TTAATADIEVTLIETHANVRILSSTRKT  1125
             QY+T  + S         P  C +        ++ A ADIEVTL++ HAN++IL   R  
Sbjct  221   QYSTRATQSSSSSSSKGYPGTCEANNNMARNPSSWAVADIEVTLVDGHANMKILCKKRPG  280

Query  1126  RQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
               L KMV    ++ +S+LHLNVTT D +VL S+S KVE GCQL++ DEIA AVH + R +
Sbjct  281   -MLLKMVVGLLSLGLSILHLNVTTVDDMVLTSVSVKVEEGCQLNTVDEIAAAVHQLSRTV  339



>ref|XP_009103235.1| PREDICTED: transcription factor bHLH94-like [Brassica rapa]
Length=303

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 145/224 (65%), Gaps = 33/224 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VK+LE
Sbjct  106   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPLSYAQRGDQASIVGGAINYVKKLE  165

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +      +  ++                           S    F   F +
Sbjct  166   HILQSMEPRRTTTTSHEADTSTS-------------------------SLVCTFSDVFTF  200

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+ +  S         +++++ A+IEVT+ E HANV+I++  +K RQL K+VA+ Q++
Sbjct  201   PQYSKNSLS-------EVESSSSPAEIEVTVAEGHANVKIMAK-KKPRQLLKLVASIQSL  252

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
              +S+LHLNVTT D L+LYSIS KVE G QL++ ++IA A++ I+
Sbjct  253   RLSLLHLNVTTLDNLILYSISVKVEEGSQLNTVEDIATALNQII  296



>ref|XP_004139191.1| PREDICTED: transcription factor bHLH96-like [Cucumis sativus]
 ref|XP_004169432.1| PREDICTED: transcription factor bHLH96-like [Cucumis sativus]
 gb|KGN60884.1| Helix-loop-helix-like protein [Cucumis sativus]
Length=317

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 146/224 (65%), Gaps = 21/224 (9%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE  +
Sbjct  108   EEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEQQV  167

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L   + + +         +  + + +K                    PF +FF++PQ+
Sbjct  168   QVLSTVETKGKINNSAEGCCNSNSNSNSKI-------------------PFTEFFSFPQF  208

Query  994   TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMS  1173
                   S++ ++  ++ ++  ADIEVT++E HAN++I  S R+ +Q+ K+VA   ++ +S
Sbjct  209   KAMEGCSLV-SENETQCSSTVADIEVTMVENHANLKI-RSKRRPKQILKIVAGLHSLSLS  266

Query  1174  VLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VLHLN++T + +VLY +S KVE  C+LSS DEIA A+H +L  I
Sbjct  267   VLHLNISTINQIVLYCLSVKVEDDCKLSSVDEIASALHQLLSRI  310



>ref|XP_010521172.1| PREDICTED: transcription factor bHLH96-like [Tarenaya hassleriana]
Length=322

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 148/226 (65%), Gaps = 36/226 (16%)
 Frame = +1

Query  628   NKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEH  807
             NKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP +Y QRGDQASI+GGAI +VKELEH
Sbjct  126   NKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPPTYAQRGDQASIIGGAINYVKELEH  185

Query  808   LLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYP  987
             LLQS+E +K     + Q S   DD  ++ +                            +P
Sbjct  186   LLQSMEPKK-----KTQNSGDDDDDTSSFSDFF------------------------TFP  216

Query  988   QYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMC  1167
             QYT      + P++ ++     TA+IEVT+ E++AN++IL+  R  RQL K+V+A Q++ 
Sbjct  217   QYT------LRPSESSAAAAEGTAEIEVTMAESNANLKILTKKR-PRQLLKLVSAIQSLR  269

Query  1168  MSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             +++LHLNVTT D  VLYSIS KVE G QL++ D+IA AV+ IL+ +
Sbjct  270   LTLLHLNVTTLDHSVLYSISVKVEEGSQLNTVDDIAAAVNQILKRV  315



>ref|XP_008454918.1| PREDICTED: transcription factor bHLH94-like [Cucumis melo]
Length=317

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 146/224 (65%), Gaps = 21/224 (9%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE E QR+THIAVERNRRKQMNE+L+VLRSLMPESYVQRGDQASI+GGAI FVKELE  +
Sbjct  108   EEIENQRMTHIAVERNRRKQMNEYLSVLRSLMPESYVQRGDQASIIGGAINFVKELEQQV  167

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             Q L   + + +         +  + + +K                    PF +FF++PQ+
Sbjct  168   QVLSTIETKGKINNSAEGCCNSNSNSNSKI-------------------PFAEFFSFPQF  208

Query  994   TTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTMCMS  1173
                   S++ ++  ++ ++  ADIEVT++E HAN++I  S R+ +Q+ K+VA   ++ +S
Sbjct  209   KAMEGCSLV-SENETQCSSTVADIEVTMVENHANLKI-RSKRRPKQILKIVAGLHSLSLS  266

Query  1174  VLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             VLHLN++T + +VLY +S KVE  C+LSS DEIA A+H +L  I
Sbjct  267   VLHLNISTINQIVLYCLSVKVEDDCKLSSVDEIASALHQLLSRI  310



>ref|XP_009127909.1| PREDICTED: transcription factor bHLH96-like [Brassica rapa]
Length=326

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 146/228 (64%), Gaps = 23/228 (10%)
 Frame = +1

Query  622   CKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKEL  801
              KNKEE E QR+THIAVERNRRKQMN++LAVLRSLMP SY QRGDQASIVGGAI ++KEL
Sbjct  117   SKNKEEIENQRMTHIAVERNRRKQMNDYLAVLRSLMPPSYAQRGDQASIVGGAINYLKEL  176

Query  802   EHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFA  981
             EH LQS+E                    T    T+  + A+        S    F +FFA
Sbjct  177   EHHLQSIEP--------------PLKSTTVPVDTESASPAADQINTIAASSLGQFSEFFA  222

Query  982   YPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQT  1161
             +PQY++  SSS +            A+IEVT++E+HA+V+IL+  R  +QL K+ A+ Q 
Sbjct  223   FPQYSSRPSSSSV--------AEGVAEIEVTMVESHASVKILAKKR-PKQLLKLAASIQN  273

Query  1162  MCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             + ++VLHLNVTT D  VLYSIS KVE G QL++ ++IA  ++ ILR I
Sbjct  274   LKLTVLHLNVTTCDDSVLYSISLKVEEGSQLNTVEDIAAGMNQILRRI  321



>ref|XP_009110135.1| PREDICTED: transcription factor bHLH94-like [Brassica rapa]
Length=302

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 144/227 (63%), Gaps = 33/227 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VK+LE
Sbjct  105   KNVEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKKLE  164

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +                             +        S  +PF  FF++
Sbjct  165   HILQSMEPNR-------------------------TTTITHEANTSTSSLVDPFSDFFSF  199

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  S         ++ +++ A+IEVT+ E HAN++I++  +  +   K+VA+ Q++
Sbjct  200   PQYSTKSS-------SITEGSSSPAEIEVTVAEGHANIKIMAKKKPKQL-LKLVASLQSL  251

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE G QL++ D+IA A++ I+R I
Sbjct  252   RLTLLHLNVTTLDNSILYSISVKVEEGSQLTTVDDIATALNQIIRRI  298



>emb|CDY41479.1| BnaA08g20810D [Brassica napus]
Length=286

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 143/227 (63%), Gaps = 33/227 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VK+LE
Sbjct  89    KNVEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKKLE  148

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +                             +        S  +PF  FF++
Sbjct  149   HILQSMEPNR-------------------------TTTITHEANTSTSSLVDPFSDFFSF  183

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T            ++ +++ A+IEVT+ E HAN++I++  +  +   K+VA+ Q++
Sbjct  184   PQYSTKS-------SSITEGSSSPAEIEVTVAEGHANIKIMAKKKPKQL-LKLVASLQSL  235

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE G QL++ D+IA A++ I+R I
Sbjct  236   RLTLLHLNVTTLDNSILYSISVKVEEGSQLTTVDDIATALNQIIRRI  282



>ref|NP_568666.1| transcription factor bHLH71 [Arabidopsis thaliana]
 sp|Q56XR0.1|BH071_ARATH RecName: Full=Transcription factor bHLH71; AltName: Full=Basic 
helix-loop-helix protein 71; Short=AtbHLH71; Short=bHLH 71; 
AltName: Full=Transcription factor EN 17; AltName: Full=bHLH 
transcription factor bHLH071 [Arabidopsis thaliana]
 dbj|BAD95200.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|ABF74724.1| At5g46690 [Arabidopsis thaliana]
 dbj|BAH30618.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95414.1| transcription factor bHLH71 [Arabidopsis thaliana]
Length=327

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 154/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  76    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  135

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+K    +  Q   +     +   + +    +S+S             QFF
Sbjct  136   LEHKLLSLEAQKHHNAKLNQSVTSSTSQDSNGEQENPHQPSSLS-----------LSQFF  184

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILS----------STRKTR  1128
              +  Y  S  +    N  TS       D+EVTLIETHAN+RILS          +T K  
Sbjct  185   LH-SYDPSQENR---NGSTSSVKTPMEDLEVTLIETHANIRILSRRRGFRWSTLATTKPP  240

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLSK+VA+ Q++ +S+LHL+VTT D   +YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  241   QLSKLVASLQSLSLSILHLSVTTLDNYAIYSISAKVEESCQLSSVDDIAGAVHHMLSII  299



>ref|XP_010477508.1| PREDICTED: transcription factor bHLH94 isoform X1 [Camelina sativa]
Length=307

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 148/227 (65%), Gaps = 28/227 (12%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KNKEE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKELE
Sbjct  105   KNKEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKELE  164

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+  ++                 +                    S  +PF  FF++
Sbjct  165   HILQSMGPKRTTTTSTTHDVEGAKTSTS--------------------SLADPFSDFFSF  204

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQ++T  S          ++++++A+IEVT+ E+HAN++IL+  +K RQL K+VA+ Q++
Sbjct  205   PQFSTKSSE-------VPESSSSSAEIEVTVAESHANIKILAK-KKPRQLIKLVASLQSL  256

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT    +LYSIS KVE G QL++ D+IA A++  +R I
Sbjct  257   RLTLLHLNVTTHQNSILYSISVKVEEGSQLNTVDDIATALNQTIRRI  303



>ref|XP_009417602.1| PREDICTED: transcription factor bHLH94-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 137/229 (60%), Gaps = 42/229 (18%)
 Frame = +1

Query  634   EEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELEHLL  813
             EE ETQR+THIAVERNRR+ MNE+LAVLRSLMP SYVQ+GDQASIVGGAI FVKELE  +
Sbjct  97    EEVETQRMTHIAVERNRRRLMNEYLAVLRSLMPASYVQKGDQASIVGGAINFVKELEQSV  156

Query  814   QSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAYPQY  993
             QSLEA+K                                  ++ RS   PF  FF +PQY
Sbjct  157   QSLEAQK---------------------------------RIRERSKAAPFADFFTFPQY  183

Query  994   TTSCSSSMIPN--------KCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVA  1149
             ++S S     +        +   +  +A ADIEVT++E+HANV+I S  R  RQL  +V 
Sbjct  184   SSSSSHCTSTSSTDTTATVEAARRNPSAMADIEVTIVESHANVKIFSRWRP-RQLLMLVL  242

Query  1150  AFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
               Q + ++ LHLNVTT D +VLY  S KVE  CQ +S D IA AVH I+
Sbjct  243   GLQNLRLTTLHLNVTTVDEMVLYCFSLKVEDDCQCASVDVIATAVHQII  291



>ref|XP_009803283.1| PREDICTED: transcription factor bHLH94-like [Nicotiana sylvestris]
Length=333

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 151/234 (65%), Gaps = 35/234 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E+QR+THIAVERNRRKQMNE+L+VLR+LMP+SYVQRGDQASIV GAI +VKELE
Sbjct  123   KNQEEIESQRMTHIAVERNRRKQMNEYLSVLRTLMPDSYVQRGDQASIVSGAINYVKELE  182

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               LQ L  +K  L  ++ Q   G+                          T+PF +FF+ 
Sbjct  183   QQLQFLCGQK-HLNEKKLQDINGE--------------------------TSPFSEFFSI  215

Query  985   PQYTTSCSSSMIPNKCT-------SKTTAATADIEVTLIETHANVRILSSTRKTRQLSKM  1143
             PQY+T+ +++   N+ +       ++   ATADIEVT++E HAN++I  S R+ R L ++
Sbjct  216   PQYSTTMTAATSENRASGNEYYTRNQQLPATADIEVTMVENHANLKI-RSQRRPRLLPRI  274

Query  1144  VAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             ++  +++ +SVLHLNV+  D  VL S+S KVE  C+LSS ++IA  V+ IL  I
Sbjct  275   ISGLESLRLSVLHLNVSKVDQFVLCSLSLKVEEDCKLSSVEDIAAVVNQILGRI  328



>ref|XP_006649528.1| PREDICTED: transcription factor bHLH96-like [Oryza brachyantha]
Length=328

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 143/247 (58%), Gaps = 46/247 (19%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             + KNKEE E QR+THIAVERNRR+QMNE+LAVLRSLMP SY QRGDQASIVGGAI +VKE
Sbjct  100   VIKNKEEIECQRMTHIAVERNRRRQMNEYLAVLRSLMPPSYAQRGDQASIVGGAINYVKE  159

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LE LLQSLE +K    R     A                              +PF  FF
Sbjct  160   LEQLLQSLEVQKSLKNRTAGMDAGE---------------------------DSPFSGFF  192

Query  979   AYPQYTTSCSSS---------------MIPNKCTSKT---TAATADIEVTLIETHANVRI  1104
             ++PQY TS  S                ++ +   S      AA ADIEVT++E HA++++
Sbjct  193   SFPQYCTSSRSGCSSASAGSSGNASSVVMDDTAGSAERVRPAAIADIEVTMVEGHASLKV  252

Query  1105  LSSTRKTRQLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAV  1284
             L+  R+ +QL K+V   Q + +  LHLNVTT D +VLYS S KVE   +L S ++IA AV
Sbjct  253   LAR-RRPKQLLKLVVGLQQLRIPPLHLNVTTVDAMVLYSFSLKVEDDSKLGSVEDIATAV  311

Query  1285  HHILRVI  1305
             H IL  I
Sbjct  312   HEILGSI  318



>gb|AAM65023.1| bHLH DNA-binding protein-like protein [Arabidopsis thaliana]
Length=327

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 154/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  76    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  135

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+K    +  Q   +     T   + +    +S+S             QFF
Sbjct  136   LEHKLLSLEAQKHHNAKLNQSVTSSTSQDTNGEQENPHQPSSLS-----------LSQFF  184

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILS----------STRKTR  1128
              +  Y  S  +    N  TS       D+EVTLIETHAN+RILS          +T K  
Sbjct  185   LH-SYDPSQENR---NGSTSSVKTPMEDLEVTLIETHANIRILSRRRGFRWSTLATTKPP  240

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLSK+VA+ Q++ +S+LHL+VTT D   +YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  241   QLSKLVASLQSLSLSILHLSVTTLDNYAIYSISAKVEESCQLSSVDDIAGAVHHMLSII  299



>ref|XP_002865169.1| BHLH071 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41428.1| BHLH071 [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 154/239 (64%), Gaps = 25/239 (10%)
 Frame = +1

Query  619   ICKNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKE  798
             +CKN+EEAE QR+THIAVERNRR+QMN+HL+VLRSLMP+ +  +GDQASIVGGAI+F+KE
Sbjct  76    VCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRSLMPQPFAHKGDQASIVGGAIDFIKE  135

Query  799   LEHLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFF  978
             LEH L SLEA+KL   +  Q   +     +   + +    +S+S             QFF
Sbjct  136   LEHKLLSLEAQKLHNAKSNQSVTSSTSQDSNGEQENPHQPSSLS-----------LSQFF  184

Query  979   AYPQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTR----------  1128
              +  Y     +    N  TS       D+EVTLIETHAN+RILS  R  R          
Sbjct  185   LH-SYDPGQENR---NGSTSSVKTPMEDLEVTLIETHANIRILSRRRGFRWSTMATARPP  240

Query  1129  QLSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
             QLSK+V+A Q++ +S+LHL+VTT D  V+YSISAKVE  CQLSS D+IA AVHH+L +I
Sbjct  241   QLSKLVSALQSLSLSILHLSVTTLDTYVIYSISAKVEESCQLSSVDDIAGAVHHMLSII  299



>emb|CDX91680.1| BnaC08g05990D [Brassica napus]
Length=286

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 146/227 (64%), Gaps = 33/227 (15%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN EE E QR+THIAVERNRRKQMNE+LAVLRSLMP SY QRGDQASIVGGAI +VK+LE
Sbjct  89    KNVEEIENQRMTHIAVERNRRKQMNEYLAVLRSLMPSSYAQRGDQASIVGGAINYVKKLE  148

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
             H+LQS+E  +      +  ++                           S  +PF  FF++
Sbjct  149   HILQSMEPNRTTTIPHEANTSTS-------------------------SLVDPFSDFFSF  183

Query  985   PQYTTSCSSSMIPNKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQLSKMVAAFQTM  1164
             PQY+T  S         ++ +++ A+IEVT+ E HAN++I++  +  +   K+VA+ Q++
Sbjct  184   PQYSTKSS-------SITEGSSSPAEIEVTVAEGHANIKIMAKKKPKQL-LKLVASIQSL  235

Query  1165  CMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHILRVI  1305
              +++LHLNVTT D  +LYSIS KVE G QL++ D+IA A++ I+R I
Sbjct  236   RLALLHLNVTTLDNSILYSISVKVEEGSQLTTVDDIATALNKIMRRI  282



>ref|XP_009373972.1| PREDICTED: transcription factor bHLH94-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373973.1| PREDICTED: transcription factor bHLH94-like isoform X2 [Pyrus 
x bretschneideri]
Length=323

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 143/235 (61%), Gaps = 51/235 (22%)
 Frame = +1

Query  625   KNKEEAETQRITHIAVERNRRKQMNEHLAVLRSLMPESYVQRGDQASIVGGAIEFVKELE  804
             KN+EE E QR+THIAVERNRRKQMNE+L+VLRS+MP+SYVQRGDQASI+GGAI +VKELE
Sbjct  117   KNEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPDSYVQRGDQASIIGGAINYVKELE  176

Query  805   HLLQSLEAEKLRLQRQQQQSaagddgataatktddgavasvsggvKGRSFTNPFWQFFAY  984
               +Q L  +K                                     R+   PF +FF +
Sbjct  177   QEVQFLGVQK----------------------------------ANDRA---PFSEFFTF  199

Query  985   PQYTTSCSSS----------MIP-NKCTSKTTAATADIEVTLIETHANVRILSSTRKTRQ  1131
             PQY++  S+S           +P  +C S   A  ADIEVT++E+HA++++  S +  +Q
Sbjct  200   PQYSSRSSTSDHEPAVAAMAELPLLECRSSKIA--ADIEVTMVESHASLKV-RSKKVPKQ  256

Query  1132  LSKMVAAFQTMCMSVLHLNVTTFDLLVLYSISAKVEGGCQLSSADEIAEAVHHIL  1296
             L K+V+    M +++LHLNV T D +VLYS+S KVE  C L+S DEIA AVH +L
Sbjct  257   LLKIVSGLHDMHLTILHLNVVTVDDIVLYSLSLKVEDECMLTSVDEIATAVHEML  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3721193409042